BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18822_g1_i1 len=1679 path=[1:0-192 194:193-1397 1399:1398-1678]

Length=1679
                                                                      Score     E

ref|XP_011095410.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    734   0.0      
ref|XP_002279440.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    733   0.0      Vitis vinifera
ref|XP_010644464.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    733   0.0      
emb|CBI26657.3|  unnamed protein product                                729   0.0      
ref|XP_010644467.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    727   0.0      
ref|XP_011095409.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    726   0.0      
ref|XP_010644466.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    726   0.0      
ref|XP_009608753.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    725   0.0      
ref|XP_010327311.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    720   0.0      
ref|XP_010644463.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    726   0.0      
emb|CDP05728.1|  unnamed protein product                                723   0.0      
ref|XP_006338892.1|  PREDICTED: DNA mismatch repair protein MSH5-...    724   0.0      
ref|XP_010327310.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    718   0.0      
ref|XP_004248554.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    720   0.0      
ref|XP_010327308.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    719   0.0      
ref|XP_010327307.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    720   0.0      
ref|XP_008226951.1|  PREDICTED: DNA mismatch repair protein MSH5        707   0.0      
ref|XP_007214518.1|  hypothetical protein PRUPE_ppa015717mg             705   0.0      
ref|XP_009608758.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    697   0.0      
ref|XP_009608756.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    696   0.0      
ref|XP_009608757.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    694   0.0      
ref|XP_004295833.1|  PREDICTED: DNA mismatch repair protein MSH5-...    698   0.0      
ref|XP_010244495.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    692   0.0      
ref|XP_007020780.1|  MUTS                                               695   0.0      
ref|XP_006452401.1|  hypothetical protein CICLE_v10010304mg             694   0.0      
ref|XP_009608750.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    695   0.0      
gb|KDO62059.1|  hypothetical protein CISIN_1g043119mg                   693   0.0      
ref|XP_006475043.1|  PREDICTED: DNA mismatch repair protein MSH5-...    694   0.0      
ref|XP_009608749.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    694   0.0      
ref|XP_010244494.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    692   0.0      
ref|XP_010244492.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    692   0.0      
ref|XP_008449117.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    688   0.0      
ref|XP_006595730.1|  PREDICTED: DNA mismatch repair protein MSH5-...    687   0.0      
ref|XP_006595728.1|  PREDICTED: DNA mismatch repair protein MSH5-...    688   0.0      
ref|XP_011012093.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    687   0.0      
ref|XP_004149586.1|  PREDICTED: DNA mismatch repair protein MSH5-...    685   0.0      
ref|XP_007142299.1|  hypothetical protein PHAVU_008G268900g             684   0.0      
ref|XP_007142300.1|  hypothetical protein PHAVU_008G268900g             684   0.0      
ref|XP_003617575.1|  DNA mismatch repair protein mutS                   670   0.0      
ref|XP_011012094.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    681   0.0      
ref|XP_011012101.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    673   0.0      
ref|XP_011012097.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    673   0.0      
ref|XP_004491410.1|  PREDICTED: DNA mismatch repair protein MSH5-...    673   0.0      
ref|XP_008449115.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    674   0.0      
ref|XP_011012092.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    672   0.0      
gb|AET00534.2|  DNA mismatch repair protein MutS                        668   0.0      
ref|XP_010644465.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    667   0.0      
ref|XP_010060318.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    664   0.0      
gb|EPS67262.1|  hypothetical protein M569_07513                         663   0.0      
gb|KGN56072.1|  hypothetical protein Csa_3G064210                       663   0.0      
ref|XP_006595729.1|  PREDICTED: DNA mismatch repair protein MSH5-...    662   0.0      
ref|XP_010915350.1|  PREDICTED: DNA mismatch repair protein MSH5        657   0.0      
ref|XP_002883246.1|  hypothetical protein ARALYDRAFT_479572             654   0.0      
gb|ABO69626.1|  MutS-like protein 5                                     652   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009608751.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    653   0.0      
ref|NP_188683.3|  DNA mismatch repair protein MSH5                      652   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466240.1|  PREDICTED: DNA mismatch repair protein MSH5        651   0.0      
ref|XP_009145622.1|  PREDICTED: DNA mismatch repair protein MSH5        650   0.0      
ref|XP_010488024.1|  PREDICTED: DNA mismatch repair protein MSH5-...    645   0.0      
ref|XP_010488023.1|  PREDICTED: DNA mismatch repair protein MSH5-...    645   0.0      
ref|XP_010545521.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    647   0.0      
ref|XP_010488022.1|  PREDICTED: DNA mismatch repair protein MSH5-...    647   0.0      
gb|KCW66980.1|  hypothetical protein EUGRSUZ_F00744                     645   0.0      
ref|XP_010545520.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    643   0.0      
ref|XP_006299772.1|  hypothetical protein CARUB_v10015967mg             642   0.0      
ref|XP_010666205.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    641   0.0      
ref|XP_010545526.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    637   0.0      
ref|XP_010327309.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    640   0.0      
ref|XP_010545518.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    641   0.0      
ref|XP_006406378.1|  hypothetical protein EUTSA_v10022259mg             640   0.0      
ref|XP_010545523.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    637   0.0      
ref|XP_009608752.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    638   0.0      
emb|CDY65220.1|  BnaCnng46130D                                          636   0.0      
ref|XP_010545522.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    635   0.0      
ref|XP_010545519.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    637   0.0      
ref|XP_010545517.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    637   0.0      
ref|XP_010060319.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    631   0.0      
ref|XP_011012095.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    626   0.0      
ref|XP_011012096.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    626   0.0      
ref|XP_009406511.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    620   0.0      
ref|XP_006595731.1|  PREDICTED: DNA mismatch repair protein MSH5-...    617   0.0      
ref|XP_009608754.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    612   0.0      
ref|XP_006654595.1|  PREDICTED: DNA mismatch repair protein MSH5-...    611   0.0      
emb|CDY19637.1|  BnaA05g20450D                                          608   0.0      
gb|KDP39150.1|  hypothetical protein JCGZ_00907                         602   0.0      
ref|NP_001055948.1|  Os05g0498300                                       601   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFP73611.1|  mutS-like protein 5                                     600   0.0      
ref|XP_004961619.1|  PREDICTED: DNA mismatch repair protein MSH5-...    600   0.0      
ref|XP_010666206.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    593   0.0      
gb|EEE64238.1|  hypothetical protein OsJ_19071                          600   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571344.1|  PREDICTED: DNA mismatch repair protein MSH5        590   0.0      
gb|KHN38268.1|  MutS protein like 5                                     583   0.0      
ref|XP_008777633.1|  PREDICTED: DNA mismatch repair protein MSH5        578   0.0      
ref|XP_002317341.2|  hypothetical protein POPTR_0011s09190g             572   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009608760.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    571   0.0      
ref|XP_010468325.1|  PREDICTED: DNA mismatch repair protein MSH5-...    556   0.0      
ref|XP_009406512.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    546   0.0      
ref|XP_010545524.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    543   0.0      
ref|XP_010545525.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    537   6e-180   
ref|XP_009608755.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    526   4e-175   
ref|XP_010666207.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    523   1e-174   
ref|XP_006855938.1|  hypothetical protein AMTR_s00037p00213740          525   3e-174   
ref|XP_010327312.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    513   6e-171   
ref|XP_009803940.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    509   1e-169   
ref|XP_009803942.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    508   3e-169   
ref|XP_009803939.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    508   7e-169   
ref|XP_009803938.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    508   9e-169   
ref|XP_002440016.1|  hypothetical protein SORBIDRAFT_09g024520          498   2e-165   Sorghum bicolor [broomcorn]
ref|XP_002529913.1|  conserved hypothetical protein                     485   6e-165   Ricinus communis
ref|XP_011012099.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    483   2e-159   
gb|KHN11911.1|  MutS protein like 5                                     459   3e-154   
ref|XP_010545527.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    466   6e-153   
ref|XP_009803941.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    464   5e-152   
ref|XP_010666208.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    461   8e-151   
ref|XP_010096888.1|  MutS protein-5-like protein                        433   1e-138   
ref|XP_009803943.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    426   9e-138   
ref|XP_008359281.1|  PREDICTED: DNA mismatch repair protein MSH5-...    410   1e-135   
ref|XP_010060320.1|  PREDICTED: DNA mismatch repair protein MSH5 ...    398   9e-127   
gb|EMS56680.1|  MutS protein-like protein 5                             363   3e-109   
dbj|BAD95388.1|  DNA mismatch repair protein                            286   3e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008359282.1|  PREDICTED: DNA mismatch repair protein MSH5-...    281   3e-83    
dbj|BAB02831.1|  unnamed protein product                                270   2e-77    Arabidopsis thaliana [mouse-ear cress]
gb|EEC79464.1|  hypothetical protein OsI_20481                          240   2e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_008656419.1|  PREDICTED: DNA mismatch repair protein MSH5-...    221   7e-65    
ref|XP_009767808.1|  PREDICTED: DNA mismatch repair protein MSH5-...    202   2e-57    
gb|EMT12766.1|  hypothetical protein F775_05603                         177   2e-48    
ref|XP_005644118.1|  hypothetical protein COCSUDRAFT_58323              181   2e-45    
ref|XP_001640822.1|  predicted protein                                  178   4e-44    Nematostella vectensis
gb|KFM62949.1|  MutS protein-like protein                               176   1e-43    
gb|AFW82411.1|  hypothetical protein ZEAMMB73_943067                    160   3e-43    
ref|XP_010705670.1|  PREDICTED: mutS protein homolog 5                  168   4e-41    
ref|XP_003388269.1|  PREDICTED: mutS protein homolog 5                  166   2e-40    
ref|XP_002981803.1|  hypothetical protein SELMODRAFT_115165             164   2e-40    
ref|XP_005154794.1|  PREDICTED: mutS protein homolog 5-like             165   4e-40    
gb|KFR07341.1|  MutS protein 5                                          164   7e-40    
ref|XP_009930214.1|  PREDICTED: mutS protein homolog 5                  164   7e-40    
ref|XP_005091912.1|  PREDICTED: mutS protein homolog 5-like             166   8e-40    
ref|XP_002967541.1|  hypothetical protein SELMODRAFT_88713              161   2e-39    
gb|KFP20574.1|  MutS protein 5                                          162   3e-39    
ref|XP_009642661.1|  PREDICTED: mutS protein homolog 5                  162   3e-39    
gb|KFO96199.1|  MutS protein 5                                          162   4e-39    
ref|XP_008497466.1|  PREDICTED: mutS protein homolog 5                  162   5e-39    
gb|KGL89306.1|  MutS protein 5                                          160   1e-38    
gb|KFO93873.1|  MutS protein 5                                          161   1e-38    
ref|XP_009878464.1|  PREDICTED: mutS protein homolog 5                  161   1e-38    
ref|XP_010141062.1|  PREDICTED: mutS protein homolog 5                  161   1e-38    
gb|EOB08672.1|  MutS protein-like protein 5                             160   1e-38    
ref|XP_010018240.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    160   3e-38    
ref|XP_004077924.1|  PREDICTED: mutS protein homolog 5-like             159   4e-38    
ref|XP_007060849.1|  PREDICTED: mutS protein homolog 5-like             159   4e-38    
ref|XP_006030851.1|  PREDICTED: mutS protein homolog 5-like             159   5e-38    
ref|XP_004286634.1|  PREDICTED: mutS protein homolog 5 isoform 1        159   6e-38    
ref|XP_004286635.1|  PREDICTED: mutS protein homolog 5 isoform 2        159   6e-38    
ref|XP_005509440.1|  PREDICTED: mutS protein homolog 5-like             159   6e-38    
ref|XP_004311279.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    159   6e-38    
gb|EMC83310.1|  MutS like protein 5                                     158   7e-38    
ref|XP_006118687.1|  PREDICTED: mutS protein homolog 5-like             158   1e-37    
ref|XP_009561174.1|  PREDICTED: mutS protein homolog 5                  158   1e-37    
gb|KFO77640.1|  MutS protein 5                                          158   1e-37    
ref|XP_006259839.1|  PREDICTED: mutS protein homolog 5-like             157   2e-37    
ref|XP_010077228.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    157   2e-37    
ref|XP_005280328.1|  PREDICTED: mutS protein homolog 5 isoform X1       157   2e-37    
ref|XP_005280329.1|  PREDICTED: mutS protein homolog 5 isoform X2       157   2e-37    
ref|XP_009317320.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    157   2e-37    
ref|XP_009997426.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    157   2e-37    
ref|XP_007459613.1|  PREDICTED: mutS protein homolog 5 isoform X2       157   2e-37    
ref|XP_007459612.1|  PREDICTED: mutS protein homolog 5 isoform X1       157   3e-37    
gb|KFV88451.1|  MutS protein 5                                          157   3e-37    
gb|KFP67796.1|  MutS protein 5                                          157   3e-37    
ref|XP_009508200.1|  PREDICTED: mutS protein homolog 5                  157   3e-37    
ref|XP_009687119.1|  PREDICTED: mutS protein homolog 5                  157   3e-37    
gb|KFW93842.1|  MutS protein 5                                          157   3e-37    
ref|XP_010226117.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    157   3e-37    
gb|KFQ85939.1|  MutS protein 5                                          157   3e-37    
ref|XP_009704081.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    157   3e-37    
ref|XP_009093466.1|  PREDICTED: mutS protein homolog 5                  157   3e-37    
gb|KFM09048.1|  MutS protein 5                                          156   3e-37    
gb|KFV20075.1|  MutS protein 5                                          156   3e-37    
ref|XP_010399946.1|  PREDICTED: mutS protein homolog 5                  156   4e-37    
ref|XP_009279797.1|  PREDICTED: mutS protein homolog 5                  156   4e-37    
ref|XP_009988118.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    156   4e-37    
ref|XP_007194024.1|  PREDICTED: mutS protein homolog 5 isoform X5       155   4e-37    
gb|KFV60516.1|  MutS protein 5                                          156   4e-37    
ref|XP_008636052.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    156   5e-37    
ref|XP_009972762.1|  PREDICTED: mutS protein homolog 5                  156   5e-37    
ref|XP_008819731.1|  PREDICTED: mutS protein homolog 5                  156   5e-37    
ref|XP_010573003.1|  PREDICTED: mutS protein homolog 5                  156   6e-37    
gb|KFQ55251.1|  MutS protein 5                                          155   6e-37    
ref|XP_009488976.1|  PREDICTED: mutS protein homolog 5                  155   7e-37    
gb|KFZ46653.1|  MutS protein 5                                          155   7e-37    
gb|KFW63646.1|  MutS protein 5                                          155   7e-37    
ref|XP_007194023.1|  PREDICTED: mutS protein homolog 5 isoform X4       155   8e-37    
ref|XP_003272166.2|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    155   9e-37    
ref|XP_007110174.1|  PREDICTED: mutS protein homolog 5                  155   9e-37    
ref|XP_010113946.1|  PREDICTED: mutS protein homolog 5                  155   1e-36    
ref|XP_007194022.1|  PREDICTED: mutS protein homolog 5 isoform X3       155   1e-36    
ref|XP_010163817.1|  PREDICTED: mutS protein homolog 5                  155   1e-36    
ref|XP_007194020.1|  PREDICTED: mutS protein homolog 5 isoform X1       155   1e-36    
gb|KFP35265.1|  MutS protein 5                                          155   1e-36    
ref|XP_009575536.1|  PREDICTED: mutS protein homolog 5                  155   1e-36    
ref|XP_007647282.1|  PREDICTED: mutS protein homolog 5 isoform X1       155   1e-36    
ref|XP_003508523.2|  PREDICTED: mutS protein homolog 5 isoform X2       155   1e-36    
gb|KFV97048.1|  MutS protein 5                                          155   1e-36    
ref|XP_005005527.1|  PREDICTED: mutS protein homolog 5 isoform X2       155   1e-36    
ref|XP_003473798.1|  PREDICTED: mutS protein homolog 5 isoform X1       155   1e-36    
ref|XP_002119672.1|  PREDICTED: mutS protein homolog 5-like             155   2e-36    Ciona intestinalis [sea vase]
ref|NP_001182287.1|  mutS protein homolog 5                             155   2e-36    
ref|XP_002190135.2|  PREDICTED: mutS protein homolog 5                  155   2e-36    Taeniopygia guttata
ref|XP_003340425.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    154   2e-36    
ref|XP_003944383.1|  PREDICTED: mutS protein homolog 5                  154   2e-36    
gb|KFQ93670.1|  MutS protein 5                                          154   2e-36    
ref|XP_009459030.1|  PREDICTED: mutS protein homolog 5                  154   2e-36    
gb|KFW80954.1|  MutS protein 5                                          154   2e-36    
ref|XP_008260820.1|  PREDICTED: mutS protein homolog 5 isoform X5       154   2e-36    
gb|KFQ75666.1|  MutS protein 5                                          154   2e-36    
ref|XP_004598826.1|  PREDICTED: mutS protein homolog 5                  154   2e-36    
ref|XP_007098839.1|  PREDICTED: mutS protein homolog 5 isoform X1       154   3e-36    
ref|XP_010286073.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    154   3e-36    
ref|XP_008922098.1|  PREDICTED: mutS protein homolog 5                  154   3e-36    
gb|ERE88822.1|  putative mutS protein                                   155   3e-36    
ref|XP_008260819.1|  PREDICTED: mutS protein homolog 5 isoform X4       154   3e-36    
ref|XP_008260818.1|  PREDICTED: mutS protein homolog 5 isoform X3       154   3e-36    
ref|XP_009863415.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    154   3e-36    
ref|XP_003985987.1|  PREDICTED: mutS protein homolog 5 isoform X1       154   3e-36    
ref|XP_008260815.1|  PREDICTED: mutS protein homolog 5 isoform X1       154   3e-36    
gb|KFP24238.1|  MutS protein 5                                          153   4e-36    
ref|XP_010158520.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    153   4e-36    
ref|XP_009072377.1|  PREDICTED: mutS protein homolog 5                  153   4e-36    
ref|XP_008260817.1|  PREDICTED: mutS protein homolog 5 isoform X2       153   4e-36    
ref|XP_006896237.1|  PREDICTED: mutS protein homolog 5                  153   4e-36    
ref|XP_009816016.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    153   4e-36    
ref|XP_005965433.1|  PREDICTED: mutS protein homolog 5                  153   5e-36    
gb|KFP70259.1|  MutS protein 5                                          153   5e-36    
ref|XP_010816610.1|  PREDICTED: mutS protein homolog 5 isoform X2       153   5e-36    
ref|XP_010193789.1|  PREDICTED: mutS protein homolog 5                  153   5e-36    
ref|XP_005418535.1|  PREDICTED: mutS protein homolog 5-like             153   5e-36    
gb|KFZ54273.1|  MutS protein 5                                          153   6e-36    
ref|XP_007949535.1|  PREDICTED: mutS protein homolog 5 isoform X1       153   6e-36    
ref|XP_007949536.1|  PREDICTED: mutS protein homolog 5 isoform X2       153   6e-36    
ref|XP_007556242.1|  PREDICTED: mutS protein homolog 5 isoform X2       152   7e-36    
ref|XP_006995336.1|  PREDICTED: mutS protein homolog 5                  152   1e-35    
ref|XP_006154349.1|  PREDICTED: mutS protein homolog 5 isoform X2       152   1e-35    
ref|XP_005043626.1|  PREDICTED: mutS protein homolog 5-like             152   1e-35    
ref|XP_003768976.1|  PREDICTED: mutS protein homolog 5                  152   1e-35    
ref|XP_006154348.1|  PREDICTED: mutS protein homolog 5 isoform X1       152   1e-35    
ref|XP_004847022.1|  PREDICTED: mutS protein homolog 5 isoform X2       152   2e-35    
ref|XP_004390814.1|  PREDICTED: mutS protein homolog 5 isoform 1        151   2e-35    
ref|XP_004847021.1|  PREDICTED: mutS protein homolog 5 isoform X1       151   2e-35    
ref|XP_004905508.1|  PREDICTED: mutS protein homolog 5 isoform X2       151   2e-35    
ref|XP_008430898.1|  PREDICTED: mutS protein homolog 5                  151   2e-35    
ref|XP_004624357.1|  PREDICTED: mutS protein homolog 5 isoform X2       151   2e-35    
ref|XP_004905507.1|  PREDICTED: mutS protein homolog 5 isoform X1       151   2e-35    
ref|XP_006523844.1|  PREDICTED: mutS protein homolog 5 isoform X12      149   2e-35    
ref|XP_004624356.1|  PREDICTED: mutS protein homolog 5 isoform X1       151   2e-35    
ref|XP_005518404.1|  PREDICTED: mutS protein homolog 5-like             150   3e-35    
gb|EHB16072.1|  MutS protein-like protein 5                             150   4e-35    
ref|XP_004424404.1|  PREDICTED: mutS protein homolog 5 isoform 2        150   4e-35    
ref|XP_004424403.1|  PREDICTED: mutS protein homolog 5 isoform 1        150   4e-35    
gb|EKC41211.1|  MutS-like protein 5                                     149   4e-35    
ref|XP_005696629.1|  PREDICTED: mutS protein homolog 5                  150   5e-35    
ref|XP_010599836.1|  PREDICTED: mutS protein homolog 5 isoform X1       150   5e-35    
ref|XP_003422319.1|  PREDICTED: mutS protein homolog 5 isoform X2       150   6e-35    
ref|XP_005005528.1|  PREDICTED: mutS protein homolog 5 isoform X3       150   6e-35    
ref|XP_638383.1|  hypothetical protein DDB_G0284747                     150   6e-35    Dictyostelium discoideum AX4
ref|XP_010816611.1|  PREDICTED: mutS protein homolog 5 isoform X3       150   6e-35    
ref|XP_008955141.1|  PREDICTED: mutS protein homolog 5 isoform X4       150   6e-35    
ref|XP_003831601.1|  PREDICTED: mutS protein homolog 5 isoform X3       150   6e-35    
ref|XP_009955391.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    150   6e-35    
ref|XP_002803716.1|  PREDICTED: mutS protein homolog 5-like isofo...    150   7e-35    
ref|XP_010816606.1|  PREDICTED: mutS protein homolog 5 isoform X1       150   7e-35    
ref|XP_005904267.1|  PREDICTED: mutS protein homolog 5 isoform X2       150   7e-35    
ref|NP_001192428.1|  mutS protein homolog 5                             150   7e-35    
ref|XP_005904266.1|  PREDICTED: mutS protein homolog 5 isoform X1       150   7e-35    
ref|XP_009203099.1|  PREDICTED: mutS protein homolog 5 isoform X2       149   7e-35    
ref|XP_001105745.1|  PREDICTED: mutS protein homolog 5-like isofo...    150   7e-35    Macaca mulatta [rhesus macaque]
ref|XP_010303564.1|  PREDICTED: mutS protein homolog 5                  149   7e-35    
gb|KFQ14960.1|  MutS protein 5                                          149   7e-35    
ref|XP_005553536.1|  PREDICTED: mutS protein homolog 5 isoform X6       149   7e-35    
ref|XP_009203098.1|  PREDICTED: mutS protein homolog 5 isoform X1       150   8e-35    
gb|KFO05443.1|  MutS protein 5                                          149   8e-35    
ref|XP_010381649.1|  PREDICTED: mutS protein homolog 5                  149   8e-35    
ref|XP_010831636.1|  PREDICTED: mutS protein homolog 5 isoform X2       149   8e-35    
ref|XP_005553534.1|  PREDICTED: mutS protein homolog 5 isoform X4       149   9e-35    
ref|XP_005553538.1|  PREDICTED: mutS protein homolog 5 isoform X8       149   9e-35    
ref|XP_007971282.1|  PREDICTED: mutS protein homolog 5 isoform X2       149   9e-35    
ref|XP_010184179.1|  PREDICTED: mutS protein homolog 5                  149   1e-34    
ref|XP_005370872.1|  PREDICTED: mutS protein homolog 5                  149   1e-34    
ref|XP_005553531.1|  PREDICTED: mutS protein homolog 5 isoform X1       149   1e-34    
ref|XP_001491489.3|  PREDICTED: mutS protein homolog 5 isoform X1       149   1e-34    
ref|NP_038628.2|  mutS protein homolog 5                                149   1e-34    
ref|XP_006875647.1|  PREDICTED: mutS protein homolog 5 isoform X2       149   1e-34    
ref|XP_009203102.1|  PREDICTED: mutS protein homolog 5 isoform X4       149   1e-34    
ref|XP_006523834.1|  PREDICTED: mutS protein homolog 5 isoform X2       149   1e-34    
sp|Q9QUM7.1|MSH5_MOUSE  RecName: Full=MutS protein homolog 5            149   1e-34    
gb|AAI41114.1|  MutS homolog 5 (E. coli)                                149   1e-34    
ref|XP_006875646.1|  PREDICTED: mutS protein homolog 5 isoform X1       149   1e-34    
ref|XP_004018989.1|  PREDICTED: mutS protein homolog 5                  149   1e-34    
ref|XP_010831633.1|  PREDICTED: mutS protein homolog 5 isoform X1       149   1e-34    
gb|EAX03508.1|  mutS homolog 5 (E. coli), isoform CRA_c                 149   1e-34    
ref|XP_006523833.1|  PREDICTED: mutS protein homolog 5 isoform X1       149   1e-34    
ref|NP_002432.1|  mutS protein homolog 5 isoform c                      149   1e-34    
ref|NP_751897.1|  mutS protein homolog 5 isoform b                      149   1e-34    
gb|AAC62533.1|  MutS homolog 5                                          149   1e-34    
ref|XP_005553537.1|  PREDICTED: mutS protein homolog 5 isoform X7       148   2e-34    
ref|XP_004672007.1|  PREDICTED: mutS protein homolog 5                  149   2e-34    
gb|KFQ37076.1|  MutS protein 5                                          148   2e-34    
gb|AAP36674.1|  Homo sapiens mutS homolog 5 (E. coli)                   149   2e-34    
ref|XP_009449201.1|  PREDICTED: mutS protein homolog 5                  148   2e-34    
ref|XP_009917702.1|  PREDICTED: mutS protein homolog 5                  148   2e-34    
ref|XP_007612871.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    148   2e-34    
ref|XP_004781005.1|  PREDICTED: mutS protein homolog 5 isoform X2       148   2e-34    
ref|XP_004781004.1|  PREDICTED: mutS protein homolog 5 isoform X1       148   3e-34    
gb|KFQ04385.1|  MutS protein 5                                          148   3e-34    
ref|XP_005493630.1|  PREDICTED: mutS protein homolog 5-like             148   3e-34    
ref|XP_008535769.1|  PREDICTED: mutS protein homolog 5                  147   3e-34    
ref|XP_006178838.1|  PREDICTED: mutS protein homolog 5 isoform X2       147   3e-34    
ref|XP_010976419.1|  PREDICTED: mutS protein homolog 5 isoform X3       147   4e-34    
ref|XP_005339042.1|  PREDICTED: mutS protein homolog 5                  147   4e-34    
ref|XP_008710105.1|  PREDICTED: mutS protein homolog 5                  147   4e-34    
gb|KFO21054.1|  MutS protein like protein 5                             147   4e-34    
ref|XP_007556243.1|  PREDICTED: mutS protein homolog 5 isoform X3       147   4e-34    
ref|XP_006178837.1|  PREDICTED: mutS protein homolog 5 isoform X1       147   4e-34    
ref|XP_010608176.1|  PREDICTED: mutS protein homolog 5 isoform X4       147   4e-34    
ref|XP_007422095.1|  PREDICTED: mutS protein homolog 5-like             147   5e-34    
ref|XP_008297768.1|  PREDICTED: mutS protein homolog 5                  147   5e-34    
ref|XP_008890469.1|  hypothetical protein, variant 5                    146   5e-34    
ref|XP_007971279.1|  PREDICTED: mutS protein homolog 5 isoform X1       147   5e-34    
ref|XP_003289889.1|  hypothetical protein DICPUDRAFT_88710              147   5e-34    
ref|XP_008573260.1|  PREDICTED: mutS protein homolog 5 isoform X2       147   5e-34    
ref|XP_006041959.1|  PREDICTED: mutS protein homolog 5 isoform X2       147   5e-34    
ref|XP_006215402.1|  PREDICTED: mutS protein homolog 5 isoform X2       147   5e-34    
ref|XP_009901749.1|  PREDICTED: mutS protein homolog 5                  147   5e-34    
ref|XP_007556241.1|  PREDICTED: mutS protein homolog 5 isoform X1       147   5e-34    
ref|XP_008573259.1|  PREDICTED: mutS protein homolog 5 isoform X1       147   6e-34    
ref|XP_007949537.1|  PREDICTED: mutS protein homolog 5 isoform X3       147   6e-34    
ref|XP_006738514.1|  PREDICTED: mutS protein homolog 5 isoform X2       147   6e-34    
ref|XP_006215401.1|  PREDICTED: mutS protein homolog 5 isoform X1       147   6e-34    
ref|XP_006041958.1|  PREDICTED: mutS protein homolog 5 isoform X1       147   6e-34    
ref|XP_006738513.1|  PREDICTED: mutS protein homolog 5 isoform X1       147   6e-34    
ref|XP_007971288.1|  PREDICTED: mutS protein homolog 5 isoform X7       146   6e-34    
gb|KFV69572.1|  MutS protein 5                                          147   7e-34    
ref|XP_005086885.1|  PREDICTED: mutS protein homolog 5                  147   7e-34    
ref|XP_008065907.1|  PREDICTED: mutS protein homolog 5 isoform X1       147   8e-34    
ref|XP_008321310.1|  PREDICTED: mutS protein homolog 5                  146   8e-34    
ref|XP_008065908.1|  PREDICTED: mutS protein homolog 5 isoform X2       147   8e-34    
ref|XP_007971287.1|  PREDICTED: mutS protein homolog 5 isoform X6       146   8e-34    
ref|XP_008890473.1|  hypothetical protein, variant 4                    145   9e-34    
ref|XP_008938084.1|  PREDICTED: mutS protein homolog 5                  146   9e-34    
gb|KFQ18517.1|  MutS protein 5                                          146   1e-33    
ref|XP_008890470.1|  hypothetical protein, variant 6                    145   1e-33    
ref|XP_004621344.1|  PREDICTED: mutS protein homolog 5 isoform X1       146   1e-33    
ref|XP_006256119.1|  PREDICTED: mutS protein homolog 5 isoform X1       146   1e-33    
gb|ELT91413.1|  hypothetical protein CAPTEDRAFT_89832                   145   1e-33    
ref|XP_003789334.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    146   1e-33    
ref|XP_008890474.1|  hypothetical protein, variant 1                    145   1e-33    
ref|XP_004351299.1|  mutS like protein                                  146   1e-33    
ref|XP_004621345.1|  PREDICTED: mutS protein homolog 5 isoform X2       145   2e-33    
ref|XP_004456148.1|  PREDICTED: mutS protein homolog 5                  145   2e-33    
ref|XP_007241980.1|  PREDICTED: mutS protein homolog 5-like             145   2e-33    
ref|XP_004415304.1|  PREDICTED: mutS protein homolog 5 isoform 2        145   2e-33    
ref|XP_004711856.1|  PREDICTED: mutS protein homolog 5                  145   2e-33    
ref|XP_008155566.1|  PREDICTED: mutS protein homolog 5 isoform X2       145   2e-33    
ref|XP_008155565.1|  PREDICTED: mutS protein homolog 5 isoform X1       145   2e-33    
ref|XP_004415303.1|  PREDICTED: mutS protein homolog 5 isoform 1        145   2e-33    
ref|XP_004695159.1|  PREDICTED: mutS protein homolog 5                  145   3e-33    
gb|EFW43591.2|  MSH5 protein                                            145   3e-33    
ref|XP_008890468.1|  hypothetical protein PPTG_00750                    145   3e-33    
ref|XP_006904704.1|  PREDICTED: mutS protein homolog 5                  144   3e-33    
ref|XP_005859984.1|  PREDICTED: mutS protein homolog 5                  144   4e-33    
ref|XP_007537223.1|  PREDICTED: mutS protein homolog 5 isoform X2       144   4e-33    
ref|XP_008120616.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    144   4e-33    
ref|XP_007537222.1|  PREDICTED: mutS protein homolog 5 isoform X1       144   4e-33    
ref|XP_008890472.1|  hypothetical protein, variant 3                    144   5e-33    
ref|XP_004624358.1|  PREDICTED: mutS protein homolog 5 isoform X3       144   5e-33    
ref|XP_006523836.1|  PREDICTED: mutS protein homolog 5 isoform X4       144   5e-33    
ref|XP_007459614.1|  PREDICTED: mutS protein homolog 5 isoform X3       144   6e-33    
ref|NP_997701.2|  mutS protein homolog 5                                144   6e-33    
ref|XP_005738659.1|  PREDICTED: mutS protein homolog 5-like isofo...    144   6e-33    
ref|XP_005738657.1|  PREDICTED: mutS protein homolog 5-like isofo...    144   6e-33    
ref|XP_008890471.1|  hypothetical protein, variant 2                    144   6e-33    
gb|EMP34845.1|  MutS protein like protein 5                             143   6e-33    
ref|XP_002939511.2|  PREDICTED: mutS protein homolog 5                  143   8e-33    
ref|XP_003422318.1|  PREDICTED: mutS protein homolog 5 isoform X3       143   9e-33    
ref|XP_003450992.1|  PREDICTED: mutS protein homolog 5 isoform X1       143   1e-32    
ref|XP_006801350.1|  PREDICTED: mutS protein homolog 5-like             143   1e-32    
ref|XP_006875648.1|  PREDICTED: mutS protein homolog 5 isoform X3       143   1e-32    
ref|XP_010608175.1|  PREDICTED: mutS protein homolog 5 isoform X3       143   1e-32    
gb|EAX03517.1|  mutS homolog 5 (E. coli), isoform CRA_g                 142   1e-32    
ref|XP_004424405.1|  PREDICTED: mutS protein homolog 5 isoform 3        142   2e-32    
emb|CCX11685.1|  Similar to MutS protein homolog 5; acc. no. Q12175     142   2e-32    
ref|XP_008955142.1|  PREDICTED: mutS protein homolog 5 isoform X6       142   2e-32    
ref|XP_005937679.1|  PREDICTED: mutS protein homolog 5-like isofo...    142   2e-32    
ref|XP_003831603.1|  PREDICTED: mutS protein homolog 5 isoform X5       142   2e-32    
ref|XP_008955137.1|  PREDICTED: mutS protein homolog 5 isoform X1       142   2e-32    
ref|XP_002883205.1|  hypothetical protein ARALYDRAFT_898369             132   2e-32    
ref|XP_005937676.1|  PREDICTED: mutS protein homolog 5-like isofo...    142   2e-32    
ref|XP_008955140.1|  PREDICTED: mutS protein homolog 5 isoform X2       142   3e-32    
ref|XP_006523837.1|  PREDICTED: mutS protein homolog 5 isoform X5       142   3e-32    
ref|XP_008573262.1|  PREDICTED: mutS protein homolog 5 isoform X3       142   3e-32    
gb|EHH18174.1|  hypothetical protein EGK_14724                          141   4e-32    
ref|XP_005603801.1|  PREDICTED: mutS protein homolog 5 isoform X2       141   4e-32    
ref|XP_005603805.1|  PREDICTED: mutS protein homolog 5 isoform X6       141   4e-32    
ref|XP_004390815.1|  PREDICTED: mutS protein homolog 5 isoform 2        141   4e-32    
ref|XP_004541743.1|  PREDICTED: mutS protein homolog 5-like             141   5e-32    
ref|NP_079535.4|  mutS protein homolog 5 isoform a                      141   5e-32    
ref|XP_005157849.1|  PREDICTED: mutS protein homolog 5                  141   5e-32    
emb|CAB52406.1|  G7 protein                                             141   5e-32    
gb|EAX03506.1|  mutS homolog 5 (E. coli), isoform CRA_a                 140   5e-32    
gb|EHH61984.1|  hypothetical protein EGM_20140                          141   5e-32    
gb|AAX20111.1|  mutS homolog 5 (E. coli)                                141   6e-32    
ref|XP_006523846.1|  PREDICTED: mutS protein homolog 5 isoform X14      137   7e-32    
ref|XP_010959790.1|  PREDICTED: mutS protein homolog 5 isoform X1       140   1e-31    
ref|XP_010976417.1|  PREDICTED: mutS protein homolog 5 isoform X1       140   1e-31    
ref|XP_010959793.1|  PREDICTED: mutS protein homolog 5 isoform X4       139   1e-31    
ref|XP_010976420.1|  PREDICTED: mutS protein homolog 5 isoform X4       139   2e-31    
ref|XP_008992428.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    139   2e-31    
ref|XP_003966181.1|  PREDICTED: mutS protein homolog 5-like             139   3e-31    
ref|XP_010734317.1|  PREDICTED: mutS protein homolog 5                  138   4e-31    
ref|XP_008770940.1|  PREDICTED: mutS protein homolog 5 isoform X2       138   6e-31    
dbj|GAM25145.1|  hypothetical protein SAMD00019534_083200               137   9e-31    
ref|XP_005472776.1|  PREDICTED: mutS protein homolog 5 isoform X2       137   9e-31    
ref|XP_005472778.1|  PREDICTED: mutS protein homolog 5 isoform X4       136   1e-30    
ref|XP_005472777.1|  PREDICTED: mutS protein homolog 5 isoform X3       137   1e-30    
gb|EFB18159.1|  hypothetical protein PANDA_020400                       132   2e-30    
ref|XP_006104723.1|  PREDICTED: mutS protein homolog 5                  135   6e-30    
ref|XP_005627803.1|  PREDICTED: mutS protein homolog 5                  134   7e-30    
ref|XP_008065909.1|  PREDICTED: mutS protein homolog 5 isoform X3       134   7e-30    
ref|XP_005553533.1|  PREDICTED: mutS protein homolog 5 isoform X3       133   2e-29    
ref|XP_009056678.1|  hypothetical protein LOTGIDRAFT_233005             133   2e-29    
ref|XP_004781012.1|  PREDICTED: mutS protein homolog 5 isoform X9       132   2e-29    
ref|XP_010883083.1|  PREDICTED: mutS protein homolog 5                  132   3e-29    
ref|XP_005553539.1|  PREDICTED: mutS protein homolog 5 isoform X9       132   3e-29    
ref|XP_006154350.1|  PREDICTED: mutS protein homolog 5 isoform X3       132   3e-29    
ref|XP_005810639.1|  PREDICTED: mutS protein homolog 5-like             132   3e-29    
ref|XP_009203103.1|  PREDICTED: mutS protein homolog 5 isoform X5       132   4e-29    
ref|XP_004781006.1|  PREDICTED: mutS protein homolog 5 isoform X3       132   4e-29    
ref|XP_007971285.1|  PREDICTED: mutS protein homolog 5 isoform X4       131   8e-29    
ref|XP_005390162.1|  PREDICTED: mutS protein homolog 5                  131   1e-28    
ref|XP_007971284.1|  PREDICTED: mutS protein homolog 5 isoform X3       130   1e-28    
ref|XP_005553535.1|  PREDICTED: mutS protein homolog 5 isoform X5       130   1e-28    
ref|XP_009203101.1|  PREDICTED: mutS protein homolog 5 isoform X3       130   1e-28    
gb|EPQ03728.1|  MutS protein like protein 5                             130   1e-28    
ref|XP_006811330.1|  PREDICTED: mutS protein homolog 5-like             130   1e-28    
ref|XP_004781011.1|  PREDICTED: mutS protein homolog 5 isoform X8       130   1e-28    
ref|XP_004364503.1|  MSH5 protein                                       130   2e-28    
ref|XP_008605650.1|  hypothetical protein, variant                      130   2e-28    
ref|XP_004781007.1|  PREDICTED: mutS protein homolog 5 isoform X4       130   2e-28    
ref|XP_007971290.1|  PREDICTED: mutS protein homolog 5 isoform X8       129   2e-28    
ref|XP_006523841.1|  PREDICTED: mutS protein homolog 5 isoform X9       129   3e-28    
gb|ELW61867.1|  MutS protein like protein 5                             129   3e-28    
ref|XP_007971286.1|  PREDICTED: mutS protein homolog 5 isoform X5       128   7e-28    
ref|XP_004847023.1|  PREDICTED: mutS protein homolog 5 isoform X3       126   2e-27    
gb|KFH69331.1|  hypothetical protein MVEG_04145                         125   6e-27    
ref|XP_008605649.1|  hypothetical protein SDRG_01874                    125   9e-27    
ref|XP_007670881.1|  PREDICTED: mutS protein homolog 5                  123   1e-26    
gb|EXX78176.1|  MutS family protein MSH5                                124   1e-26    
ref|XP_010959791.1|  PREDICTED: mutS protein homolog 5 isoform X2       124   2e-26    
ref|XP_010976418.1|  PREDICTED: mutS protein homolog 5 isoform X2       124   2e-26    
ref|XP_006523843.1|  PREDICTED: mutS protein homolog 5 isoform X11      123   3e-26    
gb|ESA03634.1|  hypothetical protein GLOINDRAFT_556                     123   5e-26    
ref|XP_004043743.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    122   8e-26    
ref|XP_007971291.1|  PREDICTED: mutS protein homolog 5 isoform X9       122   8e-26    
ref|XP_006523847.1|  PREDICTED: mutS protein homolog 5 isoform X15      119   1e-25    
ref|XP_002669325.1|  predicted protein                                  121   2e-25    
ref|XP_009239995.1|  PREDICTED: LOW QUALITY PROTEIN: mutS protein...    120   2e-25    
ref|XP_006523838.1|  PREDICTED: mutS protein homolog 5 isoform X6       119   5e-25    
gb|KGB75535.1|  DNA mismatch repair protein MSH5                        119   6e-25    
gb|AFR92681.2|  DNA mismatch repair protein MSH5                        119   6e-25    
ref|XP_004781010.1|  PREDICTED: mutS protein homolog 5 isoform X7       117   3e-24    
ref|XP_005703512.1|  DNA mismatch repair protein MutS                   116   6e-24    
ref|XP_566842.1|  meiotic recombination-related protein                 116   6e-24    
ref|XP_006523842.1|  PREDICTED: mutS protein homolog 5 isoform X10      116   8e-24    
ref|XP_007098840.1|  PREDICTED: mutS protein homolog 5 isoform X2       115   1e-23    
ref|XP_010608178.1|  PREDICTED: mutS protein homolog 5 isoform X5       112   9e-23    
ref|XP_010608171.1|  PREDICTED: mutS protein homolog 5 isoform X1       112   1e-22    
ref|XP_010608174.1|  PREDICTED: mutS protein homolog 5 isoform X2       112   1e-22    
ref|XP_007768480.1|  hypothetical protein CONPUDRAFT_90104              112   1e-22    
ref|XP_005848992.1|  hypothetical protein CHLNCDRAFT_144556             112   1e-22    
ref|XP_002425413.1|  conserved hypothetical protein                     111   3e-22    
ref|XP_003191516.1|  meiotic recombination-related protein              110   5e-22    
ref|XP_010785356.1|  PREDICTED: mutS protein homolog 5-like             107   7e-22    
ref|XP_002842251.1|  hypothetical protein                               110   7e-22    
gb|EFA85304.1|  DNA mismatch repair protein                             110   8e-22    
gb|KDQ25591.1|  hypothetical protein PLEOSDRAFT_1078086                 109   1e-21    
gb|EPQ65858.1|  Protein of the MutS family                              108   2e-21    
gb|KEQ78523.1|  hypothetical protein M438DRAFT_410187                   108   4e-21    
ref|XP_003835772.1|  hypothetical protein LEMA_P051130.1                107   5e-21    
ref|XP_004781009.1|  PREDICTED: mutS protein homolog 5 isoform X6       106   1e-20    
ref|XP_004210373.1|  PREDICTED: mutS protein homolog 5-like             105   2e-20    
gb|KDR82897.1|  hypothetical protein GALMADRAFT_220895                  105   3e-20    
gb|EWZ49842.1|  DNA mismatch repair protein MSH5                        105   4e-20    
ref|XP_001592471.1|  hypothetical protein SS1G_06712                    105   4e-20    
gb|EXL46649.1|  DNA mismatch repair protein MSH5                        104   4e-20    
gb|KEQ61036.1|  hypothetical protein M437DRAFT_67800                    104   7e-20    
emb|CCU76777.1|  DNA mismatch repair protein Msh5                       104   7e-20    
ref|XP_007776680.1|  hypothetical protein W97_00577                     104   7e-20    
gb|EZF33889.1|  hypothetical protein H101_02549                         103   8e-20    
gb|EXK47095.1|  DNA mismatch repair protein MSH5                        103   1e-19    
ref|XP_005553540.1|  PREDICTED: mutS protein homolog 5 isoform X10      102   1e-19    
ref|XP_007971292.1|  PREDICTED: mutS protein homolog 5 isoform X10      102   1e-19    



>ref|XP_011095410.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Sesamum 
indicum]
Length=809

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/497 (73%), Positives = 416/497 (84%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACIMHG R+G+S+YDSSI QL+V+E WEDG++DFPL++M+KYQ QP +IYTSTK E+
Sbjct  13    VYMACIMHGQRVGISFYDSSICQLHVLEFWEDGNEDFPLVEMVKYQAQPCIIYTSTKCEQ  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQ  D  +EA TVKLVKSSLFSYEQAWHRLMYL+VTGMD+ LNIKER+S+LSSMM
Sbjct  73    SFLAALQNNDGNAEAPTVKLVKSSLFSYEQAWHRLMYLRVTGMDEGLNIKERVSYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVRASGGLLAILE+ER++D  E  E  NASIA++SVSEISLN FLKVDSAA EA
Sbjct  133   DVGSDVQVRASGGLLAILENERVLDTLEAKESGNASIAINSVSEISLNNFLKVDSAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSV+GMMNKCVTPMGRRLLRNWFLRP+LD++ LN RL+ 
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVYGMMNKCVTPMGRRLLRNWFLRPVLDVEKLNIRLNT  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEEL VSLR+TLKSVKD+P ILKK NSPS  CTS+DW +FLKSICSLLHINKIF
Sbjct  253   ISFFLCAEELLVSLRQTLKSVKDIPHILKKINSPSSVCTSSDWTSFLKSICSLLHINKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE LREQLK+LNL I++KAG ++S+DLA++ ELV+GV+DVNRSK KGY+TIVKDGF
Sbjct  313   EVGISETLREQLKHLNLDIIEKAGHYMSTDLAYVYELVMGVIDVNRSKDKGYDTIVKDGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FLEEVSSLELARLP M GE  +PCIVYIHQIGYL+CIF +KL++
Sbjct  373   CGELDELRQIYEELPEFLEEVSSLELARLPHMSGEKFIPCIVYIHQIGYLMCIFEDKLND  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
              + EKL DFEFA                              F DEDGD+KKFFYRT+KT
Sbjct  433   NILEKLQDFEFA------------------------------FSDEDGDSKKFFYRTAKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDDLLGDIYHKILDM  479



>ref|XP_002279440.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X5 [Vitis 
vinifera]
Length=807

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/497 (74%), Positives = 421/497 (85%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P +IYTSTK E+
Sbjct  13    VYMACILHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLIIYTSTKCED  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQR D T+EA TVKL+KSS+FSYEQAWHRL+YL+VTGMDD LNIKERI FLSSMM
Sbjct  73    SFLSALQRSDGTTEAPTVKLMKSSIFSYEQAWHRLIYLRVTGMDDGLNIKERICFLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI SD+QVRASGGLLAILE+ERI+D  EQ E  NASI +D V+EISL+KFLK+D+AA EA
Sbjct  133   DIGSDIQVRASGGLLAILENERIVDTLEQKECGNASITIDFVTEISLHKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL++LN+RL+A
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLENLNSRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL+VSLRETLKSVKD+P ILKKFNSPS  CTSTDWA+FLKS+CSLLH+NKIF
Sbjct  253   ISFFLCSEELTVSLRETLKSVKDIPYILKKFNSPSSICTSTDWASFLKSVCSLLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L+EQ+KYLNL IV+KA   ++++LA++ ELVIGV+DVNRSK+KGY T+VK+GF
Sbjct  313   EVGISESLQEQVKYLNLDIVEKAHSCITTELAYVYELVIGVIDVNRSKEKGYGTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVSSLELARLP   G   +PCIVYIHQIGYL+CIF +KLDE
Sbjct  373   CDELDELRQIYEELPEFLEEVSSLELARLPHFCGGKLVPCIVYIHQIGYLMCIFEDKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EKL DFEFA                              F D DGDTKKFFYRTSKT
Sbjct  433   TTLEKLQDFEFA------------------------------FSDGDGDTKKFFYRTSKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_010644464.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Vitis 
vinifera]
Length=863

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/497 (74%), Positives = 421/497 (85%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P +IYTSTK E+
Sbjct  13    VYMACILHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLIIYTSTKCED  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQR D T+EA TVKL+KSS+FSYEQAWHRL+YL+VTGMDD LNIKERI FLSSMM
Sbjct  73    SFLSALQRSDGTTEAPTVKLMKSSIFSYEQAWHRLIYLRVTGMDDGLNIKERICFLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI SD+QVRASGGLLAILE+ERI+D  EQ E  NASI +D V+EISL+KFLK+D+AA EA
Sbjct  133   DIGSDIQVRASGGLLAILENERIVDTLEQKECGNASITIDFVTEISLHKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL++LN+RL+A
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLENLNSRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL+VSLRETLKSVKD+P ILKKFNSPS  CTSTDWA+FLKS+CSLLH+NKIF
Sbjct  253   ISFFLCSEELTVSLRETLKSVKDIPYILKKFNSPSSICTSTDWASFLKSVCSLLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L+EQ+KYLNL IV+KA   ++++LA++ ELVIGV+DVNRSK+KGY T+VK+GF
Sbjct  313   EVGISESLQEQVKYLNLDIVEKAHSCITTELAYVYELVIGVIDVNRSKEKGYGTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVSSLELARLP   G   +PCIVYIHQIGYL+CIF +KLDE
Sbjct  373   CDELDELRQIYEELPEFLEEVSSLELARLPHFCGGKLVPCIVYIHQIGYLMCIFEDKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EKL DFEFA                              F D DGDTKKFFYRTSKT
Sbjct  433   TTLEKLQDFEFA------------------------------FSDGDGDTKKFFYRTSKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>emb|CBI26657.3| unnamed protein product [Vitis vinifera]
Length=793

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/495 (74%), Positives = 419/495 (85%), Gaps = 30/495 (6%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             MACI+HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P +IYTSTK E+SF
Sbjct  1     MACILHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLIIYTSTKCEDSF  60

Query  1493  LAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDI  1314
             L+ALQR D T+EA TVKL+KSS+FSYEQAWHRL+YL+VTGMDD LNIKERI FLSSMMDI
Sbjct  61    LSALQRSDGTTEAPTVKLMKSSIFSYEQAWHRLIYLRVTGMDDGLNIKERICFLSSMMDI  120

Query  1313  SSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQ  1134
              SD+QVRASGGLLAILE+ERI+D  EQ E  NASI +D V+EISL+KFLK+D+AA EALQ
Sbjct  121   GSDIQVRASGGLLAILENERIVDTLEQKECGNASITIDFVTEISLHKFLKLDAAAHEALQ  180

Query  1133  IFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAIS  954
             IFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL++LN+RL+AIS
Sbjct  181   IFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLENLNSRLNAIS  240

Query  953   FLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEV  774
             F L +EEL+VSLRETLKSVKD+P ILKKFNSPS  CTSTDWA+FLKS+CSLLH+NKIFEV
Sbjct  241   FFLCSEELTVSLRETLKSVKDIPYILKKFNSPSSICTSTDWASFLKSVCSLLHVNKIFEV  300

Query  773   GISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCN  594
             GISE L+EQ+KYLNL IV+KA   ++++LA++ ELVIGV+DVNRSK+KGY T+VK+GFC+
Sbjct  301   GISESLQEQVKYLNLDIVEKAHSCITTELAYVYELVIGVIDVNRSKEKGYGTLVKEGFCD  360

Query  593   ELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEM  414
             ELDELRQIYE LP+FLEEVSSLELARLP   G   +PCIVYIHQIGYL+CIF +KLDE  
Sbjct  361   ELDELRQIYEELPEFLEEVSSLELARLPHFCGGKLVPCIVYIHQIGYLMCIFEDKLDETT  420

Query  413   QEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRE  234
              EKL DFEFA                              F D DGDTKKFFYRTSKTRE
Sbjct  421   LEKLQDFEFA------------------------------FSDGDGDTKKFFYRTSKTRE  450

Query  233   LDTLLGDIYHKILGM  189
             LD LLGDIYHKIL M
Sbjct  451   LDNLLGDIYHKILDM  465



>ref|XP_010644467.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X6 [Vitis 
vinifera]
Length=772

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/506 (73%), Positives = 421/506 (83%), Gaps = 39/506 (8%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDM---------IKYQVQPGV  1527
             VYMACI+HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D+         +KYQ +P +
Sbjct  13    VYMACILHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLGRTSCLFVNVKYQAKPLI  72

Query  1526  IYTSTKSEESFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKE  1347
             IYTSTK E+SFL+ALQR D T+EA TVKL+KSS+FSYEQAWHRL+YL+VTGMDD LNIKE
Sbjct  73    IYTSTKCEDSFLSALQRSDGTTEAPTVKLMKSSIFSYEQAWHRLIYLRVTGMDDGLNIKE  132

Query  1346  RISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFL  1167
             RI FLSSMMDI SD+QVRASGGLLAILE+ERI+D  EQ E  NASI +D V+EISL+KFL
Sbjct  133   RICFLSSMMDIGSDIQVRASGGLLAILENERIVDTLEQKECGNASITIDFVTEISLHKFL  192

Query  1166  KVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldl  987
             K+D+AA EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL
Sbjct  193   KLDAAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL  252

Query  986   ddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSIC  807
             ++LN+RL+AISF L +EEL+VSLRETLKSVKD+P ILKKFNSPS  CTSTDWA+FLKS+C
Sbjct  253   ENLNSRLNAISFFLCSEELTVSLRETLKSVKDIPYILKKFNSPSSICTSTDWASFLKSVC  312

Query  806   SLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKG  627
             SLLH+NKIFEVGISE L+EQ+KYLNL IV+KA   ++++LA++ ELVIGV+DVNRSK+KG
Sbjct  313   SLLHVNKIFEVGISESLQEQVKYLNLDIVEKAHSCITTELAYVYELVIGVIDVNRSKEKG  372

Query  626   YETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLL  447
             Y T+VK+GFC+ELDELRQIYE LP+FLEEVSSLELARLP   G   +PCIVYIHQIGYL+
Sbjct  373   YGTLVKEGFCDELDELRQIYEELPEFLEEVSSLELARLPHFCGGKLVPCIVYIHQIGYLM  432

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
             CIF +KLDE   EKL DFEFA                              F D DGDTK
Sbjct  433   CIFEDKLDETTLEKLQDFEFA------------------------------FSDGDGDTK  462

Query  266   KFFYRTSKTRELDTLLGDIYHKILGM  189
             KFFYRTSKTRELD LLGDIYHKIL M
Sbjct  463   KFFYRTSKTRELDNLLGDIYHKILDM  488



>ref|XP_011095409.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Sesamum 
indicum]
Length=818

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/506 (72%), Positives = 416/506 (82%), Gaps = 39/506 (8%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACIMHG R+G+S+YDSSI QL+V+E WEDG++DFPL++M+KYQ QP +IYTSTK E+
Sbjct  13    VYMACIMHGQRVGISFYDSSICQLHVLEFWEDGNEDFPLVEMVKYQAQPCIIYTSTKCEQ  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQ  D  +EA TVKLVKSSLFSYEQAWHRLMYL+VTGMD+ LNIKER+S+LSSMM
Sbjct  73    SFLAALQNNDGNAEAPTVKLVKSSLFSYEQAWHRLMYLRVTGMDEGLNIKERVSYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVRASGGLLAILE+ER++D  E  E  NASIA++SVSEISLN FLKVDSAA EA
Sbjct  133   DVGSDVQVRASGGLLAILENERVLDTLEAKESGNASIAINSVSEISLNNFLKVDSAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSV+GMMNKCVTPMGRRLLRNWFLRP+LD++ LN RL+ 
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVYGMMNKCVTPMGRRLLRNWFLRPVLDVEKLNIRLNT  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILK---------KFNSPSCTCTSTDWAAFLKSIC  807
             ISF L AEEL VSLR+TLKSVKD+P ILK         K NSPS  CTS+DW +FLKSIC
Sbjct  253   ISFFLCAEELLVSLRQTLKSVKDIPHILKVQNLLLALLKINSPSSVCTSSDWTSFLKSIC  312

Query  806   SLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKG  627
             SLLHINKIFEVGISE LREQLK+LNL I++KAG ++S+DLA++ ELV+GV+DVNRSK KG
Sbjct  313   SLLHINKIFEVGISETLREQLKHLNLDIIEKAGHYMSTDLAYVYELVMGVIDVNRSKDKG  372

Query  626   YETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLL  447
             Y+TIVKDGFC ELDELRQIYE LP+FLEEVSSLELARLP M GE  +PCIVYIHQIGYL+
Sbjct  373   YDTIVKDGFCGELDELRQIYEELPEFLEEVSSLELARLPHMSGEKFIPCIVYIHQIGYLM  432

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
             CIF +KL++ + EKL DFEFA                              F DEDGD+K
Sbjct  433   CIFEDKLNDNILEKLQDFEFA------------------------------FSDEDGDSK  462

Query  266   KFFYRTSKTRELDTLLGDIYHKILGM  189
             KFFYRT+KTRELD LLGDIYHKIL M
Sbjct  463   KFFYRTAKTRELDDLLGDIYHKILDM  488



>ref|XP_010644466.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X4 [Vitis 
vinifera]
Length=816

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/506 (73%), Positives = 421/506 (83%), Gaps = 39/506 (8%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDM---------IKYQVQPGV  1527
             VYMACI+HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D+         +KYQ +P +
Sbjct  13    VYMACILHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLGRTSCLFVNVKYQAKPLI  72

Query  1526  IYTSTKSEESFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKE  1347
             IYTSTK E+SFL+ALQR D T+EA TVKL+KSS+FSYEQAWHRL+YL+VTGMDD LNIKE
Sbjct  73    IYTSTKCEDSFLSALQRSDGTTEAPTVKLMKSSIFSYEQAWHRLIYLRVTGMDDGLNIKE  132

Query  1346  RISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFL  1167
             RI FLSSMMDI SD+QVRASGGLLAILE+ERI+D  EQ E  NASI +D V+EISL+KFL
Sbjct  133   RICFLSSMMDIGSDIQVRASGGLLAILENERIVDTLEQKECGNASITIDFVTEISLHKFL  192

Query  1166  KVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldl  987
             K+D+AA EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL
Sbjct  193   KLDAAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL  252

Query  986   ddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSIC  807
             ++LN+RL+AISF L +EEL+VSLRETLKSVKD+P ILKKFNSPS  CTSTDWA+FLKS+C
Sbjct  253   ENLNSRLNAISFFLCSEELTVSLRETLKSVKDIPYILKKFNSPSSICTSTDWASFLKSVC  312

Query  806   SLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKG  627
             SLLH+NKIFEVGISE L+EQ+KYLNL IV+KA   ++++LA++ ELVIGV+DVNRSK+KG
Sbjct  313   SLLHVNKIFEVGISESLQEQVKYLNLDIVEKAHSCITTELAYVYELVIGVIDVNRSKEKG  372

Query  626   YETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLL  447
             Y T+VK+GFC+ELDELRQIYE LP+FLEEVSSLELARLP   G   +PCIVYIHQIGYL+
Sbjct  373   YGTLVKEGFCDELDELRQIYEELPEFLEEVSSLELARLPHFCGGKLVPCIVYIHQIGYLM  432

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
             CIF +KLDE   EKL DFEFA                              F D DGDTK
Sbjct  433   CIFEDKLDETTLEKLQDFEFA------------------------------FSDGDGDTK  462

Query  266   KFFYRTSKTRELDTLLGDIYHKILGM  189
             KFFYRTSKTRELD LLGDIYHKIL M
Sbjct  463   KFFYRTSKTRELDNLLGDIYHKILDM  488



>ref|XP_009608753.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X5 [Nicotiana 
tomentosiformis]
Length=808

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/497 (73%), Positives = 416/497 (84%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+SIRQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACVMHGHRIGVSYYDASIRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL ALQR D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  72    SFLGALQRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  132   DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD+LN RLD 
Sbjct  192   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLDNLNRRLDT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS   TS DWAAFLKS+C+LLHI+KIF
Sbjct  252   ISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPSSISTSADWAAFLKSVCALLHISKIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+LK L+L I+++A  H+S DLA++CELVIGV DV+RSK+KGYETIVK+GF
Sbjct  312   EVGISGSLYEELKNLDLDIIERADFHISVDLAYVCELVIGVTDVDRSKEKGYETIVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FL EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  372   CDELDELRQIYEGLPEFLGEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  431

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
             EM EKL D+EFA                              F DE+G+  +FFY T+KT
Sbjct  432   EMLEKLQDYEFA------------------------------FADEEGENGRFFYHTAKT  461

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  462   RELDNLLGDIYHKILDM  478



>ref|XP_010327311.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X6 [Solanum 
lycopersicum]
Length=686

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 416/497 (84%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+S RQL+V+EI+EDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  32    VYMACVMHGHRIGVSYYDASARQLHVLEIYEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  91

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR D TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  92    SFLAALQRSDGTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  151

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQVRASGGLLA+LE+ERIID  E NE  +AS+A+D + EISL+KFLKVDSAA EA
Sbjct  152   DVSSDVQVRASGGLLAVLENERIIDTLELNECGSASVAIDCICEISLDKFLKVDSAAHEA  211

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLD+LN RLD 
Sbjct  212   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLDNLNRRLDT  271

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE+SVSLRETLKSVKD+P ILKKFNSPS   TS DW+AFLKS+C+LLHI+KIF
Sbjct  272   ISFFLSAEEVSVSLRETLKSVKDIPRILKKFNSPSSISTSADWSAFLKSVCALLHISKIF  331

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+L  L+L I+++AG  +S DLA++CELVIGV+DV+RSK+KGYETIVK+GF
Sbjct  332   EVGISGSLLEELTSLDLDIIERAGFFISVDLAYVCELVIGVIDVDRSKEKGYETIVKEGF  391

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FLEEV +LELARLP M  + GLP I+Y+HQIGYL+CIFNEKL E
Sbjct  392   CDELDELRQIYEGLPEFLEEVLALELARLPCMYEDKGLPSIIYLHQIGYLMCIFNEKLGE  451

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
             EM E L D+EFA                              F DE+G+ ++FFY T+KT
Sbjct  452   EMLETLQDYEFA------------------------------FADEEGEHRRFFYHTAKT  481

Query  239   RELDTLLGDIYHKILGM  189
             +E+D LLGDIYHKIL M
Sbjct  482   KEMDNLLGDIYHKILDM  498



>ref|XP_010644463.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Vitis 
vinifera]
Length=872

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/506 (73%), Positives = 421/506 (83%), Gaps = 39/506 (8%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDM---------IKYQVQPGV  1527
             VYMACI+HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D+         +KYQ +P +
Sbjct  13    VYMACILHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLGRTSCLFVNVKYQAKPLI  72

Query  1526  IYTSTKSEESFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKE  1347
             IYTSTK E+SFL+ALQR D T+EA TVKL+KSS+FSYEQAWHRL+YL+VTGMDD LNIKE
Sbjct  73    IYTSTKCEDSFLSALQRSDGTTEAPTVKLMKSSIFSYEQAWHRLIYLRVTGMDDGLNIKE  132

Query  1346  RISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFL  1167
             RI FLSSMMDI SD+QVRASGGLLAILE+ERI+D  EQ E  NASI +D V+EISL+KFL
Sbjct  133   RICFLSSMMDIGSDIQVRASGGLLAILENERIVDTLEQKECGNASITIDFVTEISLHKFL  192

Query  1166  KVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldl  987
             K+D+AA EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL
Sbjct  193   KLDAAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL  252

Query  986   ddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSIC  807
             ++LN+RL+AISF L +EEL+VSLRETLKSVKD+P ILKKFNSPS  CTSTDWA+FLKS+C
Sbjct  253   ENLNSRLNAISFFLCSEELTVSLRETLKSVKDIPYILKKFNSPSSICTSTDWASFLKSVC  312

Query  806   SLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKG  627
             SLLH+NKIFEVGISE L+EQ+KYLNL IV+KA   ++++LA++ ELVIGV+DVNRSK+KG
Sbjct  313   SLLHVNKIFEVGISESLQEQVKYLNLDIVEKAHSCITTELAYVYELVIGVIDVNRSKEKG  372

Query  626   YETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLL  447
             Y T+VK+GFC+ELDELRQIYE LP+FLEEVSSLELARLP   G   +PCIVYIHQIGYL+
Sbjct  373   YGTLVKEGFCDELDELRQIYEELPEFLEEVSSLELARLPHFCGGKLVPCIVYIHQIGYLM  432

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
             CIF +KLDE   EKL DFEFA                              F D DGDTK
Sbjct  433   CIFEDKLDETTLEKLQDFEFA------------------------------FSDGDGDTK  462

Query  266   KFFYRTSKTRELDTLLGDIYHKILGM  189
             KFFYRTSKTRELD LLGDIYHKIL M
Sbjct  463   KFFYRTSKTRELDNLLGDIYHKILDM  488



>emb|CDP05728.1| unnamed protein product [Coffea canephora]
Length=808

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/499 (74%), Positives = 415/499 (83%), Gaps = 32/499 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACIM GHRIGVSYYDSSIRQLYV+E WEDGS+DFPL+DMI YQ +P  IYTSTKSEE
Sbjct  13    VYMACIMQGHRIGVSYYDSSIRQLYVLEFWEDGSEDFPLVDMIIYQAKPSTIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
              FLAALQ+ D TS AATVKLVKSSLFSYEQAWHRLMYL+VTGMDD LNIKER+SFL+SMM
Sbjct  73    LFLAALQKNDGTSNAATVKLVKSSLFSYEQAWHRLMYLRVTGMDDGLNIKERMSFLNSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI S+VQVRA+GGLLA+LE+ERIID  EQ E  +ASIAVDSV EISLNKFLKVDSAA EA
Sbjct  133   DIQSEVQVRATGGLLAVLENERIIDTLEQKECGSASIAVDSVIEISLNKFLKVDSAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFS+FGMMNKCVTPMGRRLLRNWFLRPILD++ LN R DA
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSLFGMMNKCVTPMGRRLLRNWFLRPILDIEKLNKRFDA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLK--SICSLLHINK  786
             I+F   AEEL  SLRETL+S+KD+P ILKKFNSPS  CTS+DW AF+K  SICSLLHINK
Sbjct  253   ITFFHSAEELLASLRETLQSIKDIPHILKKFNSPSSLCTSSDWKAFVKVFSICSLLHINK  312

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEVGISE+L+E+LKYLNL IV++   +LS+DLA++ ELV+GV+DVNRSK KGYETIVKD
Sbjct  313   IFEVGISENLQEELKYLNLDIVEQVEFYLSADLAYVYELVVGVVDVNRSKDKGYETIVKD  372

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC+ELDELRQ+YE LP+FLEEVSS+EL RLP M G+  +P IVYIHQIGYL+CIF E L
Sbjct  373   GFCDELDELRQMYEELPEFLEEVSSVELTRLPYMSGDKFIPRIVYIHQIGYLMCIFQENL  432

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
             D+ M EKL D+EFA                              F DED +TKKFFYRT+
Sbjct  433   DKSMLEKLEDYEFA------------------------------FSDEDENTKKFFYRTA  462

Query  245   KTRELDTLLGDIYHKILGM  189
             KTRELD+LLGD+YHKIL M
Sbjct  463   KTRELDSLLGDLYHKILDM  481



>ref|XP_006338892.1| PREDICTED: DNA mismatch repair protein MSH5-like [Solanum tuberosum]
Length=831

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/497 (73%), Positives = 416/497 (84%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+S RQL+V+EI+EDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  35    VYMACVMHGHRIGVSYYDASARQLHVLEIYEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  94

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR D TS+A +VKLVKSSLFSYEQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  95    SFLAALQRSDGTSDAPSVKLVKSSLFSYEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  154

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQVRASGGLLA+LE+ERIID  EQNE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  155   DVSSDVQVRASGGLLAVLENERIIDTLEQNECGSASIAIDCICEISLDKFLKVDSAAHEA  214

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLD+LN RLD 
Sbjct  215   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLDNLNRRLDT  274

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L  EE+SVSLRETLKSVKD+P ILKKFNSPS   TS DW+AFLKS+C+LLHI+KIF
Sbjct  275   ISFFLSTEEISVSLRETLKSVKDIPRILKKFNSPSSISTSADWSAFLKSVCALLHISKIF  334

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+L  L+L I+++AG  +S DLA++CELVIGV+DV+RSK+KGYETIVK+GF
Sbjct  335   EVGISGSLLEELTSLDLDIIERAGFFISVDLAYVCELVIGVIDVDRSKEKGYETIVKEGF  394

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FLEEVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKL E
Sbjct  395   CDELDELRQIYEGLPEFLEEVSALELARLPCMYEDKEIPSIIYIHQIGYLMCIFNEKLGE  454

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
             EM E L D+EFA                              F DE+G+ ++FFY T+KT
Sbjct  455   EMLESLQDYEFA------------------------------FADEEGEHRRFFYHTAKT  484

Query  239   RELDTLLGDIYHKILGM  189
             +ELD LLGDIYHKIL M
Sbjct  485   KELDNLLGDIYHKILDM  501



>ref|XP_010327310.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X5 [Solanum 
lycopersicum]
Length=705

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 416/497 (84%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+S RQL+V+EI+EDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  32    VYMACVMHGHRIGVSYYDASARQLHVLEIYEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  91

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR D TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  92    SFLAALQRSDGTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  151

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQVRASGGLLA+LE+ERIID  E NE  +AS+A+D + EISL+KFLKVDSAA EA
Sbjct  152   DVSSDVQVRASGGLLAVLENERIIDTLELNECGSASVAIDCICEISLDKFLKVDSAAHEA  211

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLD+LN RLD 
Sbjct  212   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLDNLNRRLDT  271

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE+SVSLRETLKSVKD+P ILKKFNSPS   TS DW+AFLKS+C+LLHI+KIF
Sbjct  272   ISFFLSAEEVSVSLRETLKSVKDIPRILKKFNSPSSISTSADWSAFLKSVCALLHISKIF  331

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+L  L+L I+++AG  +S DLA++CELVIGV+DV+RSK+KGYETIVK+GF
Sbjct  332   EVGISGSLLEELTSLDLDIIERAGFFISVDLAYVCELVIGVIDVDRSKEKGYETIVKEGF  391

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FLEEV +LELARLP M  + GLP I+Y+HQIGYL+CIFNEKL E
Sbjct  392   CDELDELRQIYEGLPEFLEEVLALELARLPCMYEDKGLPSIIYLHQIGYLMCIFNEKLGE  451

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
             EM E L D+EFA                              F DE+G+ ++FFY T+KT
Sbjct  452   EMLETLQDYEFA------------------------------FADEEGEHRRFFYHTAKT  481

Query  239   RELDTLLGDIYHKILGM  189
             +E+D LLGDIYHKIL M
Sbjct  482   KEMDNLLGDIYHKILDM  498



>ref|XP_004248554.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Solanum 
lycopersicum]
Length=828

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 416/497 (84%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+S RQL+V+EI+EDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  32    VYMACVMHGHRIGVSYYDASARQLHVLEIYEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  91

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR D TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  92    SFLAALQRSDGTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  151

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQVRASGGLLA+LE+ERIID  E NE  +AS+A+D + EISL+KFLKVDSAA EA
Sbjct  152   DVSSDVQVRASGGLLAVLENERIIDTLELNECGSASVAIDCICEISLDKFLKVDSAAHEA  211

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLD+LN RLD 
Sbjct  212   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLDNLNRRLDT  271

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE+SVSLRETLKSVKD+P ILKKFNSPS   TS DW+AFLKS+C+LLHI+KIF
Sbjct  272   ISFFLSAEEVSVSLRETLKSVKDIPRILKKFNSPSSISTSADWSAFLKSVCALLHISKIF  331

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+L  L+L I+++AG  +S DLA++CELVIGV+DV+RSK+KGYETIVK+GF
Sbjct  332   EVGISGSLLEELTSLDLDIIERAGFFISVDLAYVCELVIGVIDVDRSKEKGYETIVKEGF  391

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FLEEV +LELARLP M  + GLP I+Y+HQIGYL+CIFNEKL E
Sbjct  392   CDELDELRQIYEGLPEFLEEVLALELARLPCMYEDKGLPSIIYLHQIGYLMCIFNEKLGE  451

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
             EM E L D+EFA                              F DE+G+ ++FFY T+KT
Sbjct  452   EMLETLQDYEFA------------------------------FADEEGEHRRFFYHTAKT  481

Query  239   RELDTLLGDIYHKILGM  189
             +E+D LLGDIYHKIL M
Sbjct  482   KEMDNLLGDIYHKILDM  498



>ref|XP_010327308.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X3 [Solanum 
lycopersicum]
Length=820

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 416/497 (84%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+S RQL+V+EI+EDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  32    VYMACVMHGHRIGVSYYDASARQLHVLEIYEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  91

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR D TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  92    SFLAALQRSDGTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  151

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQVRASGGLLA+LE+ERIID  E NE  +AS+A+D + EISL+KFLKVDSAA EA
Sbjct  152   DVSSDVQVRASGGLLAVLENERIIDTLELNECGSASVAIDCICEISLDKFLKVDSAAHEA  211

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLD+LN RLD 
Sbjct  212   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLDNLNRRLDT  271

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE+SVSLRETLKSVKD+P ILKKFNSPS   TS DW+AFLKS+C+LLHI+KIF
Sbjct  272   ISFFLSAEEVSVSLRETLKSVKDIPRILKKFNSPSSISTSADWSAFLKSVCALLHISKIF  331

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+L  L+L I+++AG  +S DLA++CELVIGV+DV+RSK+KGYETIVK+GF
Sbjct  332   EVGISGSLLEELTSLDLDIIERAGFFISVDLAYVCELVIGVIDVDRSKEKGYETIVKEGF  391

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FLEEV +LELARLP M  + GLP I+Y+HQIGYL+CIFNEKL E
Sbjct  392   CDELDELRQIYEGLPEFLEEVLALELARLPCMYEDKGLPSIIYLHQIGYLMCIFNEKLGE  451

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
             EM E L D+EFA                              F DE+G+ ++FFY T+KT
Sbjct  452   EMLETLQDYEFA------------------------------FADEEGEHRRFFYHTAKT  481

Query  239   RELDTLLGDIYHKILGM  189
             +E+D LLGDIYHKIL M
Sbjct  482   KEMDNLLGDIYHKILDM  498



>ref|XP_010327307.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Solanum 
lycopersicum]
Length=834

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/497 (73%), Positives = 416/497 (84%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+S RQL+V+EI+EDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  32    VYMACVMHGHRIGVSYYDASARQLHVLEIYEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  91

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR D TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  92    SFLAALQRSDGTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  151

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQVRASGGLLA+LE+ERIID  E NE  +AS+A+D + EISL+KFLKVDSAA EA
Sbjct  152   DVSSDVQVRASGGLLAVLENERIIDTLELNECGSASVAIDCICEISLDKFLKVDSAAHEA  211

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLD+LN RLD 
Sbjct  212   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLDNLNRRLDT  271

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE+SVSLRETLKSVKD+P ILKKFNSPS   TS DW+AFLKS+C+LLHI+KIF
Sbjct  272   ISFFLSAEEVSVSLRETLKSVKDIPRILKKFNSPSSISTSADWSAFLKSVCALLHISKIF  331

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+L  L+L I+++AG  +S DLA++CELVIGV+DV+RSK+KGYETIVK+GF
Sbjct  332   EVGISGSLLEELTSLDLDIIERAGFFISVDLAYVCELVIGVIDVDRSKEKGYETIVKEGF  391

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FLEEV +LELARLP M  + GLP I+Y+HQIGYL+CIFNEKL E
Sbjct  392   CDELDELRQIYEGLPEFLEEVLALELARLPCMYEDKGLPSIIYLHQIGYLMCIFNEKLGE  451

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
             EM E L D+EFA                              F DE+G+ ++FFY T+KT
Sbjct  452   EMLETLQDYEFA------------------------------FADEEGEHRRFFYHTAKT  481

Query  239   RELDTLLGDIYHKILGM  189
             +E+D LLGDIYHKIL M
Sbjct  482   KEMDNLLGDIYHKILDM  498



>ref|XP_008226951.1| PREDICTED: DNA mismatch repair protein MSH5 [Prunus mume]
Length=811

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/497 (71%), Positives = 408/497 (82%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HGHR+GVSYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P +IYTSTKSEE
Sbjct  16    VYMACIQHGHRVGVSYYDSSIRQLHVLEVWEDGSTDFPLIDLVKYQARPLIIYTSTKSEE  75

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQR D  +EA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  76    SFLSALQRSDGMTEAFTVKLVKSSVFSYEQAWHRLIYLRVTGMDDGLNIKERICYLSSMM  135

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SD+QVR SGGLLAILE+ER++D  EQ E  NASIA+DSV E+SLN FLK+D+AA EA
Sbjct  136   DMGSDIQVRTSGGLLAILENERVVDTLEQMESGNASIAIDSVIEVSLNNFLKLDAAAHEA  195

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKCVTPMGR LLR+WFLRPILDL+ LN RL+A
Sbjct  196   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRCLLRSWFLRPILDLETLNNRLNA  255

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SLR TLKSVKD+P ILKKFNSPS  CTS DW AFLKS+CSLLH+NKIF
Sbjct  256   ISFFLSSEELINSLRGTLKSVKDIPHILKKFNSPSSICTSGDWTAFLKSVCSLLHVNKIF  315

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE L+E  KYLNL IV+KA   ++++LA++ ELVIGVLDV+RSK+KGYETIVKD F
Sbjct  316   EVGVSESLQEHAKYLNLDIVEKAASCITTELAYVYELVIGVLDVSRSKEKGYETIVKDDF  375

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVS +EL RLP++  EN +PCIVYIHQIGYL+CIF EKLDE
Sbjct  376   CDELDELRQIYEELPEFLEEVSQMELGRLPQLYKENFVPCIVYIHQIGYLMCIFEEKLDE  435

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EK+ DFEFA                              F D +G+TK+FFY T+KT
Sbjct  436   ATLEKVQDFEFA------------------------------FSDAEGETKRFFYHTAKT  465

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  466   RELDNLLGDIYHKILDM  482



>ref|XP_007214518.1| hypothetical protein PRUPE_ppa015717mg [Prunus persica]
 gb|EMJ15717.1| hypothetical protein PRUPE_ppa015717mg [Prunus persica]
Length=798

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/497 (71%), Positives = 408/497 (82%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HG R+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P +IY STKSEE
Sbjct  3     VYMACILHGQRVGISYYDSSIRQLHVLEVWEDGSTDFPLIDLVKYQARPLIIYASTKSEE  62

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQR D  +EA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  63    SFLSALQRSDGMTEAFTVKLVKSSIFSYEQAWHRLIYLRVTGMDDGLNIKERICYLSSMM  122

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SD+QVR SGGLLAILE+ER++D  EQ E  NASIA+DSV E+SLN FLK+D+AA EA
Sbjct  123   DMGSDIQVRTSGGLLAILENERVVDTLEQMESGNASIAIDSVIEVSLNNFLKLDAAAHEA  182

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR+WFLRPILDL+ LN+RL+A
Sbjct  183   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRSWFLRPILDLETLNSRLNA  242

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SLR TLKSVKD+P ILKKFNSPS  CTS DW AFLKS+CSLLH+NKIF
Sbjct  243   ISFFLSSEELINSLRGTLKSVKDIPHILKKFNSPSSICTSGDWTAFLKSVCSLLHVNKIF  302

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE L+E  KYLNL IV+KA   ++++LA++ ELVIGVLDV+RSK+KGYETIVKD F
Sbjct  303   EVGVSESLQEHAKYLNLDIVEKAASCITTELAYVYELVIGVLDVSRSKEKGYETIVKDDF  362

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVS +EL RLP++  E  +PCIVYIHQIGYL+CIF EKLDE
Sbjct  363   CDELDELRQIYEELPEFLEEVSQMELGRLPQLYKEKFVPCIVYIHQIGYLMCIFEEKLDE  422

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EK+ DFEFA                              F D +G+TK+FFY T+KT
Sbjct  423   ATLEKVQDFEFA------------------------------FSDAEGETKRFFYHTAKT  452

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  453   RELDNLLGDIYHKILDM  469



>ref|XP_009608758.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X10 [Nicotiana 
tomentosiformis]
Length=680

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/435 (79%), Positives = 390/435 (90%), Gaps = 0/435 (0%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+SIRQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACVMHGHRIGVSYYDASIRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL ALQR D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  72    SFLGALQRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  132   DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD+LN RLD 
Sbjct  192   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLDNLNRRLDT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS   TS DWAAFLKS+C+LLHI+KIF
Sbjct  252   ISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPSSISTSADWAAFLKSVCALLHISKIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+LK L+L I+++A  H+S DLA++CELVIGV DV+RSK+KGYETIVK+GF
Sbjct  312   EVGISGSLYEELKNLDLDIIERADFHISVDLAYVCELVIGVTDVDRSKEKGYETIVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FL EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  372   CDELDELRQIYEGLPEFLGEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  431

Query  419   EMQEKLPDFEFAVCH  375
             EM EKL D+EFAVCH
Sbjct  432   EMLEKLQDYEFAVCH  446



>ref|XP_009608756.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X8 [Nicotiana 
tomentosiformis]
Length=705

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/435 (79%), Positives = 390/435 (90%), Gaps = 0/435 (0%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+SIRQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACVMHGHRIGVSYYDASIRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL ALQR D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  72    SFLGALQRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  132   DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD+LN RLD 
Sbjct  192   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLDNLNRRLDT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS   TS DWAAFLKS+C+LLHI+KIF
Sbjct  252   ISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPSSISTSADWAAFLKSVCALLHISKIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+LK L+L I+++A  H+S DLA++CELVIGV DV+RSK+KGYETIVK+GF
Sbjct  312   EVGISGSLYEELKNLDLDIIERADFHISVDLAYVCELVIGVTDVDRSKEKGYETIVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FL EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  372   CDELDELRQIYEGLPEFLGEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  431

Query  419   EMQEKLPDFEFAVCH  375
             EM EKL D+EFAVCH
Sbjct  432   EMLEKLQDYEFAVCH  446



>ref|XP_009608757.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X9 [Nicotiana 
tomentosiformis]
Length=690

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/435 (79%), Positives = 390/435 (90%), Gaps = 0/435 (0%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+SIRQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACVMHGHRIGVSYYDASIRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL ALQR D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  72    SFLGALQRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  132   DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD+LN RLD 
Sbjct  192   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLDNLNRRLDT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS   TS DWAAFLKS+C+LLHI+KIF
Sbjct  252   ISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPSSISTSADWAAFLKSVCALLHISKIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+LK L+L I+++A  H+S DLA++CELVIGV DV+RSK+KGYETIVK+GF
Sbjct  312   EVGISGSLYEELKNLDLDIIERADFHISVDLAYVCELVIGVTDVDRSKEKGYETIVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FL EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  372   CDELDELRQIYEGLPEFLGEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  431

Query  419   EMQEKLPDFEFAVCH  375
             EM EKL D+EFAVCH
Sbjct  432   EMLEKLQDYEFAVCH  446



>ref|XP_004295833.1| PREDICTED: DNA mismatch repair protein MSH5-like [Fragaria vesca 
subsp. vesca]
Length=809

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/497 (70%), Positives = 403/497 (81%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI  GHR+GVSYYDSSIRQL+VME+WEDGS DFPL+DM+KYQ +P +IYTSTKSEE
Sbjct  14    VYMACIRQGHRVGVSYYDSSIRQLHVMELWEDGSMDFPLIDMVKYQAKPLIIYTSTKSEE  73

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             +FL+ALQR D  +EA  VKLVKSS+FSYEQAWHRLMYL+VTGMDD L+IKERI +LSSMM
Sbjct  74    AFLSALQRSDGITEAFAVKLVKSSVFSYEQAWHRLMYLRVTGMDDGLDIKERICYLSSMM  133

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVRASGGLLAILE+ERI+D  EQ E  N+SIA+D+V E+SLN FLK+D+AA EA
Sbjct  134   DMGSDVQVRASGGLLAILENERIVDTLEQMECGNSSIAIDAVIEVSLNNFLKLDAAAHEA  193

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGM+NKC TPMGRRLLRNWFLRPI+DL+ LN+RLDA
Sbjct  194   LQIFQTDKHPSHMGIGRAKEGFSVFGMLNKCATPMGRRLLRNWFLRPIIDLESLNSRLDA  253

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL +SLR TLKSVKD+P ILKKFNSPS  CTSTDW AFLKS+CSLLH+NKIF
Sbjct  254   ISFFISSGELVMSLRSTLKSVKDIPHILKKFNSPSSVCTSTDWTAFLKSVCSLLHVNKIF  313

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE L+E  KYLNL IV+KA   ++++LA++ ELVIGVLDV RSK+KGYETIVKD F
Sbjct  314   EVGVSESLQEHAKYLNLDIVEKAASCITTELAYVHELVIGVLDVTRSKEKGYETIVKDDF  373

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FLEEV+ +EL R P++     +PCIVYIHQIGYL+CIF EKLDE
Sbjct  374   CTELDELRQIYEELPEFLEEVAKMELGRHPQLCKYKLVPCIVYIHQIGYLMCIFEEKLDE  433

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E L DFEFA                              F D +G+TK+FFYRT KT
Sbjct  434   ATLETLQDFEFA------------------------------FSDAEGETKRFFYRTPKT  463

Query  239   RELDTLLGDIYHKILGM  189
             R+LD LLGDIYHKIL M
Sbjct  464   RDLDNLLGDIYHKILDM  480



>ref|XP_010244495.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X3 [Nelumbo 
nucifera]
Length=680

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/497 (69%), Positives = 407/497 (82%), Gaps = 31/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACIM G RIGVSYYDSSI+QLYV+E+WEDGS DFPL+D++KYQ +P +IYTSTK+EE
Sbjct  13    VYMACIMQGQRIGVSYYDSSIQQLYVLELWEDGSADFPLIDIVKYQAKPSIIYTSTKAEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR +   +   VKL+KSS+FSYEQAWHRL+YLQVTGMDD L+IKERI +L+SMM
Sbjct  73    SFLAALQRSEGI-QGPVVKLMKSSIFSYEQAWHRLVYLQVTGMDDGLSIKERICYLNSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI SDVQVRASG LLAILE+ER++D  EQ +  N+SI +D V+EISL+KFLK+DSAA EA
Sbjct  132   DIGSDVQVRASGALLAILENERLVDTLEQKDSGNSSITIDCVTEISLHKFLKLDSAAYEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGM+NKC+TPMGRRLLR+WFLRPILDL++LN+RL+ 
Sbjct  192   LQIFQIDKHPSHMGIGRAKEGFSVFGMLNKCITPMGRRLLRSWFLRPILDLENLNSRLNT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  +LRETLKSVKDVP ILKKFNSPS  CT+ DW AF KSICSLLH+N IF
Sbjct  252   ISFFLCSEELMATLRETLKSVKDVPYILKKFNSPSSICTNVDWTAFSKSICSLLHMNNIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE+LRE  KYLN+ IV+KAG  ++++LA++ ELV+GV+DVNR+K+KGY T+VK+GF
Sbjct  312   EVGVSENLREHAKYLNVDIVEKAGSCITTELAYVYELVMGVIDVNRTKEKGYATMVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELR+IYE LP+FLEEVSSLE+ARLP + G+   PCI+YIHQIGYL+CIF +KLDE
Sbjct  372   CDELDELRKIYEELPEFLEEVSSLEIARLPHLSGDKLAPCIIYIHQIGYLMCIFEDKLDE  431

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EKL DFEFA                              F D DG+ KKFFY TSKT
Sbjct  432   GTLEKLRDFEFA------------------------------FADGDGEVKKFFYHTSKT  461

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGD+YHKIL M
Sbjct  462   RELDNLLGDVYHKILDM  478



>ref|XP_007020780.1| MUTS [Theobroma cacao]
 gb|EOY12305.1| MUTS [Theobroma cacao]
Length=818

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/510 (69%), Positives = 407/510 (80%), Gaps = 43/510 (8%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HGHRIG+SYYDSSIRQL V+E+W+DGS DFP+++++KYQ +P VIYTSTK+EE
Sbjct  14    VYMACIQHGHRIGISYYDSSIRQLNVLEVWDDGSSDFPMIELVKYQAKPVVIYTSTKAEE  73

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQ  D  +EA TVKLVKSS+F+YEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  74    SFLSALQGSDGMTEAPTVKLVKSSIFTYEQAWHRLIYLRVTGMDDGLNIKERICYLSSMM  133

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVR SGGLLAILE+ERI+D  EQ E  NASI +DSV EISL+KFLK+D+AA EA
Sbjct  134   DMGSDVQVRVSGGLLAILENERIVDTLEQKECGNASITIDSVVEISLDKFLKLDAAAHEA  193

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ+DKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL++LN RL+A
Sbjct  194   LQIFQVDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLENLNNRLNA  253

Query  959   -------------ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFL  819
                          ISF L +EEL VSLRETLKSVKD+P ILKKFNSP+  CTS+DW AFL
Sbjct  254   VSFYSLIIWGMIKISFFLSSEELMVSLRETLKSVKDIPHILKKFNSPNSMCTSSDWMAFL  313

Query  818   KSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRS  639
             KS+CSLLH+NKIFEVGISE+LRE ++YLNL IV KA   +++DLAF+ ELVIGV+DVNRS
Sbjct  314   KSVCSLLHVNKIFEVGISENLREHMEYLNLDIVAKASSCITADLAFVYELVIGVIDVNRS  373

Query  638   KQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQI  459
             K KGY T+VK+GFC+ELDELR IYE LP+FLEEV+SLELA+LP +  E   P IVYIHQI
Sbjct  374   KDKGYGTMVKEGFCDELDELRHIYEELPEFLEEVASLELAQLPHLRKEEFAPRIVYIHQI  433

Query  458   GYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDED  279
             GYL+C F EK+DE  QEKL DFEFA                              F D  
Sbjct  434   GYLMCFFEEKIDEITQEKLQDFEFA------------------------------FSDSG  463

Query  278   GDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
             G TK+FFYRT KTRELD LLGDIYHKIL M
Sbjct  464   GITKRFFYRTPKTRELDDLLGDIYHKILDM  493



>ref|XP_006452401.1| hypothetical protein CICLE_v10010304mg [Citrus clementina]
 gb|ESR65641.1| hypothetical protein CICLE_v10010304mg [Citrus clementina]
Length=799

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/497 (70%), Positives = 407/497 (82%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HGHR+GVSYYDSSIRQL+V+E+WED + DFPL+D++KYQ QP +IYTSTKSEE
Sbjct  3     VYMACILHGHRVGVSYYDSSIRQLHVLEVWEDSNSDFPLIDIVKYQAQPQIIYTSTKSEE  62

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+AL+R D T+EA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD L+IKERI +L+SMM
Sbjct  63    SFLSALKRSDGTTEAPTVKLVKSSIFSYEQAWHRLIYLRVTGMDDGLSIKERICYLNSMM  122

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVRASGGLLA+LE+ERI+D  EQ E  NASI +DSV E+SLNKFLK+D+ A EA
Sbjct  123   DMGSEVQVRASGGLLAVLENERIVDTLEQKESGNASITIDSVIEVSLNKFLKLDATAHEA  182

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL++LN+RL+A
Sbjct  183   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLENLNSRLNA  242

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SL ETLK VKD+P ILKKFNSPS   T++DW AFLKSICSLLH+NKIF
Sbjct  243   ISFFLCSEELMASLHETLKYVKDIPHILKKFNSPSFIYTASDWTAFLKSICSLLHVNKIF  302

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE LREQL+ LN  IV+KA   ++++LA++ ELVIG++DVNRSK+KGY T+VK+GF
Sbjct  303   EVGISESLREQLRLLNFDIVEKAASCITTELAYVYELVIGIIDVNRSKEKGYGTLVKEGF  362

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEV+SLEL +LP +  E  +PCIVYIHQIGYL+CIF EKLD+
Sbjct  363   CDELDELRQIYEELPEFLEEVASLELVQLPHLCKEMFVPCIVYIHQIGYLMCIFEEKLDD  422

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E+L  FEFA                              F D DG+TK+ FY T KT
Sbjct  423   TTLEQLQGFEFA------------------------------FSDMDGETKRLFYHTPKT  452

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  453   RELDNLLGDIYHKILDM  469



>ref|XP_009608750.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Nicotiana 
tomentosiformis]
Length=839

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/435 (79%), Positives = 390/435 (90%), Gaps = 0/435 (0%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+SIRQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACVMHGHRIGVSYYDASIRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL ALQR D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  72    SFLGALQRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  132   DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD+LN RLD 
Sbjct  192   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLDNLNRRLDT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS   TS DWAAFLKS+C+LLHI+KIF
Sbjct  252   ISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPSSISTSADWAAFLKSVCALLHISKIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+LK L+L I+++A  H+S DLA++CELVIGV DV+RSK+KGYETIVK+GF
Sbjct  312   EVGISGSLYEELKNLDLDIIERADFHISVDLAYVCELVIGVTDVDRSKEKGYETIVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FL EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  372   CDELDELRQIYEGLPEFLGEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  431

Query  419   EMQEKLPDFEFAVCH  375
             EM EKL D+EFAVCH
Sbjct  432   EMLEKLQDYEFAVCH  446



>gb|KDO62059.1| hypothetical protein CISIN_1g043119mg [Citrus sinensis]
Length=792

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/497 (69%), Positives = 407/497 (82%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HGHR+GVSYYDSSIRQL+V+E+WED + DFPL+D++KYQ QP +IYTSTKSEE
Sbjct  3     VYMACILHGHRVGVSYYDSSIRQLHVLEVWEDSNSDFPLIDIVKYQAQPQIIYTSTKSEE  62

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+AL+R D T+EA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD L+IKERI +L+SMM
Sbjct  63    SFLSALKRSDGTTEAPTVKLVKSSIFSYEQAWHRLIYLRVTGMDDGLSIKERICYLNSMM  122

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVRASGGLLA+LE+ERI+D  EQ E  NASI +DSV E+SLNKFLK+D+ A EA
Sbjct  123   DMGSEVQVRASGGLLAVLENERIVDTLEQKESGNASITIDSVIEVSLNKFLKLDATAHEA  182

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL++LN+RL+A
Sbjct  183   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLENLNSRLNA  242

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SL ETLK VKD+P ILKKFNSPS   T++DW AFLKSICSLLH+NKIF
Sbjct  243   ISFFLCSEELMASLHETLKYVKDIPHILKKFNSPSFIYTASDWTAFLKSICSLLHVNKIF  302

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE LREQL+ LN  IV+KA   ++++LA++ ELVIG++DVNRSK+KGY T+V++GF
Sbjct  303   EVGISESLREQLRLLNFDIVEKAASCITTELAYVYELVIGIIDVNRSKEKGYGTLVREGF  362

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEV+SLEL +LP +  E  +PCIVYIHQIGYL+CIF EKLD+
Sbjct  363   CDELDELRQIYEELPEFLEEVASLELVQLPHLCKEMFVPCIVYIHQIGYLMCIFEEKLDD  422

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E+L  FEFA                              F D DG+TK+ FY T KT
Sbjct  423   TTLEQLQGFEFA------------------------------FSDMDGETKRLFYHTPKT  452

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  453   RELDNLLGDIYHKILDM  469



>ref|XP_006475043.1| PREDICTED: DNA mismatch repair protein MSH5-like [Citrus sinensis]
Length=811

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/497 (70%), Positives = 407/497 (82%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HGHR+GVSYYDSSIRQL+V+E+WED + DFPL+D++KYQ QP +IYTSTKSEE
Sbjct  15    VYMACILHGHRVGVSYYDSSIRQLHVLEVWEDSNSDFPLIDIVKYQAQPQIIYTSTKSEE  74

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+AL+R D T+EA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD L+IKERI +L+SMM
Sbjct  75    SFLSALKRSDGTTEAPTVKLVKSSIFSYEQAWHRLIYLRVTGMDDGLSIKERICYLNSMM  134

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVRASGGLLA+LE+ERI+D  EQ E  NASI +DSV E+SLNKFLK+D+ A EA
Sbjct  135   DMGSEVQVRASGGLLAVLENERIVDTLEQKESGNASITIDSVIEVSLNKFLKLDATAHEA  194

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL++LN+RL+A
Sbjct  195   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLENLNSRLNA  254

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SL ETLK VKD+P ILKKFNSPS   T++DW AFLKSICSLLH+NKIF
Sbjct  255   ISFFLCSEELMASLHETLKYVKDIPHILKKFNSPSFIYTASDWTAFLKSICSLLHVNKIF  314

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE LREQL+ LN  IV+KA   ++++LA++ ELVIG++DVNRSK+KGY T+VK+GF
Sbjct  315   EVGISESLREQLRLLNFDIVEKAASCITTELAYVYELVIGIIDVNRSKEKGYGTLVKEGF  374

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEV+SLEL +LP +  E  +PCIVYIHQIGYL+CIF EKLD+
Sbjct  375   CDELDELRQIYEELPEFLEEVASLELVQLPHLCKEMFVPCIVYIHQIGYLMCIFEEKLDD  434

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E+L  FEFA                              F D DG+TK+ FY T KT
Sbjct  435   TTLEQLQGFEFA------------------------------FSDMDGETKRLFYHTPKT  464

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  465   RELDNLLGDIYHKILDM  481



>ref|XP_009608749.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Nicotiana 
tomentosiformis]
Length=847

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/435 (79%), Positives = 390/435 (90%), Gaps = 0/435 (0%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+SIRQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACVMHGHRIGVSYYDASIRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL ALQR D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  72    SFLGALQRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  132   DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD+LN RLD 
Sbjct  192   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLDNLNRRLDT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS   TS DWAAFLKS+C+LLHI+KIF
Sbjct  252   ISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPSSISTSADWAAFLKSVCALLHISKIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+LK L+L I+++A  H+S DLA++CELVIGV DV+RSK+KGYETIVK+GF
Sbjct  312   EVGISGSLYEELKNLDLDIIERADFHISVDLAYVCELVIGVTDVDRSKEKGYETIVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FL EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  372   CDELDELRQIYEGLPEFLGEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  431

Query  419   EMQEKLPDFEFAVCH  375
             EM EKL D+EFAVCH
Sbjct  432   EMLEKLQDYEFAVCH  446



>ref|XP_010244494.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Nelumbo 
nucifera]
Length=790

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/497 (69%), Positives = 407/497 (82%), Gaps = 31/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACIM G RIGVSYYDSSI+QLYV+E+WEDGS DFPL+D++KYQ +P +IYTSTK+EE
Sbjct  13    VYMACIMQGQRIGVSYYDSSIQQLYVLELWEDGSADFPLIDIVKYQAKPSIIYTSTKAEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR +   +   VKL+KSS+FSYEQAWHRL+YLQVTGMDD L+IKERI +L+SMM
Sbjct  73    SFLAALQRSEGI-QGPVVKLMKSSIFSYEQAWHRLVYLQVTGMDDGLSIKERICYLNSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI SDVQVRASG LLAILE+ER++D  EQ +  N+SI +D V+EISL+KFLK+DSAA EA
Sbjct  132   DIGSDVQVRASGALLAILENERLVDTLEQKDSGNSSITIDCVTEISLHKFLKLDSAAYEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGM+NKC+TPMGRRLLR+WFLRPILDL++LN+RL+ 
Sbjct  192   LQIFQIDKHPSHMGIGRAKEGFSVFGMLNKCITPMGRRLLRSWFLRPILDLENLNSRLNT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  +LRETLKSVKDVP ILKKFNSPS  CT+ DW AF KSICSLLH+N IF
Sbjct  252   ISFFLCSEELMATLRETLKSVKDVPYILKKFNSPSSICTNVDWTAFSKSICSLLHMNNIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE+LRE  KYLN+ IV+KAG  ++++LA++ ELV+GV+DVNR+K+KGY T+VK+GF
Sbjct  312   EVGVSENLREHAKYLNVDIVEKAGSCITTELAYVYELVMGVIDVNRTKEKGYATMVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELR+IYE LP+FLEEVSSLE+ARLP + G+   PCI+YIHQIGYL+CIF +KLDE
Sbjct  372   CDELDELRKIYEELPEFLEEVSSLEIARLPHLSGDKLAPCIIYIHQIGYLMCIFEDKLDE  431

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EKL DFEFA                              F D DG+ KKFFY TSKT
Sbjct  432   GTLEKLRDFEFA------------------------------FADGDGEVKKFFYHTSKT  461

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGD+YHKIL M
Sbjct  462   RELDNLLGDVYHKILDM  478



>ref|XP_010244492.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Nelumbo 
nucifera]
Length=808

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/497 (69%), Positives = 407/497 (82%), Gaps = 31/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACIM G RIGVSYYDSSI+QLYV+E+WEDGS DFPL+D++KYQ +P +IYTSTK+EE
Sbjct  13    VYMACIMQGQRIGVSYYDSSIQQLYVLELWEDGSADFPLIDIVKYQAKPSIIYTSTKAEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR +   +   VKL+KSS+FSYEQAWHRL+YLQVTGMDD L+IKERI +L+SMM
Sbjct  73    SFLAALQRSEGI-QGPVVKLMKSSIFSYEQAWHRLVYLQVTGMDDGLSIKERICYLNSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI SDVQVRASG LLAILE+ER++D  EQ +  N+SI +D V+EISL+KFLK+DSAA EA
Sbjct  132   DIGSDVQVRASGALLAILENERLVDTLEQKDSGNSSITIDCVTEISLHKFLKLDSAAYEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGM+NKC+TPMGRRLLR+WFLRPILDL++LN+RL+ 
Sbjct  192   LQIFQIDKHPSHMGIGRAKEGFSVFGMLNKCITPMGRRLLRSWFLRPILDLENLNSRLNT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  +LRETLKSVKDVP ILKKFNSPS  CT+ DW AF KSICSLLH+N IF
Sbjct  252   ISFFLCSEELMATLRETLKSVKDVPYILKKFNSPSSICTNVDWTAFSKSICSLLHMNNIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE+LRE  KYLN+ IV+KAG  ++++LA++ ELV+GV+DVNR+K+KGY T+VK+GF
Sbjct  312   EVGVSENLREHAKYLNVDIVEKAGSCITTELAYVYELVMGVIDVNRTKEKGYATMVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELR+IYE LP+FLEEVSSLE+ARLP + G+   PCI+YIHQIGYL+CIF +KLDE
Sbjct  372   CDELDELRKIYEELPEFLEEVSSLEIARLPHLSGDKLAPCIIYIHQIGYLMCIFEDKLDE  431

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EKL DFEFA                              F D DG+ KKFFY TSKT
Sbjct  432   GTLEKLRDFEFA------------------------------FADGDGEVKKFFYHTSKT  461

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGD+YHKIL M
Sbjct  462   RELDNLLGDVYHKILDM  478



>ref|XP_008449117.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Cucumis 
melo]
Length=807

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/497 (69%), Positives = 404/497 (81%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +YMAC+ HG ++GVSYYDSSIRQL+V+E+WEDGS ++PL+D++KYQ +P +IYTSTKSEE
Sbjct  13    IYMACVKHGQKVGVSYYDSSIRQLHVLEVWEDGSMEYPLIDLVKYQAKPLMIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR D  S+A TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFLAALQRSDGMSDAPTVKLVKSSIFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SD+QVRASGGLLAILE+ERI+D  EQ E   +SI +DSV EISLN FLK+D+ ALEA
Sbjct  133   DVESDIQVRASGGLLAILENERIVDTLEQKELGTSSITIDSVIEISLNNFLKLDATALEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRP+LDL++LN RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPLLDLENLNKRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + ++EL  SLRETLK VKD+P ILKKFNSPS T +S DW AFLKSICSLLH+NKIF
Sbjct  253   ISFFISSDELVHSLRETLKIVKDIPHILKKFNSPSSTYSSGDWTAFLKSICSLLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE+L+E +KY NL IV+KA   ++++LA++ ELVIGVLDV+RSK+K YETIVK+GF
Sbjct  313   EVGMSENLKENMKYFNLDIVEKANTCITTELAYVYELVIGVLDVSRSKEKSYETIVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELR++YE LP+FLEEVSS+ELA+ P++  +   PCIVYIHQIGYLLCIF EKLDE
Sbjct  373   CEELDELREVYEELPEFLEEVSSMELAQFPQLCKDTIAPCIVYIHQIGYLLCIFEEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E L DFEFA                              F D DGD K+FFY + KT
Sbjct  433   STLEILRDFEFA------------------------------FSDVDGDIKRFFYHSPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_006595730.1| PREDICTED: DNA mismatch repair protein MSH5-like isoform X3 [Glycine 
max]
Length=782

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/497 (68%), Positives = 407/497 (82%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI++G+RIGVSYYDS++RQLYV+E+W+DG K FP++D++KYQ  P VIYTSTKSEE
Sbjct  13    VYMACILNGNRIGVSYYDSTLRQLYVLEVWDDGDKGFPVIDLVKYQANPLVIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQ+ D  +E+  VKLVKSS+FSYEQAWHRL+YL+V GMDD LN+KERI +LSSMM
Sbjct  73    SFLSALQQRDGAAESPIVKLVKSSIFSYEQAWHRLVYLRVAGMDDGLNVKERIYYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             ++ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI +DS++EISLN FLK+D+AA EA
Sbjct  133   NMGSEVQVRASGGLLAILENERIVDTLEQKESGNTSITIDSLAEISLNNFLKLDTAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL+ LN RL++
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLEVLNYRLNS  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SLRETLKSVKD+P +LKKF+SPS  CTS DW A LKSIC++LH+NKIF
Sbjct  253   ISFFLCSEELVTSLRETLKSVKDIPLLLKKFDSPSSICTSFDWTALLKSICAMLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE LRE+LKYLNL IV+KA  H++++L ++ ELVIGV+DVNR+K+KGY T+VK+GF
Sbjct  313   EVGISEGLREELKYLNLDIVEKASSHITAELGYVYELVIGVIDVNRTKEKGYATVVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVSSLELA+LP +  +  +PCIVYI QIGYL+CIF EK +E
Sbjct  373   CDELDELRQIYEELPEFLEEVSSLELAQLPVLCKDKRIPCIVYIQQIGYLMCIFGEKPEE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E+L D+E+  C                              D DG+TKK+FYRT KT
Sbjct  433   TTLEQLVDWEYTFC------------------------------DTDGETKKYFYRTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD+LLGDI+HKIL M
Sbjct  463   RELDSLLGDIHHKILDM  479



>ref|XP_006595728.1| PREDICTED: DNA mismatch repair protein MSH5-like isoform X1 [Glycine 
max]
Length=812

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/497 (68%), Positives = 407/497 (82%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI++G+RIGVSYYDS++RQLYV+E+W+DG K FP++D++KYQ  P VIYTSTKSEE
Sbjct  13    VYMACILNGNRIGVSYYDSTLRQLYVLEVWDDGDKGFPVIDLVKYQANPLVIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQ+ D  +E+  VKLVKSS+FSYEQAWHRL+YL+V GMDD LN+KERI +LSSMM
Sbjct  73    SFLSALQQRDGAAESPIVKLVKSSIFSYEQAWHRLVYLRVAGMDDGLNVKERIYYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             ++ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI +DS++EISLN FLK+D+AA EA
Sbjct  133   NMGSEVQVRASGGLLAILENERIVDTLEQKESGNTSITIDSLAEISLNNFLKLDTAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL+ LN RL++
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLEVLNYRLNS  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SLRETLKSVKD+P +LKKF+SPS  CTS DW A LKSIC++LH+NKIF
Sbjct  253   ISFFLCSEELVTSLRETLKSVKDIPLLLKKFDSPSSICTSFDWTALLKSICAMLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE LRE+LKYLNL IV+KA  H++++L ++ ELVIGV+DVNR+K+KGY T+VK+GF
Sbjct  313   EVGISEGLREELKYLNLDIVEKASSHITAELGYVYELVIGVIDVNRTKEKGYATVVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVSSLELA+LP +  +  +PCIVYI QIGYL+CIF EK +E
Sbjct  373   CDELDELRQIYEELPEFLEEVSSLELAQLPVLCKDKRIPCIVYIQQIGYLMCIFGEKPEE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E+L D+E+  C                              D DG+TKK+FYRT KT
Sbjct  433   TTLEQLVDWEYTFC------------------------------DTDGETKKYFYRTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD+LLGDI+HKIL M
Sbjct  463   RELDSLLGDIHHKILDM  479



>ref|XP_011012093.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Populus 
euphratica]
Length=807

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/497 (69%), Positives = 406/497 (82%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC +HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P  IY STKSEE
Sbjct  13    VYMACFLHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLTIYASTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQR D T+EA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKER+S+LSSMM
Sbjct  73    SFLSALQRSDGTTEAPTVKLVKSSIFSYEQAWHRLIYLRVTGMDDGLNIKERVSYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI SDVQVRASGGLLAILE ERI+D  EQ E+ +ASI +DSV EISLNKFLK+D+AA EA
Sbjct  133   DIGSDVQVRASGGLLAILESERIVDTLEQKEYGSASITIDSVVEISLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIG AKEGFSVFGMMNKC+TP+G+RLLRNWFLRP+LD+++LN RL+A
Sbjct  193   LQIFQIDKHPSHMGIGGAKEGFSVFGMMNKCMTPIGKRLLRNWFLRPLLDVENLNGRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL VSLRETLKSVKD+  IL+KF+SPS   T  DWAAFLKS+C+LLH+ KIF
Sbjct  253   ISFFLCSEELMVSLRETLKSVKDIKHILRKFDSPSSLSTVGDWAAFLKSVCALLHLGKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE+L+E  KYLNL IV++A   ++++LA++ ELVIGV+DVNRSK+KGY TIVK+GF
Sbjct  313   EVGISENLQEHAKYLNLNIVEQACSCITTELAYVYELVIGVIDVNRSKEKGYGTIVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LPDFL +V+ LELA+LP +  E  +PCIVYIHQIGYLLCIF EKL+E
Sbjct  373   CDELDELRQIYEELPDFLHKVTLLELAQLPHLGKEKLVPCIVYIHQIGYLLCIFEEKLEE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                 K  DFEF                               F D DG+TK++FYRT KT
Sbjct  433   TSLLKPQDFEFM------------------------------FSDVDGETKRYFYRTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDELLGDIYHKILDM  479



>ref|XP_004149586.1| PREDICTED: DNA mismatch repair protein MSH5-like [Cucumis sativus]
 ref|XP_004166971.1| PREDICTED: DNA mismatch repair protein MSH5-like [Cucumis sativus]
Length=807

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/497 (69%), Positives = 402/497 (81%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +YMAC+ HG ++GVSYYDSSIRQL+V+E+WEDGS ++PL+D++KYQ +P +IYTSTKSEE
Sbjct  13    IYMACVKHGQKVGVSYYDSSIRQLHVLEVWEDGSIEYPLIDLVKYQAKPLMIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR D  SEA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFLAALQRSDGMSEAPTVKLVKSSIFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVRASGGLLAILE ERI+D  EQ E   +SI +DSV EISLN FLK+D+ ALEA
Sbjct  133   DVESEVQVRASGGLLAILESERIVDTLEQKELGTSSITIDSVIEISLNNFLKLDATALEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRP+LDL++LN RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPLLDLENLNKRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + ++EL  SLRETLK VKD+P ILKKFNSPS T +S DW AFLKSICSLLH+NKIF
Sbjct  253   ISFFISSDELMHSLRETLKIVKDIPHILKKFNSPSSTYSSGDWTAFLKSICSLLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE+L+E +KY NL IV+KA   ++++LA++ ELVIGVLDV+RSK+K YETIVK+GF
Sbjct  313   EVGMSENLKENMKYFNLDIVEKANTCITTELAYVYELVIGVLDVSRSKEKSYETIVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELR++YE LP+FLEEVSS+ELA+ P++      PCIVYIHQIGYLLCIF EKLDE
Sbjct  373   CEELDELREVYEELPEFLEEVSSMELAQFPQLCKYTIAPCIVYIHQIGYLLCIFEEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E L DFEFA                              F D DGD K+FFY + KT
Sbjct  433   STLEILQDFEFA------------------------------FSDVDGDIKRFFYHSPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_007142299.1| hypothetical protein PHAVU_008G268900g [Phaseolus vulgaris]
 gb|ESW14293.1| hypothetical protein PHAVU_008G268900g [Phaseolus vulgaris]
Length=800

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/497 (68%), Positives = 405/497 (81%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI++GHRIGVSYYDS++RQLYV+E+W+DG K FP++D++KYQ  P VIYTSTKSEE
Sbjct  13    VYMACILNGHRIGVSYYDSTLRQLYVLEVWDDGDKGFPIIDLVKYQANPLVIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ LQ+ D  +E+ TVKLVKSS+FSYEQAWHRL+YL+V GMDD LN+KERI +LSSMM
Sbjct  73    SFLSDLQQKDGVAESPTVKLVKSSIFSYEQAWHRLIYLRVAGMDDGLNVKERIYYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI++ SV+EISLN FLK+D+AA EA
Sbjct  133   DMGSEVQVRASGGLLAILENERIVDTLEQKESGNTSISIHSVAEISLNNFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL+ LN RL+ 
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLEVLNYRLNC  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SLRETLKSVKD+P +LKKF+SPS TC S+DW A LKSIC+LLH+NKIF
Sbjct  253   ISFFLRSEELVASLRETLKSVKDIPHLLKKFDSPSFTCASSDWTALLKSICALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE LRE+LKYLNL IV+KA   ++++L ++ ELVIGV+D+NR+K+KGY T+VK+GF
Sbjct  313   EVGISEGLREELKYLNLDIVEKASSCITAELGYVYELVIGVIDLNRTKEKGYATVVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE +P+FLEEVSSLELA LP +  +  +PCIVYI QIGYL+CIF EK +E
Sbjct  373   CDELDELRQIYEEMPEFLEEVSSLELAELPVLCKDKRVPCIVYIQQIGYLMCIFEEKPEE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E L D+E+A C                              D DG+TK++FYRT KT
Sbjct  433   TTLETLVDWEYAFC------------------------------DTDGETKRYFYRTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD+LLGDI+HKIL M
Sbjct  463   RELDSLLGDIHHKILDM  479



>ref|XP_007142300.1| hypothetical protein PHAVU_008G268900g [Phaseolus vulgaris]
 gb|ESW14294.1| hypothetical protein PHAVU_008G268900g [Phaseolus vulgaris]
Length=808

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/497 (68%), Positives = 405/497 (81%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI++GHRIGVSYYDS++RQLYV+E+W+DG K FP++D++KYQ  P VIYTSTKSEE
Sbjct  13    VYMACILNGHRIGVSYYDSTLRQLYVLEVWDDGDKGFPIIDLVKYQANPLVIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ LQ+ D  +E+ TVKLVKSS+FSYEQAWHRL+YL+V GMDD LN+KERI +LSSMM
Sbjct  73    SFLSDLQQKDGVAESPTVKLVKSSIFSYEQAWHRLIYLRVAGMDDGLNVKERIYYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI++ SV+EISLN FLK+D+AA EA
Sbjct  133   DMGSEVQVRASGGLLAILENERIVDTLEQKESGNTSISIHSVAEISLNNFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL+ LN RL+ 
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLEVLNYRLNC  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SLRETLKSVKD+P +LKKF+SPS TC S+DW A LKSIC+LLH+NKIF
Sbjct  253   ISFFLRSEELVASLRETLKSVKDIPHLLKKFDSPSFTCASSDWTALLKSICALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE LRE+LKYLNL IV+KA   ++++L ++ ELVIGV+D+NR+K+KGY T+VK+GF
Sbjct  313   EVGISEGLREELKYLNLDIVEKASSCITAELGYVYELVIGVIDLNRTKEKGYATVVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE +P+FLEEVSSLELA LP +  +  +PCIVYI QIGYL+CIF EK +E
Sbjct  373   CDELDELRQIYEEMPEFLEEVSSLELAELPVLCKDKRVPCIVYIQQIGYLMCIFEEKPEE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E L D+E+A C                              D DG+TK++FYRT KT
Sbjct  433   TTLETLVDWEYAFC------------------------------DTDGETKRYFYRTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD+LLGDI+HKIL M
Sbjct  463   RELDSLLGDIHHKILDM  479



>ref|XP_003617575.1| DNA mismatch repair protein mutS [Medicago truncatula]
Length=488

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/497 (68%), Positives = 400/497 (80%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI +GHRIGVSYYDSS+RQL V+E W+DG   F ++D++KYQ  P VIYTSTKSEE
Sbjct  15    VYMACIQNGHRIGVSYYDSSLRQLNVLEAWDDGDNGFSVIDLVKYQANPLVIYTSTKSEE  74

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQ+ D  +EA TVKLVKSS+FSYEQAWHRL+YL+V GMDD L++KERI FLSSMM
Sbjct  75    SFLAALQQSDEVAEAPTVKLVKSSIFSYEQAWHRLIYLRVAGMDDGLDVKERIYFLSSMM  134

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI +DS++EISLN F+K+D+A+ EA
Sbjct  135   DMGSEVQVRASGGLLAILENERIVDTLEQKESGNTSITIDSLAEISLNNFIKLDAASHEA  194

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR WFLRPILDL+ LN RL++
Sbjct  195   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRQWFLRPILDLEVLNYRLNS  254

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF   +EEL  SLRETLKSVKD+P +LKKF+SPS  CTSTDWAA LKSI +LLH+NKIF
Sbjct  255   ISFFHSSEELVASLRETLKSVKDIPHLLKKFDSPSSICTSTDWAALLKSISALLHVNKIF  314

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L+E+LKYLNL IV+ A   ++++LA++ EL+IGV+DVNR+K+KGY T+VK+GF
Sbjct  315   EVGISEGLQEELKYLNLDIVEMASSCITTELAYVYELIIGVIDVNRTKEKGYPTVVKEGF  374

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVSSLELA+LP +     +PCIVYI QIGYL+CIF EKL+E
Sbjct  375   CDELDELRQIYEELPEFLEEVSSLELAQLPDLCKNKLVPCIVYIQQIGYLMCIFEEKLEE  434

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EKL ++E+                               F D DG+TK++FYR  KT
Sbjct  435   ATLEKLIEWEYT------------------------------FGDADGETKRYFYRMPKT  464

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKILG+
Sbjct  465   RELDNLLGDIYHKILGV  481



>ref|XP_011012094.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X3 [Populus 
euphratica]
Length=806

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/497 (69%), Positives = 406/497 (82%), Gaps = 31/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC +HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P  IY STKSEE
Sbjct  13    VYMACFLHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLTIYASTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQR + T+EA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKER+S+LSSMM
Sbjct  73    SFLSALQR-NGTTEAPTVKLVKSSIFSYEQAWHRLIYLRVTGMDDGLNIKERVSYLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI SDVQVRASGGLLAILE ERI+D  EQ E+ +ASI +DSV EISLNKFLK+D+AA EA
Sbjct  132   DIGSDVQVRASGGLLAILESERIVDTLEQKEYGSASITIDSVVEISLNKFLKLDAAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIG AKEGFSVFGMMNKC+TP+G+RLLRNWFLRP+LD+++LN RL+A
Sbjct  192   LQIFQIDKHPSHMGIGGAKEGFSVFGMMNKCMTPIGKRLLRNWFLRPLLDVENLNGRLNA  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL VSLRETLKSVKD+  IL+KF+SPS   T  DWAAFLKS+C+LLH+ KIF
Sbjct  252   ISFFLCSEELMVSLRETLKSVKDIKHILRKFDSPSSLSTVGDWAAFLKSVCALLHLGKIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE+L+E  KYLNL IV++A   ++++LA++ ELVIGV+DVNRSK+KGY TIVK+GF
Sbjct  312   EVGISENLQEHAKYLNLNIVEQACSCITTELAYVYELVIGVIDVNRSKEKGYGTIVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LPDFL +V+ LELA+LP +  E  +PCIVYIHQIGYLLCIF EKL+E
Sbjct  372   CDELDELRQIYEELPDFLHKVTLLELAQLPHLGKEKLVPCIVYIHQIGYLLCIFEEKLEE  431

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                 K  DFEF                               F D DG+TK++FYRT KT
Sbjct  432   TSLLKPQDFEFM------------------------------FSDVDGETKRYFYRTPKT  461

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  462   RELDELLGDIYHKILDM  478



>ref|XP_011012101.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X8 [Populus 
euphratica]
Length=646

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/522 (66%), Positives = 406/522 (78%), Gaps = 55/522 (11%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC +HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P  IY STKSEE
Sbjct  13    VYMACFLHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLTIYASTKSEE  72

Query  1499  SFLAALQR-------------------------CDNTSEAATVKLVKSSLFSYEQAWHRL  1395
             SFL+ALQR                          D T+EA TVKLVKSS+FSYEQAWHRL
Sbjct  73    SFLSALQRSGTLLFTCLTYELIYMWNVFKLQSDTDGTTEAPTVKLVKSSIFSYEQAWHRL  132

Query  1394  MYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENA  1215
             +YL+VTGMDD LNIKER+S+LSSMMDI SDVQVRASGGLLAILE ERI+D  EQ E+ +A
Sbjct  133   IYLRVTGMDDGLNIKERVSYLSSMMDIGSDVQVRASGGLLAILESERIVDTLEQKEYGSA  192

Query  1214  SIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPM  1035
             SI +DSV EISLNKFLK+D+AA EALQIFQIDKHPSHMGIG AKEGFSVFGMMNKC+TP+
Sbjct  193   SITIDSVVEISLNKFLKLDAAAHEALQIFQIDKHPSHMGIGGAKEGFSVFGMMNKCMTPI  252

Query  1034  GRRLLRNWFLRPIldlddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPS  855
             G+RLLRNWFLRP+LD+++LN RL+AISF L +EEL VSLRETLKSVKD+  IL+KF+SPS
Sbjct  253   GKRLLRNWFLRPLLDVENLNGRLNAISFFLCSEELMVSLRETLKSVKDIKHILRKFDSPS  312

Query  854   CTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFIC  675
                T  DWAAFLKS+C+LLH+ KIFEVGISE+L+E  KYLNL IV++A   ++++LA++ 
Sbjct  313   SLSTVGDWAAFLKSVCALLHLGKIFEVGISENLQEHAKYLNLNIVEQACSCITTELAYVY  372

Query  674   ELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGE  495
             ELVIGV+DVNRSK+KGY TIVK+GFC+ELDELRQIYE LPDFL +V+ LELA+LP +  E
Sbjct  373   ELVIGVIDVNRSKEKGYGTIVKEGFCDELDELRQIYEELPDFLHKVTLLELAQLPHLGKE  432

Query  494   NGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQ  315
               +PCIVYIHQIGYLLCIF EKL+E    K  DFEF                        
Sbjct  433   KLVPCIVYIHQIGYLLCIFEEKLEETSLLKPQDFEFM-----------------------  469

Query  314   CCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                    F D DG+TK++FYRT KTRELD LLGDIYHKIL M
Sbjct  470   -------FSDVDGETKRYFYRTPKTRELDELLGDIYHKILDM  504



>ref|XP_011012097.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X6 [Populus 
euphratica]
Length=728

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/522 (66%), Positives = 406/522 (78%), Gaps = 55/522 (11%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC +HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P  IY STKSEE
Sbjct  13    VYMACFLHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLTIYASTKSEE  72

Query  1499  SFLAALQR-------------------------CDNTSEAATVKLVKSSLFSYEQAWHRL  1395
             SFL+ALQR                          D T+EA TVKLVKSS+FSYEQAWHRL
Sbjct  73    SFLSALQRSGTLLFTCLTYELIYMWNVFKLQSDTDGTTEAPTVKLVKSSIFSYEQAWHRL  132

Query  1394  MYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENA  1215
             +YL+VTGMDD LNIKER+S+LSSMMDI SDVQVRASGGLLAILE ERI+D  EQ E+ +A
Sbjct  133   IYLRVTGMDDGLNIKERVSYLSSMMDIGSDVQVRASGGLLAILESERIVDTLEQKEYGSA  192

Query  1214  SIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPM  1035
             SI +DSV EISLNKFLK+D+AA EALQIFQIDKHPSHMGIG AKEGFSVFGMMNKC+TP+
Sbjct  193   SITIDSVVEISLNKFLKLDAAAHEALQIFQIDKHPSHMGIGGAKEGFSVFGMMNKCMTPI  252

Query  1034  GRRLLRNWFLRPIldlddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPS  855
             G+RLLRNWFLRP+LD+++LN RL+AISF L +EEL VSLRETLKSVKD+  IL+KF+SPS
Sbjct  253   GKRLLRNWFLRPLLDVENLNGRLNAISFFLCSEELMVSLRETLKSVKDIKHILRKFDSPS  312

Query  854   CTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFIC  675
                T  DWAAFLKS+C+LLH+ KIFEVGISE+L+E  KYLNL IV++A   ++++LA++ 
Sbjct  313   SLSTVGDWAAFLKSVCALLHLGKIFEVGISENLQEHAKYLNLNIVEQACSCITTELAYVY  372

Query  674   ELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGE  495
             ELVIGV+DVNRSK+KGY TIVK+GFC+ELDELRQIYE LPDFL +V+ LELA+LP +  E
Sbjct  373   ELVIGVIDVNRSKEKGYGTIVKEGFCDELDELRQIYEELPDFLHKVTLLELAQLPHLGKE  432

Query  494   NGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQ  315
               +PCIVYIHQIGYLLCIF EKL+E    K  DFEF                        
Sbjct  433   KLVPCIVYIHQIGYLLCIFEEKLEETSLLKPQDFEFM-----------------------  469

Query  314   CCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                    F D DG+TK++FYRT KTRELD LLGDIYHKIL M
Sbjct  470   -------FSDVDGETKRYFYRTPKTRELDELLGDIYHKILDM  504



>ref|XP_004491410.1| PREDICTED: DNA mismatch repair protein MSH5-like [Cicer arietinum]
Length=809

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/497 (68%), Positives = 402/497 (81%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI  GHRIGVSYYDSS+RQLYV+E W+DG K FP++D++KYQ  P VIYTST+ EE
Sbjct  14    VYMACIQCGHRIGVSYYDSSLRQLYVLEAWDDGDKGFPVIDLVKYQANPLVIYTSTRCEE  73

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQ+ D  +EA TVKLVKSS+FSYEQAWHRL+YL+V GMDD L++KERI FLSSMM
Sbjct  74    SFLAALQQSDEVAEAPTVKLVKSSIFSYEQAWHRLIYLRVAGMDDGLDVKERIYFLSSMM  133

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVRASGGLLAILE+ER++D  EQ E  N SI +DS++EISLN F+K+D+AA EA
Sbjct  134   DMGSEVQVRASGGLLAILENERVVDTLEQKESGNTSIMIDSLAEISLNSFIKLDAAAHEA  193

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR+WFLRPILDLD LN RL++
Sbjct  194   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRHWFLRPILDLDVLNYRLNS  253

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF   +EEL  SLRETLKSVKD+P +LKKF+SPS  CTSTDW A LKSI +LLHINKIF
Sbjct  254   ISFFQCSEELVASLRETLKSVKDIPYLLKKFDSPSSICTSTDWTALLKSISALLHINKIF  313

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L+E++K+LNL IV+ A   ++++LA++ EL+IGV+DVNR+K+KGY T+VK+GF
Sbjct  314   EVGISEGLQEEMKHLNLDIVEMANSCITTELAYVYELIIGVIDVNRTKEKGYTTVVKEGF  373

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVSSLEL +LP +  +  +PCIVYI QIGYL+C+F EKL+E
Sbjct  374   CDELDELRQIYEELPEFLEEVSSLELVQLPVLCKDKLVPCIVYIQQIGYLMCLFEEKLEE  433

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EKL D+E+  C                              D DG+TK++FYRT KT
Sbjct  434   ATLEKLTDWEYTFC------------------------------DADGETKRYFYRTPKT  463

Query  239   RELDTLLGDIYHKILGM  189
             RELD+LLGDIYHKIL M
Sbjct  464   RELDSLLGDIYHKILDM  480



>ref|XP_008449115.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Cucumis 
melo]
Length=824

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/489 (69%), Positives = 397/489 (81%), Gaps = 30/489 (6%)
 Frame = -1

Query  1655  GHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESFLAALQR  1476
             GH +GVSYYDSSIRQL+V+E+WEDGS ++PL+D++KYQ +P +IYTSTKSEESFLAALQR
Sbjct  38    GHLVGVSYYDSSIRQLHVLEVWEDGSMEYPLIDLVKYQAKPLMIYTSTKSEESFLAALQR  97

Query  1475  CDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDISSDVQV  1296
              D  S+A TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMMD+ SD+QV
Sbjct  98    SDGMSDAPTVKLVKSSIFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMMDVESDIQV  157

Query  1295  RASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQIFQIDK  1116
             RASGGLLAILE+ERI+D  EQ E   +SI +DSV EISLN FLK+D+ ALEALQIFQ DK
Sbjct  158   RASGGLLAILENERIVDTLEQKELGTSSITIDSVIEISLNNFLKLDATALEALQIFQTDK  217

Query  1115  HPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAISFLLFAE  936
             HPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRP+LDL++LN RL+AISF + ++
Sbjct  218   HPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPLLDLENLNKRLNAISFFISSD  277

Query  935   ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDL  756
             EL  SLRETLK VKD+P ILKKFNSPS T +S DW AFLKSICSLLH+NKIFEVG+SE+L
Sbjct  278   ELVHSLRETLKIVKDIPHILKKFNSPSSTYSSGDWTAFLKSICSLLHVNKIFEVGMSENL  337

Query  755   REQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELR  576
             +E +KY NL IV+KA   ++++LA++ ELVIGVLDV+RSK+K YETIVK+GFC ELDELR
Sbjct  338   KENMKYFNLDIVEKANTCITTELAYVYELVIGVLDVSRSKEKSYETIVKEGFCEELDELR  397

Query  575   QIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPD  396
             ++YE LP+FLEEVSS+ELA+ P++  +   PCIVYIHQIGYLLCIF EKLDE   E L D
Sbjct  398   EVYEELPEFLEEVSSMELAQFPQLCKDTIAPCIVYIHQIGYLLCIFEEKLDESTLEILRD  457

Query  395   FEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLG  216
             FEFA                              F D DGD K+FFY + KTRELD LLG
Sbjct  458   FEFA------------------------------FSDVDGDIKRFFYHSPKTRELDNLLG  487

Query  215   DIYHKILGM  189
             DIYHKIL M
Sbjct  488   DIYHKILDM  496



>ref|XP_011012092.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Populus 
euphratica]
Length=832

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/522 (66%), Positives = 406/522 (78%), Gaps = 55/522 (11%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC +HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P  IY STKSEE
Sbjct  13    VYMACFLHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLTIYASTKSEE  72

Query  1499  SFLAALQR-------------------------CDNTSEAATVKLVKSSLFSYEQAWHRL  1395
             SFL+ALQR                          D T+EA TVKLVKSS+FSYEQAWHRL
Sbjct  73    SFLSALQRSGTLLFTCLTYELIYMWNVFKLQSDTDGTTEAPTVKLVKSSIFSYEQAWHRL  132

Query  1394  MYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENA  1215
             +YL+VTGMDD LNIKER+S+LSSMMDI SDVQVRASGGLLAILE ERI+D  EQ E+ +A
Sbjct  133   IYLRVTGMDDGLNIKERVSYLSSMMDIGSDVQVRASGGLLAILESERIVDTLEQKEYGSA  192

Query  1214  SIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPM  1035
             SI +DSV EISLNKFLK+D+AA EALQIFQIDKHPSHMGIG AKEGFSVFGMMNKC+TP+
Sbjct  193   SITIDSVVEISLNKFLKLDAAAHEALQIFQIDKHPSHMGIGGAKEGFSVFGMMNKCMTPI  252

Query  1034  GRRLLRNWFLRPIldlddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPS  855
             G+RLLRNWFLRP+LD+++LN RL+AISF L +EEL VSLRETLKSVKD+  IL+KF+SPS
Sbjct  253   GKRLLRNWFLRPLLDVENLNGRLNAISFFLCSEELMVSLRETLKSVKDIKHILRKFDSPS  312

Query  854   CTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFIC  675
                T  DWAAFLKS+C+LLH+ KIFEVGISE+L+E  KYLNL IV++A   ++++LA++ 
Sbjct  313   SLSTVGDWAAFLKSVCALLHLGKIFEVGISENLQEHAKYLNLNIVEQACSCITTELAYVY  372

Query  674   ELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGE  495
             ELVIGV+DVNRSK+KGY TIVK+GFC+ELDELRQIYE LPDFL +V+ LELA+LP +  E
Sbjct  373   ELVIGVIDVNRSKEKGYGTIVKEGFCDELDELRQIYEELPDFLHKVTLLELAQLPHLGKE  432

Query  494   NGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQ  315
               +PCIVYIHQIGYLLCIF EKL+E    K  DFEF                        
Sbjct  433   KLVPCIVYIHQIGYLLCIFEEKLEETSLLKPQDFEFM-----------------------  469

Query  314   CCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                    F D DG+TK++FYRT KTRELD LLGDIYHKIL M
Sbjct  470   -------FSDVDGETKRYFYRTPKTRELDELLGDIYHKILDM  504



>gb|AET00534.2| DNA mismatch repair protein MutS [Medicago truncatula]
Length=810

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/497 (68%), Positives = 399/497 (80%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI +GHRIGVSYYDSS+RQL V+E W+DG   F ++D++KYQ  P VIYTSTKSEE
Sbjct  15    VYMACIQNGHRIGVSYYDSSLRQLNVLEAWDDGDNGFSVIDLVKYQANPLVIYTSTKSEE  74

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQ+ D  +EA TVKLVKSS+FSYEQAWHRL+YL+V GMDD L++KERI FLSSMM
Sbjct  75    SFLAALQQSDEVAEAPTVKLVKSSIFSYEQAWHRLIYLRVAGMDDGLDVKERIYFLSSMM  134

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI +DS++EISLN F+K+D+A+ EA
Sbjct  135   DMGSEVQVRASGGLLAILENERIVDTLEQKESGNTSITIDSLAEISLNNFIKLDAASHEA  194

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR WFLRPILDL+ LN RL++
Sbjct  195   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRQWFLRPILDLEVLNYRLNS  254

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF   +EEL  SLRETLKSVKD+P +LKKF+SPS  CTSTDWAA LKSI +LLH+NKIF
Sbjct  255   ISFFHSSEELVASLRETLKSVKDIPHLLKKFDSPSSICTSTDWAALLKSISALLHVNKIF  314

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L+E+LKYLNL IV+ A   ++++LA++ EL+IGV+DVNR+K+KGY T+VK+GF
Sbjct  315   EVGISEGLQEELKYLNLDIVEMASSCITTELAYVYELIIGVIDVNRTKEKGYPTVVKEGF  374

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVSSLELA+LP +     +PCIVYI QIGYL+CIF EKL+E
Sbjct  375   CDELDELRQIYEELPEFLEEVSSLELAQLPDLCKNKLVPCIVYIQQIGYLMCIFEEKLEE  434

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                EKL ++E+                               F D DG+TK++FYR  KT
Sbjct  435   ATLEKLIEWEYT------------------------------FGDADGETKRYFYRMPKT  464

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  465   RELDNLLGDIYHKILDM  481



>ref|XP_010644465.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X3 [Vitis 
vinifera]
Length=846

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/506 (69%), Positives = 396/506 (78%), Gaps = 65/506 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDM---------IKYQVQPGV  1527
             VYMACI+HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D+         +KYQ +P +
Sbjct  13    VYMACILHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLGRTSCLFVNVKYQAKPLI  72

Query  1526  IYTSTKSEESFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKE  1347
             IYTSTK E+SFL+ALQR D T+EA TVKL+KSS+FSYEQAWHRL+YL+VTGMDD LNIKE
Sbjct  73    IYTSTKCEDSFLSALQRSDGTTEAPTVKLMKSSIFSYEQAWHRLIYLRVTGMDDGLNIKE  132

Query  1346  RISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFL  1167
             RI FLSSMMDI SD+QVRASGGLLAILE+ERI+D  EQ E  NASI +D V+EISL+KFL
Sbjct  133   RICFLSSMMDIGSDIQVRASGGLLAILENERIVDTLEQKECGNASITIDFVTEISLHKFL  192

Query  1166  KVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldl  987
             K+D+AA EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL
Sbjct  193   KLDAAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL  252

Query  986   ddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSIC  807
             ++LN+RL+AISF L +EEL+VSLRETLKSVKD+P ILKKFNSPS  CTSTDWA+FLKS+C
Sbjct  253   ENLNSRLNAISFFLCSEELTVSLRETLKSVKDIPYILKKFNSPSSICTSTDWASFLKSVC  312

Query  806   SLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKG  627
             SLLH+NKIFEVGISE L+EQ+KYLNL IV+KA   ++++LA++ EL              
Sbjct  313   SLLHVNKIFEVGISESLQEQVKYLNLDIVEKAHSCITTELAYVYEL--------------  358

Query  626   YETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLL  447
                         LDELRQIYE LP+FLEEVSSLELARLP   G   +PCIVYIHQIGYL+
Sbjct  359   ------------LDELRQIYEELPEFLEEVSSLELARLPHFCGGKLVPCIVYIHQIGYLM  406

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
             CIF +KLDE   EKL DFEFA                              F D DGDTK
Sbjct  407   CIFEDKLDETTLEKLQDFEFA------------------------------FSDGDGDTK  436

Query  266   KFFYRTSKTRELDTLLGDIYHKILGM  189
             KFFYRTSKTRELD LLGDIYHKIL M
Sbjct  437   KFFYRTSKTRELDNLLGDIYHKILDM  462



>ref|XP_010060318.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Eucalyptus 
grandis]
Length=807

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/497 (67%), Positives = 402/497 (81%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+ G+RIGVSYYDS+IRQL+V+E+WEDGS DFPL++++KYQ  P  IYTSTKSEE
Sbjct  13    VYMACILQGNRIGVSYYDSNIRQLHVLEVWEDGSPDFPLIELVKYQATPLFIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             S ++ALQR D T+EA TVKLVKSS+FSYEQAWHRLMYL+VTGMDD L+IKERIS+LSSMM
Sbjct  73    SLISALQRSDGTAEAPTVKLVKSSVFSYEQAWHRLMYLRVTGMDDGLSIKERISYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+++VRASGGLLAILE+ERI+D  EQ E  N+SI +DSV +ISLN FLK+D+AA EA
Sbjct  133   DMGSELEVRASGGLLAILENERIVDTLEQMESGNSSITIDSVIQISLNNFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTP+GRRLLR+WFLRPI+DL+ LN RL+A
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPIGRRLLRSWFLRPIVDLEHLNNRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SLRETLKSVKD+P ILKKFNSPS  CTS+DW+AFLKS+ SLLH+NKI 
Sbjct  253   ISFFLSSEELMDSLRETLKSVKDIPFILKKFNSPSSICTSSDWSAFLKSVSSLLHLNKIL  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L EQ+KYL+  I++KA   ++++LA++ ELVIGV+D++R K+KGYET+VK+ F
Sbjct  313   EVGISEGLDEQMKYLSTDILEKASSCITTELAYVYELVIGVIDISRIKEKGYETMVKESF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEV+SLELA  P +  +  +PCIVYI Q+GYL+CI  EKLDE
Sbjct  373   CDELDELRQIYEELPEFLEEVTSLELAHFPDVFKDKHVPCIVYIQQVGYLMCILEEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                 +L DFE+                               F D DG+  +FFYRT+KT
Sbjct  433   MTLARLEDFEYV------------------------------FSDNDGEMMRFFYRTTKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGD++HKIL M
Sbjct  463   RELDDLLGDLHHKILDM  479



>gb|EPS67262.1| hypothetical protein M569_07513, partial [Genlisea aurea]
Length=789

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/498 (68%), Positives = 395/498 (79%), Gaps = 31/498 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACIMHG R+G+SYYDSSI Q+ V+E WED ++DFPL+ M+K Q QP VIYTSTKSE+
Sbjct  1     VYMACIMHGRRVGISYYDSSIYQVNVLEFWEDENEDFPLVQMVKCQAQPTVIYTSTKSEQ  60

Query  1499  SFLAALQ-RCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSM  1323
              F AALQ + D      TVK+VKSSLFSYEQAWHRLMYL+VTGMD+ LN+KERIS LSSM
Sbjct  61    PFFAALQNKVDGIVAPPTVKVVKSSLFSYEQAWHRLMYLRVTGMDEGLNVKERISILSSM  120

Query  1322  MDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALE  1143
             MD  SDVQVRA+GGLLAILE+ERI+D  EQ E  +AS++++S+SEI LN FLKVDS ALE
Sbjct  121   MDTRSDVQVRATGGLLAILENERILDTLEQKESGSASLSINSLSEIPLNNFLKVDSVALE  180

Query  1142  ALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarld  963
             ALQIFQ D HPSHMGIGRAKEGFSVFGMMNKCVTP+GRRLLRNWFLRP+LDL+ LN RLD
Sbjct  181   ALQIFQTDMHPSHMGIGRAKEGFSVFGMMNKCVTPIGRRLLRNWFLRPVLDLEKLNNRLD  240

Query  962   AISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKI  783
             AISF L AEEL VSLR+TLKSVKD+P +LKK NSPS  CT +DW +FLKSICSLLHINK+
Sbjct  241   AISFFLCAEELLVSLRQTLKSVKDIPHLLKKINSPSSACTPSDWTSFLKSICSLLHINKV  300

Query  782   FEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDG  603
              EVGIS  L+EQLK L++ I++KAG  +S++L ++  L+IGV DVNRSK KGY+TIVKDG
Sbjct  301   LEVGISGTLKEQLKDLHIDIIEKAGFCISTELEYVYNLIIGVFDVNRSKDKGYDTIVKDG  360

Query  602   FCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLD  423
             FC ELDELRQIYE LP FLEEVSSLELARLP M  +  +PCIVYIHQ+GYL+CIF EKL+
Sbjct  361   FCGELDELRQIYEELPGFLEEVSSLELARLPHMPQKKFVPCIVYIHQVGYLMCIFEEKLN  420

Query  422   EEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSK  243
             + + EKL DFEF                               F +ED ++KKF+YRT+K
Sbjct  421   DSVMEKLLDFEFV------------------------------FSEEDKNSKKFYYRTAK  450

Query  242   TRELDTLLGDIYHKILGM  189
             TRELD L+GD+YHKIL M
Sbjct  451   TRELDNLIGDVYHKILDM  468



>gb|KGN56072.1| hypothetical protein Csa_3G064210 [Cucumis sativus]
Length=801

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/503 (68%), Positives = 397/503 (79%), Gaps = 42/503 (8%)
 Frame = -1

Query  1661  MHGH-----RIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEES  1497
             MHG      R+GVSYYDSSIRQL+V+E+WEDGS ++PL+D++KYQ +P +IYTSTKSEES
Sbjct  1     MHGLASFLLRVGVSYYDSSIRQLHVLEVWEDGSIEYPLIDLVKYQAKPLMIYTSTKSEES  60

Query  1496  FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMD  1317
             FLAALQR D  SEA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMMD
Sbjct  61    FLAALQRSDGMSEAPTVKLVKSSIFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMMD  120

Query  1316  ISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEAL  1137
             + S+VQVRASGGLLAILE ERI+D  EQ E   +SI +DSV EISLN FLK+D+ ALEAL
Sbjct  121   VESEVQVRASGGLLAILESERIVDTLEQKELGTSSITIDSVIEISLNNFLKLDATALEAL  180

Query  1136  QIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAI  957
             QIFQ DKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRP+LDL++LN RL+AI
Sbjct  181   QIFQTDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPLLDLENLNKRLNAI  240

Query  956   SFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFE  777
             SF + ++EL  SLRETLK VKD+P ILKKFNSPS T +S DW AFLKSICSLLH+NKIFE
Sbjct  241   SFFISSDELMHSLRETLKIVKDIPHILKKFNSPSSTYSSGDWTAFLKSICSLLHVNKIFE  300

Query  776   VGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICEL-------VIGVLDVNRSKQKGYET  618
             VG+SE+L+E +KY NL IV+KA   ++++LA++ EL       VIGVLDV+RSK+K YET
Sbjct  301   VGMSENLKENMKYFNLDIVEKANTCITTELAYVYELVIVSYFPVIGVLDVSRSKEKSYET  360

Query  617   IVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIF  438
             IVK+GFC ELDELR++YE LP+FLEEVSS+ELA+ P++      PCIVYIHQIGYLLCIF
Sbjct  361   IVKEGFCEELDELREVYEELPEFLEEVSSMELAQFPQLCKYTIAPCIVYIHQIGYLLCIF  420

Query  437   NEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFF  258
              EKLDE   E L DFEFA                              F D DGD K+FF
Sbjct  421   EEKLDESTLEILQDFEFA------------------------------FSDVDGDIKRFF  450

Query  257   YRTSKTRELDTLLGDIYHKILGM  189
             Y + KTRELD LLGDIYHKIL M
Sbjct  451   YHSPKTRELDNLLGDIYHKILDM  473



>ref|XP_006595729.1| PREDICTED: DNA mismatch repair protein MSH5-like isoform X2 [Glycine 
max]
Length=802

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/497 (67%), Positives = 397/497 (80%), Gaps = 40/497 (8%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI++G+RIGVSYYDS++RQLYV+E+W+DG K FP++D++KYQ  P VIYTSTKSEE
Sbjct  13    VYMACILNGNRIGVSYYDSTLRQLYVLEVWDDGDKGFPVIDLVKYQANPLVIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQ+ D  +E+  VKLVKSS+FSYEQAWHRL+YL+V GMDD LN+KERI +LSSMM
Sbjct  73    SFLSALQQRDGAAESPIVKLVKSSIFSYEQAWHRLVYLRVAGMDDGLNVKERIYYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             ++ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI +DS++EISLN FLK+D+AA EA
Sbjct  133   NMGSEVQVRASGGLLAILENERIVDTLEQKESGNTSITIDSLAEISLNNFLKLDTAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDL+ LN RL++
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLEVLNYRLNS  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L +EEL  SLRETLKSVKD+P +LKKF+SPS  CTS DW A L          KIF
Sbjct  253   ISFFLCSEELVTSLRETLKSVKDIPLLLKKFDSPSSICTSFDWTALL----------KIF  302

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE LRE+LKYLNL IV+KA  H++++L ++ ELVIGV+DVNR+K+KGY T+VK+GF
Sbjct  303   EVGISEGLREELKYLNLDIVEKASSHITAELGYVYELVIGVIDVNRTKEKGYATVVKEGF  362

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEVSSLELA+LP +  +  +PCIVYI QIGYL+CIF EK +E
Sbjct  363   CDELDELRQIYEELPEFLEEVSSLELAQLPVLCKDKRIPCIVYIQQIGYLMCIFGEKPEE  422

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E+L D+E+  C                              D DG+TKK+FYRT KT
Sbjct  423   TTLEQLVDWEYTFC------------------------------DTDGETKKYFYRTPKT  452

Query  239   RELDTLLGDIYHKILGM  189
             RELD+LLGDI+HKIL M
Sbjct  453   RELDSLLGDIHHKILDM  469



>ref|XP_010915350.1| PREDICTED: DNA mismatch repair protein MSH5 [Elaeis guineensis]
Length=809

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/497 (65%), Positives = 397/497 (80%), Gaps = 32/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+M GHR+G++YYDSS+RQL+V E+WEDG+ +FPL+D++KYQ +P VIY STK+EE
Sbjct  14    VYMACLMQGHRVGIAYYDSSVRQLFVTEVWEDGNGEFPLIDLVKYQAKPVVIYASTKTEE  73

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             + L+ALQR D  SEA+ VKL++SS+FSYEQAWHRL+YL+V GMDD L++KERI FL+SMM
Sbjct  74    ALLSALQRNDE-SEASVVKLIRSSVFSYEQAWHRLIYLRVAGMDDGLSVKERICFLNSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SD+QVRA+GGLLAILE+ER++D  EQ E+ N+SI +D V++I L+KFLK+D+AA EA
Sbjct  133   DLGSDLQVRAAGGLLAILENERLVDTFEQKEYGNSSITIDCVTQIPLDKFLKLDAAAYEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ+DKHPSHMGIGRAKEGFSVFGM N+CVTPMGRRLLR WFLRPILD D LN+RL+ 
Sbjct  193   LQIFQVDKHPSHMGIGRAKEGFSVFGMFNQCVTPMGRRLLRMWFLRPILDPDILNSRLNT  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L  EE+  +LRETLKSV+DVP +LKKFNSPS  CTS DW AFL+ ICSLLHINKIF
Sbjct  253   ISFFLCCEEVMSALRETLKSVRDVPHLLKKFNSPSSLCTSNDWNAFLECICSLLHINKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             +VGISE L+E+L+YLNLG+V KA   ++ +L ++ +LVIGV+DV RSK+K YET+VK+G 
Sbjct  313   QVGISEYLQERLEYLNLGLVDKANSCIAMELVYVFDLVIGVIDVQRSKEKAYETLVKEGI  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELR IYEGLPDFL +VSS E A LP + G   +PCIVYIHQIGYL+CIF+EKLDE
Sbjct  373   CDELDELRMIYEGLPDFLAQVSSFENASLPFLHGSKKVPCIVYIHQIGYLMCIFDEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
             ++ E+  DFEFA                                 EDG+ KK+FY TSKT
Sbjct  433   DILEEHQDFEFA-------------------------------FSEDGNEKKYFYHTSKT  461

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  462   RELDNLLGDIYHKILDM  478



>ref|XP_002883246.1| hypothetical protein ARALYDRAFT_479572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59505.1| hypothetical protein ARALYDRAFT_479572 [Arabidopsis lyrata subsp. 
lyrata]
Length=807

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/497 (65%), Positives = 389/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S+RQL+V+E+WE+   DF L++M+KYQ +P +IYTSTKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSVRQLHVLEVWEEDCSDFTLINMVKYQAKPSIIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+AALQ+ D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFVAALQQNDGTDETTMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE  +ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGSASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIF
Sbjct  253   ISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELVIGV+DV RSK++GY+T+VK+GF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVS++EL   P +  E   PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEELPEFLQEVSAMELEHFPHLHKEKLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                 +L +FEFA                              F D DG+T++FFY T KT
Sbjct  433   TTLNRLTEFEFA------------------------------FSDMDGETQRFFYHTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>gb|ABO69626.1| MutS-like protein 5 [Arabidopsis thaliana]
Length=807

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/497 (65%), Positives = 388/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S+RQL+V+E WE+   DF L++M+KYQ +P +IY STKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSVRQLHVLEFWEEDCSDFTLINMVKYQAKPSIIYASTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+AALQ+ D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFIAALQQNDGTDETTMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE  +ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGSASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIF
Sbjct  253   ISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELVIGV+DV RSK++GY+T+VK+GF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVS++EL   P +  E   PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEELPEFLQEVSAMELEHFPHLHKEKLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                 +L +FEFA                              F D DG+T++FFY TSKT
Sbjct  433   TALNRLTEFEFA------------------------------FSDMDGETQRFFYHTSKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_009608751.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X3 [Nicotiana 
tomentosiformis]
Length=830

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/435 (75%), Positives = 374/435 (86%), Gaps = 17/435 (4%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+SIRQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACVMHGHRIGVSYYDASIRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL ALQR D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  72    SFLGALQRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  132   DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD+LN RLD 
Sbjct  192   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLDNLNRRLDT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS   TS DWAAFLKS+C+LLHI+KIF
Sbjct  252   ISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPSSISTSADWAAFLKSVCALLHISKIF  311

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+LK L+L I+++A  H+S DLA++CELVIGV DV+RSK+KGYETIVK+GF
Sbjct  312   EVGISGSLYEELKNLDLDIIERADFHISVDLAYVCELVIGVTDVDRSKEKGYETIVKEGF  371

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C                 +EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  372   C-----------------DEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  414

Query  419   EMQEKLPDFEFAVCH  375
             EM EKL D+EFAVCH
Sbjct  415   EMLEKLQDYEFAVCH  429



>ref|NP_188683.3| DNA mismatch repair protein MSH5  [Arabidopsis thaliana]
 sp|F4JEP5.1|MSH5_ARATH RecName: Full=DNA mismatch repair protein MSH5; Short=AtMSH5; 
AltName: Full=MutS protein homolog 5 [Arabidopsis thaliana]
 gb|AEE76384.1| DNA mismatch repair protein MSH5 [Arabidopsis thaliana]
Length=807

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/497 (65%), Positives = 388/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S+RQL+V+E WE+   DF L++M+KYQ +P +IY STKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSVRQLHVLEFWEEDCSDFTLINMVKYQAKPSIIYASTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+AALQ+ D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFVAALQQNDGTDETTMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE  +ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGSASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIF
Sbjct  253   ISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELVIGV+DV RSK++GY+T+VK+GF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVS++EL   P +  E   PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEELPEFLQEVSAMELEHFPHLHKEKLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                 +L +FEFA                              F D DG+T++FFY TSKT
Sbjct  433   TALNRLTEFEFA------------------------------FSDMDGETQRFFYHTSKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_010466240.1| PREDICTED: DNA mismatch repair protein MSH5 [Camelina sativa]
Length=807

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/497 (65%), Positives = 388/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S R+L+V+E+WE+   DF L++M+KYQ +P +IYTSTKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSERKLHVLEVWEEDCSDFTLINMVKYQAKPSIIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+AALQ+ D T E   V+LVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFVAALQQSDGTDENTVVRLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIF
Sbjct  253   ISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELVIGV+DV RSK++GY+T+VK+GF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVSS+EL   P +  E   PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEELPEFLQEVSSMELEHFPHLHNEKLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                ++L +FEFA                              F D DG+T++FFY T KT
Sbjct  433   TALDRLIEFEFA------------------------------FSDMDGETQRFFYHTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_009145622.1| PREDICTED: DNA mismatch repair protein MSH5 [Brassica rapa]
Length=807

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/497 (65%), Positives = 390/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S+RQL+V+E WE+   DF L++M+KYQ +P VIYTSTKSE+
Sbjct  13    VYMACIQHGRRVGVSYYDCSVRQLHVLEFWEEDCSDFTLINMVKYQAKPLVIYTSTKSED  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF++ALQ+ D T E   VK VKSS FSYEQAWHRL+YL+VTGMD+ LNIKER+ +LSSMM
Sbjct  73    SFVSALQKSDGTEEDTMVKQVKSSTFSYEQAWHRLVYLRVTGMDEGLNIKERVCYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI+D  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVDTLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             I+F + + EL  SLR+TLKSVKD+  +LKKFNSP+  CTS DW AF+KSI +LLH+NKIF
Sbjct  253   ITFFISSIELMTSLRDTLKSVKDISHLLKKFNSPTSLCTSNDWTAFMKSIGALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELV+GV+DV RSK+KGY+T+VKDGF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVLGVIDVTRSKEKGYQTLVKDGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYEGLP+FL+EVSS+E   LP +  EN  PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEGLPEFLQEVSSMEFEHLPHLHKENLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                +++ +FEFA                              F D DG+T++FFY T KT
Sbjct  433   TALDRINEFEFA------------------------------FSDLDGETQRFFYHTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD +LGDIYHKIL M
Sbjct  463   RELDNVLGDIYHKILDM  479



>ref|XP_010488024.1| PREDICTED: DNA mismatch repair protein MSH5-like isoform X3 [Camelina 
sativa]
Length=743

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/497 (65%), Positives = 389/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S R+L+V+E+WE+   DF L++M+KYQ +P +IYTSTKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSERKLHVLEVWEEDCSDFTLINMVKYQAKPSIIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+AALQ+ D T E   V+LVKSS FSY+QAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFVAALQQSDGTDENTVVRLVKSSTFSYDQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LL++NKIF
Sbjct  253   ISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLNVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELVIGV+DV RSK++GY+T+VK+GF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVS++EL + P +  E   PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEELPEFLQEVSAMELEQFPHLHNEKLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                ++L +FEFA                              F D DG+T++FFY T KT
Sbjct  433   TALDRLIEFEFA------------------------------FSDMDGETQRFFYHTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_010488023.1| PREDICTED: DNA mismatch repair protein MSH5-like isoform X2 [Camelina 
sativa]
Length=749

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/497 (65%), Positives = 389/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S R+L+V+E+WE+   DF L++M+KYQ +P +IYTSTKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSERKLHVLEVWEEDCSDFTLINMVKYQAKPSIIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+AALQ+ D T E   V+LVKSS FSY+QAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFVAALQQSDGTDENTVVRLVKSSTFSYDQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LL++NKIF
Sbjct  253   ISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLNVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELVIGV+DV RSK++GY+T+VK+GF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVS++EL + P +  E   PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEELPEFLQEVSAMELEQFPHLHNEKLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                ++L +FEFA                              F D DG+T++FFY T KT
Sbjct  433   TALDRLIEFEFA------------------------------FSDMDGETQRFFYHTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_010545521.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X5 [Tarenaya 
hassleriana]
Length=807

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/497 (66%), Positives = 392/497 (79%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG RIGVSYYD +IRQL+++E WED   +FPL+D++KYQ  P VIYTSTKSEE
Sbjct  13    VYMACIQHGRRIGVSYYDCNIRQLHLLEFWEDSCSEFPLIDIVKYQANPLVIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQ+ D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFLSALQQNDGTCETPMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+D AA EA
Sbjct  133   DMGSEVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKLDVAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLELLDHRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIF
Sbjct  253   ISFFISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EV +SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+T+VK+GF
Sbjct  313   EVVVSETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQTMVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CIF EKL+E
Sbjct  373   CAELDELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCIFGEKLEE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                E+L +F+FA                              F D DG+T++FFY T KT
Sbjct  433   TEVERLNEFDFA------------------------------FSDMDGETQRFFYHTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_010488022.1| PREDICTED: DNA mismatch repair protein MSH5-like isoform X1 [Camelina 
sativa]
Length=807

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/497 (65%), Positives = 389/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S R+L+V+E+WE+   DF L++M+KYQ +P +IYTSTKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSERKLHVLEVWEEDCSDFTLINMVKYQAKPSIIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+AALQ+ D T E   V+LVKSS FSY+QAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFVAALQQSDGTDENTVVRLVKSSTFSYDQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LL++NKIF
Sbjct  253   ISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLNVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELVIGV+DV RSK++GY+T+VK+GF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVS++EL + P +  E   PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEELPEFLQEVSAMELEQFPHLHNEKLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                ++L +FEFA                              F D DG+T++FFY T KT
Sbjct  433   TALDRLIEFEFA------------------------------FSDMDGETQRFFYHTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>gb|KCW66980.1| hypothetical protein EUGRSUZ_F00744, partial [Eucalyptus grandis]
Length=784

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/486 (67%), Positives = 392/486 (81%), Gaps = 30/486 (6%)
 Frame = -1

Query  1646  IGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESFLAALQRCDN  1467
             IGVSYYDS+IRQL+V+E+WEDGS DFPL++++KYQ  P  IYTSTKSEES ++ALQR D 
Sbjct  1     IGVSYYDSNIRQLHVLEVWEDGSPDFPLIELVKYQATPLFIYTSTKSEESLISALQRSDG  60

Query  1466  TSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRAS  1287
             T+EA TVKLVKSS+FSYEQAWHRLMYL+VTGMDD L+IKERIS+LSSMMD+ S+++VRAS
Sbjct  61    TAEAPTVKLVKSSVFSYEQAWHRLMYLRVTGMDDGLSIKERISYLSSMMDMGSELEVRAS  120

Query  1286  GGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPS  1107
             GGLLAILE+ERI+D  EQ E  N+SI +DSV +ISLN FLK+D+AA EALQIFQIDKHPS
Sbjct  121   GGLLAILENERIVDTLEQMESGNSSITIDSVIQISLNNFLKLDAAAHEALQIFQIDKHPS  180

Query  1106  HMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAISFLLFAEELS  927
             HMGIGRAKEGFSVFGMMNKCVTP+GRRLLR+WFLRPI+DL+ LN RL+AISF L +EEL 
Sbjct  181   HMGIGRAKEGFSVFGMMNKCVTPIGRRLLRSWFLRPIVDLEHLNNRLNAISFFLSSEELM  240

Query  926   VSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQ  747
              SLRETLKSVKD+P ILKKFNSPS  CTS+DW+AFLKS+ SLLH+NKI EVGISE L EQ
Sbjct  241   DSLRETLKSVKDIPFILKKFNSPSSICTSSDWSAFLKSVSSLLHLNKILEVGISEGLDEQ  300

Query  746   LKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIY  567
             +KYL+  I++KA   ++++LA++ ELVIGV+D++R K+KGYET+VK+ FC+ELDELRQIY
Sbjct  301   MKYLSTDILEKASSCITTELAYVYELVIGVIDISRIKEKGYETMVKESFCDELDELRQIY  360

Query  566   EGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEF  387
             E LP+FLEEV+SLELA  P +  +  +PCIVYI Q+GYL+CI  EKLDE    +L DFE+
Sbjct  361   EELPEFLEEVTSLELAHFPDVFKDKHVPCIVYIQQVGYLMCILEEKLDEMTLARLEDFEY  420

Query  386   AVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIY  207
                                            F D DG+  +FFYRT+KTRELD LLGD++
Sbjct  421   V------------------------------FSDNDGEMMRFFYRTTKTRELDDLLGDLH  450

Query  206   HKILGM  189
             HKIL M
Sbjct  451   HKILDM  456



>ref|XP_010545520.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X4 [Tarenaya 
hassleriana]
Length=812

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/499 (65%), Positives = 392/499 (79%), Gaps = 32/499 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG RIGVSYYD +IRQL+++E WED   +FPL+D++KYQ  P VIYTSTKSEE
Sbjct  13    VYMACIQHGRRIGVSYYDCNIRQLHLLEFWEDSCSEFPLIDIVKYQANPLVIYTSTKSEE  72

Query  1499  SFLAALQR--CDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSS  1326
             SFL+ALQ+   D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSS
Sbjct  73    SFLSALQQNDVDGTCETPMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSS  132

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMD+ S+VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+D AA 
Sbjct  133   MMDMGSEVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKLDVAAH  192

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ L+ RL
Sbjct  193   EALQIFQIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLELLDHRL  252

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             +AISF + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NK
Sbjct  253   NAISFFISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISALLHVNK  312

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEV +SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+T+VK+
Sbjct  313   IFEVVVSETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQTMVKE  372

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC ELDELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CIF EKL
Sbjct  373   GFCAELDELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCIFGEKL  432

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
             +E   E+L +F+FA                              F D DG+T++FFY T 
Sbjct  433   EETEVERLNEFDFA------------------------------FSDMDGETQRFFYHTP  462

Query  245   KTRELDTLLGDIYHKILGM  189
             KTRELD LLGDIYHKIL M
Sbjct  463   KTRELDNLLGDIYHKILDM  481



>ref|XP_006299772.1| hypothetical protein CARUB_v10015967mg [Capsella rubella]
 gb|EOA32670.1| hypothetical protein CARUB_v10015967mg [Capsella rubella]
Length=807

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/497 (64%), Positives = 385/497 (77%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S R+L+V+E WE+   DF L++M+KYQ +P +IYTSTKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSERKLHVLEFWEEDCSDFTLINMVKYQAKPSIIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF++ALQ+ D   E   V+LVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFVSALQQNDGADENTMVRLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIF
Sbjct  253   ISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE L+E ++  NL I++KAG  +S++L +I ELV GV+DV RSK++GY+T+VK+GF
Sbjct  313   EVGVSESLKEHMRRFNLDIIEKAGLCISTELDYIYELVTGVIDVTRSKERGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVS++EL   P +  E   PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEELPEFLQEVSAMELEHFPHLHNEKLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                ++L +FEFA                              F D DG+T++FFY T KT
Sbjct  433   TALDRLIEFEFA------------------------------FSDIDGETQRFFYHTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_010666205.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=808

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/497 (66%), Positives = 398/497 (80%), Gaps = 31/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHG R+G+SYYDSSIRQL V+E+WEDG+ +FPL+D++K+Q QP +IYTSTKSEE
Sbjct  14    VYMACVMHGQRVGISYYDSSIRQLSVLEVWEDGA-EFPLIDLVKHQAQPLIIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
              FL ALQR D  + + TVKL+KSS+FS+EQAWHRL+YL+V+GMDD L++KERI+FLSSMM
Sbjct  73    QFLLALQRSDGINFSPTVKLMKSSIFSFEQAWHRLVYLRVSGMDDGLSVKERITFLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI+S+VQVRA+GGLLAILE+ER++D  E  E+ +ASI+VD ++E+SLNKFLK+D+AA EA
Sbjct  133   DIASEVQVRATGGLLAILENERLVDTLETKEYGDASISVDCLTEVSLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR WFLRPILDLD LN+RLDA
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRKWFLRPILDLDILNSRLDA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L++EEL  SLR TLK++KDVP ILKKFNSPS  CT++DWAAFLKS+ S LH+NKIF
Sbjct  253   ISFFLYSEELMASLRGTLKTIKDVPYILKKFNSPSSVCTASDWAAFLKSLSSFLHLNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+ E LRE + +  L I+ KA   ++++L++I ELV G++DV R K+KGY TIVK+GF
Sbjct  313   EVGVPESLREHVNHFYLDIIDKAASCITTELSYISELVTGIIDVTREKEKGYGTIVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+ LEEVSSLELARLP +  +  +PCI+YIHQIGYLLCI  EKLDE
Sbjct  373   CEELDELRQIYEELPELLEEVSSLELARLPNLHRDECVPCIIYIHQIGYLLCISEEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                + L D E+A                              F D + + K+FFYRTSKT
Sbjct  433   RTLQTLEDIEYA------------------------------FSDGEKEPKRFFYRTSKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD +LGDIYHKIL M
Sbjct  463   RELDNVLGDIYHKILDM  479



>ref|XP_010545526.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X10 [Tarenaya 
hassleriana]
Length=692

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/504 (65%), Positives = 392/504 (78%), Gaps = 37/504 (7%)
 Frame = -1

Query  1679  VYMACIMHGHR-----IGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTS  1515
             VYMACI HG R     IGVSYYD +IRQL+++E WED   +FPL+D++KYQ  P VIYTS
Sbjct  13    VYMACIQHGRRFVNYLIGVSYYDCNIRQLHLLEFWEDSCSEFPLIDIVKYQANPLVIYTS  72

Query  1514  TKSEESFLAALQR--CDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERI  1341
             TKSEESFL+ALQ+   D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI
Sbjct  73    TKSEESFLSALQQNDVDGTCETPMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERI  132

Query  1340  SFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKV  1161
              +LSSMMD+ S+VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+
Sbjct  133   CYLSSMMDMGSEVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKL  192

Query  1160  DSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldldd  981
             D AA EALQIFQIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ 
Sbjct  193   DVAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLEL  252

Query  980   lnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             L+ RL+AISF + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +L
Sbjct  253   LDHRLNAISFFISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISAL  312

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             LH+NKIFEV +SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+
Sbjct  313   LHVNKIFEVVVSETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQ  372

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCI  441
             T+VK+GFC ELDELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CI
Sbjct  373   TMVKEGFCAELDELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCI  432

Query  440   FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKF  261
             F EKL+E   E+L +F+FA                              F D DG+T++F
Sbjct  433   FGEKLEETEVERLNEFDFA------------------------------FSDMDGETQRF  462

Query  260   FYRTSKTRELDTLLGDIYHKILGM  189
             FY T KTRELD LLGDIYHKIL M
Sbjct  463   FYHTPKTRELDNLLGDIYHKILDM  486



>ref|XP_010327309.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X4 [Solanum 
lycopersicum]
Length=785

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/497 (67%), Positives = 376/497 (76%), Gaps = 79/497 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+S RQL+V+EI+EDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  32    VYMACVMHGHRIGVSYYDASARQLHVLEIYEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  91

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFLAALQR D TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  92    SFLAALQRSDGTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  151

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQVRASGGLLA+LE+ERIID  E NE  +AS+A+D + EISL+KFLKVDSAA EA
Sbjct  152   DVSSDVQVRASGGLLAVLENERIIDTLELNECGSASVAIDCICEISLDKFLKVDSAAHEA  211

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLD+LN RLD 
Sbjct  212   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLDNLNRRLDT  271

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE+SVSLRETLKSVKD+P ILKKFNSPS   TS DW+AFLK            
Sbjct  272   ISFFLSAEEVSVSLRETLKSVKDIPRILKKFNSPSSISTSADWSAFLK------------  319

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
                                                  VIGV+DV+RSK+KGYETIVK+GF
Sbjct  320   -------------------------------------VIGVIDVDRSKEKGYETIVKEGF  342

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FLEEV +LELARLP M  + GLP I+Y+HQIGYL+CIFNEKL E
Sbjct  343   CDELDELRQIYEGLPEFLEEVLALELARLPCMYEDKGLPSIIYLHQIGYLMCIFNEKLGE  402

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
             EM E L D+EFA                              F DE+G+ ++FFY T+KT
Sbjct  403   EMLETLQDYEFA------------------------------FADEEGEHRRFFYHTAKT  432

Query  239   RELDTLLGDIYHKILGM  189
             +E+D LLGDIYHKIL M
Sbjct  433   KEMDNLLGDIYHKILDM  449



>ref|XP_010545518.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Tarenaya 
hassleriana]
Length=815

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/502 (65%), Positives = 392/502 (78%), Gaps = 35/502 (7%)
 Frame = -1

Query  1679  VYMACIMHGHR-----IGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTS  1515
             VYMACI HG R     IGVSYYD +IRQL+++E WED   +FPL+D++KYQ  P VIYTS
Sbjct  13    VYMACIQHGRRFVNYLIGVSYYDCNIRQLHLLEFWEDSCSEFPLIDIVKYQANPLVIYTS  72

Query  1514  TKSEESFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             TKSEESFL+ALQ+ D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +
Sbjct  73    TKSEESFLSALQQNDGTCETPMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICY  132

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDS  1155
             LSSMMD+ S+VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+D 
Sbjct  133   LSSMMDMGSEVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKLDV  192

Query  1154  AALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
             AA EALQIFQIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ L+
Sbjct  193   AAHEALQIFQIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLELLD  252

Query  974   arldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLH  795
              RL+AISF + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH
Sbjct  253   HRLNAISFFISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISALLH  312

Query  794   INKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETI  615
             +NKIFEV +SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+T+
Sbjct  313   VNKIFEVVVSETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQTM  372

Query  614   VKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFN  435
             VK+GFC ELDELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CIF 
Sbjct  373   VKEGFCAELDELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCIFG  432

Query  434   EKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFY  255
             EKL+E   E+L +F+FA                              F D DG+T++FFY
Sbjct  433   EKLEETEVERLNEFDFA------------------------------FSDMDGETQRFFY  462

Query  254   RTSKTRELDTLLGDIYHKILGM  189
              T KTRELD LLGDIYHKIL M
Sbjct  463   HTPKTRELDNLLGDIYHKILDM  484



>ref|XP_006406378.1| hypothetical protein EUTSA_v10022259mg [Eutrema salsugineum]
 gb|ESQ47831.1| hypothetical protein EUTSA_v10022259mg [Eutrema salsugineum]
Length=807

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/497 (64%), Positives = 387/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GV+YYD S+RQL+V+E+WE+   DF L++M+KYQ +P VI+TSTKSEE
Sbjct  13    VYMACIQHGRRVGVAYYDCSVRQLHVLEVWEEDCSDFALINMVKYQAKPLVIFTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF++ALQ+ D T E   V+ VKSS FSYEQAWHRL+YL+VTGMD+ LNIKERI +LSSMM
Sbjct  73    SFVSALQQSDGTDEKTMVRPVKSSTFSYEQAWHRLVYLRVTGMDEGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQSDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AF+KSI +LLH+NKIF
Sbjct  253   ISFFISSVELMTSLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFMKSISALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELVIGV+DV RSK+KGY+T+VK+GF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKEKGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVSS+EL +   +  E   PCIVYI QIGYL+CIF EKLDE
Sbjct  373   CAELDELRQIYEELPEFLQEVSSMELEQFSHLHQEKLPPCIVYIQQIGYLMCIFGEKLDE  432

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                 +L +FEFA                              F D DGD+++F+Y T KT
Sbjct  433   TALNRLTEFEFA------------------------------FSDLDGDSQRFYYHTPKT  462

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  463   RELDNLLGDIYHKILDM  479



>ref|XP_010545523.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X7 [Tarenaya 
hassleriana]
Length=754

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/504 (65%), Positives = 392/504 (78%), Gaps = 37/504 (7%)
 Frame = -1

Query  1679  VYMACIMHGHR-----IGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTS  1515
             VYMACI HG R     IGVSYYD +IRQL+++E WED   +FPL+D++KYQ  P VIYTS
Sbjct  13    VYMACIQHGRRFVNYLIGVSYYDCNIRQLHLLEFWEDSCSEFPLIDIVKYQANPLVIYTS  72

Query  1514  TKSEESFLAALQR--CDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERI  1341
             TKSEESFL+ALQ+   D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI
Sbjct  73    TKSEESFLSALQQNDVDGTCETPMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERI  132

Query  1340  SFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKV  1161
              +LSSMMD+ S+VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+
Sbjct  133   CYLSSMMDMGSEVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKL  192

Query  1160  DSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldldd  981
             D AA EALQIFQIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ 
Sbjct  193   DVAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLEL  252

Query  980   lnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             L+ RL+AISF + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +L
Sbjct  253   LDHRLNAISFFISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISAL  312

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             LH+NKIFEV +SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+
Sbjct  313   LHVNKIFEVVVSETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQ  372

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCI  441
             T+VK+GFC ELDELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CI
Sbjct  373   TMVKEGFCAELDELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCI  432

Query  440   FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKF  261
             F EKL+E   E+L +F+FA                              F D DG+T++F
Sbjct  433   FGEKLEETEVERLNEFDFA------------------------------FSDMDGETQRF  462

Query  260   FYRTSKTRELDTLLGDIYHKILGM  189
             FY T KTRELD LLGDIYHKIL M
Sbjct  463   FYHTPKTRELDNLLGDIYHKILDM  486



>ref|XP_009608752.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X4 [Nicotiana 
tomentosiformis]
Length=818

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/435 (73%), Positives = 362/435 (83%), Gaps = 29/435 (7%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+SIRQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACVMHGHRIGVSYYDASIRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL ALQR D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  72    SFLGALQRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  132   DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD        
Sbjct  192   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLD--------  243

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
                         +L   L +         KFNSPS   TS DWAAFLKS+C+LLHI+KIF
Sbjct  244   ------------NLNRRLDT---------KFNSPSSISTSADWAAFLKSVCALLHISKIF  282

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+LK L+L I+++A  H+S DLA++CELVIGV DV+RSK+KGYETIVK+GF
Sbjct  283   EVGISGSLYEELKNLDLDIIERADFHISVDLAYVCELVIGVTDVDRSKEKGYETIVKEGF  342

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FL EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  343   CDELDELRQIYEGLPEFLGEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  402

Query  419   EMQEKLPDFEFAVCH  375
             EM EKL D+EFAVCH
Sbjct  403   EMLEKLQDYEFAVCH  417



>emb|CDY65220.1| BnaCnng46130D [Brassica napus]
Length=802

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/497 (64%), Positives = 386/497 (78%), Gaps = 30/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S+RQL+V+E WE+   DF L++M+KYQ +P VIYTSTKSE+
Sbjct  10    VYMACIQHGRRVGVSYYDCSVRQLHVLEFWEEDCSDFTLINMVKYQAKPLVIYTSTKSED  69

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF++AL + D T E +TVKLVKSS FSYEQAWHRL+YL+VTGMD+ LNIKER+ +LSSMM
Sbjct  70    SFVSALHKSDGTDEDSTVKLVKSSTFSYEQAWHRLVYLRVTGMDEGLNIKERVCYLSSMM  129

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI+D  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  130   DVGSEVQVRVSGGLLAILESERIVDTLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  189

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  190   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  249

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             I+F + + EL  SLR+TLKSVKD+  +LKKFNSP+  CTS DW AF+KSI +LL +NKIF
Sbjct  250   ITFFISSIELMTSLRDTLKSVKDISHLLKKFNSPTSLCTSNDWTAFMKSIGALLRVNKIF  309

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L  + ELV+GV+DV R K+KGY+T+VKDGF
Sbjct  310   EVGVSESLREHMRRFNLDIIEKAGLCISTELDHVYELVLGVIDVTRCKEKGYQTLVKDGF  369

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+FL+EVSS+E   LP +  EN  PCIVYI QIGYL+CIF EKL+E
Sbjct  370   CAELDELRQIYEELPEFLQEVSSMEFEHLPHLHKENLPPCIVYIQQIGYLMCIFGEKLEE  429

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                +++ +FEF+                              F D DG+T +FFY T KT
Sbjct  430   IALDRIKEFEFS------------------------------FSDLDGETHRFFYHTPKT  459

Query  239   RELDTLLGDIYHKILGM  189
             RELD +LGDIYHKIL M
Sbjct  460   RELDNVLGDIYHKILDM  476



>ref|XP_010545522.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X6 [Tarenaya 
hassleriana]
Length=777

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/504 (65%), Positives = 392/504 (78%), Gaps = 37/504 (7%)
 Frame = -1

Query  1679  VYMACIMHGHR-----IGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTS  1515
             VYMACI HG R     IGVSYYD +IRQL+++E WED   +FPL+D++KYQ  P VIYTS
Sbjct  13    VYMACIQHGRRFVNYLIGVSYYDCNIRQLHLLEFWEDSCSEFPLIDIVKYQANPLVIYTS  72

Query  1514  TKSEESFLAALQR--CDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERI  1341
             TKSEESFL+ALQ+   D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI
Sbjct  73    TKSEESFLSALQQNDVDGTCETPMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERI  132

Query  1340  SFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKV  1161
              +LSSMMD+ S+VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+
Sbjct  133   CYLSSMMDMGSEVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKL  192

Query  1160  DSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldldd  981
             D AA EALQIFQIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ 
Sbjct  193   DVAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLEL  252

Query  980   lnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             L+ RL+AISF + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +L
Sbjct  253   LDHRLNAISFFISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISAL  312

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             LH+NKIFEV +SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+
Sbjct  313   LHVNKIFEVVVSETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQ  372

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCI  441
             T+VK+GFC ELDELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CI
Sbjct  373   TMVKEGFCAELDELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCI  432

Query  440   FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKF  261
             F EKL+E   E+L +F+FA                              F D DG+T++F
Sbjct  433   FGEKLEETEVERLNEFDFA------------------------------FSDMDGETQRF  462

Query  260   FYRTSKTRELDTLLGDIYHKILGM  189
             FY T KTRELD LLGDIYHKIL M
Sbjct  463   FYHTPKTRELDNLLGDIYHKILDM  486



>ref|XP_010545519.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X3 [Tarenaya 
hassleriana]
Length=814

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/504 (65%), Positives = 392/504 (78%), Gaps = 37/504 (7%)
 Frame = -1

Query  1679  VYMACIMHGHR-----IGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTS  1515
             VYMACI HG R     IGVSYYD +IRQL+++E WED   +FPL+D++KYQ  P VIYTS
Sbjct  13    VYMACIQHGRRFVNYLIGVSYYDCNIRQLHLLEFWEDSCSEFPLIDIVKYQANPLVIYTS  72

Query  1514  TKSEESFLAALQR--CDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERI  1341
             TKSEESFL+ALQ+   D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI
Sbjct  73    TKSEESFLSALQQNDVDGTCETPMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERI  132

Query  1340  SFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKV  1161
              +LSSMMD+ S+VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+
Sbjct  133   CYLSSMMDMGSEVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKL  192

Query  1160  DSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldldd  981
             D AA EALQIFQIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ 
Sbjct  193   DVAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLEL  252

Query  980   lnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             L+ RL+AISF + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +L
Sbjct  253   LDHRLNAISFFISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISAL  312

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             LH+NKIFEV +SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+
Sbjct  313   LHVNKIFEVVVSETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQ  372

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCI  441
             T+VK+GFC ELDELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CI
Sbjct  373   TMVKEGFCAELDELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCI  432

Query  440   FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKF  261
             F EKL+E   E+L +F+FA                              F D DG+T++F
Sbjct  433   FGEKLEETEVERLNEFDFA------------------------------FSDMDGETQRF  462

Query  260   FYRTSKTRELDTLLGDIYHKILGM  189
             FY T KTRELD LLGDIYHKIL M
Sbjct  463   FYHTPKTRELDNLLGDIYHKILDM  486



>ref|XP_010545517.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Tarenaya 
hassleriana]
Length=817

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/504 (65%), Positives = 392/504 (78%), Gaps = 37/504 (7%)
 Frame = -1

Query  1679  VYMACIMHGHR-----IGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTS  1515
             VYMACI HG R     IGVSYYD +IRQL+++E WED   +FPL+D++KYQ  P VIYTS
Sbjct  13    VYMACIQHGRRFVNYLIGVSYYDCNIRQLHLLEFWEDSCSEFPLIDIVKYQANPLVIYTS  72

Query  1514  TKSEESFLAALQR--CDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERI  1341
             TKSEESFL+ALQ+   D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI
Sbjct  73    TKSEESFLSALQQNDVDGTCETPMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERI  132

Query  1340  SFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKV  1161
              +LSSMMD+ S+VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+
Sbjct  133   CYLSSMMDMGSEVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKL  192

Query  1160  DSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldldd  981
             D AA EALQIFQIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ 
Sbjct  193   DVAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLEL  252

Query  980   lnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             L+ RL+AISF + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +L
Sbjct  253   LDHRLNAISFFISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISAL  312

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             LH+NKIFEV +SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+
Sbjct  313   LHVNKIFEVVVSETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQ  372

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCI  441
             T+VK+GFC ELDELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CI
Sbjct  373   TMVKEGFCAELDELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCI  432

Query  440   FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKF  261
             F EKL+E   E+L +F+FA                              F D DG+T++F
Sbjct  433   FGEKLEETEVERLNEFDFA------------------------------FSDMDGETQRF  462

Query  260   FYRTSKTRELDTLLGDIYHKILGM  189
             FY T KTRELD LLGDIYHKIL M
Sbjct  463   FYHTPKTRELDNLLGDIYHKILDM  486



>ref|XP_010060319.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Eucalyptus 
grandis]
Length=782

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/497 (63%), Positives = 380/497 (76%), Gaps = 55/497 (11%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+ G+RIGVSYYDS+IRQL+V+E+WEDGS DFPL++++KYQ  P  IYTSTKSEE
Sbjct  13    VYMACILQGNRIGVSYYDSNIRQLHVLEVWEDGSPDFPLIELVKYQATPLFIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             S ++ALQR D T+EA TVKLVKSS+FSYEQAWHRLMYL+VTGMDD L+IKERIS+LSSMM
Sbjct  73    SLISALQRSDGTAEAPTVKLVKSSVFSYEQAWHRLMYLRVTGMDDGLSIKERISYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+++VRASGGLLAILE+ERI+D  EQ E  N+SI +DSV +ISLN FLK+D+AA EA
Sbjct  133   DMGSELEVRASGGLLAILENERIVDTLEQMESGNSSITIDSVIQISLNNFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTP+GRRLL                    
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPIGRRLLS-------------------  233

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
                   +EEL  SLRETLKSVKD+P ILKKFNSPS  CTS+DW+AFLKS+ SLLH+NKI 
Sbjct  234   ------SEELMDSLRETLKSVKDIPFILKKFNSPSSICTSSDWSAFLKSVSSLLHLNKIL  287

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L EQ+KYL+  I++KA   ++++LA++ ELVIGV+D++R K+KGYET+VK+ F
Sbjct  288   EVGISEGLDEQMKYLSTDILEKASSCITTELAYVYELVIGVIDISRIKEKGYETMVKESF  347

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYE LP+FLEEV+SLELA  P +  +  +PCIVYI Q+GYL+CI  EKLDE
Sbjct  348   CDELDELRQIYEELPEFLEEVTSLELAHFPDVFKDKHVPCIVYIQQVGYLMCILEEKLDE  407

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                 +L DFE+                               F D DG+  +FFYRT+KT
Sbjct  408   MTLARLEDFEYV------------------------------FSDNDGEMMRFFYRTTKT  437

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGD++HKIL M
Sbjct  438   RELDDLLGDLHHKILDM  454



>ref|XP_011012095.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X4 [Populus 
euphratica]
Length=803

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/522 (62%), Positives = 376/522 (72%), Gaps = 84/522 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC +HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P  IY STKSEE
Sbjct  13    VYMACFLHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLTIYASTKSEE  72

Query  1499  SFLAALQR-------------------------CDNTSEAATVKLVKSSLFSYEQAWHRL  1395
             SFL+ALQR                          D T+EA TVKLVKSS+FSYEQAWHRL
Sbjct  73    SFLSALQRSGTLLFTCLTYELIYMWNVFKLQSDTDGTTEAPTVKLVKSSIFSYEQAWHRL  132

Query  1394  MYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENA  1215
             +YL+VTGMDD LNIKER+S+LSSMMDI SDVQVRASGGLLAILE ERI+D  EQ E+ +A
Sbjct  133   IYLRVTGMDDGLNIKERVSYLSSMMDIGSDVQVRASGGLLAILESERIVDTLEQKEYGSA  192

Query  1214  SIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPM  1035
             SI +DSV EISLNKFLK+D+AA EALQIFQIDKHPSHMGIG AKEGFSVFGMMNKC+TP+
Sbjct  193   SITIDSVVEISLNKFLKLDAAAHEALQIFQIDKHPSHMGIGGAKEGFSVFGMMNKCMTPI  252

Query  1034  GRRLLRNWFLRPIldlddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPS  855
             G+RLLRNWFLRP                LL  E L+  L               KF+SPS
Sbjct  253   GKRLLRNWFLRP----------------LLDVENLNGRLN-------------AKFDSPS  283

Query  854   CTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFIC  675
                T  DWAAFLKS+C+LLH+ KIFEVGISE+L+E  KYLNL IV++A   ++++LA++ 
Sbjct  284   SLSTVGDWAAFLKSVCALLHLGKIFEVGISENLQEHAKYLNLNIVEQACSCITTELAYVY  343

Query  674   ELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGE  495
             ELVIGV+DVNRSK+KGY TIVK+GFC+ELDELRQIYE LPDFL +V+ LELA+LP +  E
Sbjct  344   ELVIGVIDVNRSKEKGYGTIVKEGFCDELDELRQIYEELPDFLHKVTLLELAQLPHLGKE  403

Query  494   NGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQ  315
               +PCIVYIHQIGYLLCIF EKL+E    K  DFEF                        
Sbjct  404   KLVPCIVYIHQIGYLLCIFEEKLEETSLLKPQDFEFM-----------------------  440

Query  314   CCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                    F D DG+TK++FYRT KTRELD LLGDIYHKIL M
Sbjct  441   -------FSDVDGETKRYFYRTPKTRELDELLGDIYHKILDM  475



>ref|XP_011012096.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X5 [Populus 
euphratica]
Length=802

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/522 (61%), Positives = 375/522 (72%), Gaps = 85/522 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC +HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P  IY STKSEE
Sbjct  13    VYMACFLHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLTIYASTKSEE  72

Query  1499  SFLAALQR-------------------------CDNTSEAATVKLVKSSLFSYEQAWHRL  1395
             SFL+ALQR                          D T+EA TVKLVKSS+FSYEQAWHRL
Sbjct  73    SFLSALQRSGTLLFTCLTYELIYMWNVFKLQSDTDGTTEAPTVKLVKSSIFSYEQAWHRL  132

Query  1394  MYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENA  1215
             +YL+VTGMDD LNIKER+S+LSSMMDI SDVQVRASGGLLAILE ERI+D  EQ E+ +A
Sbjct  133   IYLRVTGMDDGLNIKERVSYLSSMMDIGSDVQVRASGGLLAILESERIVDTLEQKEYGSA  192

Query  1214  SIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPM  1035
             SI +DSV EISLNKFLK+D+AA EALQIFQIDKHPSHMGIG AKEGFSVFGMMNKC+TP+
Sbjct  193   SITIDSVVEISLNKFLKLDAAAHEALQIFQIDKHPSHMGIGGAKEGFSVFGMMNKCMTPI  252

Query  1034  GRRLLRNWFLRPIldlddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPS  855
             G+RLLRNWFLRP                              L  V+++   L  F+SPS
Sbjct  253   GKRLLRNWFLRP------------------------------LLDVENLNGRLNAFDSPS  282

Query  854   CTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFIC  675
                T  DWAAFLKS+C+LLH+ KIFEVGISE+L+E  KYLNL IV++A   ++++LA++ 
Sbjct  283   SLSTVGDWAAFLKSVCALLHLGKIFEVGISENLQEHAKYLNLNIVEQACSCITTELAYVY  342

Query  674   ELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGE  495
             ELVIGV+DVNRSK+KGY TIVK+GFC+ELDELRQIYE LPDFL +V+ LELA+LP +  E
Sbjct  343   ELVIGVIDVNRSKEKGYGTIVKEGFCDELDELRQIYEELPDFLHKVTLLELAQLPHLGKE  402

Query  494   NGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQ  315
               +PCIVYIHQIGYLLCIF EKL+E    K  DFEF                        
Sbjct  403   KLVPCIVYIHQIGYLLCIFEEKLEETSLLKPQDFEFM-----------------------  439

Query  314   CCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                    F D DG+TK++FYRT KTRELD LLGDIYHKIL M
Sbjct  440   -------FSDVDGETKRYFYRTPKTRELDELLGDIYHKILDM  474



>ref|XP_009406511.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=810

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/498 (63%), Positives = 387/498 (78%), Gaps = 34/498 (7%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HGHR+GV+YYD++  QL+V+E WEDG+ + PL+D++KYQV+P VIY STK++E
Sbjct  16    VYMACIIHGHRVGVAYYDANTHQLFVIEFWEDGNGELPLIDLVKYQVKPLVIYASTKTDE  75

Query  1499  SFLAALQRCDNTS-EAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSM  1323
              FLAALQR  N S E   VKL++SS+FSYEQAWHRL+YL+V GMDD L+IKERI FL+SM
Sbjct  76    LFLAALQR--NVSIETFEVKLIRSSIFSYEQAWHRLVYLRVAGMDDGLSIKERICFLNSM  133

Query  1322  MDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALE  1143
             MD+ S+VQVRA+GGLLAILE+ER++D  +QNE   +SI +D +S+ISL+KFLK+D+AA E
Sbjct  134   MDLGSEVQVRAAGGLLAILENERLVDTFQQNECGYSSITIDCMSQISLDKFLKLDAAAHE  193

Query  1142  ALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarld  963
             ALQIFQ+DKHPS MGIGRAKEGFSVFGM NKCVTPMGRRLLR WFLRPILDLD LN RL+
Sbjct  194   ALQIFQVDKHPSDMGIGRAKEGFSVFGMFNKCVTPMGRRLLRAWFLRPILDLDMLNNRLN  253

Query  962   AISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKI  783
              ISF L  EE+  +LRETLK+V+DVP +LKKFNSPS  CT++DW AFLK ICSLLHINKI
Sbjct  254   TISFFLCCEEVMSALRETLKTVRDVPHMLKKFNSPSSLCTTSDWNAFLKCICSLLHINKI  313

Query  782   FEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDG  603
             FEVGISE L+E+L+YL L +V+KA   ++ +L ++ +LV+GV+DV RSK+KGYET+VK+G
Sbjct  314   FEVGISEYLQEKLEYLKLDLVEKASSCITMELVYVYDLVMGVIDVKRSKEKGYETLVKEG  373

Query  602   FCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLD  423
              C+ELDELR +YE LPDFLE+VS+ E A +P   G    P IVY+HQIGYL+CIF+EKL 
Sbjct  374   LCDELDELRMVYERLPDFLEQVSAYENASVPVQHGWKKAPSIVYVHQIGYLMCIFDEKLS  433

Query  422   EEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSK  243
             +E   KL DFE A                                 EDGD K+FFY T K
Sbjct  434   DETLGKLHDFELA-------------------------------FSEDGDEKRFFYHTPK  462

Query  242   TRELDTLLGDIYHKILGM  189
             TRELD LLGDIYHKIL M
Sbjct  463   TRELDNLLGDIYHKILDM  480



>ref|XP_006595731.1| PREDICTED: DNA mismatch repair protein MSH5-like isoform X4 [Glycine 
max]
Length=761

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/456 (68%), Positives = 368/456 (81%), Gaps = 30/456 (7%)
 Frame = -1

Query  1556  MIKYQVQPGVIYTSTKSEESFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVT  1377
             ++KYQ  P VIYTSTKSEESFL+ALQ+ D  +E+  VKLVKSS+FSYEQAWHRL+YL+V 
Sbjct  3     IVKYQANPLVIYTSTKSEESFLSALQQRDGAAESPIVKLVKSSIFSYEQAWHRLVYLRVA  62

Query  1376  GMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDS  1197
             GMDD LN+KERI +LSSMM++ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI +DS
Sbjct  63    GMDDGLNVKERIYYLSSMMNMGSEVQVRASGGLLAILENERIVDTLEQKESGNTSITIDS  122

Query  1196  VSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR  1017
             ++EISLN FLK+D+AA EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR
Sbjct  123   LAEISLNNFLKLDTAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR  182

Query  1016  NWFLRPIldlddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTST  837
             NWFLRPILDL+ LN RL++ISF L +EEL  SLRETLKSVKD+P +LKKF+SPS  CTS 
Sbjct  183   NWFLRPILDLEVLNYRLNSISFFLCSEELVTSLRETLKSVKDIPLLLKKFDSPSSICTSF  242

Query  836   DWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGV  657
             DW A LKSIC++LH+NKIFEVGISE LRE+LKYLNL IV+KA  H++++L ++ ELVIGV
Sbjct  243   DWTALLKSICAMLHVNKIFEVGISEGLREELKYLNLDIVEKASSHITAELGYVYELVIGV  302

Query  656   LDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCI  477
             +DVNR+K+KGY T+VK+GFC+ELDELRQIYE LP+FLEEVSSLELA+LP +  +  +PCI
Sbjct  303   IDVNRTKEKGYATVVKEGFCDELDELRQIYEELPEFLEEVSSLELAQLPVLCKDKRIPCI  362

Query  476   VYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS  297
             VYI QIGYL+CIF EK +E   E+L D+E+  C                           
Sbjct  363   VYIQQIGYLMCIFGEKPEETTLEQLVDWEYTFC---------------------------  395

Query  296   *FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                D DG+TKK+FYRT KTRELD+LLGDI+HKIL M
Sbjct  396   ---DTDGETKKYFYRTPKTRELDSLLGDIHHKILDM  428



>ref|XP_009608754.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X6 [Nicotiana 
tomentosiformis]
Length=798

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/435 (72%), Positives = 349/435 (80%), Gaps = 49/435 (11%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHGHRIGVSYYD+SIRQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACVMHGHRIGVSYYDASIRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL ALQR D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  72    SFLGALQRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  131

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  132   DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  191

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD+LN RLD 
Sbjct  192   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLDNLNRRLDT  251

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS   TS DWAAFLK            
Sbjct  252   ISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPSSISTSADWAAFLK------------  299

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
                                                  VIGV DV+RSK+KGYETIVK+GF
Sbjct  300   -------------------------------------VIGVTDVDRSKEKGYETIVKEGF  322

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FL EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  323   CDELDELRQIYEGLPEFLGEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  382

Query  419   EMQEKLPDFEFAVCH  375
             EM EKL D+EFAVCH
Sbjct  383   EMLEKLQDYEFAVCH  397



>ref|XP_006654595.1| PREDICTED: DNA mismatch repair protein MSH5-like [Oryza brachyantha]
Length=790

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/495 (61%), Positives = 379/495 (77%), Gaps = 32/495 (6%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             MAC+M G R+GV+YYDSS+RQL+V+EIWED ++DFPL+D++KYQ +P  IYTSTK+EES 
Sbjct  1     MACVMQGRRVGVAYYDSSMRQLFVLEIWEDIAEDFPLIDLVKYQSRPSTIYTSTKTEESL  60

Query  1493  LAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDI  1314
             L ALQR D+  EA  VKL+KSS FSYEQAWHRLMYL+V  MD+ L++KERI FL+SMMD+
Sbjct  61    LLALQRNDSNGEAPAVKLMKSSTFSYEQAWHRLMYLKVAAMDEGLSVKERICFLNSMMDL  120

Query  1313  SSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQ  1134
              SDVQVRA+GGLLAIL++ER++D  +Q E   ASIA+DSV++ISL+KFLK+D+ A EALQ
Sbjct  121   GSDVQVRAAGGLLAILDNERLLDTLDQME-GGASIAIDSVAQISLDKFLKLDATAHEALQ  179

Query  1133  IFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAIS  954
             IFQ+DKHPS+MGIGRAKEGFSVFGM+NKCVTPMG+RLLR WFLRPI+D++ +N RL+ IS
Sbjct  180   IFQVDKHPSYMGIGRAKEGFSVFGMVNKCVTPMGKRLLRTWFLRPIVDIEVINNRLNTIS  239

Query  953   FLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEV  774
             F L  EE+  +LRETLKSV+D+P +LKKFNSPS  CTS DW  FLK ICSLLHINKIFEV
Sbjct  240   FFLCCEEVMAALRETLKSVRDIPHMLKKFNSPSSLCTSNDWHTFLKCICSLLHINKIFEV  299

Query  773   GISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCN  594
             GISE L  +L+++N+ +V KA   ++ +L ++ +LV+GV+DV R K+KGYET+VK+G C+
Sbjct  300   GISEHLANKLQHMNIDLVGKANSSITEELDYVSDLVVGVIDVQRGKEKGYETLVKEGLCD  359

Query  593   ELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEM  414
             ELDELR +YE LPDFLE+VS+ E A  P        P IVY+HQIGYL+C F+EK+ + +
Sbjct  360   ELDELRMVYEELPDFLEQVSANENASFPFSFECRKAPLIVYVHQIGYLMCFFDEKISDAL  419

Query  413   QEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRE  234
                LPDFEFA                                 E+G+ ++F+Y T KTRE
Sbjct  420   LIGLPDFEFA-------------------------------FSEEGEERRFYYHTQKTRE  448

Query  233   LDTLLGDIYHKILGM  189
             LD LLGDIYHKIL M
Sbjct  449   LDNLLGDIYHKILDM  463



>emb|CDY19637.1| BnaA05g20450D [Brassica napus]
Length=851

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/543 (58%), Positives = 382/543 (70%), Gaps = 76/543 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S+RQL+V+E WE+   DF L++M+KYQ +P VIYTSTKSE+
Sbjct  13    VYMACIQHGRRVGVSYYDCSVRQLHVLEFWEEDCSDFTLVNMVKYQAKPLVIYTSTKSED  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF++ALQ+ D T E   VK VKSS FSYEQAWHRL+YL+VTGMD+ LNIKER+ +LSSMM
Sbjct  73    SFVSALQKSDGTEEDTMVKQVKSSTFSYEQAWHRLVYLRVTGMDEGLNIKERVCYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI+D  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVDTLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLL-----------------------------FAEELSVSLRETLKSV----------  897
             +SF L                             FA+E   SL    + V          
Sbjct  253   VSFFLRLMPSRIGVGNQADDIFAGYTEICEGHIPFAQESVFSLHAMCELVCRSCRFFISC  312

Query  896   -------KDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKY  738
                        C  KKFNSP+  CTS DW AF+KSI +LLH+NKIFEVG+SE LRE ++ 
Sbjct  313   THLVLLNISFLCENKKFNSPTSLCTSNDWTAFMKSIGALLHVNKIFEVGVSESLREHMRR  372

Query  737   LNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGL  558
              NL I++KAG  +S++L ++ ELV+GV+DV RSK+KGY+T+VKDGFC ELDELRQIYEGL
Sbjct  373   FNLDIIEKAGLCISTELDYVYELVLGVIDVTRSKEKGYQTLVKDGFCAELDELRQIYEGL  432

Query  557   PDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVC  378
             P+FL+EVSS+E   LP +  EN  PCIVYI QIGYL+CIF EKLDE   +++ +FEFA  
Sbjct  433   PEFLQEVSSMEFEHLPHLHKENLPPCIVYIQQIGYLMCIFGEKLDETALDRINEFEFA--  490

Query  377   HLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
                                         F D DG+T++FFY T KTRELD +LGDIYHKI
Sbjct  491   ----------------------------FSDLDGETQRFFYHTPKTRELDNVLGDIYHKI  522

Query  197   LGM  189
             L M
Sbjct  523   LDM  525



>gb|KDP39150.1| hypothetical protein JCGZ_00907 [Jatropha curcas]
Length=745

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/495 (62%), Positives = 362/495 (73%), Gaps = 78/495 (16%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             MACI+HGH +G+SYYDSSIRQL+V+EIWED S DFPL+D++KYQ +P  IYTS+KSEESF
Sbjct  1     MACILHGHTVGISYYDSSIRQLHVLEIWEDVSSDFPLIDLVKYQAKPLTIYTSSKSEESF  60

Query  1493  LAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDI  1314
             ++ALQR D T EA TVKLVKSS+FSYEQAWHRL+YL+VTGMD+ LNIKERI +LSSMMD+
Sbjct  61    ISALQRSDGTPEAPTVKLVKSSIFSYEQAWHRLIYLRVTGMDNGLNIKERICYLSSMMDM  120

Query  1313  SSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQ  1134
              S++QVR SGGLLAILE+ERI+D  EQ E  NASI +D+V++ISLNKFLK+D+AA EALQ
Sbjct  121   GSEIQVRVSGGLLAILENERIVDALEQKECGNASITIDAVTKISLNKFLKLDAAAHEALQ  180

Query  1133  IFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAIS  954
             IFQIDKHPSHMGIGR+KEGFSVFGMMNKC TPMG+RLL+NWFLRPIL             
Sbjct  181   IFQIDKHPSHMGIGRSKEGFSVFGMMNKCATPMGQRLLKNWFLRPIL-------------  227

Query  953   FLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEV  774
                                 D+  +  + N+               SICSLLH++KIFEV
Sbjct  228   --------------------DLERLNGRLNA---------------SICSLLHVDKIFEV  252

Query  773   GISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCN  594
             GISE LREQ K LNL I+++AG  +S++LA++ ELVIGV+DVNRSK+K Y TIVK+GFC 
Sbjct  253   GISESLREQAKCLNLNIIEQAGFCISTELAYVYELVIGVIDVNRSKEKDYGTIVKEGFCE  312

Query  593   ELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEM  414
             ELDELRQIYE LPDFL++VS LELA+LP +  E   PCIVY+HQIGYLLCIF EKLDE +
Sbjct  313   ELDELRQIYEELPDFLQKVSLLELAQLPHLSNEKLTPCIVYLHQIGYLLCIFEEKLDETL  372

Query  413   QEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRE  234
              EKL DFEF                               F D DG+TK+FFYRT KTRE
Sbjct  373   LEKLQDFEFV------------------------------FSDADGETKRFFYRTPKTRE  402

Query  233   LDTLLGDIYHKILGM  189
             LD LLGDIYHKIL M
Sbjct  403   LDNLLGDIYHKILDM  417



>ref|NP_001055948.1| Os05g0498300 [Oryza sativa Japonica Group]
 gb|AAT44285.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17862.1| Os05g0498300 [Oryza sativa Japonica Group]
Length=809

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/497 (60%), Positives = 379/497 (76%), Gaps = 32/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V+MAC+M G R+G++YYDSS+ QL+V+EIWED ++DFPL+D++KYQ +P  IYTSTK++E
Sbjct  18    VHMACVMQGRRVGIAYYDSSMHQLFVLEIWEDITEDFPLIDLVKYQSKPSTIYTSTKTDE  77

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             + L ALQR D   EA  VKL+KSS FSYEQAWHRLMYL+V  MD+ L++KERI FL+SMM
Sbjct  78    ALLLALQRNDCNDEAPAVKLMKSSTFSYEQAWHRLMYLKVAAMDEGLSVKERICFLNSMM  137

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVRA+GGLLAIL++ER++D  +Q E   ASIA+DSV++ISL+KFLK+D+ A EA
Sbjct  138   DLGSDVQVRAAGGLLAILDNERLLDTLDQME-GGASIAIDSVAQISLDKFLKLDATAHEA  196

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ+DKHPS+MGIGRAKEGFSVFGM+NKCVTPMG+ LLR WFLRPI+D+D +N RL+ 
Sbjct  197   LQIFQVDKHPSYMGIGRAKEGFSVFGMLNKCVTPMGKHLLRTWFLRPIIDIDVINNRLNT  256

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L  E++  +LR TLKSV+D+P +LKKFNSPS  CTS+DW AFLK ICSLLHINKIF
Sbjct  257   ISFFLCCEDVMSALRGTLKSVRDIPHMLKKFNSPSSFCTSSDWHAFLKCICSLLHINKIF  316

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L  +L+++N+ +V KA   ++ +L ++ +LV+GV+DV R K+KGY+T+VKDG 
Sbjct  317   EVGISEHLAIKLQHMNIDLVGKANSSITEELDYVSDLVVGVIDVQRGKEKGYDTLVKDGL  376

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELR +YE LPDFLE+VS+ E+A  P        P IVY+HQIGYL+C F+EK+ +
Sbjct  377   CEELDELRMVYEELPDFLEQVSANEIASFPFSFECRKAPLIVYVHQIGYLMCFFDEKISD  436

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
              +   LPDFEFA                                 E+G+ ++F+Y T KT
Sbjct  437   ALLIGLPDFEFA-------------------------------FSEEGEERRFYYHTQKT  465

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  466   RELDNLLGDIYHKILDM  482



>gb|AFP73611.1| mutS-like protein 5 [Hordeum vulgare subsp. vulgare]
Length=792

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/495 (60%), Positives = 376/495 (76%), Gaps = 32/495 (6%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             MAC+M G R+GVSYYDS  RQL+V+EIWED +  FPL+D++K Q +P  IY STK+EE  
Sbjct  1     MACVMQGRRVGVSYYDSDTRQLFVLEIWEDSAGGFPLIDLVKCQAKPSTIYASTKTEEEL  60

Query  1493  LAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDI  1314
             L+ALQR D+  +   VKLVKSS F+YEQAWHRL+YL+V  MDD L++KERI FL+SMMD+
Sbjct  61    LSALQRNDSNDDPPVVKLVKSSTFTYEQAWHRLIYLKVAAMDDGLSVKERICFLNSMMDL  120

Query  1313  SSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQ  1134
              SDVQVRA+GGLLAIL++ER++D  EQ E   ASIA+DSV++ISL++FLK+D+AA EALQ
Sbjct  121   GSDVQVRAAGGLLAILDNERLLDTLEQME-GGASIAIDSVAQISLDRFLKLDAAAHEALQ  179

Query  1133  IFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAIS  954
             IFQ+DKHPS+MGIGRAKEGFSVFG++NKCVTPMGRRLLR WFLRPI+D++ +N RL+ IS
Sbjct  180   IFQVDKHPSYMGIGRAKEGFSVFGILNKCVTPMGRRLLRAWFLRPIIDIEVINNRLNTIS  239

Query  953   FLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEV  774
             F L  EE+  +LRETLKSV+DVP +LKKFNSPS +CTS DW  FLK ICSLLHINKIFEV
Sbjct  240   FFLCCEEVMSALRETLKSVRDVPHMLKKFNSPSSSCTSNDWHTFLKCICSLLHINKIFEV  299

Query  773   GISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCN  594
             GISE L  +L+++++ +++KA   ++++L ++  LV+GV+DV RSK+KGYET+VK+  C+
Sbjct  300   GISEHLANKLQHMSIDLLEKANSSITAELDYVSNLVVGVIDVQRSKEKGYETLVKENLCD  359

Query  593   ELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEM  414
             ELDELR +YEGLPDFLE+VS+ E A  P  +     P IVY+HQIGYL+C F+EK+ + +
Sbjct  360   ELDELRMVYEGLPDFLEQVSANENASFPFSLECRKAPLIVYVHQIGYLMCFFDEKISDAL  419

Query  413   QEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRE  234
                L DFEFA                                 EDG+ ++F+Y T KTRE
Sbjct  420   LIGLQDFEFA-------------------------------FSEDGEERRFYYHTQKTRE  448

Query  233   LDTLLGDIYHKILGM  189
             LD LLGDIYHKIL M
Sbjct  449   LDNLLGDIYHKILDM  463



>ref|XP_004961619.1| PREDICTED: DNA mismatch repair protein MSH5-like [Setaria italica]
Length=814

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/500 (59%), Positives = 382/500 (76%), Gaps = 40/500 (8%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V+MAC+M G R+GV+YYD++ RQL+V+EIWED + +FPL+D++K+Q +P  IY STK+EE
Sbjct  23    VHMACVMQGRRVGVAYYDTNTRQLFVLEIWEDSAGEFPLIDLVKFQSKPSTIYASTKTEE  82

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             + L+ALQR D   EA  VKL+KSS FSYE AWHRL+YL+V  MDD L++KERI FL+SMM
Sbjct  83    ALLSALQRNDGNDEAPVVKLMKSSTFSYEPAWHRLIYLKVAAMDDGLSVKERICFLNSMM  142

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVRA+GGLLAIL++ER++D  EQ E   ASIA+DSV++ISL+KFLK+D+ A EA
Sbjct  143   DLGSDVQVRAAGGLLAILDNERLLDTIEQME-GGASIAIDSVAQISLDKFLKLDATAHEA  201

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ+DKHPS+MGIGRAKEGFSVFGM+NKCVTPMGRRLLR WFLRPI+D+D +N RL+ 
Sbjct  202   LQIFQVDKHPSYMGIGRAKEGFSVFGMLNKCVTPMGRRLLRAWFLRPIIDIDVINNRLNT  261

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             I+F L  EE+  +L ETLKSV+DVP +LKKFNSPS  CTS+DW  FLK ICSLLHINKIF
Sbjct  262   ITFFLCCEEVMSALCETLKSVRDVPHMLKKFNSPSSFCTSSDWNTFLKCICSLLHINKIF  321

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L  +L+++N+ ++ KA   ++++L ++ +LV+GV+DV R K+KGYET+VK+G 
Sbjct  322   EVGISEHLANKLQHMNIDLIGKANSSITAELDYVSDLVVGVIDVQRGKEKGYETVVKEGL  381

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLP---RMVGENGLPCIVYIHQIGYLLCIFNEK  429
             C+ELDELR +YEGLPDFLE+VS+ E A LP   R+      P IVY+HQIGYL+C F+EK
Sbjct  382   CDELDELRMVYEGLPDFLEQVSANENASLPFEFRIP-----PLIVYVHQIGYLMCFFDEK  436

Query  428   LDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRT  249
             + + +   LPD++FA                                 E+G+ ++F+Y T
Sbjct  437   ISDALLVGLPDYKFA-------------------------------FSEEGEERRFYYHT  465

Query  248   SKTRELDTLLGDIYHKILGM  189
              KTRELD LLGDIYHKIL M
Sbjct  466   QKTRELDNLLGDIYHKILDM  485



>ref|XP_010666206.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=785

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/497 (63%), Positives = 376/497 (76%), Gaps = 54/497 (11%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMAC+MHG R+G+SYYDSSIRQL V+E+WEDG+ +FPL+D++K+Q QP +IYTSTKSEE
Sbjct  14    VYMACVMHGQRVGISYYDSSIRQLSVLEVWEDGA-EFPLIDLVKHQAQPLIIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
              FL ALQR D  + + TVKL+KSS+FS+EQAWH                       SSMM
Sbjct  73    QFLLALQRSDGINFSPTVKLMKSSIFSFEQAWH-----------------------SSMM  109

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             DI+S+VQVRA+GGLLAILE+ER++D  E  E+ +ASI+VD ++E+SLNKFLK+D+AA EA
Sbjct  110   DIASEVQVRATGGLLAILENERLVDTLETKEYGDASISVDCLTEVSLNKFLKLDAAAHEA  169

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR WFLRPILDLD LN+RLDA
Sbjct  170   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRKWFLRPILDLDILNSRLDA  229

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L++EEL  SLR TLK++KDVP ILKKFNSPS  CT++DWAAFLKS+ S LH+NKIF
Sbjct  230   ISFFLYSEELMASLRGTLKTIKDVPYILKKFNSPSSVCTASDWAAFLKSLSSFLHLNKIF  289

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+ E LRE + +  L I+ KA   ++++L++I ELV G++DV R K+KGY TIVK+GF
Sbjct  290   EVGVPESLREHVNHFYLDIIDKAASCITTELSYISELVTGIIDVTREKEKGYGTIVKEGF  349

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELRQIYE LP+ LEEVSSLELARLP +  +  +PCI+YIHQIGYLLCI  EKLDE
Sbjct  350   CEELDELRQIYEELPELLEEVSSLELARLPNLHRDECVPCIIYIHQIGYLLCISEEKLDE  409

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
                + L D E+A                              F D + + K+FFYRTSKT
Sbjct  410   RTLQTLEDIEYA------------------------------FSDGEKEPKRFFYRTSKT  439

Query  239   RELDTLLGDIYHKILGM  189
             RELD +LGDIYHKIL M
Sbjct  440   RELDNVLGDIYHKILDM  456



>gb|EEE64238.1| hypothetical protein OsJ_19071 [Oryza sativa Japonica Group]
Length=1046

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/497 (60%), Positives = 379/497 (76%), Gaps = 32/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V+MAC+M G R+G++YYDSS+ QL+V+EIWED ++DFPL+D++KYQ +P  IYTSTK++E
Sbjct  255   VHMACVMQGRRVGIAYYDSSMHQLFVLEIWEDITEDFPLIDLVKYQSKPSTIYTSTKTDE  314

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             + L ALQR D   EA  VKL+KSS FSYEQAWHRLMYL+V  MD+ L++KERI FL+SMM
Sbjct  315   ALLLALQRNDCNDEAPAVKLMKSSTFSYEQAWHRLMYLKVAAMDEGLSVKERICFLNSMM  374

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVRA+GGLLAIL++ER++D  +Q E   ASIA+DSV++ISL+KFLK+D+ A EA
Sbjct  375   DLGSDVQVRAAGGLLAILDNERLLDTLDQME-GGASIAIDSVAQISLDKFLKLDATAHEA  433

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ+DKHPS+MGIGRAKEGFSVFGM+NKCVTPMG+ LLR WFLRPI+D+D +N RL+ 
Sbjct  434   LQIFQVDKHPSYMGIGRAKEGFSVFGMLNKCVTPMGKHLLRTWFLRPIIDIDVINNRLNT  493

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L  E++  +LR TLKSV+D+P +LKKFNSPS  CTS+DW AFLK ICSLLHINKIF
Sbjct  494   ISFFLCCEDVMSALRGTLKSVRDIPHMLKKFNSPSSFCTSSDWHAFLKCICSLLHINKIF  553

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L  +L+++N+ +V KA   ++ +L ++ +LV+GV+DV R K+KGY+T+VKDG 
Sbjct  554   EVGISEHLAIKLQHMNIDLVGKANSSITEELDYVSDLVVGVIDVQRGKEKGYDTLVKDGL  613

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C ELDELR +YE LPDFLE+VS+ E+A  P        P IVY+HQIGYL+C F+EK+ +
Sbjct  614   CEELDELRMVYEELPDFLEQVSANEIASFPFSFECRKAPLIVYVHQIGYLMCFFDEKISD  673

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
              +   LPDFEFA                                 E+G+ ++F+Y T KT
Sbjct  674   ALLIGLPDFEFA-------------------------------FSEEGEERRFYYHTQKT  702

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  703   RELDNLLGDIYHKILDM  719



>ref|XP_003571344.1| PREDICTED: DNA mismatch repair protein MSH5 [Brachypodium distachyon]
Length=815

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/497 (61%), Positives = 378/497 (76%), Gaps = 32/497 (6%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V+MAC+M G RIGV+YYDS+ RQL+V+EIWED +  FPL+D++K Q +P  IY STK+EE
Sbjct  22    VHMACVMQGRRIGVAYYDSNTRQLFVLEIWEDSAGGFPLIDLVKCQAKPSTIYASTKTEE  81

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
               L+ALQ+ D   EA  VKL+KSS FSYEQAWHRL+YL+V GMDD L++KERI FL+SMM
Sbjct  82    ELLSALQQNDGNGEAPVVKLMKSSTFSYEQAWHRLIYLKVAGMDDGLSVKERICFLNSMM  141

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVRA+GGLLAIL++ER++D  EQ E   ASI +DSV++ISL++FLK+D+AA EA
Sbjct  142   DLGSDVQVRAAGGLLAILDNERLLDTVEQME-GGASIEIDSVAQISLDRFLKLDAAAHEA  200

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ+DKHPS+MGIGRAKEGFSVFGM+NKCVTPMGRRLLR WFLRPI+D+D ++ RLD 
Sbjct  201   LQIFQVDKHPSYMGIGRAKEGFSVFGMLNKCVTPMGRRLLRGWFLRPIIDIDVIHNRLDT  260

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L  EE+  +LRETLKSV+D+P +LKKFNSPS +CTS+DW   LK ICSLLHINKIF
Sbjct  261   ISFFLCCEEVMTALRETLKSVRDIPHMLKKFNSPSSSCTSSDWHTVLKCICSLLHINKIF  320

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L  +L+ +N+ +VKKA   ++++L ++  LVIG +DV RSK+KGY+T+VK+G 
Sbjct  321   EVGISEHLANKLQNINIDLVKKANSSITAELDYVSNLVIGAIDVQRSKEKGYDTVVKEGL  380

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELR +YEGLPDFLE+VS+ E A  P  +     P IVYIHQIGYL+C F+EK+ +
Sbjct  381   CDELDELRMVYEGLPDFLEQVSANENASFPFALECREAPLIVYIHQIGYLMCFFDEKISD  440

Query  419   EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKT  240
              +   L DFEFA                                 EDG+ ++F+Y T KT
Sbjct  441   ALLVGLQDFEFA-------------------------------FSEDGEERRFYYHTQKT  469

Query  239   RELDTLLGDIYHKILGM  189
             RELD LLGDIYHKIL M
Sbjct  470   RELDNLLGDIYHKILDM  486



>gb|KHN38268.1| MutS protein like 5 [Glycine soja]
Length=806

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/519 (58%), Positives = 375/519 (72%), Gaps = 80/519 (15%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI++G+RIGVSYYDS++RQLYV+EIW+DG + FP++D++KYQ  P VIYTSTKSEE
Sbjct  13    VYMACILNGNRIGVSYYDSTLRQLYVLEIWDDGDRGFPVIDLVKYQANPLVIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQ+ D  +E+ TVKLVKSS+FSYEQAWHRL+YL+V GMDD LN+KE+I +LSSMM
Sbjct  73    SFLSALQQSDGVAESPTVKLVKSSIFSYEQAWHRLVYLRVAGMDDGLNVKEKIYYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISL---------NKFL  1167
             D+ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI +DS++EISL         N FL
Sbjct  133   DLGSEVQVRASGGLLAILENERIVDTLEQKESGNTSITIDSLAEISLFCPLLRRYRNNFL  192

Query  1166  KVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldl  987
             K+D+ A EALQIFQIDKHPSHMGIGRAKEG      M +CVTPMGRRLLRNWFLRPI   
Sbjct  193   KLDTTAHEALQIFQIDKHPSHMGIGRAKEGTKCLSCM-QCVTPMGRRLLRNWFLRPI---  248

Query  986   ddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSIC  807
                   L+ +++ L ++ L + LRETLKSVKD+P                     L SIC
Sbjct  249   ----LDLEVLNYRLNSKNL-LPLRETLKSVKDIP-------------------HLLNSIC  284

Query  806   SLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICEL-------------V  666
             +LLH+N+IFEVGIS+ LRE+LKYLNL IV+KA  +++++L ++ EL             V
Sbjct  285   ALLHVNEIFEVGISKGLREELKYLNLDIVEKASSYITAELGYVYELISAQVGSGTTILRV  344

Query  665   IGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGL  486
             IGV+DVNR+K+KGY T+VK+GFC+ELDELRQIYE LP+FLEEVSSLELA+LP +  +  +
Sbjct  345   IGVIDVNRTKEKGYATVVKEGFCDELDELRQIYEELPEFLEEVSSLELAQLPVLCKDKRI  404

Query  485   PCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCW  306
             PCIVYI QIGYL+CIF EK +E   E+L D+E+  C                        
Sbjct  405   PCIVYIQQIGYLMCIFEEKPEETTLEQLVDWEYTFC------------------------  440

Query  305   LIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                   D DG+TKK+FYRT KTRELD+LLGDI+HKIL M
Sbjct  441   ------DTDGETKKYFYRTPKTRELDSLLGDIHHKILDM  473



>ref|XP_008777633.1| PREDICTED: DNA mismatch repair protein MSH5, partial [Phoenix 
dactylifera]
Length=773

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/455 (65%), Positives = 357/455 (78%), Gaps = 32/455 (7%)
 Frame = -1

Query  1553  IKYQVQPGVIYTSTKSEESFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTG  1374
             +KYQ +P VIY STK+EE+ L+ALQ+ +  +EA  VKL++SS+FSYEQAWHRL+YL+V G
Sbjct  20    VKYQAKPVVIYASTKTEEALLSALQQ-NGGNEAGVVKLIRSSVFSYEQAWHRLVYLRVAG  78

Query  1373  MDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSV  1194
             MDD L+IKERI FL+SMMD+ SD+QVRA+GGLLAILE+ER++D  EQ E  N+SI +D V
Sbjct  79    MDDGLSIKERICFLNSMMDLGSDIQVRAAGGLLAILENERLVDTFEQKECGNSSITIDCV  138

Query  1193  SEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRN  1014
             ++ISL+KFLK+D+AA EALQIFQ+DKHPSHMGIGRAKEGFSVFGM NKC TPMGRRLLR 
Sbjct  139   TQISLDKFLKLDAAAYEALQIFQVDKHPSHMGIGRAKEGFSVFGMFNKCATPMGRRLLRM  198

Query  1013  WFLRPIldlddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTD  834
             WFLRPILDLD LN+RL+ ISF L  EE+  +L ETLKSV+DVP +LKKFNSPS  CTS+D
Sbjct  199   WFLRPILDLDILNSRLNTISFFLCCEEVMSALHETLKSVRDVPHLLKKFNSPSSLCTSSD  258

Query  833   WAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVL  654
             W AFL+ ICSLLHINKIF+VGISE L+E+L+YLNLG+V KA   ++ +L ++ +LV+GV+
Sbjct  259   WNAFLECICSLLHINKIFQVGISEYLQERLEYLNLGLVDKANSCIAMELVYVFDLVMGVI  318

Query  653   DVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIV  474
             DV RSK+K YET+VK+G C+ELDELR IYEGLPDFLE+VSS E A LP +      PCIV
Sbjct  319   DVQRSKEKEYETLVKEGICDELDELRMIYEGLPDFLEQVSSFENASLPFLHESKKAPCIV  378

Query  473   YIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*  294
             YIHQIGYL+CIF+EKL+E++ EKL DFEFA                              
Sbjct  379   YIHQIGYLMCIFDEKLNEDILEKLQDFEFA------------------------------  408

Query  293   FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                EDGD KK+FY TSKTRELD LLGDIYHKIL M
Sbjct  409   -FSEDGDEKKYFYHTSKTRELDNLLGDIYHKILDM  442



>ref|XP_002317341.2| hypothetical protein POPTR_0011s09190g [Populus trichocarpa]
 gb|EEE97953.2| hypothetical protein POPTR_0011s09190g [Populus trichocarpa]
Length=791

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/521 (59%), Positives = 365/521 (70%), Gaps = 102/521 (20%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P  IYTSTK EE
Sbjct  13    VYMACILHGHRVGISYYDSSIRQLHVLEVWEDGSSDFPLIDLVKYQAKPLNIYTSTKCEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQR D T+EA  VKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKER+S+LSSMM
Sbjct  73    SFLSALQRSDGTTEAPMVKLVKSSIFSYEQAWHRLIYLRVTGMDDGLNIKERVSYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISL-------------  1179
             DI SDVQVRASGGLLAILE ERI+D  EQ E+ NASI +DS+ EISL             
Sbjct  133   DIGSDVQVRASGGLLAILESERIVDTLEQKEYGNASITIDSIVEISLYLFIYKRNLENNL  192

Query  1178  -------NKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLL  1020
                    NKFLK+D+AA EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTP+G+ LL
Sbjct  193   SFTYQIRNKFLKLDAAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPIGKHLL  252

Query  1019  RNWFLRPIldlddln--arldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTC  846
             RNWFLRP+LD+++LN       ISF L +EEL VSLRETLKSVKD+  IL+KF+SPS   
Sbjct  253   RNWFLRPLLDVENLNGRLNAIKISFFLCSEELMVSLRETLKSVKDIKRILRKFDSPSSLS  312

Query  845   TSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELV  666
             T  DW AFLKS+C+LLH+ KIFEVGISE+L+E  KYLNL IV++A   ++++LA++ ELV
Sbjct  313   TVGDWTAFLKSVCALLHLGKIFEVGISENLQEHAKYLNLNIVEQACSCITTELAYVYELV  372

Query  665   IGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGL  486
             IGV+DVNRSK+KGY TIVK+GFC+E                                   
Sbjct  373   IGVIDVNRSKEKGYGTIVKEGFCDE-----------------------------------  397

Query  485   PCIVYIHQIGYLLCIFNEKLDE--EMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQC  312
                            F+ +LDE  ++ E+LPDF                       LH+ 
Sbjct  398   -------------PFFHMQLDELRQIYEELPDF-----------------------LHK-  420

Query  311   CWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                   F D DG+TK++FYRT KTRELD LLGDIYHKIL +
Sbjct  421   ------FFDVDGETKRYFYRTPKTRELDELLGDIYHKILAV  455



>ref|XP_009608760.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X11 [Nicotiana 
tomentosiformis]
Length=795

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/375 (77%), Positives = 331/375 (88%), Gaps = 0/375 (0%)
 Frame = -1

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             +F   + R D+TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +FLSSMM
Sbjct  20    TFPWLIWRSDSTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAFLSSMM  79

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA EA
Sbjct  80    DVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAHEA  139

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPMGRRLLR+WFLRPILDLD+LN RLD 
Sbjct  140   LQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPMGRRLLRSWFLRPILDLDNLNRRLDT  199

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS   TS DWAAFLKS+C+LLHI+KIF
Sbjct  200   ISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPSSISTSADWAAFLKSVCALLHISKIF  259

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGIS  L E+LK L+L I+++A  H+S DLA++CELVIGV DV+RSK+KGYETIVK+GF
Sbjct  260   EVGISGSLYEELKNLDLDIIERADFHISVDLAYVCELVIGVTDVDRSKEKGYETIVKEGF  319

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDE  420
             C+ELDELRQIYEGLP+FL EVS+LELARLP M  +  +P I+YIHQIGYL+CIFNEKLDE
Sbjct  320   CDELDELRQIYEGLPEFLGEVSALELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKLDE  379

Query  419   EMQEKLPDFEFAVCH  375
             EM EKL D+EFAVCH
Sbjct  380   EMLEKLQDYEFAVCH  394



>ref|XP_010468325.1| PREDICTED: DNA mismatch repair protein MSH5-like [Camelina sativa]
Length=596

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/413 (67%), Positives = 337/413 (82%), Gaps = 3/413 (1%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S R+L+V+E+WE+   DF L++M+KYQ +P +IYTSTKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSERKLHVLEVWEEDCSDFTLINMVKYQAKPSIIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+AALQ+ D T E   V+LVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFVAALQQSDGTDENTVVRLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE   ASIA+DSV E+ LNKFLK+D+AA EA
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGTASIAIDSVMEVPLNKFLKLDAAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ DKHPSHMGIGRAKEGFSVFGMMNKC TPMGRRLLR+WF+RPILDL+ L+ RL+A
Sbjct  193   LQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDLEVLDRRLNA  252

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             ISF + + EL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIF
Sbjct  253   ISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIF  312

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVG+SE LRE ++  NL I++KAG  +S++L ++ ELVIGV+DV RSK++GY+T+VK+GF
Sbjct  313   EVGVSESLREHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGF  372

Query  599   CNELDELRQIYEGLPDFLEEVSSLELARLPR--MVGENGLPCIVYIHQIGYLL  447
             C ELDELRQIYE LP+FL+EV S+    +    M  E     ++ +HQ+G +L
Sbjct  373   CAELDELRQIYEELPEFLQEVVSMIFCAMGSKFMTAEQS-TFMIDLHQVGMML  424



>ref|XP_009406512.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=761

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/498 (58%), Positives = 348/498 (70%), Gaps = 83/498 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HGHR+GV+YYD++  QL+V+E WEDG+ + PL+D++KYQV+P VIY STK++E
Sbjct  16    VYMACIIHGHRVGVAYYDANTHQLFVIEFWEDGNGELPLIDLVKYQVKPLVIYASTKTDE  75

Query  1499  SFLAALQRCDNTS-EAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSM  1323
              FLAALQR  N S E   VKL++SS+FSYEQAWHRL+YL+V GMDD L+IKERI FL+SM
Sbjct  76    LFLAALQR--NVSIETFEVKLIRSSIFSYEQAWHRLVYLRVAGMDDGLSIKERICFLNSM  133

Query  1322  MDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALE  1143
             MD+ S+VQVRA+GGLLAILE+ER++D  +QNE   +SI +D +S+ISL+KFLK+D+AA E
Sbjct  134   MDLGSEVQVRAAGGLLAILENERLVDTFQQNECGYSSITIDCMSQISLDKFLKLDAAAHE  193

Query  1142  ALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarld  963
             ALQIFQ+DKHPS MGIGRAKEGFSVFGM NKCVTPMGRRLLR WFLRPILDLD LN RL+
Sbjct  194   ALQIFQVDKHPSDMGIGRAKEGFSVFGMFNKCVTPMGRRLLRAWFLRPILDLDMLNNRLN  253

Query  962   AISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKI  783
              ISF L  EE+  +LRETLK+V+DVP +LKKFNSPS  CT++DW AFLK           
Sbjct  254   TISFFLCCEEVMSALRETLKTVRDVPHMLKKFNSPSSLCTTSDWNAFLK-----------  302

Query  782   FEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDG  603
                                                   V+GV+DV RSK+KGYET+VK+G
Sbjct  303   --------------------------------------VMGVIDVKRSKEKGYETLVKEG  324

Query  602   FCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLD  423
              C+ELDELR +YE LPDFLE+VS+ E A +P   G    P IVY+HQIGYL+CIF+EKL 
Sbjct  325   LCDELDELRMVYERLPDFLEQVSAYENASVPVQHGWKKAPSIVYVHQIGYLMCIFDEKLS  384

Query  422   EEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSK  243
             +E   KL DFE A                                 EDGD K+FFY T K
Sbjct  385   DETLGKLHDFELA-------------------------------FSEDGDEKRFFYHTPK  413

Query  242   TRELDTLLGDIYHKILGM  189
             TRELD LLGDIYHKIL M
Sbjct  414   TRELDNLLGDIYHKILDM  431



>ref|XP_010545524.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X8 [Tarenaya 
hassleriana]
Length=753

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/433 (64%), Positives = 336/433 (78%), Gaps = 30/433 (7%)
 Frame = -1

Query  1487  ALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDISS  1308
             + Q  D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMMD+ S
Sbjct  20    SFQDVDGTCETPMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMMDMGS  79

Query  1307  DVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQIF  1128
             +VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+D AA EALQIF
Sbjct  80    EVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKLDVAAHEALQIF  139

Query  1127  QIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAISFL  948
             QIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ L+ RL+AISF 
Sbjct  140   QIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLELLDHRLNAISFF  199

Query  947   LFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGI  768
             + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIFEV +
Sbjct  200   ISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISALLHVNKIFEVVV  259

Query  767   SEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNEL  588
             SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+T+VK+GFC EL
Sbjct  260   SETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQTMVKEGFCAEL  319

Query  587   DELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQE  408
             DELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CIF EKL+E   E
Sbjct  320   DELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCIFGEKLEETEVE  379

Query  407   KLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELD  228
             +L +F+FA                              F D DG+T++FFY T KTRELD
Sbjct  380   RLNEFDFA------------------------------FSDMDGETQRFFYHTPKTRELD  409

Query  227   TLLGDIYHKILGM  189
              LLGDIYHKIL M
Sbjct  410   NLLGDIYHKILDM  422



>ref|XP_010545525.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X9 [Tarenaya 
hassleriana]
Length=722

 Score =   537 bits (1384),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 275/420 (65%), Positives = 331/420 (79%), Gaps = 30/420 (7%)
 Frame = -1

Query  1448  VKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAI  1269
             VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMMD+ S+VQVR  GGLLAI
Sbjct  2     VKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMMDMGSEVQVRVGGGLLAI  61

Query  1268  LEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGR  1089
             LE+ERII+  EQ E   ASIA+DS++E+SLN FLK+D AA EALQIFQIDKHPSHMGIGR
Sbjct  62    LENERIIETLEQKESGTASIAIDSITEVSLNNFLKLDVAAHEALQIFQIDKHPSHMGIGR  121

Query  1088  AKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAISFLLFAEELSVSLRET  909
             AKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ L+ RL+AISF + +EEL  SLRET
Sbjct  122   AKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLELLDHRLNAISFFISSEELMTSLRET  181

Query  908   LKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNL  729
             LKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIFEV +SE LRE +K L+L
Sbjct  182   LKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISALLHVNKIFEVVVSETLREYMKSLHL  241

Query  728   GIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDF  549
              IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+T+VK+GFC ELDELRQIYE LP+F
Sbjct  242   DIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQTMVKEGFCAELDELRQIYEELPEF  301

Query  548   LEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLA  369
             L+EVSS+EL++   +  EN  PC+VYI QIGYL+CIF EKL+E   E+L +F+FA     
Sbjct  302   LQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCIFGEKLEETEVERLNEFDFA-----  356

Query  368   NFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                                      F D DG+T++FFY T KTRELD LLGDIYHKIL M
Sbjct  357   -------------------------FSDMDGETQRFFYHTPKTRELDNLLGDIYHKILDM  391



>ref|XP_009608755.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X7 [Nicotiana 
tomentosiformis]
Length=741

 Score =   526 bits (1354),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 265/340 (78%), Positives = 302/340 (89%), Gaps = 0/340 (0%)
 Frame = -1

Query  1394  MYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENA  1215
             MYLQVTGMDD LNIKER +FLSSMMD+SSDVQ+RASGGLLA+LE+ERIID  E NE  +A
Sbjct  1     MYLQVTGMDDGLNIKERTAFLSSMMDVSSDVQIRASGGLLAVLENERIIDTLELNESGSA  60

Query  1214  SIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPM  1035
             SIA+D + EISL+KFLKVDSAA EALQIFQIDKHPSHMGIGR+KEGFSVFG MNKCVTPM
Sbjct  61    SIAIDCICEISLDKFLKVDSAAHEALQIFQIDKHPSHMGIGRSKEGFSVFGTMNKCVTPM  120

Query  1034  GRRLLRNWFLRPIldlddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPS  855
             GRRLLR+WFLRPILDLD+LN RLD ISF L AEE++VSLRETLKSVKD+ CILKKFNSPS
Sbjct  121   GRRLLRSWFLRPILDLDNLNRRLDTISFFLSAEEIAVSLRETLKSVKDISCILKKFNSPS  180

Query  854   CTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFIC  675
                TS DWAAFLKS+C+LLHI+KIFEVGIS  L E+LK L+L I+++A  H+S DLA++C
Sbjct  181   SISTSADWAAFLKSVCALLHISKIFEVGISGSLYEELKNLDLDIIERADFHISVDLAYVC  240

Query  674   ELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGE  495
             ELVIGV DV+RSK+KGYETIVK+GFC+ELDELRQIYEGLP+FL EVS+LELARLP M  +
Sbjct  241   ELVIGVTDVDRSKEKGYETIVKEGFCDELDELRQIYEGLPEFLGEVSALELARLPHMCRD  300

Query  494   NGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCH  375
               +P I+YIHQIGYL+CIFNEKLDEEM EKL D+EFAVCH
Sbjct  301   KEIPSIIYIHQIGYLMCIFNEKLDEEMLEKLQDYEFAVCH  340



>ref|XP_010666207.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=716

 Score =   523 bits (1348),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 273/417 (65%), Positives = 330/417 (79%), Gaps = 30/417 (7%)
 Frame = -1

Query  1439  VKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILED  1260
             +KSS+FS+EQAWHRL+YL+V+GMDD L++KERI+FLSSMMDI+S+VQVRA+GGLLAILE+
Sbjct  1     MKSSIFSFEQAWHRLVYLRVSGMDDGLSVKERITFLSSMMDIASEVQVRATGGLLAILEN  60

Query  1259  ERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKE  1080
             ER++D  E  E+ +ASI+VD ++E+SLNKFLK+D+AA EALQIFQIDKHPSHMGIGRAKE
Sbjct  61    ERLVDTLETKEYGDASISVDCLTEVSLNKFLKLDAAAHEALQIFQIDKHPSHMGIGRAKE  120

Query  1079  GFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAISFLLFAEELSVSLRETLKS  900
             GFSVFGMMNKCVTPMGRRLLR WFLRPILDLD LN+RLDAISF L++EEL  SLR TLK+
Sbjct  121   GFSVFGMMNKCVTPMGRRLLRKWFLRPILDLDILNSRLDAISFFLYSEELMASLRGTLKT  180

Query  899   VKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIV  720
             +KDVP ILKKFNSPS  CT++DWAAFLKS+ S LH+NKIFEVG+ E LRE + +  L I+
Sbjct  181   IKDVPYILKKFNSPSSVCTASDWAAFLKSLSSFLHLNKIFEVGVPESLREHVNHFYLDII  240

Query  719   KKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEE  540
              KA   ++++L++I ELV G++DV R K+KGY TIVK+GFC ELDELRQIYE LP+ LEE
Sbjct  241   DKAASCITTELSYISELVTGIIDVTREKEKGYGTIVKEGFCEELDELRQIYEELPELLEE  300

Query  539   VSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFY  360
             VSSLELARLP +  +  +PCI+YIHQIGYLLCI  EKLDE   + L D E+A        
Sbjct  301   VSSLELARLPNLHRDECVPCIIYIHQIGYLLCISEEKLDERTLQTLEDIEYA--------  352

Query  359   Y*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                                   F D + + K+FFYRTSKTRELD +LGDIYHKIL M
Sbjct  353   ----------------------FSDGEKEPKRFFYRTSKTRELDNVLGDIYHKILDM  387



>ref|XP_006855938.1| hypothetical protein AMTR_s00037p00213740 [Amborella trichopoda]
 gb|ERN17405.1| hypothetical protein AMTR_s00037p00213740 [Amborella trichopoda]
Length=805

 Score =   525 bits (1353),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 277/486 (57%), Positives = 346/486 (71%), Gaps = 44/486 (9%)
 Frame = -1

Query  1646  IGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESFLAALQRCDN  1467
             IGV+YYD+S  QL+V+E WEDGS DFP++D++KYQ +P VIYTSTK+EESFL+ALQ+ D 
Sbjct  33    IGVAYYDTSDCQLHVLETWEDGSGDFPMIDLVKYQAKPSVIYTSTKTEESFLSALQKRDE  92

Query  1466  TSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDISSDVQVRAS  1287
             T  A  VKLVKSS+FSYEQAWHRL+ L+V+GMD+ L+IKER+ FL+SMM+  +++ VR +
Sbjct  93    TV-AHEVKLVKSSIFSYEQAWHRLIQLRVSGMDEGLSIKERVFFLNSMMNTGNEMLVRTT  151

Query  1286  GGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPS  1107
             GGLLAILE+E ++D   Q E  NA I +D V+EISL  FLKVD+ A EALQIFQ+DKHPS
Sbjct  152   GGLLAILENEMLVDTVGQVESGNALITIDCVTEISLRNFLKVDATAHEALQIFQVDKHPS  211

Query  1106  HMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldAISFLLFAEELS  927
             +MGIGRAKEGFSVFGM+NKCVT MGRRL+R++               + ISF  + EEL 
Sbjct  212   YMGIGRAKEGFSVFGMLNKCVTAMGRRLMRSF-----------PPNKNKISFFHYCEELM  260

Query  926   VSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQ  747
             V+ RETLKSV+D+P ILKKFNSPS   T  +W+  LKSI SLLHI ++FEV +   L++Q
Sbjct  261   VAFRETLKSVRDIPHILKKFNSPSSISTIDEWSTILKSIASLLHIGRLFEVEVPGRLQQQ  320

Query  746   LKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIY  567
             L+ L L I +KA   ++++L F+ ELV GV+DV+RSK K   T +K GFC+ELDEL+ IY
Sbjct  321   LEGLTLHIFEKACTSITTELVFVYELVSGVIDVSRSK-KECGTFIKQGFCDELDELQTIY  379

Query  566   EGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEF  387
             E LP FLE+VSSLEL RLP M       CIVY+ QIGYL+CI+ EKLDE + E LPD EF
Sbjct  380   EELPQFLEQVSSLELTRLP-MNDRKPSGCIVYVQQIGYLMCIYEEKLDETIIESLPDIEF  438

Query  386   AVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIY  207
             A                              F D D   ++FFYRTSKTRELD LLGD+Y
Sbjct  439   A------------------------------FADGDDVERRFFYRTSKTRELDLLLGDLY  468

Query  206   HKILGM  189
             HKIL M
Sbjct  469   HKILDM  474



>ref|XP_010327312.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X7 [Solanum 
lycopersicum]
Length=685

 Score =   513 bits (1321),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 266/379 (70%), Positives = 308/379 (81%), Gaps = 30/379 (8%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMD+SSDVQVRASGGLLA+LE+ERIID  E NE  +AS+A+D + EISL+KFLKVDSAA 
Sbjct  1     MMDVSSDVQVRASGGLLAVLENERIIDTLELNECGSASVAIDCICEISLDKFLKVDSAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLD+LN RL
Sbjct  61    EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPILDLDNLNRRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             D ISF L AEE+SVSLRETLKSVKD+P ILKKFNSPS   TS DW+AFLKS+C+LLHI+K
Sbjct  121   DTISFFLSAEEVSVSLRETLKSVKDIPRILKKFNSPSSISTSADWSAFLKSVCALLHISK  180

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEVGIS  L E+L  L+L I+++AG  +S DLA++CELVIGV+DV+RSK+KGYETIVK+
Sbjct  181   IFEVGISGSLLEELTSLDLDIIERAGFFISVDLAYVCELVIGVIDVDRSKEKGYETIVKE  240

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC+ELDELRQIYEGLP+FLEEV +LELARLP M  + GLP I+Y+HQIGYL+CIFNEKL
Sbjct  241   GFCDELDELRQIYEGLPEFLEEVLALELARLPCMYEDKGLPSIIYLHQIGYLMCIFNEKL  300

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
              EEM E L D+EFA                              F DE+G+ ++FFY T+
Sbjct  301   GEEMLETLQDYEFA------------------------------FADEEGEHRRFFYHTA  330

Query  245   KTRELDTLLGDIYHKILGM  189
             KT+E+D LLGDIYHKIL M
Sbjct  331   KTKEMDNLLGDIYHKILDM  349



>ref|XP_009803940.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X3 [Nicotiana 
sylvestris]
Length=689

 Score =   509 bits (1312),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 266/379 (70%), Positives = 306/379 (81%), Gaps = 30/379 (8%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMD+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA 
Sbjct  1     MMDVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGR+KEGFSVFGMMNKCVTPMGRRLLR+WFLRPILDLD+LN RL
Sbjct  61    EALQIFQIDKHPSHMGIGRSKEGFSVFGMMNKCVTPMGRRLLRSWFLRPILDLDNLNQRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             D ISF L AEE+SVSL ETLKSVKD+  ILKKFNSPS   TS DWAAFLKS+C+LLHI+K
Sbjct  121   DTISFFLSAEEISVSLCETLKSVKDISRILKKFNSPSSISTSADWAAFLKSVCALLHISK  180

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEVGIS  L E+LKYL L I+++A  H+S DLA++ ELVIGV DV+RSK+KGYETIVK+
Sbjct  181   IFEVGISGSLYEELKYLGLDIIERADFHISVDLAYVYELVIGVTDVDRSKEKGYETIVKE  240

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC+ELDELRQIYEGLP+FLEEVS++ELARLP M  +  +P I+YIHQIGYL+CIFNEKL
Sbjct  241   GFCDELDELRQIYEGLPEFLEEVSAVELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKL  300

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
              EEM EKL D+EFA                              F DE+G+ ++FFY T+
Sbjct  301   AEEMLEKLQDYEFA------------------------------FADEEGENRRFFYHTA  330

Query  245   KTRELDTLLGDIYHKILGM  189
             KTRELD LLGDIYHKIL M
Sbjct  331   KTRELDNLLGDIYHKILDM  349



>ref|XP_009803942.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X5 [Nicotiana 
sylvestris]
Length=681

 Score =   508 bits (1309),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 265/377 (70%), Positives = 305/377 (81%), Gaps = 30/377 (8%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMD+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA 
Sbjct  1     MMDVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGR+KEGFSVFGMMNKCVTPMGRRLLR+WFLRPILDLD+LN RL
Sbjct  61    EALQIFQIDKHPSHMGIGRSKEGFSVFGMMNKCVTPMGRRLLRSWFLRPILDLDNLNQRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             D ISF L AEE+SVSL ETLKSVKD+  ILKKFNSPS   TS DWAAFLKS+C+LLHI+K
Sbjct  121   DTISFFLSAEEISVSLCETLKSVKDISRILKKFNSPSSISTSADWAAFLKSVCALLHISK  180

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEVGIS  L E+LKYL L I+++A  H+S DLA++ ELVIGV DV+RSK+KGYETIVK+
Sbjct  181   IFEVGISGSLYEELKYLGLDIIERADFHISVDLAYVYELVIGVTDVDRSKEKGYETIVKE  240

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC+ELDELRQIYEGLP+FLEEVS++ELARLP M  +  +P I+YIHQIGYL+CIFNEKL
Sbjct  241   GFCDELDELRQIYEGLPEFLEEVSAVELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKL  300

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
              EEM EKL D+EFA                              F DE+G+ ++FFY T+
Sbjct  301   AEEMLEKLQDYEFA------------------------------FADEEGENRRFFYHTA  330

Query  245   KTRELDTLLGDIYHKIL  195
             KTRELD LLGDIYHKIL
Sbjct  331   KTRELDNLLGDIYHKIL  347



>ref|XP_009803939.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X2 [Nicotiana 
sylvestris]
Length=689

 Score =   508 bits (1307),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 265/377 (70%), Positives = 305/377 (81%), Gaps = 30/377 (8%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMD+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA 
Sbjct  1     MMDVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGR+KEGFSVFGMMNKCVTPMGRRLLR+WFLRPILDLD+LN RL
Sbjct  61    EALQIFQIDKHPSHMGIGRSKEGFSVFGMMNKCVTPMGRRLLRSWFLRPILDLDNLNQRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             D ISF L AEE+SVSL ETLKSVKD+  ILKKFNSPS   TS DWAAFLKS+C+LLHI+K
Sbjct  121   DTISFFLSAEEISVSLCETLKSVKDISRILKKFNSPSSISTSADWAAFLKSVCALLHISK  180

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEVGIS  L E+LKYL L I+++A  H+S DLA++ ELVIGV DV+RSK+KGYETIVK+
Sbjct  181   IFEVGISGSLYEELKYLGLDIIERADFHISVDLAYVYELVIGVTDVDRSKEKGYETIVKE  240

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC+ELDELRQIYEGLP+FLEEVS++ELARLP M  +  +P I+YIHQIGYL+CIFNEKL
Sbjct  241   GFCDELDELRQIYEGLPEFLEEVSAVELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKL  300

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
              EEM EKL D+EFA                              F DE+G+ ++FFY T+
Sbjct  301   AEEMLEKLQDYEFA------------------------------FADEEGENRRFFYHTA  330

Query  245   KTRELDTLLGDIYHKIL  195
             KTRELD LLGDIYHKIL
Sbjct  331   KTRELDNLLGDIYHKIL  347



>ref|XP_009803938.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X1 [Nicotiana 
sylvestris]
Length=699

 Score =   508 bits (1307),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 265/377 (70%), Positives = 305/377 (81%), Gaps = 30/377 (8%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMD+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA 
Sbjct  1     MMDVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGR+KEGFSVFGMMNKCVTPMGRRLLR+WFLRPILDLD+LN RL
Sbjct  61    EALQIFQIDKHPSHMGIGRSKEGFSVFGMMNKCVTPMGRRLLRSWFLRPILDLDNLNQRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             D ISF L AEE+SVSL ETLKSVKD+  ILKKFNSPS   TS DWAAFLKS+C+LLHI+K
Sbjct  121   DTISFFLSAEEISVSLCETLKSVKDISRILKKFNSPSSISTSADWAAFLKSVCALLHISK  180

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEVGIS  L E+LKYL L I+++A  H+S DLA++ ELVIGV DV+RSK+KGYETIVK+
Sbjct  181   IFEVGISGSLYEELKYLGLDIIERADFHISVDLAYVYELVIGVTDVDRSKEKGYETIVKE  240

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC+ELDELRQIYEGLP+FLEEVS++ELARLP M  +  +P I+YIHQIGYL+CIFNEKL
Sbjct  241   GFCDELDELRQIYEGLPEFLEEVSAVELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKL  300

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
              EEM EKL D+EFA                              F DE+G+ ++FFY T+
Sbjct  301   AEEMLEKLQDYEFA------------------------------FADEEGENRRFFYHTA  330

Query  245   KTRELDTLLGDIYHKIL  195
             KTRELD LLGDIYHKIL
Sbjct  331   KTRELDNLLGDIYHKIL  347



>ref|XP_002440016.1| hypothetical protein SORBIDRAFT_09g024520 [Sorghum bicolor]
 gb|EES18446.1| hypothetical protein SORBIDRAFT_09g024520 [Sorghum bicolor]
Length=687

 Score =   498 bits (1283),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 259/501 (52%), Positives = 327/501 (65%), Gaps = 94/501 (19%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             MAC+M G R+GV+YYDS  RQL+V+EIWED   ++PL+D+                    
Sbjct  1     MACVMQGRRVGVAYYDSDTRQLFVLEIWEDSVGEYPLIDL--------------------  40

Query  1493  LAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDI  1314
                    D  +EA  VKL+KSS FSYEQAWHRL+YL+V  MDD L+ KERI FL+SMMD+
Sbjct  41    -------DGNNEAPVVKLMKSSTFSYEQAWHRLIYLKVAAMDDGLSAKERICFLNSMMDL  93

Query  1313  SSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISL------NKFLKVDSA  1152
              SDVQVRA+GGLLAIL++ER++D  EQ +   ASIA+DSV  ++       +KFLK+D+ 
Sbjct  94    GSDVQVRAAGGLLAILDNERLLDTIEQMQ-GGASIAIDSVLALNALTYNHRDKFLKLDAT  152

Query  1151  ALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlna  972
             A EALQIFQ+DKHPS+MGIGRAKEGFSVFGM+NKCVTPMG+RLLR WFLRPI        
Sbjct  153   AHEALQIFQVDKHPSYMGIGRAKEGFSVFGMLNKCVTPMGKRLLRAWFLRPI--------  204

Query  971   rldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHI  792
                 I   +    L+                  KFNSPS  CTS+DW  FLK ICSLLHI
Sbjct  205   ----IDIDVINNRLNT-----------------KFNSPSSFCTSSDWTTFLKCICSLLHI  243

Query  791   NKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIV  612
             NKIFEVGISE L  +L+++N+ ++ KA   ++++L ++ +LV+GV+DV R K+KGYET+V
Sbjct  244   NKIFEVGISEHLAIKLQHMNIDLIGKANSSITAELDYVSDLVVGVIDVQRGKEKGYETVV  303

Query  611   KDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNE  432
             K+G C+ELDELR +YEGLPDFLE+VS  E A LP   G    P +VY+HQIGYL+C F+E
Sbjct  304   KEGLCDELDELRMVYEGLPDFLEQVSDNENASLPFSFGCRIAPLVVYVHQIGYLMCFFDE  363

Query  431   KLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYR  252
             K+ + +   LPD+EFA                              F DE G+ ++FFY 
Sbjct  364   KISDALLAGLPDYEFA------------------------------FSDE-GEERRFFYH  392

Query  251   TSKTRELDTLLGDIYHKILGM  189
             T KTRELD LLGDIYHKIL M
Sbjct  393   TQKTRELDNLLGDIYHKILDM  413



>ref|XP_002529913.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32467.1| conserved hypothetical protein [Ricinus communis]
Length=351

 Score =   485 bits (1249),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 232/323 (72%), Positives = 274/323 (85%), Gaps = 16/323 (5%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI+HGHR+G+SYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ QP  IY S+KSEE
Sbjct  10    VYMACILHGHRVGISYYDSSIRQLHVLEVWEDGSLDFPLIDLVKYQAQPLTIYASSKSEE  69

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+ ALQR D T+EA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKER+ +LSSMM
Sbjct  70    SFINALQRSDGTTEAPTVKLVKSSIFSYEQAWHRLIYLRVTGMDDGLNIKERVCYLSSMM  129

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S++QVRASGGLLAILE+ERI+D   Q E   A+I +DSV EISLNKFLK+D+AA EA
Sbjct  130   DMGSEIQVRASGGLLAILENERIVDTLAQKECGTAAITIDSVVEISLNKFLKLDAAAHEA  189

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGR+KEGFSVFGMMNKCVTP+G+RLLRNWFLRPI+DL         
Sbjct  190   LQIFQIDKHPSHMGIGRSKEGFSVFGMMNKCVTPVGQRLLRNWFLRPIVDL---------  240

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
                    E+L  SLRETLK VKD+P +LKKFNSPS  CT+ DW AFLKSICSLLH++KIF
Sbjct  241   -------EKLMASLRETLKHVKDIPRLLKKFNSPSSICTTGDWTAFLKSICSLLHVDKIF  293

Query  779   EVGISEDLREQLKYLNLGIVKKA  711
             E+G+SEDLREQ K LN+ I++K+
Sbjct  294   ELGMSEDLREQAKCLNVNIIEKS  316



>ref|XP_011012099.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X7 [Populus 
euphratica]
 ref|XP_011012100.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X7 [Populus 
euphratica]
Length=677

 Score =   483 bits (1243),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 254/379 (67%), Positives = 298/379 (79%), Gaps = 30/379 (8%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMDI SDVQVRASGGLLAILE ERI+D  EQ E+ +ASI +DSV EISLNKFLK+D+AA 
Sbjct  1     MMDIGSDVQVRASGGLLAILESERIVDTLEQKEYGSASITIDSVVEISLNKFLKLDAAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIG AKEGFSVFGMMNKC+TP+G+RLLRNWFLRP+LD+++LN RL
Sbjct  61    EALQIFQIDKHPSHMGIGGAKEGFSVFGMMNKCMTPIGKRLLRNWFLRPLLDVENLNGRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             +AISF L +EEL VSLRETLKSVKD+  IL+KF+SPS   T  DWAAFLKS+C+LLH+ K
Sbjct  121   NAISFFLCSEELMVSLRETLKSVKDIKHILRKFDSPSSLSTVGDWAAFLKSVCALLHLGK  180

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEVGISE+L+E  KYLNL IV++A   ++++LA++ ELVIGV+DVNRSK+KGY TIVK+
Sbjct  181   IFEVGISENLQEHAKYLNLNIVEQACSCITTELAYVYELVIGVIDVNRSKEKGYGTIVKE  240

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC+ELDELRQIYE LPDFL +V+ LELA+LP +  E  +PCIVYIHQIGYLLCIF EKL
Sbjct  241   GFCDELDELRQIYEELPDFLHKVTLLELAQLPHLGKEKLVPCIVYIHQIGYLLCIFEEKL  300

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
             +E    K  DFEF                               F D DG+TK++FYRT 
Sbjct  301   EETSLLKPQDFEFM------------------------------FSDVDGETKRYFYRTP  330

Query  245   KTRELDTLLGDIYHKILGM  189
             KTRELD LLGDIYHKIL M
Sbjct  331   KTRELDELLGDIYHKILDM  349



>gb|KHN11911.1| MutS protein like 5 [Glycine soja]
Length=375

 Score =   459 bits (1181),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 223/337 (66%), Positives = 267/337 (79%), Gaps = 29/337 (9%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI++G+RIGVSYYDS++RQLYV+E+W+DG K FP++D++KYQ  P VIYTSTKSEE
Sbjct  13    VYMACILNGNRIGVSYYDSTLRQLYVLEVWDDGDKGFPVIDLVKYQANPLVIYTSTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQ+ D  +E+  VKLVKSS+FSYEQAWHRL+YL+V GMDD LN+KERI +LSSMM
Sbjct  73    SFLSALQQRDGAAESPIVKLVKSSIFSYEQAWHRLVYLRVAGMDDGLNVKERIYYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             ++ S+VQVRASGGLLAILE+ERI+D  EQ E  N SI +DS++EISLN FLK+D+AA EA
Sbjct  133   NMGSEVQVRASGGLLAILENERIVDTLEQKESGNTSITIDSLAEISLNNFLKLDTAAHEA  192

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPI            
Sbjct  193   LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPI------------  240

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
                 L  E L+  L               KF+SPS  CTS DW A LKSIC++LH+NKIF
Sbjct  241   ----LDLEVLNYRLN-------------SKFDSPSSICTSFDWTALLKSICAMLHVNKIF  283

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICEL  669
             EVGISE LRE+LKYLNL IV+KA  H++++L ++ EL
Sbjct  284   EVGISEGLREELKYLNLDIVEKASSHITAELGYVYEL  320


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  293  FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
            F D DG+TKK+FYRT KTRELD+LLGDI+HKILG+
Sbjct  321  FCDTDGETKKYFYRTPKTRELDSLLGDIHHKILGI  355



>ref|XP_010545527.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X11 [Tarenaya 
hassleriana]
Length=680

 Score =   466 bits (1200),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 293/379 (77%), Gaps = 30/379 (8%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMD+ S+VQVR  GGLLAILE+ERII+  EQ E   ASIA+DS++E+SLN FLK+D AA 
Sbjct  1     MMDMGSEVQVRVGGGLLAILENERIIETLEQKESGTASIAIDSITEVSLNNFLKLDVAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGRAKEGFSVFG+MNKC TPMGRRLLR+WF+RPILDL+ L+ RL
Sbjct  61    EALQIFQIDKHPSHMGIGRAKEGFSVFGVMNKCATPMGRRLLRSWFMRPILDLELLDHRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             +AISF + +EEL  SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NK
Sbjct  121   NAISFFISSEELMTSLRETLKSVKDITHLLKKFNSPTSLCTSKDWTAFLKSISALLHVNK  180

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEV +SE LRE +K L+L IV+KAG  +S++LA++ ELVIGV+D++RSK+K Y+T+VK+
Sbjct  181   IFEVVVSETLREYMKSLHLDIVEKAGLCISTELAYVYELVIGVIDISRSKEKSYQTMVKE  240

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC ELDELRQIYE LP+FL+EVSS+EL++   +  EN  PC+VYI QIGYL+CIF EKL
Sbjct  241   GFCAELDELRQIYEELPEFLQEVSSMELSKFSHLHKENLPPCVVYIQQIGYLMCIFGEKL  300

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
             +E   E+L +F+FA                              F D DG+T++FFY T 
Sbjct  301   EETEVERLNEFDFA------------------------------FSDMDGETQRFFYHTP  330

Query  245   KTRELDTLLGDIYHKILGM  189
             KTRELD LLGDIYHKIL M
Sbjct  331   KTRELDNLLGDIYHKILDM  349



>ref|XP_009803941.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X4 [Nicotiana 
sylvestris]
Length=682

 Score =   464 bits (1194),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 249/377 (66%), Positives = 288/377 (76%), Gaps = 47/377 (12%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMD+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA 
Sbjct  1     MMDVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGR+KEGFSVFGMMNKCVTPMGRRLLR+WFLRPILDLD+LN RL
Sbjct  61    EALQIFQIDKHPSHMGIGRSKEGFSVFGMMNKCVTPMGRRLLRSWFLRPILDLDNLNQRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             D ISF L AEE+SVSL ETLKSVKD+  ILKKFNSPS   TS DWAAFLKS+C+LLHI+K
Sbjct  121   DTISFFLSAEEISVSLCETLKSVKDISRILKKFNSPSSISTSADWAAFLKSVCALLHISK  180

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEVGIS  L E+LKYL L I+++A  H+S DLA++ ELVIGV DV+RSK+KGYETIVK+
Sbjct  181   IFEVGISGSLYEELKYLGLDIIERADFHISVDLAYVYELVIGVTDVDRSKEKGYETIVKE  240

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC                 +EVS++ELARLP M  +  +P I+YIHQIGYL+CIFNEKL
Sbjct  241   GFC-----------------DEVSAVELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKL  283

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
              EEM EKL D+EFA                              F DE+G+ ++FFY T+
Sbjct  284   AEEMLEKLQDYEFA------------------------------FADEEGENRRFFYHTA  313

Query  245   KTRELDTLLGDIYHKIL  195
             KTRELD LLGDIYHKIL
Sbjct  314   KTRELDNLLGDIYHKIL  330



>ref|XP_010666208.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X4 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010666209.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=678

 Score =   461 bits (1186),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 245/379 (65%), Positives = 293/379 (77%), Gaps = 30/379 (8%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMDI+S+VQVRA+GGLLAILE+ER++D  E  E+ +ASI+VD ++E+SLNKFLK+D+AA 
Sbjct  1     MMDIASEVQVRATGGLLAILENERLVDTLETKEYGDASISVDCLTEVSLNKFLKLDAAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLR WFLRPILDLD LN+RL
Sbjct  61    EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRKWFLRPILDLDILNSRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             DAISF L++EEL  SLR TLK++KDVP ILKKFNSPS  CT++DWAAFLKS+ S LH+NK
Sbjct  121   DAISFFLYSEELMASLRGTLKTIKDVPYILKKFNSPSSVCTASDWAAFLKSLSSFLHLNK  180

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
             IFEVG+ E LRE + +  L I+ KA   ++++L++I ELV G++DV R K+KGY TIVK+
Sbjct  181   IFEVGVPESLREHVNHFYLDIIDKAASCITTELSYISELVTGIIDVTREKEKGYGTIVKE  240

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC ELDELRQIYE LP+ LEEVSSLELARLP +  +  +PCI+YIHQIGYLLCI  EKL
Sbjct  241   GFCEELDELRQIYEELPELLEEVSSLELARLPNLHRDECVPCIIYIHQIGYLLCISEEKL  300

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
             DE   + L D E+A                              F D + + K+FFYRTS
Sbjct  301   DERTLQTLEDIEYA------------------------------FSDGEKEPKRFFYRTS  330

Query  245   KTRELDTLLGDIYHKILGM  189
             KTRELD +LGDIYHKIL M
Sbjct  331   KTRELDNVLGDIYHKILDM  349



>ref|XP_010096888.1| MutS protein-5-like protein [Morus notabilis]
 gb|EXB66342.1| MutS protein-5-like protein [Morus notabilis]
Length=776

 Score =   433 bits (1113),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 261/524 (50%), Positives = 321/524 (61%), Gaps = 114/524 (22%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDM---------------IKY  1545
             VYMACI HG+R+G+SYYDSSIRQL+V+E+WEDGS +FPL+D+               +KY
Sbjct  13    VYMACIQHGNRVGISYYDSSIRQLHVLEVWEDGSTEFPLIDLSSHIFLFLYCCNTDSVKY  72

Query  1544  QVQPGVIYTSTKSEESFLAALQRCDNTSEAATVKLVKSSLFSYEQAWH----------RL  1395
             Q +P +IY+S+KSEES L+ALQR + T E  TVKLVKSS+FSYEQAWH          R+
Sbjct  73    QAKPMIIYSSSKSEESLLSALQRSEGTDETPTVKLVKSSVFSYEQAWHSFGVSNFLEQRV  132

Query  1394  MYLQVTG--MDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFE  1221
               LQ+    MD  +N++     LSSMMD+ SDVQVRASGGLLAILE+ERI+D  EQ E  
Sbjct  133   PNLQIRSICMDWLVNLQ---GLLSSMMDMGSDVQVRASGGLLAILENERIVDTLEQKECG  189

Query  1220  NASIAVDSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVT  1041
             NASI +DSV         ++ + A+ AL                            K   
Sbjct  190   NASITIDSVLTRHYRYSKQISTQAIWAL------------------------AEQKKVHN  225

Query  1040  PMGRRLLRNWFLRPIldlddlnarldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNS  861
               G   L   FL               ISF L +EEL++SLRETLKSVKD+P ILK    
Sbjct  226   TSGETSLECSFL-----------MASKISFFLASEELTLSLRETLKSVKDIPHILK----  270

Query  860   PSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAF  681
                            S+CSLLH+NKIFEVGISE LRE  +YLNL IV+KA   ++++LA+
Sbjct  271   ---------------SVCSLLHVNKIFEVGISESLREHARYLNLDIVEKANSSITTELAY  315

Query  680   ICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMV  501
             + ELVIGVLD+NRSK+KGYETIVKDGFC+ELDELRQIYE LP+FL++V+SLELAR P + 
Sbjct  316   VYELVIGVLDINRSKEKGYETIVKDGFCDELDELRQIYEELPEFLQKVTSLELARCPELC  375

Query  500   GENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYL  321
                  P IVYI+QIGYL+CI  E++DE   EK+ DF FA                     
Sbjct  376   EGKLTPRIVYINQIGYLMCILEEEIDEITLEKIHDFVFA---------------------  414

Query  320   HQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                      F D DG+TK+FFYRT KT+ELD LLGDIYHKIL M
Sbjct  415   ---------FSDMDGETKRFFYRTPKTQELDNLLGDIYHKILDM  449



>ref|XP_009803943.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X6 [Nicotiana 
sylvestris]
Length=650

 Score =   426 bits (1096),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 235/377 (62%), Positives = 265/377 (70%), Gaps = 79/377 (21%)
 Frame = -1

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             MMD+SSDVQ+RASGGLLA+LE+ERIID  E NE  +ASIA+D + EISL+KFLKVDSAA 
Sbjct  1     MMDVSSDVQIRASGGLLAVLENERIIDTLELNESGSASIAIDCICEISLDKFLKVDSAAH  60

Query  1145  EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarl  966
             EALQIFQIDKHPSHMGIGR+KEGFSVFGMMNKCVTPMGRRLLR+WFLRPILDLD+LN RL
Sbjct  61    EALQIFQIDKHPSHMGIGRSKEGFSVFGMMNKCVTPMGRRLLRSWFLRPILDLDNLNQRL  120

Query  965   dAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINK  786
             D ISF L AEE+SVSL ETLKSVKD+  ILKKFNSPS   TS DWAAFLK          
Sbjct  121   DTISFFLSAEEISVSLCETLKSVKDISRILKKFNSPSSISTSADWAAFLK----------  170

Query  785   IFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKD  606
                                                    VIGV DV+RSK+KGYETIVK+
Sbjct  171   ---------------------------------------VIGVTDVDRSKEKGYETIVKE  191

Query  605   GFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKL  426
             GFC+ELDELRQIYEGLP+FLEEVS++ELARLP M  +  +P I+YIHQIGYL+CIFNEKL
Sbjct  192   GFCDELDELRQIYEGLPEFLEEVSAVELARLPHMCRDKEIPSIIYIHQIGYLMCIFNEKL  251

Query  425   DEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTS  246
              EEM EKL D+EFA                              F DE+G+ ++FFY T+
Sbjct  252   AEEMLEKLQDYEFA------------------------------FADEEGENRRFFYHTA  281

Query  245   KTRELDTLLGDIYHKIL  195
             KTRELD LLGDIYHKIL
Sbjct  282   KTRELDNLLGDIYHKIL  298



>ref|XP_008359281.1| PREDICTED: DNA mismatch repair protein MSH5-like [Malus domestica]
Length=341

 Score =   410 bits (1053),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 207/271 (76%), Positives = 237/271 (87%), Gaps = 0/271 (0%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HGHR+GVSYYDSSIRQL+V+E+WEDGS DFPL+D++KYQ +P +IYTSTKSEE
Sbjct  55    VYMACIRHGHRVGVSYYDSSIRQLHVLEVWEDGSTDFPLIDLVKYQAKPLIIYTSTKSEE  114

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SFL+ALQR D  +EA TVKLVKSS+FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  115   SFLSALQRSDGMTEAFTVKLVKSSIFSYEQAWHRLIYLRVTGMDDGLNIKERICYLSSMM  174

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVR SGGLLAILE+ER++D   Q E  N SIA+DSV E+SLN FLK+D+AA EA
Sbjct  175   DMGSDVQVRTSGGLLAILENERVVDTLGQMESGNPSIAIDSVIEVSLNNFLKLDAAAHEA  234

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIF  DKHPSHMGIG AKEGFSVFGMMNKCVTPMGRRLLR+WFLRPILDL+ LN RL+A
Sbjct  235   LQIFLTDKHPSHMGIGXAKEGFSVFGMMNKCVTPMGRRLLRSWFLRPILDLEVLNNRLNA  294

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKF  867
             ISF L +EEL  SL  TLKSVKD+P ILK++
Sbjct  295   ISFFLSSEELINSLHGTLKSVKDIPHILKEW  325



>ref|XP_010060320.1| PREDICTED: DNA mismatch repair protein MSH5 isoform X3 [Eucalyptus 
grandis]
Length=649

 Score =   398 bits (1022),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 205/323 (63%), Positives = 248/323 (77%), Gaps = 30/323 (9%)
 Frame = -1

Query  1157  SAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
             +AA EALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTP+GRRLLR+WFLRPI+DL+ L
Sbjct  29    AAAHEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPIGRRLLRSWFLRPIVDLEHL  88

Query  977   narldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLL  798
             N RL+AISF L +EEL  SLRETLKSVKD+P ILKKFNSPS  CTS+DW+AFLKS+ SLL
Sbjct  89    NNRLNAISFFLSSEELMDSLRETLKSVKDIPFILKKFNSPSSICTSSDWSAFLKSVSSLL  148

Query  797   HINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYET  618
             H+NKI EVGISE L EQ+KYL+  I++KA   ++++LA++ ELVIGV+D++R K+KGYET
Sbjct  149   HLNKILEVGISEGLDEQMKYLSTDILEKASSCITTELAYVYELVIGVIDISRIKEKGYET  208

Query  617   IVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIF  438
             +VK+ FC+ELDELRQIYE LP+FLEEV+SLELA  P +  +  +PCIVYI Q+GYL+CI 
Sbjct  209   MVKESFCDELDELRQIYEELPEFLEEVTSLELAHFPDVFKDKHVPCIVYIQQVGYLMCIL  268

Query  437   NEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFF  258
              EKLDE    +L DFE+                               F D DG+  +FF
Sbjct  269   EEKLDEMTLARLEDFEYV------------------------------FSDNDGEMMRFF  298

Query  257   YRTSKTRELDTLLGDIYHKILGM  189
             YRT+KTRELD LLGD++HKIL M
Sbjct  299   YRTTKTRELDDLLGDLHHKILDM  321



>gb|EMS56680.1| MutS protein-like protein 5 [Triticum urartu]
Length=1140

 Score =   363 bits (933),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 255/380 (67%), Gaps = 61/380 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V+MAC+M G R+GVSYYDS+ RQL+V+EIWED +  FPL+D+                  
Sbjct  25    VHMACVMQGRRVGVSYYDSNTRQLFVLEIWEDSAGGFPLIDL------------------  66

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
                      D+  +   VKL+KSS F+YEQAWHRL+YL+V  MDD L++KERI FL+SMM
Sbjct  67    ---------DSNVDPPVVKLMKSSTFTYEQAWHRLIYLKVAAMDDGLSVKERICFLNSMM  117

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ SDVQVRA+GGLLAIL+ ER++D  EQ E   ASIA+DSV++IS   +  +  +A EA
Sbjct  118   DLGSDVQVRAAGGLLAILDSERLLDTLEQME-GGASIAIDSVTQISF--YPSIYDSAHEA  174

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
             LQIFQ+DKHPS+MGIGRAKEGFSVFG++NKCVTPMGRRLLR                   
Sbjct  175   LQIFQVDKHPSYMGIGRAKEGFSVFGILNKCVTPMGRRLLR-------------------  215

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIF  780
             +S+ +++     + ++ + S  D    L K +             F   ICSLLHINKIF
Sbjct  216   VSWRIWSNH-DEAFKKMMTSTDDASVGLGKPDR-----------VFTHCICSLLHINKIF  263

Query  779   EVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGF  600
             EVGISE L  +L+++++ +V+KA   ++++L ++  LVIGV+DV RSK+KGYET+VK+  
Sbjct  264   EVGISEHLANKLQHMSIDLVEKANSSITAELDYVSNLVIGVIDVQRSKEKGYETLVKENL  323

Query  599   CNELDELRQIYEGLPDFLEE  540
             C+ELDELR +YEGLPDFLE+
Sbjct  324   CDELDELRMVYEGLPDFLEQ  343


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 45/90 (50%), Gaps = 31/90 (34%)
 Frame = -1

Query  458  GYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDED  279
            GYL+C F+EK+ E +   L DFEFA                                 ED
Sbjct  733  GYLMCFFDEKISEALLIGLQDFEFA-------------------------------FSED  761

Query  278  GDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
            G+ ++F+Y T KTRELD LLGDIYHKIL M
Sbjct  762  GEERRFYYHTQKTRELDNLLGDIYHKILDM  791



>dbj|BAD95388.1| DNA mismatch repair protein [Arabidopsis thaliana]
 dbj|BAF02028.1| putative DNA mismatch repair protein [Arabidopsis thaliana]
Length=545

 Score =   286 bits (733),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 175/245 (71%), Gaps = 30/245 (12%)
 Frame = -1

Query  923  SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQL  744
            SLRETLKSVKD+  +LKKFNSP+  CTS DW AFLKSI +LLH+NKIFEVG+SE LRE +
Sbjct  3    SLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIFEVGVSESLREHM  62

Query  743  KYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYE  564
            +  NL I++KAG  +S++L ++ ELVIGV+DV RSK++GY+T+VK+GFC ELDELRQIYE
Sbjct  63   RRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGFCAELDELRQIYE  122

Query  563  GLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFA  384
             LP+FL+EVS++EL   P +  E   PCIVYI QIGYL+CIF EKLDE    +L +FEFA
Sbjct  123  ELPEFLQEVSAMELEHFPHLHKEKLPPCIVYIQQIGYLMCIFGEKLDETALNRLTEFEFA  182

Query  383  VCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYH  204
                                          F D DG+T++FFY TSKTRELD LLGDIYH
Sbjct  183  ------------------------------FSDMDGETQRFFYHTSKTRELDNLLGDIYH  212

Query  203  KILGM  189
            KIL M
Sbjct  213  KILDM  217



>ref|XP_008359282.1| PREDICTED: DNA mismatch repair protein MSH5-like [Malus domestica]
Length=531

 Score =   281 bits (718),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 164/229 (72%), Gaps = 30/229 (13%)
 Frame = -1

Query  875  KKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLS  696
            KKFNSPS  CTS+DW AFLKS+CSLLH+NKIFEVG+SE L+E  KY NL IV+KA   ++
Sbjct  4    KKFNSPSSICTSSDWTAFLKSVCSLLHVNKIFEVGVSESLQEHAKYFNLDIVEKAASCIT  63

Query  695  SDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELAR  516
            ++LA++ ELVIGVLDVNRSK+KGY TIVKD FC+ELDELRQIYE LP+FLE+VS +EL R
Sbjct  64   TELAYVYELVIGVLDVNRSKEKGYATIVKDDFCDELDELRQIYEELPEFLEQVSQMELER  123

Query  515  LPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL  336
            LP++  +   PCIVYIHQIGYL+C F EK DE   EK+ DFEFA                
Sbjct  124  LPQLYKDKLAPCIVYIHQIGYLMCSFEEKFDEATLEKVQDFEFA----------------  167

Query  335  *HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                          F D +G+TK+FFY T KTRELD LLGDIYHKIL M
Sbjct  168  --------------FSDAEGETKRFFYYTPKTRELDNLLGDIYHKILDM  202



>dbj|BAB02831.1| unnamed protein product [Arabidopsis thaliana]
Length=748

 Score =   270 bits (691),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 192/502 (38%), Positives = 252/502 (50%), Gaps = 145/502 (29%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACI HG R+GVSYYD S+RQL+V+E WE+   DF L++M+KYQ +P +IY STKSEE
Sbjct  13    VYMACIQHGRRVGVSYYDCSVRQLHVLEFWEEDCSDFTLINMVKYQAKPSIIYASTKSEE  72

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
             SF+AALQ+ D T E   VKLVKSS FSYEQAWHRL+YL+VTGMDD LNIKERI +LSSMM
Sbjct  73    SFVAALQQNDGTDETTMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMM  132

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAALEA  1140
             D+ S+VQVR SGGLLAILE ERI++  EQNE  +ASIA+DSV E                
Sbjct  133   DVGSEVQVRVSGGLLAILESERIVETLEQNESGSASIAIDSVME----------------  176

Query  1139  LQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnarldA  960
                                           C TPMGRRLL           D + A    
Sbjct  177   ------------------------------CATPMGRRLLSR--------ADGIIAGDTE  198

Query  959   ISFLLFAEELSVSLRETLKSVKDVPCILKKFN----SPSCTCTSTDWAAFLKSICSLLHI  792
             IS     E    S +E+L+        +++FN      +  C ST+             +
Sbjct  199   IS-----EGHFTSTQESLREH------MRRFNLDIIEKAGLCISTE-------------L  234

Query  791   NKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK-QKGYETI  615
             + ++E+ I+  +   +  +++   K+ G        F  E++I V  V   + ++ YE  
Sbjct  235   DYVYELTITPQV---IGVIDVTRSKERGYQTLVKEGFCAEVIIEVHFVQLDELRQIYE--  289

Query  614   VKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFN  435
                    EL E  Q    +   LE    L   +LP        PCIVYI QIG       
Sbjct  290   -------ELPEFLQEVSAME--LEHFPHLHKEKLP--------PCIVYIQQIG-------  325

Query  434   EKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFY  255
                      ++  F+F +  +                    C+++        +T++FFY
Sbjct  326   -------GSEVSRFKFDISSIQ-------------------CYILK-------ETQRFFY  352

Query  254   RTSKTRELDTLLGDIYHKILGM  189
              TSKTRELD LLGDIYHKIL M
Sbjct  353   HTSKTRELDNLLGDIYHKILDM  374



>gb|EEC79464.1| hypothetical protein OsI_20481 [Oryza sativa Indica Group]
Length=927

 Score =   240 bits (612),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 152/232 (66%), Gaps = 31/232 (13%)
 Frame = -1

Query  884  CILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGD  705
            C   KFNSPS  CTS+DW AFLK ICSLLHINKIFEVGISE L  +L+++N+ +V KA  
Sbjct  398  CRFAKFNSPSSFCTSSDWHAFLKCICSLLHINKIFEVGISEHLAIKLQHMNIDLVGKANS  457

Query  704  HLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLE  525
             ++ +L ++ +LV+GV+DV R K+KGY+T+VKDG C ELDELR +YE LPDFLE+VS+ E
Sbjct  458  SITEELDYVSDLVVGVIDVQRGKEKGYDTLVKDGLCEELDELRMVYEELPDFLEQVSANE  517

Query  524  LARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHI  345
            +A  P        P IVY+HQIGYL+C F+EK+ + +   LPDFEFA             
Sbjct  518  IASFPFSFECRKAPLIVYVHQIGYLMCFFDEKISDALLIGLPDFEFA-------------  564

Query  344  LQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                                E+G+ ++F+Y T KTRELD LLGDIYHKIL M
Sbjct  565  ------------------FSEEGEERRFYYHTQKTRELDNLLGDIYHKILDM  598


 Score =   167 bits (424),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 27/155 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V+MAC+M G R+G++YYDSS+ QL+V+EIWED ++DFPL+D+                  
Sbjct  254   VHMACVMQGRRVGIAYYDSSMHQLFVLEIWEDITEDFPLIDL------------------  295

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
                      D   EA  VKL+KSS FSYEQAWHRLMYL+V  MD+ L++KERI FL+SMM
Sbjct  296   ---------DCNDEAPAVKLMKSSTFSYEQAWHRLMYLKVAAMDEGLSVKERICFLNSMM  346

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENA  1215
             D+ SDVQVRA+GGLLAIL++ER++D  +Q E  ++
Sbjct  347   DLGSDVQVRAAGGLLAILDNERLLDTLDQMEVRHS  381



>ref|XP_008656419.1| PREDICTED: DNA mismatch repair protein MSH5-like [Zea mays]
Length=171

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 134/172 (78%), Gaps = 1/172 (1%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             MAC+M G R+GV+YYDS  RQL+V+EIWED   +FPL+D++K+Q +   IYTSTK+EE+ 
Sbjct  1     MACVMQGRRVGVAYYDSDTRQLFVLEIWEDSVGEFPLIDLVKFQSKASTIYTSTKTEEAL  60

Query  1493  LAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDI  1314
             L+ALQR D   EA  VKL KSS FSYEQAWH L+YL+V  MDD L+ KERI FL+SMMD+
Sbjct  61    LSALQRNDGNGEAPVVKLTKSSTFSYEQAWHILIYLKVAAMDDGLSAKERICFLNSMMDL  120

Query  1313  SSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVD  1158
              SDVQVRA+GGLLAIL++ER++D  EQ E   ASIA+DSV +IS    ++++
Sbjct  121   GSDVQVRAAGGLLAILDNERLLDTIEQME-GGASIAIDSVVQISFYPLMEIN  171



>ref|XP_009767808.1| PREDICTED: DNA mismatch repair protein MSH5-like [Nicotiana sylvestris]
Length=194

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYMACIM GHRIGVSYYD+S RQL+V+EIWEDGS DF L+DM+KYQ +PG IYTSTKSEE
Sbjct  12    VYMACIMQGHRIGVSYYDASTRQLHVLEIWEDGSHDFSLVDMVKYQAKPGTIYTSTKSEE  71

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             SFL ALQR D TS+A +VKLVKSSLFS+EQAWHRLMYLQVTGMDD LNIKER +F
Sbjct  72    SFLGALQRSDGTSDAPSVKLVKSSLFSHEQAWHRLMYLQVTGMDDGLNIKERTAF  126



>gb|EMT12766.1| hypothetical protein F775_05603 [Aegilops tauschii]
Length=171

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 115/167 (69%), Gaps = 28/167 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V+MAC+M G R+GVSYYDS+ RQL+V+EIWED +  FPL+D+                  
Sbjct  24    VHMACVMQGRRVGVSYYDSNTRQLFVLEIWEDSAGGFPLIDL------------------  65

Query  1499  SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMM  1320
                      D+  +   VKL+KSS F+YEQAWHRL+YL+V  MDD L++KERI FL+SMM
Sbjct  66    ---------DSNDDPPVVKLMKSSTFTYEQAWHRLIYLKVAAMDDGLSVKERICFLNSMM  116

Query  1319  DISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISL  1179
             D+ SDVQVRA+GGLLAIL+ ER++D  EQ E   ASIA+DSV++IS 
Sbjct  117   DLGSDVQVRAAGGLLAILDSERLLDTLEQME-GGASIAIDSVAQISF  162



>ref|XP_005644118.1| hypothetical protein COCSUDRAFT_58323 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19574.1| hypothetical protein COCSUDRAFT_58323 [Coccomyxa subellipsoidea 
C-169]
Length=865

 Score =   181 bits (459),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 167/276 (61%), Gaps = 18/276 (7%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPL--LDMIKYQVQPGVIYTSTKSEE  1500
             MA       +G++ +DSS  ++ VM+  E+    F    L + K Q  P VIYTS K+++
Sbjct  1     MAAFHQSGSLGLACFDSSTAEVLVMQTNEESRGPFAYQSLQLAKLQFNPEVIYTSAKADQ  60

Query  1499  SFLAALQR---CDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
              FL AL++    D +     V+L KS LF   +A   L  L V GM + L+++ER+  L+
Sbjct  61    EFLDALKQGSGVDASDGEFEVRLEKSRLFHPNEAMGYLQMLHVRGMREGLSVQERMHVLN  120

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAA  1149
             +MM +S+  Q     GLL         D+  + EF+    +VD ++E  L+  L VD A+
Sbjct  121   TMMSLSATQQ-----GLLTA-----PTDMDSEMEFQ---FSVDRLAEFLLHGQLIVDPAS  167

Query  1148  LEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnar  969
             + ALQIFQ ++HPS MG+G++KEGFS+FGM+NKCV+PMG+RLL+ WF RPI++L  L  R
Sbjct  168   MRALQIFQEEQHPSAMGVGQSKEGFSIFGMLNKCVSPMGKRLLKLWFSRPIVNLAVLQDR  227

Query  968   ldAISFLLFAEELSVSLRETLKSVKDVPCILKKFNS  861
              D I  L+ A ++  SLR+ L+ +KDVP +L++  +
Sbjct  228   QDTIEALMRAPDVMKSLRDVLRKIKDVPKLLQRLQA  263


 Score = 84.7 bits (208),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 86/181 (48%), Gaps = 37/181 (20%)
 Frame = -1

Query  731  LGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPD  552
            LGIV+KA D + S L     ++  V++ ++ +      ++  G  ++LD L+  Y GLPD
Sbjct  380  LGIVRKAADCIDSALLTCHSMIANVINPDQEE----AMLIAVGVSDKLDALKHAYHGLPD  435

Query  551  FLEEVSSLELARLPRMVGE---NGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAV  381
            FL  V   E+ R+PR + +     L  I+Y+ Q+G+L+ +   ++  +++E LPD+EFA 
Sbjct  436  FLTRVVEAEMGRIPRHLSDAFKQQLWSIIYMPQVGFLVRVEGRRMTADVEEYLPDYEFA-  494

Query  380  CHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHK  201
                                         F D   +    +YR  +TR+L    GD+ H+
Sbjct  495  -----------------------------FEDASAEGSGMYYRCERTRDLQAEFGDMLHR  525

Query  200  I  198
            I
Sbjct  526  I  526



>ref|XP_001640822.1| predicted protein [Nematostella vectensis]
 gb|EDO48759.1| predicted protein [Nematostella vectensis]
Length=889

 Score =   178 bits (451),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 145/470 (31%), Positives = 235/470 (50%), Gaps = 55/470 (12%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVM-EIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEES  1497
             M  +  G ++GV+YYD+   +L++M +I E  + DF  L  +K Q+ P +I TS+K EE 
Sbjct  61    MCTVWSGSKLGVAYYDTFSSKLHLMMDIVE--TSDFQFLKRVKEQINPDIIVTSSKQEER  118

Query  1496  FLAALQ--RCDNTSEA----ATVKLVKSSLFSYEQAWHRLMYLQ-VTGMDDSLNIKERIS  1338
             F+A LQ    +N  E       V+++ +  F+ +    R++ L  + GM       ER  
Sbjct  119   FIAVLQGKEGENNDEQLCQQTDVEVLPAIDFTVDACKRRIIALNGLPGMPQHFTDMERTI  178

Query  1337  FLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEI--SLNKFLK  1164
             +++S++   +   VRA+G LL  LE +R        E E+  + V  +  +  S++  + 
Sbjct  179   YMTSLVPFDNVNMVRAAGALLKYLEKKRF-----GQELEDPDVHVPILDLVVFSIDDMVI  233

Query  1163  VDSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldl  987
             VD     ALQIFQ + HPS    G + KEG S+FG++N+  + +G RLLR WFLRP  D+
Sbjct  234   VDDNTYSALQIFQKESHPSVYKSGTSSKEGLSLFGVLNRTRSALGSRLLRMWFLRPTRDI  293

Query  986   ddlnarldAISFLLFAE--ELSVSLRETLKSVKD----------------VPCILKKFNS  861
               L  R  AI+F       +L  SL++ LK+VK+                VP IL +  +
Sbjct  294   LVLTERQKAITFFTTPRNIDLIASLQDCLKNVKNVSVRLYITKRELKVKSVPRILVRMKT  353

Query  860   PSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAF  681
                +   TDW A  K++ + ++I  +     SE          + I KK    ++ DL  
Sbjct  354   AQASI--TDWQALYKTVYNAMYIADLCRTIPSE----------IAIAKKITVLVTQDLHN  401

Query  680   ICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRM  504
             I  L+  ++D + S ++    +VK G    LDE ++ Y GLPDF+ +V+  EL +L P +
Sbjct  402   IASLINTIIDFDDSTEQN-RFVVKPGVDPALDERKRTYNGLPDFMTKVARKELNKLNPSI  460

Query  503   VGENGLPCIVYIHQIGYLLCI-FNEKLDEEMQEKLPDFEFAVCHLANFYY  357
             V  N    ++Y+ Q+GYLL +    K+ EE   ++   +F        YY
Sbjct  461   VECN----VIYLPQLGYLLAVPRTTKMKEEKDFEMDGLDFVFLSNNMVYY  506



>gb|KFM62949.1| MutS protein-like protein, partial [Stegodyphus mimosarum]
Length=841

 Score =   176 bits (445),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 138/513 (27%), Positives = 248/513 (48%), Gaps = 83/513 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             + ++ I   +++G +YY+    QLY++    D +  F +L  +  Q +P  + TS +++E
Sbjct  44    IILSIIWQANKLGAAYYNIDTSQLYLVTDHLDPAPHFTILSTLLKQTEPAYVVTSARTDE  103

Query  1499  SFLAAL----------QRCDNTS--------EAATVKLVKSSLFSYEQAWHRLMYLQVTG  1374
              F++AL          QR   +S        E   + L+ S  F++E + HRL  L    
Sbjct  104   KFISALKELLLQQNSAQRRSESSIFSNILSDENEKLHLLPSIEFAFEVSKHRLKNLNFPN  163

Query  1373  MDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSV  1194
             +  ++N  E+  + SS++D ++   V+A+GGLL  +E   +            ++ + SV
Sbjct  164   VPSNMNDVEKTIYFSSLIDFTNTCMVKAAGGLLKTIERSPL-------GLSLDTLKIVSV  216

Query  1193  SEISLNKFLKVDSAALEALQIFQIDKHPS-HMGIGRAKEGFSVFGMMNKCVTPMGRRLLR  1017
             S +SL   + +D     ALQIFQ ++HPS +      KEG S++G+ NKC + +G++ L+
Sbjct  217   STLSLKHLVNIDENTYRALQIFQEERHPSVYKNTFGIKEGLSLYGICNKCKSGIGKKELK  276

Query  1016  NWFLRPIldlddlnarldAISFLLFA--EELSVSLRETLKSVKDVPCILKKFNSPSCTCT  843
              WFL P  D++ +  R  +I + + A  +E+  +L+++LK +K +P +L    +   +  
Sbjct  277   RWFLLPTNDINLIQERQTSIQYFILAKNKEVMTALQDSLKFIKFLPRLLSHMKNAQASL-  335

Query  842   STDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVI  663
              +DW A  ++    + I  I     S+          L I K+ G+  S DL  I  L+ 
Sbjct  336   -SDWQALYRTSYHAVLIGDICRSRNSD----------LKIFKEIGETFSMDLFRIASLLD  384

Query  662   GVLDVNR-SKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGL  486
              ++D    +KQ  +  +VK G  +ELD++++ Y GLPDF+ +V+  EL  L     E+  
Sbjct  385   KIIDFQEYAKQNHF--VVKPGVDSELDKMKRTYNGLPDFMTQVAYQELQEL----SEDIQ  438

Query  485   PC-IVYIHQIGYLLCI-FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQC  312
              C ++Y+ Q+GYLL +   E++       +P+  F                         
Sbjct  439   KCSVIYLPQLGYLLAVPVTEQMKTTKNYIIPNLRFM------------------------  474

Query  311   CWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGD  213
                   F+  D       Y+T+ T++LD+LLGD
Sbjct  475   ------FILNDVA----HYKTANTKKLDSLLGD  497



>gb|AFW82411.1| hypothetical protein ZEAMMB73_943067 [Zea mays]
Length=118

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             MAC+M G R+GV+YYDS  RQL+V+EIWED   +FPL+D++K+Q +   IYTSTK+EE+ 
Sbjct  1     MACVMQGRRVGVAYYDSDTRQLFVLEIWEDSVGEFPLIDLVKFQSKASTIYTSTKTEEAL  60

Query  1493  LAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSM  1323
             L+ALQR D   EA  VKL KSS FSYEQAWH L+YL+V  MDD L+ KERI F+S +
Sbjct  61    LSALQRNDGNGEAPVVKLTKSSTFSYEQAWHILIYLKVAAMDDGLSAKERICFVSDL  117



>ref|XP_010705670.1| PREDICTED: mutS protein homolog 5 [Meleagris gallopavo]
Length=809

 Score =   168 bits (425),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 150/506 (30%), Positives = 243/506 (48%), Gaps = 71/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             ++M+ + +     V+YYD+    +Y M    D S+   LL  +  +V P  I TS K ++
Sbjct  27    IHMSVLWYAGEFAVTYYDTEDCSVYFMPDTPD-SEGLELLQKVTGEVHPKCIVTSAKQDQ  85

Query  1499  S---FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
             +   FL  L   D+      + L  +  F  E +  R++  Q   +   +   E+I +LS
Sbjct  86    NIANFLTNLADSDSDKGKIEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILYLS  145

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVS--EISLNKFLKVDS  1155
             S++   S + +RA GGLL  L+  R+       E E + IAV  ++  +  L++ + +D 
Sbjct  146   SVIPFESPLMIRALGGLLKYLDRRRV-----GVELEESGIAVPVLAFRKFVLSETVNIDQ  200

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ D HPS   +    KEGFS+FG++N+C    G +LLR W  RP  +L +L
Sbjct  201   DTYSVLQIFKSDIHPSVYKLSSGLKEGFSLFGILNRCRCKRGEKLLRLWLTRPTRNLTEL  260

Query  977   narldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N RLD I F L A+  E  ++L++ L+++K+VP ILK+          +DW A  K++C+
Sbjct  261   NKRLDVIHFFLLAQNHETVLTLQDCLRNIKNVPLILKRMTLSHTKV--SDWQALYKTVCN  318

Query  803   LLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              L             LR+  + L  ++ + +      + DL +I  L+  V+D   S  +
Sbjct  319   ALC------------LRDTCRSLPHSIELFQIISRVFTDDLQYIASLISKVVDFEGSISQ  366

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  367   NRFT-VRPNVDPTIDEKKRRLMGLSDFLTEVAQKELETL-----DNHIPSCCVIYIPLIG  420

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  421   FLLSI--PRLPSMVDKS--DFEIEGLDFM-------------------------FLSED-  450

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD+LLGD++ +I
Sbjct  451   ---KLHYRSARTKELDSLLGDLHCEI  473



>ref|XP_003388269.1| PREDICTED: mutS protein homolog 5 [Amphimedon queenslandica]
Length=837

 Score =   166 bits (421),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 158/510 (31%), Positives = 253/510 (50%), Gaps = 80/510 (16%)
 Frame = -1

Query  1673  MACIMHGHRIGVSYYDSSIRQLYVM-EIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEES  1497
             M+ + +G  +G+SYYD+   QL +M ++ E  +KD+ +L  +  QV+P VI TS+K +E+
Sbjct  46    MSVLYNGGCLGLSYYDTESGQLCIMLDVAE--TKDYEILKRVIMQVEPSVILTSSKQDEN  103

Query  1496  FLAALQRCDNTSE--------AATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNI----  1353
                 L+ C +           + +V+++ S  F YE A  R+M     G+  +       
Sbjct  104   MQQILKDCSSPEGDTGSIFAFSISVEVLPSVEFKYETAHRRIMSYSWPGVQGAGTGEGRA  163

Query  1352  ----KERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFEN--ASIAVDSVS  1191
                 KER   +SS++ + S   VR++G LL  L+ +RI       E E+    + + SV 
Sbjct  164   EGIEKEREVRISSIIPMDSSNMVRSTGALLKYLDKKRI-----GIELEDIGTHVPILSVK  218

Query  1190  EISLNKFLKVDSAALEALQIFQIDKHPS-HMGIGRAKEGFSVFGMMNKCVTPMGRRLLRN  1014
               +L+  L +D  A  +L+IF  + HPS + G   +KEG S+FG+ N   + +G +LL+ 
Sbjct  219   RFTLDDLLLMDETAFSSLRIFYRENHPSVYKGSSGSKEGLSLFGIANHTRSSLGHKLLKL  278

Query  1013  WFLRPIldlddlnarldAISF--LLFAEELSVSLRETLKSVKDVPCILKKFNSPSCTCTS  840
             WFLRP+ D+  L+ RLDAI +  L+   E   SL + LK++K++P IL + +    +   
Sbjct  279   WFLRPLKDIGTLSKRLDAIEYLSLIKNNETVASLTDCLKNIKNIPRILVRMSQSHLSI--  336

Query  839   TDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIG  660
             TDW +  K+  + ++I ++        L +     N+ I KK    LS  L  I  L+  
Sbjct  337   TDWQSLYKTTFNAINICELCST-----LPQ-----NIYIFKKIKGVLSDGLYQIASLITK  386

Query  659   VLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPC  480
             V+D   S  +    +VK G  ++LDE +  ++GL D + +V++ ELA L   V E    C
Sbjct  387   VVDFEESVAQN-RFVVKYGVNSDLDEKKHTFDGLTDLMTKVAATELAGLDPEVKE----C  441

Query  479   -IVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWL  303
              ++Y+ QIG+LL    EK+    QE  PDF              HI  +  A+L +    
Sbjct  442   QVIYVPQIGFLLRF--EKVSWMKQE--PDF--------------HIKDMTFAFLSE----  479

Query  302   IS*FLDEDGDTKKFFYRTSKTRELDTLLGD  213
                            YRT  T ELD LLGD
Sbjct  480   -----------GHVHYRTKATIELDDLLGD  498



>ref|XP_002981803.1| hypothetical protein SELMODRAFT_115165, partial [Selaginella 
moellendorffii]
 gb|EFJ17285.1| hypothetical protein SELMODRAFT_115165, partial [Selaginella 
moellendorffii]
Length=540

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 141/244 (58%), Gaps = 36/244 (15%)
 Frame = -1

Query  920  LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLK  741
            L+ T+K VK +P +L+KF SPS   + TDW+ FLKSI +L+ I +     +S   +++++
Sbjct  1    LQNTMKQVKSIPRLLQKFASPSFLSSRTDWSTFLKSINALIEIRQTLAAFLSSR-QDRVQ  59

Query  740  YLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEG  561
              NL I +K    ++ D A++ +LV GVLD +++  +  +T V  G C ELDEL+ IY+G
Sbjct  60   ISNLEIFQKVFSTVTEDFAYVSDLVKGVLDFDQTCGEACDTFVARGICQELDELKAIYDG  119

Query  560  LPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAV  381
            LP FL+E++S E+ +LPR     G   IVYI Q+GYL+C F  +L  E+ E  PDF+ A 
Sbjct  120  LPQFLDEIASSEIKKLPRQ--RQG--SIVYIPQVGYLMC-FPGELKPEVLEIAPDFQLA-  173

Query  380  CHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHK  201
                                         F    G+ ++FFY T+KTRELD +LGDIY+K
Sbjct  174  -----------------------------FKSGCGNDEEFFYHTTKTRELDEVLGDIYYK  204

Query  200  ILGM  189
            IL M
Sbjct  205  ILDM  208



>ref|XP_005154794.1| PREDICTED: mutS protein homolog 5-like [Melopsittacus undulatus]
Length=809

 Score =   165 bits (418),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 149/501 (30%), Positives = 238/501 (48%), Gaps = 67/501 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  27    THMSVMWYAGQLAITYYDTEDCSVYFMPDVPD-NEDLRLLQQVIGEINPRCIVTSAKQDQ  85

Query  1499  S---FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
             +   FL  L   D       + L  ++ F  E +  R++  Q   +   +   E+I +LS
Sbjct  86    NIAKFLTNLTAGDTDIRKPEIVLFPNTDFGLEVSKQRILSRQFPFIPSHMTTTEKILYLS  145

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVDS  1155
             S++   S + +RA GGLL  L+  R+       E E +S AV   +  +  L++ + +D 
Sbjct  146   SVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESSTAVPILAFKKFVLSEIVNMDQ  200

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L +L
Sbjct  201   DTYSVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGGKLLRLWLTRPTRNLTEL  260

Query  977   narldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N RLD I F L A+  E  ++L+  L+++K+VP ILK+          TDW A  K+ CS
Sbjct  261   NKRLDVIHFFLQAQNHETVLTLQGCLRNIKNVPLILKRMTLSHTKV--TDWQALYKTACS  318

Query  803   LLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGY  624
                      V + +  R   K + L   +      + DL +I  L+  V+D   S  +  
Sbjct  319   --------AVCLRDTCRSLPKTIEL--FQTISRVFTDDLHYIASLISKVVDFEGSISESR  368

Query  623   ETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYL  450
              T VK      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG+L
Sbjct  369   FT-VKPNVDPTIDEKKRKLMGLSDFLTEVARKELEDL-----DNHIPSCCVIYIPLIGFL  422

Query  449   LCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDT  270
             L I   +L   + +   DFE                                FL ED   
Sbjct  423   LSI--PRLPSMVDKS--DFEIEGLDFM-------------------------FLSED---  450

Query  269   KKFFYRTSKTRELDTLLGDIY  207
              K  YR+++T+ELD+LLGD++
Sbjct  451   -KLHYRSARTKELDSLLGDLH  470



>gb|KFR07341.1| MutS protein 5, partial [Opisthocomus hoazin]
Length=794

 Score =   164 bits (416),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 150/506 (30%), Positives = 243/506 (48%), Gaps = 69/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLRKVTGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL +L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTSLTATAVDKDVGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPPHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E +++AV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTVAVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D  A   LQIF+ D HPS   +    KEGFS++G++N+C    G++LLR W  RP  +L 
Sbjct  184   DEDAYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGQKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+   P      +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLPHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              S         V + +  R   K + L   +      + DL +I  L+  V+D   S  +
Sbjct  302   YS--------AVCLRDTCRSLPKTIEL--FQTISRVFTDDLHYIANLISKVVDFEGSMSE  351

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  352   NRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVAQKELETL-----DNHIPSCCVIYIPLIG  405

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  406   FLLSI--PRLPTMVDKS--DFEIKGLDFM-------------------------FLSED-  435

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD+LLGD++ +I
Sbjct  436   ---KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_009930214.1| PREDICTED: mutS protein homolog 5 [Opisthocomus hoazin]
Length=811

 Score =   164 bits (416),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 150/506 (30%), Positives = 243/506 (48%), Gaps = 69/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLRKVTGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL +L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTSLTATAVDKDVGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPPHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E +++AV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTVAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D  A   LQIF+ D HPS   +    KEGFS++G++N+C    G++LLR W  RP  +L 
Sbjct  201   DEDAYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGQKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+   P      +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLPHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              S         V + +  R   K + L   +      + DL +I  L+  V+D   S  +
Sbjct  319   YS--------AVCLRDTCRSLPKTIEL--FQTISRVFTDDLHYIANLISKVVDFEGSMSE  368

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  369   NRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVAQKELETL-----DNHIPSCCVIYIPLIG  422

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  423   FLLSI--PRLPTMVDKS--DFEIKGLDFM-------------------------FLSED-  452

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD+LLGD++ +I
Sbjct  453   ---KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_005091912.1| PREDICTED: mutS protein homolog 5-like [Aplysia californica]
Length=1184

 Score =   166 bits (420),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 149/512 (29%), Positives = 234/512 (46%), Gaps = 74/512 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VYM+ + H   + V++YD +  Q+YV+    + + DF L+  +  Q+QP VI  S+  + 
Sbjct  55    VYMSIVWHSGHLAVAHYDLTNVQIYVLPDVRE-TDDFSLIKHLLQQIQPSVIVVSSIQDS  113

Query  1499  SFLAALQRC----DNTS-----EAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKE  1347
               L  +++     ++TS     EA  ++ +  S F+YE +  R++ + +  +      +E
Sbjct  114   RLLTCIKKIATDMNSTSPGSNGEAYRIQFLPRSDFNYEVSKRRIIGMSLPSVPGHFTDEE  173

Query  1346  RISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENAS--IAVDSVSEISLNK  1173
             R    SS++ + S   VR  GGLL  LE  R+       E E+AS  + V      SL  
Sbjct  174   RRIHFSSLIPLDSVNMVRCVGGLLRHLEKMRV-----GVELEDASTRVPVLGFKVFSLED  228

Query  1172  FLKVDSAALEALQIFQIDKHPS--HMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRP  999
              +++D     AL IF  + HPS   +G   +KEG S+FG++N+C +  G R LR+WFLRP
Sbjct  229   QVQIDMLTYTALNIFHKELHPSAFKLGASGSKEGLSLFGILNRCKSANGTRRLRHWFLRP  288

Query  998   IldlddlnarldAISFLLFAEELSV--SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAA  825
             I +   L  R DA+SF L    L V   L   LK VK +P +L + +    T    DW A
Sbjct  289   IKNAALLRQRHDAVSFFLTPRNLEVVSCLHGCLKHVKFIPNVLVRMSKAKATI--GDWIA  346

Query  824   FLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVN  645
               K++   ++I  I         R Q++ +   I +K     + DL     LV   LD  
Sbjct  347   LSKTLYHAVYIGDI--------CRSQVQTVE--IFRKISATFTDDLHRCANLVFRTLDFE  396

Query  644   RSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIV-YI  468
              SK +    +VK G  + LD  ++ YEGLP  + +V+  EL  L   + E    C + YI
Sbjct  397   ESK-RAQRFVVKIGVDDALDAKKRTYEGLPSLMNQVAREELTGLSSEISE----CFLSYI  451

Query  467   HQIGYLLCIFN-EKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*F  291
              ++GYLL I   E   ++    +   +F        Y                       
Sbjct  452   PEVGYLLVIPKPEGKPDDADHTIEGLQFKFVSNGQLY-----------------------  488

Query  290   LDEDGDTKKFFYRTSKTRELDTLLGDIYHKIL  195
                        Y+++KT E+D LLGD   +IL
Sbjct  489   -----------YKSAKTLEMDRLLGDTKLEIL  509



>ref|XP_002967541.1| hypothetical protein SELMODRAFT_88713, partial [Selaginella moellendorffii]
 gb|EFJ30888.1| hypothetical protein SELMODRAFT_88713, partial [Selaginella moellendorffii]
Length=540

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 140/244 (57%), Gaps = 36/244 (15%)
 Frame = -1

Query  920  LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLK  741
            L+ T+K VK +P +L+KF SPS   + TDW+ FLKSI +L+ I +     +S   +++++
Sbjct  1    LQNTMKQVKSIPRLLQKFASPSFLSSRTDWSTFLKSINALIEIRQTLAAFLSSR-QDRVQ  59

Query  740  YLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEG  561
              NL I +K    ++ D A++ +LV GVLD +++  +  +T V  G C ELDEL+ IY+G
Sbjct  60   ISNLEIFQKVFSTVTEDFAYVSDLVKGVLDFDQTCGEACDTFVARGICQELDELKAIYDG  119

Query  560  LPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAV  381
            LP FL+E++S E+ +LP      G   IVYI Q+GYL+C F  +L  E+ E  PDF+ A 
Sbjct  120  LPQFLDEIASSEIKKLPHQ--RQG--SIVYIPQVGYLMC-FPGELKPEVLEIAPDFQLA-  173

Query  380  CHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHK  201
                                         F    G+ ++FFY T+KTRELD +LGDIY+K
Sbjct  174  -----------------------------FKSGCGNDEEFFYHTTKTRELDEVLGDIYYK  204

Query  200  ILGM  189
            IL M
Sbjct  205  ILDM  208



>gb|KFP20574.1| MutS protein 5, partial [Egretta garzetta]
Length=778

 Score =   162 bits (411),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ V+YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAVTYYDTEDCSVYFMPDIPD-NEDLKLLHKVIREVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL +L     D  +    + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIARFLTSLTATAGDKDTGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNI  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +  
Sbjct  184   DEDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNFT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+   P      +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRM--PLSHTKVSDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLQYIASLISKVVDFEGSA  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPAIDEKKRKLMGLSDFLTEVARKELEAL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  404   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_009642661.1| PREDICTED: mutS protein homolog 5 [Egretta garzetta]
Length=795

 Score =   162 bits (411),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ V+YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAVTYYDTEDCSVYFMPDIPD-NEDLKLLHKVIREVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL +L     D  +    + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIARFLTSLTATAGDKDTGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNI  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +  
Sbjct  201   DEDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNFT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+   P      +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRM--PLSHTKVSDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLQYIASLISKVVDFEGSA  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPAIDEKKRKLMGLSDFLTEVARKELEAL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>gb|KFO96199.1| MutS protein 5, partial [Calypte anna]
Length=792

 Score =   162 bits (410),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 149/512 (29%), Positives = 241/512 (47%), Gaps = 83/512 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLRLLQKVIGEVNPKCIVTSAKQDQ  68

Query  1499  S---FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
             +   FL  L   D       V L  +  F  E +  R++  Q   +   +   E+I +LS
Sbjct  69    NIAKFLTNLTAGDKEIGKPEVVLFPNMDFGLEVSKQRILSRQFPFIPSHMTATEKILYLS  128

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVDS  1155
             S++   + + +R  GGLL  L+  R+       E E +S+AV   +  +  L+  + +D 
Sbjct  129   SIIPFENPLMIRTLGGLLKFLDRRRV-----GVELEESSVAVPILAFKKFVLSDTVNMDQ  183

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L +L
Sbjct  184   DTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLTEL  243

Query  977   narldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N RLD I+F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K++ S
Sbjct  244   NKRLDVINFFLMAQNHETVLTLQGCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTVHS  301

Query  803   LLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              +             LR+  + L  N+ + +      + DL +I  L+  V+D   S  +
Sbjct  302   AVC------------LRDTCRSLPNNIELFQTISRVFTDDLHYIANLISKVVDFEGSNSE  349

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  350   NRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELENL-----DNHIPSCCVIYIPLIG  403

Query  455   YLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*  294
             +LL I           +LP      DFE                                
Sbjct  404   FLLSI----------PRLPTMVDKSDFEIEGLDFM-------------------------  428

Query  293   FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  429   FLSED----KLHYRSARTKELDSLLGDLHCEI  456



>ref|XP_008497466.1| PREDICTED: mutS protein homolog 5 [Calypte anna]
Length=809

 Score =   162 bits (410),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 148/506 (29%), Positives = 242/506 (48%), Gaps = 71/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLRLLQKVIGEVNPKCIVTSAKQDQ  85

Query  1499  S---FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
             +   FL  L   D       V L  +  F  E +  R++  Q   +   +   E+I +LS
Sbjct  86    NIAKFLTNLTAGDKEIGKPEVVLFPNMDFGLEVSKQRILSRQFPFIPSHMTATEKILYLS  145

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVDS  1155
             S++   + + +R  GGLL  L+  R+       E E +S+AV   +  +  L+  + +D 
Sbjct  146   SIIPFENPLMIRTLGGLLKFLDRRRV-----GVELEESSVAVPILAFKKFVLSDTVNMDQ  200

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L +L
Sbjct  201   DTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLTEL  260

Query  977   narldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N RLD I+F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K++ S
Sbjct  261   NKRLDVINFFLMAQNHETVLTLQGCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTVHS  318

Query  803   LLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              +             LR+  + L  N+ + +      + DL +I  L+  V+D   S  +
Sbjct  319   AVC------------LRDTCRSLPNNIELFQTISRVFTDDLHYIANLISKVVDFEGSNSE  366

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  367   NRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELENL-----DNHIPSCCVIYIPLIG  420

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  421   FLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSED-  450

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD+LLGD++ +I
Sbjct  451   ---KLHYRSARTKELDSLLGDLHCEI  473



>gb|KGL89306.1| MutS protein 5, partial [Charadrius vociferus]
Length=772

 Score =   160 bits (406),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 150/514 (29%), Positives = 240/514 (47%), Gaps = 85/514 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL M+  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLQMVIGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E++ +
Sbjct  69    NIAKFLTGLTAAAGDKDIRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKVLY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E +++AV   S  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTVAVPILSFKKFVLSDIVHM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     EN +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----ENHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLI  300
             IG+LL I           +LP      DFE                              
Sbjct  404   IGFLLSI----------PRLPTMVDKSDFEIEGLDFM-----------------------  430

Query  299   S*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
               FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   --FLSED----KLHYRSARTKELDSLLGDLHCEI  458



>gb|KFO93873.1| MutS protein 5, partial [Buceros rhinoceros silvestris]
Length=790

 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 148/514 (29%), Positives = 244/514 (47%), Gaps = 85/514 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +VQP  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLRLLHKVIGEVQPQTIVTSAKQDQ  68

Query  1499  S---FLAALQRCDNTSEAATVKLV--KSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L       +A   ++V   +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGEKDAGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   + + +RA GGLL  L+  R+       E E +++AV   S  +  L++ + V
Sbjct  129   LSSVIPFENPLMIRALGGLLKFLDRRRV-----GVELEESTVAVPILSFKKFGLSETVNV  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D  A   LQ+F+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDAYCVLQVFKSDIHPSVYKLSSGLKEGFSLYGILNRCKCKWGEKLLRLWLTRPTWNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++ +  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  244   ELNKRLDVIQFFLLAQNHEAVLTFQGCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
             CS +             LR+  + L   + + +      + DL ++  L+  V+D   S 
Sbjct  302   CSAVC------------LRDTCRSLTSTIELFQTISRVFTDDLRYLASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     ++ +P  C++YI  
Sbjct  350   SENRFT-VRPSVDPTIDEKKRKLMGLSDFLTEVAQKELENL-----DDHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLI  300
             IG+LL I           +LP      DFE                              
Sbjct  404   IGFLLSI----------PRLPTMVDKSDFEIEGLDFM-----------------------  430

Query  299   S*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
               FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   --FLSED----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_009878464.1| PREDICTED: mutS protein homolog 5 [Charadrius vociferus]
Length=809

 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 241/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL M+  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLQMVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E++ +
Sbjct  86    NIAKFLTGLTAAAGDKDIRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKVLY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E +++AV   S  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTVAVPILSFKKFVLSDIVHM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     EN +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----ENHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_010141062.1| PREDICTED: mutS protein homolog 5 [Buceros rhinoceros silvestris]
Length=811

 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 246/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +VQP  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLRLLHKVIGEVQPQTIVTSAKQDQ  85

Query  1499  S---FLAALQRCDNTSEAATVKLV--KSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L       +A   ++V   +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGEKDAGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   + + +RA GGLL  L D R + V    E E +++AV   S  +  L++ + V
Sbjct  146   LSSVIPFENPLMIRALGGLLKFL-DRRRVGV----ELEESTVAVPILSFKKFGLSETVNV  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D  A   LQ+F+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDAYCVLQVFKSDIHPSVYKLSSGLKEGFSLYGILNRCKCKWGEKLLRLWLTRPTWNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++ +  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  261   ELNKRLDVIQFFLLAQNHEAVLTFQGCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
             CS +             LR+  + L   + + +      + DL ++  L+  V+D   S 
Sbjct  319   CSAVC------------LRDTCRSLTSTIELFQTISRVFTDDLRYLASLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     ++ +P  C++YI  
Sbjct  367   SENRFT-VRPSVDPTIDEKKRKLMGLSDFLTEVAQKELENL-----DDHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>gb|EOB08672.1| MutS protein-like protein 5, partial [Anas platyrhynchos]
Length=793

 Score =   160 bits (406),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 151/508 (30%), Positives = 246/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  +  V+YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  9     THMSVLWYAGQFAVTYYDTEDCSVYFMPDTPD-NEDLDLLQKVVEEVHPQCIVTSAKQDQ  67

Query  1499  S---FLAALQRCDNTSEAATVKLV--KSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FLA L   D+  +    ++V   ++ F  E    R++  Q   +   +   E+I +
Sbjct  68    NIAKFLADLTASDSDKDVGKPEIVLFPNTDFGLEVGKQRILSRQFPFIPSHMTATEKILY  127

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E +S+ V   +  +  L+  + +
Sbjct  128   LSSVIPFESPLVIRALGGLLKFLDRRRV-----GIELEESSVVVPILAFKKFVLSDTVNM  182

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D  A   LQIF+ D HPS   +    KEGFS++G++N+C    G +LL+ W  RP  +L 
Sbjct  183   DQDAYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLKLWLTRPTRNLT  242

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L++ L+++K+VP ILK+          +DW A  K++
Sbjct  243   ELNKRLDVIHFFLLAQNHETVLTLQDCLRNIKNVPLILKRMTLSHTKV--SDWQALYKTL  300

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L  N+ + +      + DL +I  L+  V+D   S 
Sbjct  301   YSAVC------------LRDTCRSLPSNIELFQTISRVFTDDLHYIASLISKVVDFEGSI  348

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     ++ +P  C++YI  
Sbjct  349   SENRFT-VRPNVDPTIDEKKRRLMGLSDFLTEVARKELETL-----DDHIPSCCVIYIPL  402

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   M EK  DFE                                FL E
Sbjct  403   IGFLLSI--PRL-PTMVEK-SDFEIEGLDFM-------------------------FLSE  433

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  434   D----KLHYRSARTKELDSLLGDLHCEI  457



>ref|XP_010018240.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Nestor 
notabilis]
Length=806

 Score =   160 bits (404),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 149/506 (29%), Positives = 239/506 (47%), Gaps = 71/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDMPD-NEDLRLLQKVTEEINPQCIVTSAKQDQ  85

Query  1499  ---SFLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
                 FL  L   D       + L  +  F  E +  R++  Q   +   +   E+I +LS
Sbjct  86    HIAKFLTNLTAGDADIRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILYLS  145

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVDS  1155
             S++   S + +RA GGLL  L+  R+       E E ++ AV   +  +  L++ + +D 
Sbjct  146   SVIPFESSLMIRALGGLLKFLDRRRV-----GVELEESTTAVPILAFKKFVLSEIVNMDQ  200

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L +L
Sbjct  201   DTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLTEL  260

Query  977   narldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N RLD I F L A+  E  ++L+  LK++K+VP ILK+          TDW A  K+ CS
Sbjct  261   NKRLDVIHFFLQAQHHETVLTLQGCLKNIKNVPLILKRMTLYHTKV--TDWQALYKTACS  318

Query  803   LLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              L             LR+  + L   + + +      + DL +I  L+  V+D   S  +
Sbjct  319   ALC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSISE  366

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T VK      +DE ++   GL DFL EV+  EL  L     ++ +P  C++YI  IG
Sbjct  367   SRFT-VKPNVDPIIDEKKRKLMGLSDFLTEVARKELEDL-----DDHIPSCCVIYIPLIG  420

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  421   FLLSI--PRLPTMVDKN--DFEIEGLDFM-------------------------FLSED-  450

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD+LLGD++ +I
Sbjct  451   ---KLHYRSARTKELDSLLGDLHCEI  473



>ref|XP_004077924.1| PREDICTED: mutS protein homolog 5-like [Oryzias latipes]
Length=817

 Score =   159 bits (403),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 149/510 (29%), Positives = 236/510 (46%), Gaps = 90/510 (18%)
 Frame = -1

Query  1658  HGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESFLAALQ  1479
             HG ++G+ +YDS    L+ M    D + D  LL  +  ++ P VI TS K E      LQ
Sbjct  41    HG-QVGLCFYDSGDSSLHYMVDTPD-NYDLHLLARVIREISPHVIITSAKMEHCMTRFLQ  98

Query  1478  RCDN----TSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSSMMDIS  1311
                +      E  T   V    F  E    RL+   +  +  S+  ++R+S+LSS +   
Sbjct  99    HLASIPHYKPEVVTYPYVD---FGLEVGKQRLLSAHLPLLPASITERDRMSYLSSCITFD  155

Query  1310  SDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVDSAALEAL  1137
             S + +RA G LL  L+  R+       E E++S+ V        +L   + +DS     L
Sbjct  156   SPLMLRAVGALLKCLDRRRV-----GVELEDSSVGVPILQFHAYTLKGGVYIDSDTYSVL  210

Query  1136  QIFQIDKHPS----HMGIGRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnar  969
             QIF+ D HPS    H G    KEG S++G+MN+C    G +LLR WFLRP  DL  L  R
Sbjct  211   QIFKSDMHPSVYKLHSG---EKEGLSLYGIMNRCRCKFGAKLLRQWFLRPTQDLAVLCRR  267

Query  968   ldAISFLLFAEELSV--SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLH  795
              + I F    +   V  +L+  L++++++P +L++ +  +     TDW +  K++ S++ 
Sbjct  268   QEVIRFFTSPQNSDVLSTLQSLLRNIRNIPSLLRRMSLANTKV--TDWQSLYKTVYSVVC  325

Query  794   INKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             +            R+ +++L  ++G+ +      S DL++I  L+  ++D   + Q+   
Sbjct  326   V------------RDSVRHLPQSIGVFRDISGGFSDDLSYITALIGRIVDFEATVQENRF  373

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T VK      +DE ++   GL DFL +V+  EL  L PR+       C++YI  IG+LL 
Sbjct  374   T-VKPNVDPAIDEKKRRMAGLSDFLTDVARRELEHLDPRVPS----CCVIYIPLIGFLLS  428

Query  443   I-----FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDED  279
             +       EK D EM+      EF                               FL ED
Sbjct  429   LPRLPSMVEKEDFEME----GLEFM------------------------------FLSED  454

Query  278   GDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
                 +  YR+ +TRELD LLGD++  I  M
Sbjct  455   ----RLHYRSQRTRELDELLGDMHCDIRDM  480



>ref|XP_007060849.1| PREDICTED: mutS protein homolog 5-like [Chelonia mydas]
Length=812

 Score =   159 bits (403),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 145/506 (29%), Positives = 242/506 (48%), Gaps = 71/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +YM  + +   +G++YYD+    +Y M    D ++D  LL  +  +V P  I TS K + 
Sbjct  30    IYMCVLWYAGLLGITYYDTGDCSVYFMPDMPD-NEDLKLLQKVIDEVLPRCIVTSAKQDH  88

Query  1499  S---FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
             +   FL  +       +   + L  +  F  E +  R++  Q   +   +   E+I +LS
Sbjct  89    NIAKFLTNMGAATGDVDKPEIVLFPNMDFGLEVSKQRILSRQFPFIPSHMTATEKILYLS  148

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVDS  1155
             S++   S + VRA GGLL  L+  RI       E E+++I V   +  +  L   + +D 
Sbjct  149   SIIPFESPLMVRALGGLLKFLDRRRI-----GVELEDSTIGVPILAFKKFVLMDIVNMDQ  203

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ + HPS   +    KEG S++G++N+C    G +L+R W +RP  +L +L
Sbjct  204   DTFCVLQIFKSEVHPSVYKLSSGLKEGLSLYGILNRCRCKWGEKLMRLWLMRPTRNLTEL  263

Query  977   narldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N RLD I F L A+  E  ++L++ LK++K+VP IL++ N        +DW A  K++ S
Sbjct  264   NKRLDVIQFFLLAQNHETVLTLQDCLKNIKNVPQILRRMNLSHTKV--SDWQALYKTVYS  321

Query  803   LLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              +             LR+  + L  ++ + +      + DL +I  L+  V+D   S  +
Sbjct  322   AVC------------LRDTCRSLPSSIELFQTISQVFTDDLHYIASLISKVVDFESSISE  369

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+    + +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  370   NRFT-VRPNVDSIIDEKKRKLMGLSDFLTEVARKELETL-----DNRIPSCCVIYIPLIG  423

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  424   FLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSED-  453

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD++LGD++ +I
Sbjct  454   ---KLHYRSARTKELDSILGDLHCEI  476



>ref|XP_006030851.1| PREDICTED: mutS protein homolog 5-like [Alligator sinensis]
Length=813

 Score =   159 bits (402),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 145/507 (29%), Positives = 242/507 (48%), Gaps = 72/507 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V+M  + +G ++G++YYD+    +Y +    D ++   LL  +  +V P  I TS K + 
Sbjct  30    VHMCVLWYGGQLGITYYDTEDCSVYFVPDMPD-NEHLKLLQKVIDEVFPRCIVTSAKQDH  88

Query  1499  SFLAALQRCDNTSEAATVK----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
              F   L    +T +    K    L  ++ F  E +  R++  Q   +   +   E+I +L
Sbjct  89    HFAKFLTNISSTGDEHVKKPEIVLFPNADFGLEVSKQRILSRQFPFIPSHMTATEKILYL  148

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVD  1158
             SS++   S + VRA GGLL  L+  R+       E E++++ V   +  +  L   + +D
Sbjct  149   SSIIPFESPLMVRALGGLLKFLDRRRV-----GVELEDSTVGVPILAFKKFVLTDIVNMD  203

Query  1157  SAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldldd  981
                   LQIF+ + HPS   +    KEGFS++G++N+C    G +LLR W +RP  +L +
Sbjct  204   QDTYYVLQIFKSEVHPSVYKLASGLKEGFSLYGILNRCRCKWGEKLLRLWLMRPTRNLTE  263

Query  980   lnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSIC  807
             LN RLD I F L A+  E  ++L++ LK++K+VP IL++    +     +DW A  K+  
Sbjct  264   LNKRLDVIQFFLLAQNHETVLTLQDCLKNIKNVPLILRRMTLSNTKV--SDWQALYKTAY  321

Query  806   SLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQ  633
             S +             LR+  + L   + + +      + DL +I  L+  V+D   S  
Sbjct  322   SAVC------------LRDTCRSLPSTIELFQTISHVFTDDLHYIASLISKVIDFEGSIS  369

Query  632   KGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQI  459
             +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  I
Sbjct  370   ENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNRIPSCCVIYIPLI  423

Query  458   GYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDED  279
             G+LL I   +L   + +   DFE                                FL ED
Sbjct  424   GFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSED  454

Query  278   GDTKKFFYRTSKTRELDTLLGDIYHKI  198
                 K  YR+++T+ELD++LGD++ +I
Sbjct  455   ----KLHYRSARTKELDSMLGDLHCEI  477



>ref|XP_004286634.1| PREDICTED: mutS protein homolog 5 isoform 1 [Orcinus orca]
Length=832

 Score =   159 bits (402),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 149/502 (30%), Positives = 235/502 (47%), Gaps = 62/502 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  +     +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWSSGYLGIAYYDTSDSTIYFMPDAPD-HESLQLLQRVLDEIDPQSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   + L+ S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIILLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N SI +    + +L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFLGRRRI---GVELEDYNVSIPILGFKKFALTHLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLEELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETS--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++  I
Sbjct  473   LHYRSARTKELDALLGDLHCDI  494



>ref|XP_004286635.1| PREDICTED: mutS protein homolog 5 isoform 2 [Orcinus orca]
Length=831

 Score =   159 bits (402),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 149/502 (30%), Positives = 235/502 (47%), Gaps = 62/502 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  +     +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWSSGYLGIAYYDTSDSTIYFMPDAPD-HESLQLLQRVLDEIDPQSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   + L+ S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIILLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N SI +    + +L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFLGRRRI---GVELEDYNVSIPILGFKKFALTHLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLEELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETS--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++  I
Sbjct  473   LHYRSARTKELDALLGDLHCDI  494



>ref|XP_005509440.1| PREDICTED: mutS protein homolog 5-like [Columba livia]
Length=811

 Score =   159 bits (402),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 240/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL     ++ P  + TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDTPD-NEDLKLLHKAIGEINPQCVVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FLA L     DN +    + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLANLTATAGDNNTRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L   + +
Sbjct  146   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESAIAVPILAFKKFVLTDIVSM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + +        + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPSTIELFHTISRVFTDDLHYIATLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T VK      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VKPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_004311279.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Tursiops 
truncatus]
Length=771

 Score =   159 bits (401),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 148/499 (30%), Positives = 233/499 (47%), Gaps = 62/499 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  +     +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K  E
Sbjct  47    IHLCVLWSSGYLGIAYYDTSDSTIYFMPDAPD-HESLQLLQRVLDEIDPQSVVTSAKQNE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   + L+ S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIILLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N SI +    + +L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFLGRRRI---GVELEDYNVSIPILGFKKFALTHLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLEELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETS--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIY  207
               YR+++T+ELD LLGD++
Sbjct  473   LHYRSARTKELDALLGDLH  491



>gb|EMC83310.1| MutS like protein 5, partial [Columba livia]
Length=775

 Score =   158 bits (400),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 240/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL     ++ P  + TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDTPD-NEDLKLLHKAIGEINPQCVVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FLA L     DN +    + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLANLTATAGDNNTRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L   + +
Sbjct  129   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESAIAVPILAFKKFVLTDIVSM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + +        + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPSTIELFHTISRVFTDDLHYIATLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T VK      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VKPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  404   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_006118687.1| PREDICTED: mutS protein homolog 5-like [Pelodiscus sinensis]
Length=810

 Score =   158 bits (400),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 145/506 (29%), Positives = 240/506 (47%), Gaps = 71/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +YM  + +  ++G++YYD+    +Y M    D ++D  LL  +  +V P  I TS K + 
Sbjct  28    IYMCVLWYAGQLGITYYDTGDCSVYFMPDMPD-NEDLKLLQKVIDEVLPQCIVTSAKQDH  86

Query  1499  S---FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
             +   FL  +       E   + L  +  F  E +  R++  Q   +   +   E+I +LS
Sbjct  87    NIAKFLTNMGTATGNVEKPEIVLFPNMDFGLEVSKQRILSRQFPFIPSHMTATEKILYLS  146

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVDS  1155
             S++   S + VRA GGLL  L+  RI       E E+++I V   +  +  L   + +D 
Sbjct  147   SIIPFESPLMVRALGGLLKFLDKRRI-----GVELEDSTIGVPILAFKKFVLMDIVNMDQ  201

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ + HPS   +    KEG S+FG++N C    G +L+R W +RP  +L +L
Sbjct  202   DTYCVLQIFKSEVHPSVYKLATGLKEGLSLFGILNCCRCKWGEKLMRLWLMRPTQNLTEL  261

Query  977   narldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N RLD I F L A+  E  ++L++ LK++K+VP IL++          +DW A  K++ +
Sbjct  262   NKRLDVIQFFLLAQNHETVLTLQDCLKNIKNVPQILRRMTLSHTKV--SDWQALYKTVYN  319

Query  803   LLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              +             LR+  + L  ++ + +      + DL +I  L+  V+D   S  +
Sbjct  320   AVC------------LRDTCRSLPSSIELFQTISQVFTDDLYYIASLISKVVDFEGSISE  367

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  368   NRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELEML-----DNQIPSCCVIYIPLIG  421

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  422   FLLSI--PRLPTMVDKN--DFEIEGLDFM-------------------------FLSED-  451

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD++LGD++ +I
Sbjct  452   ---KLHYRSARTKELDSILGDLHCEI  474



>ref|XP_009561174.1| PREDICTED: mutS protein homolog 5 [Cuculus canorus]
Length=811

 Score =   158 bits (400),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 150/508 (30%), Positives = 243/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSIYFMPDVAD-NEDLKLLQKVIGEVSPRCIVTSAKQDQ  85

Query  1499  S---FLAAL--QRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTTNNGDKDIRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  RI       E E+++ AV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRI-----GVELEDSTTAVPILAFKKYVLSDTVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGI-GRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   + G  KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSGGLKEGFSLYGILNRCKCKWGEKLLRLWLTRPTRNLA  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K++
Sbjct  261   ELNKRLDVIHFFLQAQNHETVLTLQGCLKNIKNVPLILKRMTLSNTKV--SDWQALHKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   +G+ +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIGLFQTISHIFTDDLQYIGSLISKVVDFEGSS  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELEAL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>gb|KFO77640.1| MutS protein 5, partial [Cuculus canorus]
Length=794

 Score =   158 bits (399),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 151/514 (29%), Positives = 242/514 (47%), Gaps = 85/514 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSIYFMPDVAD-NEDLKLLQKVIGEVSPRCIVTSAKQDQ  68

Query  1499  S---FLAAL--QRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTTNNGDKDIRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  RI       E E+++ AV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRI-----GVELEDSTTAVPILAFKKYVLSDTVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGI-GRAKEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   + G  KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSGGLKEGFSLYGILNRCKCKWGEKLLRLWLTRPTRNLA  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K++
Sbjct  244   ELNKRLDVIHFFLQAQNHETVLTLQGCLKNIKNVPLILKRMTLSNTKV--SDWQALHKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   +G+ +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIGLFQTISHIFTDDLQYIGSLISKVVDFEGSS  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELEAL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLI  300
             IG+LL I           +LP      DFE                              
Sbjct  404   IGFLLSI----------PRLPTMVDKSDFEIEGLDFM-----------------------  430

Query  299   S*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
               FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   --FLSED----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_006259839.1| PREDICTED: mutS protein homolog 5-like [Alligator mississippiensis]
Length=813

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 145/507 (29%), Positives = 241/507 (48%), Gaps = 72/507 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V+M  + +  ++G++YYD+    +Y M    D ++   LL  +  +V P  I TS K + 
Sbjct  30    VHMCVLWYRGQLGITYYDTEDCSVYFMPDMPD-NEHLKLLQKVIDEVFPRCIVTSAKQDH  88

Query  1499  SFLAALQRCDNTSEAATVK----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
              F   L    +T +    K    L  ++ F  E +  R++  Q   +   +   E+I +L
Sbjct  89    HFAKFLTNISSTGDELVKKPEIVLFPNADFGLEVSKQRILSRQFPFIPSHMTATEKILYL  148

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVD  1158
             SS++   S + VRA GGLL  L+  R+       E E++++ V   +  +  L   + +D
Sbjct  149   SSIIPFESPLMVRALGGLLKFLDRRRV-----GVELEDSTVGVPILAFKKFVLTDIVNMD  203

Query  1157  SAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldldd  981
                   LQIF+ + HPS   +    KEGFS++G++N+C    G +LLR W +RP  +L +
Sbjct  204   QDTYYVLQIFKSEVHPSVYKLASGLKEGFSLYGILNRCRCKWGEKLLRLWLMRPTRNLTE  263

Query  980   lnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSIC  807
             LN RLD I F L A+  E  ++L++ LK++K+VP IL++    +     +DW A  K+  
Sbjct  264   LNKRLDVIQFFLLAQNHETVLTLQDCLKNIKNVPLILRRMTLSNTKV--SDWQALYKTAY  321

Query  806   SLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQ  633
             S +             LR+  + L   + + +      + DL +I  L+  V+D   S  
Sbjct  322   SAVC------------LRDTCRSLPSTIELFQTISHVFTDDLHYIASLISKVIDFEGSIS  369

Query  632   KGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQI  459
             +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  I
Sbjct  370   ENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNCIPSCCVIYIPLI  423

Query  458   GYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDED  279
             G+LL I   +L   + +   DFE                                FL ED
Sbjct  424   GFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSED  454

Query  278   GDTKKFFYRTSKTRELDTLLGDIYHKI  198
                 K  YR+++T+ELD++LGD++ +I
Sbjct  455   ----KLHYRSARTKELDSMLGDLHCEI  477



>ref|XP_010077228.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Pterocles 
gutturalis]
Length=807

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 147/506 (29%), Positives = 239/506 (47%), Gaps = 72/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +   + ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGELAITYYDTEDCSVYFMPDTPD-NEDLKLLHKVIGEVSPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    + L  ++ F  E +  R++  Q   +   +   E+I +
Sbjct  86    NITKFLNNLTATAGDKDTRKPEIVLFPNTDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +R  GGLL  L+  R+       E E ++I V   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRTLGGLLKFLDRRRV-----GVELEESTIVVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+      T   TDW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQSCLKNIKNVPLILKRM-----TLXVTDWQALYKTV  315

Query  809   CSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              S         V + +  R   K + L   +      + DL +I  L+  V+D   S  +
Sbjct  316   YS--------AVCLRDTCRSLPKTIEL--FQTISHVFTDDLHYIASLISKVVDFEGSVSE  365

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  366   NRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPLIG  419

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ++ 
Sbjct  420   FLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSDN-  449

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD+LLGD++ +I
Sbjct  450   ---KLHYRSARTKELDSLLGDLHCEI  472



>ref|XP_005280328.1| PREDICTED: mutS protein homolog 5 isoform X1 [Chrysemys picta 
bellii]
Length=811

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 242/506 (48%), Gaps = 71/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             ++M  + +  ++G++YYD+    +Y M    D ++D  LL  +  +V P  I TS K + 
Sbjct  29    IHMCVLWYAGQLGITYYDTGDCSVYFMPDMPD-NEDLKLLQKVIDEVLPQCIVTSAKQDH  87

Query  1499  S---FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
             +   FL  +       +   + L  +  F  E +  R++  Q   +   +   E+I +LS
Sbjct  88    NIAKFLTNMGAATGDGDKPEIVLFPNMDFGLEVSKQRILSRQFPFIPSHMTATEKILYLS  147

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVDS  1155
             S++   S + VRA GGLL  L+  RI       E E+++I V   +  +  L   + +D 
Sbjct  148   SIIPFESPLMVRALGGLLKFLDRRRI-----GVELEDSTIGVPILAFKKFVLMDIVNMDQ  202

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ + HPS   +    KEG S++G++N+C    G +L+R W +RP  +L +L
Sbjct  203   DTYCVLQIFKSEVHPSVYKLASGLKEGLSLYGILNRCRCKWGEKLMRLWLMRPTRNLTEL  262

Query  977   narldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N RLD I F L A+  E  ++L++ LK++K+VP IL++          +DW A  K++ S
Sbjct  263   NKRLDVIQFFLLAQNHETVLTLQDCLKNIKNVPQILRRMTLSHTKV--SDWQALYKTVYS  320

Query  803   LLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              +             LR+  + L  ++ + +      + DL +I  L+  V+D   S  +
Sbjct  321   AVC------------LRDTCRSLPSSIELFQTISQVFTDDLHYIASLISKVVDFEGSISE  368

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+    + +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  369   NRFT-VRPNVDSTIDEKKRKLMGLSDFLTEVARKELETL-----DNRIPSCCVIYIPLIG  422

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  423   FLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSED-  452

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD++LGD++ +I
Sbjct  453   ---KLHYRSARTKELDSILGDLHCEI  475



>ref|XP_005280329.1| PREDICTED: mutS protein homolog 5 isoform X2 [Chrysemys picta 
bellii]
Length=785

 Score =   157 bits (397),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 242/506 (48%), Gaps = 71/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             ++M  + +  ++G++YYD+    +Y M    D ++D  LL  +  +V P  I TS K + 
Sbjct  29    IHMCVLWYAGQLGITYYDTGDCSVYFMPDMPD-NEDLKLLQKVIDEVLPQCIVTSAKQDH  87

Query  1499  S---FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
             +   FL  +       +   + L  +  F  E +  R++  Q   +   +   E+I +LS
Sbjct  88    NIAKFLTNMGAATGDGDKPEIVLFPNMDFGLEVSKQRILSRQFPFIPSHMTATEKILYLS  147

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVDS  1155
             S++   S + VRA GGLL  L+  RI       E E+++I V   +  +  L   + +D 
Sbjct  148   SIIPFESPLMVRALGGLLKFLDRRRI-----GVELEDSTIGVPILAFKKFVLMDIVNMDQ  202

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ + HPS   +    KEG S++G++N+C    G +L+R W +RP  +L +L
Sbjct  203   DTYCVLQIFKSEVHPSVYKLASGLKEGLSLYGILNRCRCKWGEKLMRLWLMRPTRNLTEL  262

Query  977   narldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N RLD I F L A+  E  ++L++ LK++K+VP IL++          +DW A  K++ S
Sbjct  263   NKRLDVIQFFLLAQNHETVLTLQDCLKNIKNVPQILRRMTLSHTKV--SDWQALYKTVYS  320

Query  803   LLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              +             LR+  + L  ++ + +      + DL +I  L+  V+D   S  +
Sbjct  321   AVC------------LRDTCRSLPSSIELFQTISQVFTDDLHYIASLISKVVDFEGSISE  368

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+    + +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  369   NRFT-VRPNVDSTIDEKKRKLMGLSDFLTEVARKELETL-----DNRIPSCCVIYIPLIG  422

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  423   FLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSED-  452

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD++LGD++ +I
Sbjct  453   ---KLHYRSARTKELDSILGDLHCEI  475



>ref|XP_009317320.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Pygoscelis 
adeliae]
Length=814

 Score =   157 bits (397),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 151/509 (30%), Positives = 244/509 (48%), Gaps = 72/509 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  + +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDIGKPEIVLFPNIDFGLDVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTS-TDWAAFLKS  813
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+    + + T  +DW A  K+
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMKRMTMSHTKVSDWQALYKT  320

Query  812   ICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRS  639
             + S +             LR+  + L   + + +      + DL +I  L+  V+D   S
Sbjct  321   VYSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGS  368

Query  638   KQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIH  465
               +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI 
Sbjct  369   ISENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIP  422

Query  464   QIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLD  285
              IG+LL I   +L   M EK  DFE                                FL 
Sbjct  423   LIGFLLSI--PRL-PTMVEK-SDFEIEGLDFM-------------------------FLS  453

Query  284   EDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  454   ED----KLHYRSARTKELDSLLGDLHCEI  478



>ref|XP_009997426.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Chaetura 
pelagica]
Length=809

 Score =   157 bits (397),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 150/508 (30%), Positives = 246/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+   +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVFWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLQKVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRCDNTSEAATVKLV--KSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             S   FL  L   +   +    ++V   ++ F  E +  R++  Q   +   +   E+I +
Sbjct  86    SISKFLTNLTATEGDKDIGKPEIVLFPNTDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E +++AV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLVIRALGGLLKFLDRRRV-----GVELEESTVAVPILAFRKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I+F L A+  E  ++L+  LK+ K++P ILK+  + S T  S DW A  K++
Sbjct  261   ELNKRLDVINFFLMAQNHETVLTLQGCLKNXKNLPLILKRM-ALSHTKVS-DWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L  N+ + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPSNIELFQSIARVFTDDLHYIASLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   AENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVAQKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_007459613.1| PREDICTED: mutS protein homolog 5 isoform X2 [Lipotes vexillifer]
Length=831

 Score =   157 bits (397),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 147/502 (29%), Positives = 235/502 (47%), Gaps = 62/502 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWNSGYLGIAYYDTSDSTIYFMPDAPD-HESLKLLQRVLDEIDPQSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  +   RI     + E  N SI +    + +L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFMGRRRI---GVELEDCNVSIPILGFKKFALTHLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLEELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETN--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++  I
Sbjct  473   LHYRSARTKELDALLGDLHCDI  494



>ref|XP_007459612.1| PREDICTED: mutS protein homolog 5 isoform X1 [Lipotes vexillifer]
Length=832

 Score =   157 bits (397),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 147/502 (29%), Positives = 235/502 (47%), Gaps = 62/502 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWNSGYLGIAYYDTSDSTIYFMPDAPD-HESLKLLQRVLDEIDPQSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  +   RI     + E  N SI +    + +L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFMGRRRI---GVELEDCNVSIPILGFKKFALTHLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLEELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETN--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++  I
Sbjct  473   LHYRSARTKELDALLGDLHCDI  494



>gb|KFV88451.1| MutS protein 5, partial [Struthio camelus australis]
Length=794

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 145/505 (29%), Positives = 240/505 (48%), Gaps = 69/505 (14%)
 Frame = -1

Query  1676  YMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEES  1497
             YM+ +    ++ ++YYD+    +Y M    D ++D  LL     +V P  I TS K +++
Sbjct  11    YMSVLWFAGQLAITYYDTEDCSVYFMPDTPD-NEDLKLLQKAIGEVLPQCIVTSAKQDQN  69

Query  1496  ---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
                FL  L+    D  +    + L  +  F  E +  R++  Q   +   +   E+I +L
Sbjct  70    IAKFLTNLRDTADDKDTRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPTHMTATEKILYL  129

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++   S + +RA GGLL  L+  R+    E+N     ++ + +  +  L+  + +D  
Sbjct  130   SSIIPFESPLMIRALGGLLKFLDRRRVGVELEEN---TVAVPILAFKKFVLSDIVNMDQD  186

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L +LN
Sbjct  187   TYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTQNLIELN  246

Query  974   arldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
              RLD I F L A+  E  ++L++ LK++K+VP ILK+          +DW A  K++ S 
Sbjct  247   KRLDVIHFFLLAQNHETVLTLQDCLKNIKNVPLILKRMTLSHTRV--SDWQALYKTVYSA  304

Query  800   LHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKG  627
             +             LR+  + L   + + +      + DL +I  L+  V+D   S  + 
Sbjct  305   VC------------LRDTCRSLPSTIELFQTISHAFTDDLHYIASLISKVVDFEGSISEN  352

Query  626   YETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGY  453
               T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG+
Sbjct  353   RFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPLIGF  406

Query  452   LLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGD  273
             LL I   +L   + +   DFE                                FL ED  
Sbjct  407   LLSI--PRLPTMVDKN--DFEIEGLDFM-------------------------FLSED--  435

Query  272   TKKFFYRTSKTRELDTLLGDIYHKI  198
               K  YR+++T+ELD++LGD++ +I
Sbjct  436   --KLHYRSARTKELDSMLGDLHCEI  458



>gb|KFP67796.1| MutS protein 5, partial [Cariama cristata]
Length=784

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 146/508 (29%), Positives = 240/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSILWYAGQLAITYYDTEDCSIYFMPDIPD-NEDLKLLQKVIGEVNPQCIVTSAKQDQ  68

Query  1499  SFLAALQRCDNTSEAATVK-----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +    L     T+    V+     L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGDKDVRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPPHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++I V   +  +  L+  + +
Sbjct  129   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIVVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E+ ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHEIVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEASM  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  404   IGFLLSI--PRLPTMVDKS--DFEIKGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_009508200.1| PREDICTED: mutS protein homolog 5 [Phalacrocorax carbo]
Length=806

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 241/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ V+YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAVAYYDTEDCSVYFMPDTPD-NEDLRLLHKVIEEVNPQSIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDTGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTTTEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLVIRALGGLLKFLDRRRV-----GVELEESAIAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIHFFLMAQNHETVLTLQGCLKNIKNVPLILKRMTLAHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELENL-----DNQIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIKGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_009687119.1| PREDICTED: mutS protein homolog 5 [Struthio camelus australis]
Length=812

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 145/505 (29%), Positives = 240/505 (48%), Gaps = 69/505 (14%)
 Frame = -1

Query  1676  YMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEES  1497
             YM+ +    ++ ++YYD+    +Y M    D ++D  LL     +V P  I TS K +++
Sbjct  29    YMSVLWFAGQLAITYYDTEDCSVYFMPDTPD-NEDLKLLQKAIGEVLPQCIVTSAKQDQN  87

Query  1496  ---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
                FL  L+    D  +    + L  +  F  E +  R++  Q   +   +   E+I +L
Sbjct  88    IAKFLTNLRDTADDKDTRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPTHMTATEKILYL  147

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++   S + +RA GGLL  L+  R+    E+N     ++ + +  +  L+  + +D  
Sbjct  148   SSIIPFESPLMIRALGGLLKFLDRRRVGVELEEN---TVAVPILAFKKFVLSDIVNMDQD  204

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L +LN
Sbjct  205   TYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTQNLIELN  264

Query  974   arldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
              RLD I F L A+  E  ++L++ LK++K+VP ILK+          +DW A  K++ S 
Sbjct  265   KRLDVIHFFLLAQNHETVLTLQDCLKNIKNVPLILKRMTLSHTRV--SDWQALYKTVYSA  322

Query  800   LHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKG  627
             +             LR+  + L   + + +      + DL +I  L+  V+D   S  + 
Sbjct  323   VC------------LRDTCRSLPSTIELFQTISHAFTDDLHYIASLISKVVDFEGSISEN  370

Query  626   YETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGY  453
               T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG+
Sbjct  371   RFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPLIGF  424

Query  452   LLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGD  273
             LL I   +L   + +   DFE                                FL ED  
Sbjct  425   LLSI--PRLPTMVDKN--DFEIEGLDFM-------------------------FLSED--  453

Query  272   TKKFFYRTSKTRELDTLLGDIYHKI  198
               K  YR+++T+ELD++LGD++ +I
Sbjct  454   --KLHYRSARTKELDSMLGDLHCEI  476



>gb|KFW93842.1| MutS protein 5, partial [Phalacrocorax carbo]
Length=789

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 150/514 (29%), Positives = 240/514 (47%), Gaps = 85/514 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ V+YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAVAYYDTEDCSVYFMPDTPD-NEDLRLLHKVIEEVNPQSIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGDKDTGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTTTEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLVIRALGGLLKFLDRRRV-----GVELEESAIAVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIHFFLMAQNHETVLTLQGCLKNIKNVPLILKRMTLAHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELENL-----DNQIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLI  300
             IG+LL I           +LP      DFE                              
Sbjct  404   IGFLLSI----------PRLPTMVDKSDFEIKGLDFM-----------------------  430

Query  299   S*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
               FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   --FLSED----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_010226117.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Tinamus 
guttatus]
Length=807

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 149/510 (29%), Positives = 246/510 (48%), Gaps = 77/510 (15%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              YM+ +    ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  25    TYMSVLWFAGQLAITYYDTEDCSIYFMPDTPD-NEDLKLLQKVIGEVLPQCIVTSAKQDQ  83

Query  1499  S---FLAALQRCDNTSEAATVK----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERI  1341
             +   FL  L+  D+  E  T K    L  +  F  E +  R++  Q   +   +   E+I
Sbjct  84    NISKFLTDLR--DSGDEKDTRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKI  141

Query  1340  SFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFL  1167
              +LSS++   S + +RA GGLL  L+  R+       E E++S+ V   +  +  L+  +
Sbjct  142   LYLSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEDSSVVVPILAFKKFLLSDIV  196

Query  1166  KVDSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIld  990
              +D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +
Sbjct  197   NMDQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRN  256

Query  989   lddlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLK  816
             L +LN RLD I F L A+  E  ++L++ LK++K+VP ILK+    +     +DW A  K
Sbjct  257   LTELNKRLDVIHFFLLAQNHETVLTLQDCLKNIKNVPLILKRMTLSNTKV--SDWQALYK  314

Query  815   SICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNR  642
             ++ S +             LR+  + L   + + +      + DL +I  L+  V+D + 
Sbjct  315   TVYSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFDA  362

Query  641   SKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYI  468
             S  +   T V+      +DE ++   GL DFL EV+  EL  L     ++ +P  C++YI
Sbjct  363   SISENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DDHIPSCCVIYI  416

Query  467   HQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FL  288
               IG+LL I   +L   + +   DFE                                FL
Sbjct  417   PLIGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FL  447

Query  287   DEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
              ED    K  YR+++T+ELD++LGD++ +I
Sbjct  448   SED----KLHYRSARTKELDSMLGDLHCEI  473



>gb|KFQ85939.1| MutS protein 5, partial [Phoenicopterus ruber ruber]
Length=785

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 151/508 (30%), Positives = 243/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDTPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPPHMTPTEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  ++  + +
Sbjct  129   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVMSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYSVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+  S S T  S DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRM-SLSNTKVS-DWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISHVFTDDLHYIASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  404   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_009704081.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Cariama 
cristata]
Length=818

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 146/508 (29%), Positives = 240/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSILWYAGQLAITYYDTEDCSIYFMPDIPD-NEDLKLLQKVIGEVNPQCIVTSAKQDQ  85

Query  1499  SFLAALQRCDNTSEAATVK-----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +    L     T+    V+     L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDVRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPPHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++I V   +  +  L+  + +
Sbjct  146   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIVVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E+ ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHEIVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEASM  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIKGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_009093466.1| PREDICTED: mutS protein homolog 5 [Serinus canaria]
Length=811

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 150/515 (29%), Positives = 244/515 (47%), Gaps = 87/515 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLQKVIGELNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDS  1155
             LSS++   S + +RA GGLL  L+  R+       E E++SIAV     ++  KF+  D+
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEDSSIAVPI---LAFKKFVMSDT  197

Query  1154  AALE-----ALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIl  993
               ++      LQIF+ D HPS   +    KEGFS+FG++N+C    G +LLR W  RP  
Sbjct  198   VNMDQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLFGILNRCRCKWGEKLLRLWLTRPTR  257

Query  992   dlddlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFL  819
             +L +LN RLD I+F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  
Sbjct  258   NLTELNKRLDVINFFLLAQNYETVLTLQNCLKNIKNVPLILKRMTLSNTKV--SDWQALY  315

Query  818   KS----ICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGV  657
             K+    +C                LR+  + L   + + +      + DL +I  L+  V
Sbjct  316   KTAYNAVC----------------LRDTCRSLPSTIELFQTISRVFTDDLHYIANLISKV  359

Query  656   LDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--  483
             +D   S  +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  
Sbjct  360   VDFEGSLSENRFT-VRPNVDATIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSC  413

Query  482   CIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWL  303
             C++YI  IG+LL I   +L   + +   DFE                             
Sbjct  414   CVIYIPLIGFLLSI--PRLPNMVDKT--DFEIEGLDFM----------------------  447

Query  302   IS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
                FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  448   ---FLSED----KLHYRSARTKELDSLLGDLHCEI  475



>gb|KFM09048.1| MutS protein 5, partial [Aptenodytes forsteri]
Length=794

 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 150/508 (30%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +   + ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGHLAITYYDTEDCSVYFMPDIPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  ++ F  + +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGDKDIGKPEIVLFPNTDFGLDVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      ++DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTNDLHYIASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   M EK  DFE                                FL E
Sbjct  404   IGFLLSI--PRL-PTMVEK-SDFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDSLLGDLHCEI  458



>gb|KFV20075.1| MutS protein 5, partial [Tauraco erythrolophus]
Length=775

 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 149/512 (29%), Positives = 238/512 (46%), Gaps = 81/512 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL+ +  ++ P  I TS K ++
Sbjct  10    THMSLLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLEKVIGEINPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       V L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTTAAGDKDIGKPEVVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++I V   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIVVPILAFKKFVLSDTVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  ++ 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNVT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  V+L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVVTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              S         V + +  R   K + L   +      + DL +I  L+  V+D   S  +
Sbjct  302   YS--------AVCLRDTCRSLPKTIEL--FQTISRVFTDDLHYIASLISKVVDFEGSVSE  351

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  352   NRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPLIG  405

Query  455   YLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*  294
             +LL I           +LP      DFE                                
Sbjct  406   FLLSI----------PRLPTMVDKSDFEIEGLDFM-------------------------  430

Query  293   FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   FLSED----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_010399946.1| PREDICTED: mutS protein homolog 5 [Corvus cornix cornix]
Length=811

 Score =   156 bits (395),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 242/510 (47%), Gaps = 77/510 (15%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             ++M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  27    IHMSVLWYAGQLAITYYDTEDCSVYFMPEIPD-NEDLKLLQKVIGELNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    + L  +  F  E    R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDTGKPEIVLFPNIDFGLEVTKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E++SIAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEDSSIAVPILAFKKFVLSDTVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  ++ 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNVT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKS-  813
             +LN RLD I+F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  261   ELNKRLDVINFFLLAQNHETVLTLQNCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  318

Query  812   ---ICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDV  648
                +C                LR+  + L   + + +      + DL +I  L+  V+D 
Sbjct  319   YNAVC----------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLISKVVDF  362

Query  647   NRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYI  468
               S  +   T+  +   N +DE ++   GL DFL EV+  EL  L   +      C++YI
Sbjct  363   EGSLSENRFTVRPNVDAN-IDEKKRKLMGLSDFLTEVARKELETLDNRITSC---CVIYI  418

Query  467   HQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FL  288
               IG+LL I   +L   M EK  DFE                                FL
Sbjct  419   PLIGFLLSI--PRL-PNMVEK-SDFEIEGLDFM-------------------------FL  449

Query  287   DEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
              ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  450   SED----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_009279797.1| PREDICTED: mutS protein homolog 5 [Aptenodytes forsteri]
Length=811

 Score =   156 bits (395),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 150/508 (30%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +   + ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGHLAITYYDTEDCSVYFMPDIPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  ++ F  + +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDIGKPEIVLFPNTDFGLDVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      ++DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTNDLHYIASLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   M EK  DFE                                FL E
Sbjct  421   IGFLLSI--PRL-PTMVEK-SDFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_009988118.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Tauraco 
erythrolophus]
Length=805

 Score =   156 bits (395),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 148/506 (29%), Positives = 239/506 (47%), Gaps = 69/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL+ +  ++ P  I TS K ++
Sbjct  27    THMSLLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLEKVIGEINPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       V L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTTAAGDKDIGKPEVVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++I V   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIVVPILAFKKFVLSDTVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  ++ 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNVT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  V+L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVVTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              S         V + +  R   K + L   +      + DL +I  L+  V+D   S  +
Sbjct  319   YS--------AVCLRDTCRSLPKTIEL--FQTISRVFTDDLHYIASLISKVVDFEGSVSE  368

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  IG
Sbjct  369   NRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPLIG  422

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   + +   DFE                                FL ED 
Sbjct  423   FLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSED-  452

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD+LLGD++ +I
Sbjct  453   ---KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_007194024.1| PREDICTED: mutS protein homolog 5 isoform X5 [Balaenoptera acutorostrata 
scammoni]
Length=683

 Score =   155 bits (392),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 145/499 (29%), Positives = 232/499 (46%), Gaps = 62/499 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWNSGYLGIAYYDTSDSTIYFMPDAPD-HESLRLLQRVLDEINPQSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIIYLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  +   RI     + E  N S+ +    +  L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFMGRRRI---GVELEDYNVSVPILGFKKFVLTHLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETN--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIY  207
               YR+++T+ELD LLGD++
Sbjct  473   LHYRSARTKELDALLGDLH  491



>gb|KFV60516.1| MutS protein 5, partial [Tyto alba]
Length=794

 Score =   156 bits (395),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 240/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLRKVIGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  + +  R++  Q   +   +   E+I +
Sbjct  69    NISKFLTNLTATAGDKDIGKPEIVLFPNIDFGLQVSKQRILSRQFPFIPSHMTTTEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       + E ++IAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVQLEESTIAVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  V+L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVVTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+I V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPHTIELFQTISRVFTDDLHYIASLIIKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  404   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDRLLGDLHCEI  458



>ref|XP_008636052.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Corvus 
brachyrhynchos]
Length=801

 Score =   156 bits (395),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 242/510 (47%), Gaps = 77/510 (15%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             ++M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  27    IHMSVLWYAGQLAITYYDTEDCSVYFMPEIPD-NEDLKLLQKVIGELNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    + L  +  F  E    R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDTGKPEIVLFPNIDFGLEVTKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E++SIAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEDSSIAVPILAFKKFVLSDTVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  ++ 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNVT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKS-  813
             +LN RLD I+F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  261   ELNKRLDVINFFLLAQNHETVLTLQNCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  318

Query  812   ---ICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDV  648
                +C                LR+  + L   + + +      + DL +I  L+  V+D 
Sbjct  319   YNAVC----------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLISKVVDF  362

Query  647   NRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYI  468
               S  +   T+  +   N +DE ++   GL DFL EV+  EL  L   +      C++YI
Sbjct  363   EGSLSENRFTVRPNVDAN-IDEKKRKLMGLSDFLTEVARKELETLDNRITSC---CVIYI  418

Query  467   HQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FL  288
               IG+LL I   +L   M EK  DFE                                FL
Sbjct  419   PLIGFLLSI--PRL-PNMVEK-SDFEIEGLDFM-------------------------FL  449

Query  287   DEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
              ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  450   SED----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_009972762.1| PREDICTED: mutS protein homolog 5 [Tyto alba]
Length=811

 Score =   156 bits (395),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 240/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLRKVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  + +  R++  Q   +   +   E+I +
Sbjct  86    NISKFLTNLTATAGDKDIGKPEIVLFPNIDFGLQVSKQRILSRQFPFIPSHMTTTEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       + E ++IAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVQLEESTIAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  V+L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVVTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+I V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPHTIELFQTISRVFTDDLHYIASLIIKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDRLLGDLHCEI  475



>ref|XP_008819731.1| PREDICTED: mutS protein homolog 5 [Nannospalax galili]
Length=828

 Score =   156 bits (395),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 145/501 (29%), Positives = 231/501 (46%), Gaps = 60/501 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V++  +     +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E
Sbjct  44    VHLCVLWSSGYLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEVSPQTVVTSAKQDE  102

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++  ++   +  + S  F  E +  RL+    T +  S+   E++ FL
Sbjct  103   NMTQFLGKLASQEHRETKRPEIIFLPSMDFGPEISKQRLLSGNYTFIPQSMTASEKVLFL  162

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N S+ +    +  L   + +D  
Sbjct  163   SSIVPFDCLLTVRALGGLLKFLSRRRI---GVELEDPNVSVPILGFKKFVLTHLVSIDQD  219

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  +L +LN
Sbjct  220   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTHELRELN  279

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +++VP ILK+    S      DW    K++ S 
Sbjct  280   SRLDVIQFFLLPQNLDMAQMLHRLLSHIRNVPLILKRMKLASTKV--RDWQVLYKTVYSA  337

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL +I  L+  V+D  RS  +   
Sbjct  338   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLYYIASLIGKVVDFERSLAENRF  387

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCI  441
             T++ +    E+DE ++   GLP FL EV+  EL  L   V       ++YI  IG+LL I
Sbjct  388   TVLPN-IDPEIDEKKRRLMGLPSFLTEVAQKELENLDSCVPSCS---VIYIPLIGFLLSI  443

Query  440   FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKF  261
                +L   ++    DFE                                FL E+    K 
Sbjct  444   --PRLSSMLEAS--DFEVEGLDFM-------------------------FLSEE----KL  470

Query  260   FYRTSKTRELDTLLGDIYHKI  198
              YR+++T+ELD LLGD++ +I
Sbjct  471   HYRSARTKELDALLGDLHCEI  491



>ref|XP_010573003.1| PREDICTED: mutS protein homolog 5 [Haliaeetus leucocephalus]
Length=811

 Score =   156 bits (394),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 149/510 (29%), Positives = 243/510 (48%), Gaps = 77/510 (15%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL+ L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLSNLTATAGDKDIRKPEIVLFPNMDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  146   LSSIIPFESTLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKK--FNSPSCTCTSTDWAAFLK  816
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+   + P      +DW A  K
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHPKV----SDWQALYK  316

Query  815   SICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNR  642
             ++ S +             LR   + L  ++ + +      + DL +I  L+  V+D   
Sbjct  317   TVYSAVC------------LRNTCRSLPNSIELFQTISRVFTDDLHYIASLISKVVDFEG  364

Query  641   SKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYI  468
             S  +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI
Sbjct  365   SISENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYI  418

Query  467   HQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FL  288
               IG+LL I   +L   + +   DFE                                FL
Sbjct  419   PLIGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FL  449

Query  287   DEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
              ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  450   SED----KLHYRSARTKELDSLLGDLHCEI  475



>gb|KFQ55251.1| MutS protein 5, partial [Pelecanus crispus]
Length=794

 Score =   155 bits (393),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 147/508 (29%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y +    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCVVYFLPDIPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL +L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTSLTATAGDKDRGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  + +L+  + +
Sbjct  129   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESAIAVPILAFKKFALSDTVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIQFFLLAQNHETVLTLQSCLKNIKNVPLILKRMTLAHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRNLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  404   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_009488976.1| PREDICTED: mutS protein homolog 5 [Pelecanus crispus]
Length=811

 Score =   155 bits (393),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 147/508 (29%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y +    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCVVYFLPDIPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL +L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTSLTATAGDKDRGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  + +L+  + +
Sbjct  146   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESAIAVPILAFKKFALSDTVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIQFFLLAQNHETVLTLQSCLKNIKNVPLILKRMTLAHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRNLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>gb|KFZ46653.1| MutS protein 5, partial [Caprimulgus carolinensis]
Length=794

 Score =   155 bits (393),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 149/514 (29%), Positives = 241/514 (47%), Gaps = 85/514 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAIAYYDTEDCSVYFMPDTPD-NEDLKLLHKVIEEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGDKDTGKPEIVLFPNIDFGLEVSKQRIVSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  RI       E E +SIAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLLIRALGGLLKFLDRRRI-----GVELEESSIAVPILAFKKYVLSDIVNI  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ + HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSEVHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLA  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I+F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVINFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              + +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YNAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLI  300
             IG+LL I           +LP      DFE                              
Sbjct  404   IGFLLSI----------PRLPTMVDKSDFEIEGLDFM-----------------------  430

Query  299   S*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
               FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   --FLSED----KLHYRSARTKELDSLLGDLHCEI  458



>gb|KFW63646.1| MutS protein 5, partial [Pygoscelis adeliae]
Length=782

 Score =   155 bits (393),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 150/508 (30%), Positives = 241/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  + +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGDKDIGKPEIVLFPNIDFGLDVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTMSHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   M EK  DFE                                FL E
Sbjct  404   IGFLLSI--PRL-PTMVEK-SDFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_007194023.1| PREDICTED: mutS protein homolog 5 isoform X4 [Balaenoptera acutorostrata 
scammoni]
Length=815

 Score =   155 bits (393),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 145/499 (29%), Positives = 232/499 (46%), Gaps = 62/499 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWNSGYLGIAYYDTSDSTIYFMPDAPD-HESLRLLQRVLDEINPQSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIIYLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  +   RI     + E  N S+ +    +  L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFMGRRRI---GVELEDYNVSVPILGFKKFVLTHLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETN--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIY  207
               YR+++T+ELD LLGD++
Sbjct  473   LHYRSARTKELDALLGDLH  491



>ref|XP_003272166.2| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 isoform 
2 [Nomascus leucogenys]
Length=835

 Score =   155 bits (393),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 145/502 (29%), Positives = 232/502 (46%), Gaps = 63/502 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  51    IHLCVLWNSGYLGIAYYDTSDSTIHFMPDAPD-YESLKLLQRVLDEINPQSVVTSAKQDE  109

Query  1499  S---FLAALQRCDNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLS  1329
             +   FL  L      +    +  + S  F  E +  RL+    + + DS+   E+I FLS
Sbjct  110   NMTRFLGKLAPGAQRAXKTEIIFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFLS  169

Query  1328  SMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAA  1149
             S++     + VRA GGLL  L   RI     + E  N S+ +    +  L   + +D   
Sbjct  170   SIIPFDCLLTVRALGGLLKFLGRRRI---GVELEDYNVSVPILGFKKFMLTHLVNIDQDT  226

Query  1148  LEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlna  972
                LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN+
Sbjct  227   YSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTHDLGELNS  286

Query  971   rldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLL  798
             RLD I F L  + L V+  L   L  +K+VP ILK+          +DW    K++ S L
Sbjct  287   RLDVIQFFLLPQNLDVAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSAL  344

Query  797   HINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYET  618
                     G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   T
Sbjct  345   --------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFT  394

Query  617   IVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLLC  444
             ++ +    E+DE ++   GLP+FL EV+  EL  L     ++ +P   ++YI  IG+LL 
Sbjct  395   VLPN-IDPEIDEKKRRLMGLPNFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLLS  448

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  449   I--PRLPSMVEAS--DFEINGLDFM-------------------------FLSEE----K  475

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++ +I
Sbjct  476   LHYRSARTKELDALLGDLHCEI  497



>ref|XP_007110174.1| PREDICTED: mutS protein homolog 5 [Physeter catodon]
Length=831

 Score =   155 bits (393),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 147/502 (29%), Positives = 232/502 (46%), Gaps = 62/502 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  +     +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWSSGYLGIAYYDTSDSTIYFMPDAPD-HESLKLLQRVLDEIDPRSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  +   RI     + E  N SI +    +  L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFMGRRRI---GVELEDYNVSIPILGFKKFVLTYLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETN--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++  I
Sbjct  473   LHYRSARTKELDALLGDLHCDI  494



>ref|XP_010113946.1| PREDICTED: mutS protein homolog 5 [Chlamydotis macqueenii]
Length=811

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 151/508 (30%), Positives = 243/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSIYFMPDTPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    V L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDTGKPEVVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E  +IAV   +  +  L+  + +
Sbjct  146   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEENTIAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP +LK+  + S T  S DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETILTLQGCLKNIKNVPLMLKRM-ALSHTKVS-DWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_007194022.1| PREDICTED: mutS protein homolog 5 isoform X3 [Balaenoptera acutorostrata 
scammoni]
Length=831

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 233/502 (46%), Gaps = 62/502 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWNSGYLGIAYYDTSDSTIYFMPDAPD-HESLRLLQRVLDEINPQSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIIYLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  +   RI     + E  N S+ +    +  L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFMGRRRI---GVELEDYNVSVPILGFKKFVLTHLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETN--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++  I
Sbjct  473   LHYRSARTKELDALLGDLHCDI  494



>ref|XP_010163817.1| PREDICTED: mutS protein homolog 5 [Caprimulgus carolinensis]
Length=811

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAIAYYDTEDCSVYFMPDTPD-NEDLKLLHKVIEEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDTGKPEIVLFPNIDFGLEVSKQRIVSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  RI       E E +SIAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLLIRALGGLLKFLDRRRI-----GVELEESSIAVPILAFKKYVLSDIVNI  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ + HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSEVHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLA  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I+F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVINFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              + +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YNAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_007194020.1| PREDICTED: mutS protein homolog 5 isoform X1 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007194021.1| PREDICTED: mutS protein homolog 5 isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=832

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 233/502 (46%), Gaps = 62/502 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWNSGYLGIAYYDTSDSTIYFMPDAPD-HESLRLLQRVLDEINPQSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIIYLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  +   RI     + E  N S+ +    +  L   + +D  
Sbjct  166   SSIIPFDCLLTVRALGGLLKFMGRRRI---GVELEDYNVSVPILGFKKFVLTHLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  223   TYSVLQIFKSEPHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARL-PRMVGENGLPCIVYIHQIGYLLC  444
             T++ +    E+DE ++   GLP FL EV+  EL  L PR+   +    ++YI  IG+LLC
Sbjct  391   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDPRIPSCS----VIYIPLIGFLLC  445

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  446   I--PRLPSMVETN--DFEIEGLDFM-------------------------FLSEE----K  472

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++  I
Sbjct  473   LHYRSARTKELDALLGDLHCDI  494



>gb|KFP35265.1| MutS protein 5, partial [Chlamydotis macqueenii]
Length=794

 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 152/514 (30%), Positives = 242/514 (47%), Gaps = 85/514 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSIYFMPDTPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    V L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGDKDTGKPEVVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E  +IAV   +  +  L+  + +
Sbjct  129   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEENTIAVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP +LK+  + S T  S DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETILTLQGCLKNIKNVPLMLKRM-ALSHTKVS-DWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLI  300
             IG+LL I           +LP      DFE                              
Sbjct  404   IGFLLSI----------PRLPTMVDKSDFEIEGLDFM-----------------------  430

Query  299   S*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
               FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   --FLSED----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_009575536.1| PREDICTED: mutS protein homolog 5 [Fulmarus glacialis]
Length=807

 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 240/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAEFLTNLTATAGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGAKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_007647282.1| PREDICTED: mutS protein homolog 5 isoform X1 [Cricetulus griseus]
Length=881

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 228/503 (45%), Gaps = 71/503 (14%)
 Frame = -1

Query  1667  CIM--HGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             C++   GH +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E+ 
Sbjct  99    CVLWSSGH-LGIAYYDTSDSTVHFMPDAPD-HQSLKLLQRVLDEVNPQSVITSAKQDEAM  156

Query  1493  LAALQRCDNTSEAATVK----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSS  1326
                L++  +       K    L+ S  F  E +  RL+    + + +S+   E+I FLSS
Sbjct  157   TRFLRKLASQEHRQPKKPEIILLPSVDFGPETSKQRLLSGNYSFIPESMTATEKILFLSS  216

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             ++     + VRA GGLL  L   R   V  + E  N S+ +    +  L   + +D    
Sbjct  217   IIPFDCVLTVRALGGLLKFLSRRR---VGVELEDYNVSVPILGFKKFVLTHLVSIDQDTY  273

Query  1145  EALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnar  969
               LQIF+ + HPS   +    KEG S+FG++N+C    G++LLR WF RP  +L +LN+R
Sbjct  274   SVLQIFKSEAHPSVYKVASGLKEGLSLFGILNRCRCKWGQKLLRLWFTRPTQELRELNSR  333

Query  968   ldAISFLLFAEELSV--SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLH  795
             LD I F L  + L    ++   L  +K+VP ILK+          +DW    K++ S L 
Sbjct  334   LDVIQFFLMPQNLDTAQTMHRLLSHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSAL-  390

Query  794   INKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETI  615
                    G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   T+
Sbjct  391   -------GLRDVCRSLPQAIQL--FQDIAQEFSDDLHHIASLIGKVVDFEESLAENRFTV  441

Query  614   VKDGFCNELDELRQIYEGLPDFLEEVSSLEL----ARLPRMVGENGLPCIVYIHQIGYLL  447
             + +    E+D  ++   GLP FL EV+  EL    AR+P          ++YI  IG+LL
Sbjct  442   LPN-IDPEIDSKKRRLTGLPSFLTEVAQKELDNLDARIPSC-------SVIYIPLIGFLL  493

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I       E      DFE                                FL ED    
Sbjct  494   SIPRLPFMVEAS----DFEIEGLEFM-------------------------FLSED----  520

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  521   KLHYRSTRTKELDTLLGDLHCEI  543



>ref|XP_003508523.2| PREDICTED: mutS protein homolog 5 isoform X2 [Cricetulus griseus]
Length=880

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 228/503 (45%), Gaps = 71/503 (14%)
 Frame = -1

Query  1667  CIM--HGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             C++   GH +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E+ 
Sbjct  99    CVLWSSGH-LGIAYYDTSDSTVHFMPDAPD-HQSLKLLQRVLDEVNPQSVITSAKQDEAM  156

Query  1493  LAALQRCDNTSEAATVK----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSS  1326
                L++  +       K    L+ S  F  E +  RL+    + + +S+   E+I FLSS
Sbjct  157   TRFLRKLASQEHRQPKKPEIILLPSVDFGPETSKQRLLSGNYSFIPESMTATEKILFLSS  216

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             ++     + VRA GGLL  L   R   V  + E  N S+ +    +  L   + +D    
Sbjct  217   IIPFDCVLTVRALGGLLKFLSRRR---VGVELEDYNVSVPILGFKKFVLTHLVSIDQDTY  273

Query  1145  EALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnar  969
               LQIF+ + HPS   +    KEG S+FG++N+C    G++LLR WF RP  +L +LN+R
Sbjct  274   SVLQIFKSEAHPSVYKVASGLKEGLSLFGILNRCRCKWGQKLLRLWFTRPTQELRELNSR  333

Query  968   ldAISFLLFAEELSV--SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLH  795
             LD I F L  + L    ++   L  +K+VP ILK+          +DW    K++ S L 
Sbjct  334   LDVIQFFLMPQNLDTAQTMHRLLSHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSAL-  390

Query  794   INKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETI  615
                    G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   T+
Sbjct  391   -------GLRDVCRSLPQAIQL--FQDIAQEFSDDLHHIASLIGKVVDFEESLAENRFTV  441

Query  614   VKDGFCNELDELRQIYEGLPDFLEEVSSLEL----ARLPRMVGENGLPCIVYIHQIGYLL  447
             + +    E+D  ++   GLP FL EV+  EL    AR+P          ++YI  IG+LL
Sbjct  442   LPN-IDPEIDSKKRRLTGLPSFLTEVAQKELDNLDARIPSC-------SVIYIPLIGFLL  493

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I       E      DFE                                FL ED    
Sbjct  494   SIPRLPFMVEAS----DFEIEGLEFM-------------------------FLSED----  520

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  521   KLHYRSTRTKELDTLLGDLHCEI  543



>gb|KFV97048.1| MutS protein 5, partial [Fulmarus glacialis]
Length=790

 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 149/514 (29%), Positives = 239/514 (46%), Gaps = 85/514 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAEFLTNLTATAGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGAKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLI  300
             IG+LL I           +LP      DFE                              
Sbjct  404   IGFLLSI----------PRLPTMVDKSDFEIEGLDFM-----------------------  430

Query  299   S*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
               FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   --FLSED----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_005005527.1| PREDICTED: mutS protein homolog 5 isoform X2 [Cavia porcellus]
Length=838

 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 145/503 (29%), Positives = 233/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +G  +G++YYD+S   +Y M    D  +   LL  +  ++ P  I T+ K +E
Sbjct  53    IHLCALWNGGHLGIAYYDTSDSTIYFMPDAPD-HESLMLLQRVLDEINPQSIVTTAKQDE  111

Query  1499  S---FLAALQRCDN-TSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             S   FL  L   ++  S+   + L+ S  F  E +  RL+    + + +S+   E+I FL
Sbjct  112   SMTHFLGKLASQEHRASKKPEIILLPSVDFGLEISKQRLLSGNYSFIPESMTATEKILFL  171

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + +RA GGL   L   RI     + E  N S+ +    +  L   + +D  
Sbjct  172   SSIIPFDCLLTIRALGGLFKFLGRRRI---GVELEDYNISVPILGFKKFVLTHLVSIDQD  228

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++LN
Sbjct  229   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTRDLEELN  288

Query  974   arldAISFLLFAEELSV--SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L +  +L   +  +K+VP ILK+          +DW    K++ S 
Sbjct  289   SRLDVIQFFLLPQNLDIAQTLHRLMSHIKNVPMILKRMKLSHTKV--SDWHILYKTVYSA  346

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  347   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  396

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  397   TVLPN-IDPEIDEKKRRLMGLPSFLTEVARTELENL-----DSRIPSCSVIYIPLIGFLL  450

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I       E      DFE                                FL E+    
Sbjct  451   SIPRLPFMVEAN----DFEIEGLDFM-------------------------FLSEE----  477

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELD LLGD++ +I
Sbjct  478   KLHYRSTRTKELDALLGDLHCEI  500



>ref|XP_003473798.1| PREDICTED: mutS protein homolog 5 isoform X1 [Cavia porcellus]
Length=837

 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 145/503 (29%), Positives = 233/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +G  +G++YYD+S   +Y M    D  +   LL  +  ++ P  I T+ K +E
Sbjct  53    IHLCALWNGGHLGIAYYDTSDSTIYFMPDAPD-HESLMLLQRVLDEINPQSIVTTAKQDE  111

Query  1499  S---FLAALQRCDN-TSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             S   FL  L   ++  S+   + L+ S  F  E +  RL+    + + +S+   E+I FL
Sbjct  112   SMTHFLGKLASQEHRASKKPEIILLPSVDFGLEISKQRLLSGNYSFIPESMTATEKILFL  171

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + +RA GGL   L   RI     + E  N S+ +    +  L   + +D  
Sbjct  172   SSIIPFDCLLTIRALGGLFKFLGRRRI---GVELEDYNISVPILGFKKFVLTHLVSIDQD  228

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++LN
Sbjct  229   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTRDLEELN  288

Query  974   arldAISFLLFAEELSV--SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L +  +L   +  +K+VP ILK+          +DW    K++ S 
Sbjct  289   SRLDVIQFFLLPQNLDIAQTLHRLMSHIKNVPMILKRMKLSHTKV--SDWHILYKTVYSA  346

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  347   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  396

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  397   TVLPN-IDPEIDEKKRRLMGLPSFLTEVARTELENL-----DSRIPSCSVIYIPLIGFLL  450

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I       E      DFE                                FL E+    
Sbjct  451   SIPRLPFMVEAN----DFEIEGLDFM-------------------------FLSEE----  477

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELD LLGD++ +I
Sbjct  478   KLHYRSTRTKELDALLGDLHCEI  500



>ref|XP_002119672.1| PREDICTED: mutS protein homolog 5-like [Ciona intestinalis]
Length=857

 Score =   155 bits (391),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 121/444 (27%), Positives = 222/444 (50%), Gaps = 44/444 (10%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             VY++ + +  ++G +YY+S  + +Y +E   + S  F  ++ +  ++ P  I TS K + 
Sbjct  31    VYLSVVWYSGKLGAAYYESESQIIYFLEASVESSP-FERVERLINELLPTTIITSAKQDP  89

Query  1499  SFLAAL----QRCDNTSEA-----------------ATVKLVKSSLFSYEQAWHRLMYLQ  1383
              F+  L    ++  N+ E                  ATV+++ S  F Y+ +  R++ + 
Sbjct  90    DFVEKLKIFAEKETNSGEKTLEGNISNESVNVNENCATVEMLSSMEFRYDNSKRRILLVN  149

Query  1382  VTGMDDSLNIKERISFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAV  1203
             +  M D     ER  ++SS++ + +   VRA+GGLL  L+  R+    E +E +     +
Sbjct  150   LLAMPDHYTESERAVYMSSLVQLDNHCSVRAAGGLLRFLDKNRVGVGLESSEVQT---PI  206

Query  1202  DSVSEISLNKFLKVDSAALEALQIFQIDKHPSHMGIGRAKEGFSVFGMMNKCVTPMGRRL  1023
              +    +L   + +D+A+ +ALQIF+  +HPS   +G  KEG S+FG++N+  T +GRR+
Sbjct  207   ATFMNFTLKHAMSMDTASYDALQIFKQLRHPSAYKVGY-KEGISLFGILNRTTTTVGRRM  265

Query  1022  LRNWFLRPIldlddlnarldAISFLLFA--EELSVSLRETLKSVKDVPCILKKFNSPSCT  849
             L++WF RP  DL  L  RLDA+ +L     EE   S+++ LK VK V  +  K  +   +
Sbjct  266   LKSWFFRPTTDLKVLTERLDAVEYLANPRHEETLNSVKDCLKKVKTVSNMFVKLRTSKLS  325

Query  848   CTSTDWAAFLKSICSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICEL  669
                ++W    ++  + L I  +    +       L + ++          + DL  +  +
Sbjct  326   V--SEWVGLWETAQNALRIADLCRSAVLAPEATPLIFSDIART------FTQDLVSVVTV  377

Query  668   VIGVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENG  489
             +  ++D+  SK +G + +VK G    LD+++  Y  LP  L ++++ ELA+    +    
Sbjct  378   IGNIMDIPSSKTEG-KFVVKSGVSEMLDDMKATYAKLPALLGQLATKELAKYSDYISS--  434

Query  488   LPC-IVYIHQIGYLLCIFNEKLDE  420
               C +VY+  +GYLL  F  K DE
Sbjct  435   --CQVVYMRLVGYLL--FITKTDE  454



>ref|NP_001182287.1| mutS protein homolog 5 [Sus scrofa]
 gb|ABX82820.1| mutS-like protein 5 [Sus scrofa]
Length=835

 Score =   155 bits (391),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 145/500 (29%), Positives = 234/500 (47%), Gaps = 64/500 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+    ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  51    IHLCVLWNSGHLGIAYYDTGDSTIHFMPDAPD-HESLKLLQRVLDEINPLSVVTSAKQDE  109

Query  1499  S---FLAALQRCDNTS-EAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   D+ + +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  110   NMTRFLGKLVSQDHRAPKRPEIVFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  169

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N S+ +    +  L   + +D  
Sbjct  170   SSIIPFDCLLTVRALGGLLKFLGRRRI---GVELEDYNVSVPILGFKKFVLTHLVSIDQD  226

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  227   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  286

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  287   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  344

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   ++     S DL  I  L+  V+D   S  +   
Sbjct  345   L--------GLRDACRSLPQSIQL--FQEIAHDFSDDLHHIASLIGKVVDFEGSLAENRF  394

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  395   TVLPN-IDPEIDEKKRRLMGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  448

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
             CI   +L   ++    DFE                                FL E+    
Sbjct  449   CI--PRLPSMVETS--DFEIEGLDFM-------------------------FLSEE----  475

Query  266   KFFYRTSKTRELDTLLGDIY  207
             K  YR+++T+ELDTLLGD++
Sbjct  476   KLHYRSARTKELDTLLGDLH  495



>ref|XP_002190135.2| PREDICTED: mutS protein homolog 5 [Taeniopygia guttata]
Length=999

 Score =   155 bits (392),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 151/514 (29%), Positives = 246/514 (48%), Gaps = 85/514 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  211   THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLQKVIGELNPQCIVTSAKQDQ  269

Query  1499  SFLAALQRCDNTSE-----AATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +    L     TS         + L  +  F  E +  R++  Q   +   +   ++I +
Sbjct  270   NIAKFLTNLTATSGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATDKILY  329

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDS  1155
             LSS++   S + +RA GGLL  L D R + V    E E++SIAV     ++  KF+  D+
Sbjct  330   LSSIIPFESPLMIRALGGLLKFL-DRRRVGV----ELEDSSIAVPI---LAFKKFVLSDT  381

Query  1154  AALE-----ALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIl  993
               L+      LQIF+ D HPS   +    KEGFS+FG++N+C    G +LLR W  RP  
Sbjct  382   VNLDQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLFGILNRCRCKWGEKLLRLWLTRPTR  441

Query  992   dlddlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTST---DWA  828
             ++ +LN RLD I+F L A+  E  ++L+  LK++K+VP ILK+      T ++T   DW 
Sbjct  442   NVTELNKRLDVINFFLLAQNHETVLTLQNCLKNIKNVPLILKRM-----TLSNTKVRDWQ  496

Query  827   AFLKSICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVL  654
             A  K+  + +             LR+  + L   + + +      + DL +I  L+  V+
Sbjct  497   ALYKTAYNAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLISKVV  544

Query  653   DVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPC--  480
             D   S  +   TI +      +DE ++   GLPDFL EV+  EL  L     +N +P   
Sbjct  545   DFEGSLSENRFTI-RPNVDAAIDEKKRKLMGLPDFLTEVAQKELEAL-----DNHIPACS  598

Query  479   IVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLI  300
             ++YI  IG+LL I   +L   + +   DFE                              
Sbjct  599   VIYIPLIGFLLSI--PRLPNMVDKT--DFEIEGLDFM-----------------------  631

Query  299   S*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
               FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  632   --FLSED----KLHYRSARTKELDSLLGDLHSEI  659



>ref|XP_003340425.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Monodelphis 
domestica]
Length=825

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 147/511 (29%), Positives = 239/511 (47%), Gaps = 80/511 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              Y+  + +   +G++YYD++   +Y +    D   +  LL  +  ++ P  I TS K +E
Sbjct  41    TYLCVLWNSGCLGIAYYDTADSTIYFLPDTPD-CDNLKLLQRVVNEINPRSIITSAKQDE  99

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   D+   E     L+ S  F  E +  R++    + M +SL   E+I FL
Sbjct  100   NMAQFLGGLVSSDHKEQETPETVLLPSVDFGLEISKQRILSGNFSFMPESLTCTEKILFL  159

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGL   L   R   V+ + E  + S+ +    +  L   + +D  
Sbjct  160   SSIIPFDCPLMVRALGGLFKFLNRRR---VNVELEDNSVSVPILGFKKFVLTDLVSIDQD  216

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C +  G +LLR W +RP  DL++LN
Sbjct  217   TYSVLQIFKSEIHPSVYKMASGLKEGLSLFGILNRCRSKGGEKLLRLWLMRPTQDLEELN  276

Query  974   arldAISFLLFAE--ELSVSLRETLKSVKDVPCILKK--FNSPSCTCTSTDWAAFLKSIC  807
             +RLD I F L  +  E++++L   L  +K+VP IL++  F+ P      +DW    K+  
Sbjct  277   SRLDVIQFFLLPQNLEMALTLHGLLSHIKNVPLILRRMLFSHPKV----SDWRFLNKTAY  332

Query  806   SLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKG  627
             S L        G+ +  R   + + L   +      S DL  I  L+  V+D+  S  + 
Sbjct  333   SAL--------GLRDTCRSLPQSIRL--FRDIAQEFSDDLHHIACLINKVVDLESSIAEN  382

Query  626   YETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGY  453
               T V+     ++DE ++   GLP FL EV+  EL  L     ++ +P  C++YI  IG+
Sbjct  383   RFT-VRPNIDPDIDEKKRKLMGLPSFLTEVARKELETL-----DSRIPSCCVLYIPLIGF  436

Query  452   LLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*F  291
             LL I           +LP      DFE                                F
Sbjct  437   LLSI----------PRLPTMIDPSDFEIVGLDFM-------------------------F  461

Query  290   LDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             L E+    K  YR+++T+ELD++LGD++ +I
Sbjct  462   LSEE----KLHYRSARTKELDSILGDLHCEI  488



>ref|XP_003944383.1| PREDICTED: mutS protein homolog 5 [Saimiri boliviensis boliviensis]
Length=834

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 146/503 (29%), Positives = 234/503 (47%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  50    IHLCVLWNSGYLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEINPQSVVTSAKQDE  108

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  109   TMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  168

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N  I +    +  L   + +D  
Sbjct  169   SSVIPFDCLLTVRALGGLLKFLGRRRI---GVELEDYNVGIPILGFKKFVLTHLVNIDQD  225

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  226   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTHDLGELN  285

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  286   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  343

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   K + L   +      S DL  I  L+  V+D   S  +   
Sbjct  344   L--------GLRDACRSLPKSIQL--FRDIAHEFSDDLHHIASLIGKVVDFEGSLAENRF  393

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP+FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  394   TVLPN-IDPEIDEKKRRLMGLPNFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  447

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
             CI   +L   ++    DFE                                FL E+    
Sbjct  448   CI--PRLSSMVEAS--DFEIDGLDFM-------------------------FLSEE----  474

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELD LLGD++ +I
Sbjct  475   KLHYRSARTKELDALLGDLHCEI  497



>gb|KFQ93670.1| MutS protein 5, partial [Nipponia nippon]
Length=794

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 148/514 (29%), Positives = 238/514 (46%), Gaps = 85/514 (17%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMSDTPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAEFLTNLTATAGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A   ++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYNTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSS  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNRIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLP------DFEFAVCHLANFYY*LHILQL*HAYLHQCCWLI  300
             IG+LL I           +LP      DFE                              
Sbjct  404   IGFLLSI----------PRLPTMVDKSDFEIEGLDFM-----------------------  430

Query  299   S*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
               FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   --FLSED----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_009459030.1| PREDICTED: mutS protein homolog 5 [Nipponia nippon]
Length=811

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 147/508 (29%), Positives = 239/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMSDTPD-NEDLKLLHKVIGEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAEFLTNLTATAGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A   ++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYNTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGSS  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNRIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>gb|KFW80954.1| MutS protein 5, partial [Manacus vitellinus]
Length=794

 Score =   154 bits (389),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 150/512 (29%), Positives = 243/512 (47%), Gaps = 81/512 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPEIPD-NEDLKLLQKVTGELNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGDKDIGKPEIVLFPNVDFGLEVSKQRILSRQFPFIPSHMTETEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E++SIAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEDSSIAVPILAFKKFVLSDTVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKS-  813
             +LN RLD ISF L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  244   ELNKRLDVISFFLMAQNHETVLTLQNCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  301

Query  812   ---ICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDV  648
                +C                LR+  + L   + + +      + DL +I  L+  V+D 
Sbjct  302   YNAVC----------------LRDTCRSLPNTIELFQTISHVFTDDLHYIANLISKVVDF  345

Query  647   NRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIV  474
               S  +   T V+      +DE ++   GL DFL EV+  EL  L     ++ +P  C++
Sbjct  346   EGSLSENRFT-VRPNVDATIDEKKRKLMGLSDFLTEVARKELETL-----DDHIPSCCVI  399

Query  473   YIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*  294
             YI  IG+LL I   +L  +M EK  DFE                                
Sbjct  400   YIPLIGFLLSI--PRL-PDMVEK-SDFEIEGLDFM-------------------------  430

Query  293   FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             FL  D    K  YR+++T+ELD+LLGD++ +I
Sbjct  431   FLSND----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_008260820.1| PREDICTED: mutS protein homolog 5 isoform X5 [Oryctolagus cuniculus]
Length=756

 Score =   154 bits (388),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 233/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E
Sbjct  50    IHLCVLWNAGHLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEVSPRSVVTSAKQDE  108

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++       +  + S  F  E +  RL+    + M DS+   E+I FL
Sbjct  109   AMTQFLGKLASQEHREPRRPEIVYLPSVDFGLEISKQRLLCGNYSFMPDSMTATEKILFL  168

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N ++ + +  +  L   + +D  
Sbjct  169   SSIIPFDCLLLVRALGGLLKFLSRRRI---GVELEDHNVNVPILAFKKFVLTHLVSIDQD  225

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  226   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  285

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+    +      DW    K++ S 
Sbjct  286   SRLDVIQFFLLPQNLDMAQMLHRLLSHIKNVPLILKRMKLSNTKV--NDWHVLYKTVYSA  343

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  344   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  393

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  394   TVLPN-IDPEIDEKKRRLVGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  447

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I             P   F V                 A   +   L   FL E+    
Sbjct  448   SI-------------PRLPFMV----------------EASDFEIDGLDFMFLSEE----  474

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  475   KLHYRSARTKELDTLLGDLHCEI  497



>gb|KFQ75666.1| MutS protein 5, partial [Phaethon lepturus]
Length=780

 Score =   154 bits (388),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 146/508 (29%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I T+ K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDTPD-NEDLKLLHKVIGEVNPQCIVTTAKQDQ  68

Query  1499  S---FLAALQRCDNTSEAATVKLV--KSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL+ L       + A  ++V   +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLSNLTATAGDKDIAKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  129   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCKCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISHVFTDDLQYIASLISKVVDFEGSI  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  404   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
                  K  YR+++T+ELD+LLGD++ +I
Sbjct  435   G----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_004598826.1| PREDICTED: mutS protein homolog 5 [Ochotona princeps]
Length=838

 Score =   154 bits (389),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 232/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  ++ P  + TS K +E
Sbjct  54    IHLCVLWNAGYLGIAYYDTSDSTIYFMPDAPD-HESLTLLQRVLNEINPRSVVTSAKQDE  112

Query  1499  ---SFLAALQRCDNTSEA-ATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
                 FL  L   ++       +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  113   VMTQFLGKLASQEHGEPTRPEIIYLPSVDFGVEISKQRLLSGSYSFIPDSMTATEKILFL  172

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N S+ + +  +  L   + +D  
Sbjct  173   SSIIPFDCLLMVRALGGLLKFLSRRRI---GVELEDHNVSVPILAFKKFVLAHLVSIDQD  229

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  230   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  289

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+           DW    K++ S 
Sbjct  290   SRLDVIQFFLLPQNLDMAQMLHRLLSHIKNVPLILKRMKLSHTKV--NDWQVLYKTVYSA  347

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   ++     S DL  I  L+  V+D   S  +   
Sbjct  348   L--------GLRDACRSLPQSIQL--FREIAQEFSDDLLHIASLIGKVVDFEGSLAENRF  397

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  398   TVLPN-IDPEIDEKKRRLMGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  451

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I             P   F V                 A   +   L   FL E+    
Sbjct  452   SI-------------PRLPFMV----------------EASDFEIDGLDFMFLSEE----  478

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  479   KLHYRSARTKELDTLLGDLHCEI  501



>ref|XP_007098839.1| PREDICTED: mutS protein homolog 5 isoform X1 [Panthera tigris 
altaica]
Length=833

 Score =   154 bits (389),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 146/503 (29%), Positives = 230/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +Y+  +     +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  49    IYLCALWTSGYLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEINPRSVVTSAKQDE  107

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  108   NMTRFLGKLASQEHREPKRPEIVFLPSVDFGLEISKQRLLAGNYSFIPDSMTTTEKILFL  167

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N S+ +    +  L   + +D  
Sbjct  168   SSIIPFDCLLTVRALGGLLKFLGRRRI---GVELEDYNVSVPILGFKKFVLTHLVSIDQD  224

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G++LLR WF RP  DL +LN
Sbjct  225   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCHCKWGQKLLRLWFTRPTHDLGELN  284

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  285   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  342

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  343   L--------GLRDACRSLPQSIQL--FQDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  392

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  393   TVLPN-IDPEIDEKKRRLMGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  446

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
             CI       E      DFE                                FL E+    
Sbjct  447   CIPRLPFMVEAS----DFEIEGLDFM-------------------------FLSEE----  473

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELD LLGD++  I
Sbjct  474   KLHYRSARTKELDALLGDLHCDI  496



>ref|XP_010286073.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Phaethon 
lepturus]
Length=811

 Score =   154 bits (389),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 146/508 (29%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I T+ K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDTPD-NEDLKLLHKVIGEVNPQCIVTTAKQDQ  85

Query  1499  S---FLAALQRCDNTSEAATVKLV--KSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL+ L       + A  ++V   +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLSNLTATAGDKDIAKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCKCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISHVFTDDLQYIASLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
                  K  YR+++T+ELD+LLGD++ +I
Sbjct  452   G----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_008922098.1| PREDICTED: mutS protein homolog 5 [Manacus vitellinus]
Length=808

 Score =   154 bits (389),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 150/512 (29%), Positives = 243/512 (47%), Gaps = 81/512 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  24    THMSVLWYAGQLAITYYDTEDCSVYFMPEIPD-NEDLKLLQKVTGELNPQCIVTSAKQDQ  82

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  83    NIAKFLTNLTATAGDKDIGKPEIVLFPNVDFGLEVSKQRILSRQFPFIPSHMTETEKILY  142

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E++SIAV   +  +  L+  + +
Sbjct  143   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEDSSIAVPILAFKKFVLSDTVNM  197

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  198   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  257

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKS-  813
             +LN RLD ISF L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  258   ELNKRLDVISFFLMAQNHETVLTLQNCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  315

Query  812   ---ICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDV  648
                +C                LR+  + L   + + +      + DL +I  L+  V+D 
Sbjct  316   YNAVC----------------LRDTCRSLPNTIELFQTISHVFTDDLHYIANLISKVVDF  359

Query  647   NRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIV  474
               S  +   T V+      +DE ++   GL DFL EV+  EL  L     ++ +P  C++
Sbjct  360   EGSLSENRFT-VRPNVDATIDEKKRKLMGLSDFLTEVARKELETL-----DDHIPSCCVI  413

Query  473   YIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*  294
             YI  IG+LL I   +L  +M EK  DFE                                
Sbjct  414   YIPLIGFLLSI--PRL-PDMVEK-SDFEIEGLDFM-------------------------  444

Query  293   FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             FL  D    K  YR+++T+ELD+LLGD++ +I
Sbjct  445   FLSND----KLHYRSARTKELDSLLGDLHCEI  472



>gb|ERE88822.1| putative mutS protein [Cricetulus griseus]
Length=1028

 Score =   155 bits (391),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 228/503 (45%), Gaps = 71/503 (14%)
 Frame = -1

Query  1667  CIM--HGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEESF  1494
             C++   GH +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E+ 
Sbjct  99    CVLWSSGH-LGIAYYDTSDSTVHFMPDAPD-HQSLKLLQRVLDEVNPQSVITSAKQDEAM  156

Query  1493  LAALQRCDNTSEAATVK----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFLSS  1326
                L++  +       K    L+ S  F  E +  RL+    + + +S+   E+I FLSS
Sbjct  157   TRFLRKLASQEHRQPKKPEIILLPSVDFGPETSKQRLLSGNYSFIPESMTATEKILFLSS  216

Query  1325  MMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSAAL  1146
             ++     + VRA GGLL  L   R   V  + E  N S+ +    +  L   + +D    
Sbjct  217   IIPFDCVLTVRALGGLLKFLSRRR---VGVELEDYNVSVPILGFKKFVLTHLVSIDQDTY  273

Query  1145  EALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddlnar  969
               LQIF+ + HPS   +    KEG S+FG++N+C    G++LLR WF RP  +L +LN+R
Sbjct  274   SVLQIFKSEAHPSVYKVASGLKEGLSLFGILNRCRCKWGQKLLRLWFTRPTQELRELNSR  333

Query  968   ldAISFLLFAEELSV--SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSLLH  795
             LD I F L  + L    ++   L  +K+VP ILK+          +DW    K++ S L 
Sbjct  334   LDVIQFFLMPQNLDTAQTMHRLLSHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSAL-  390

Query  794   INKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYETI  615
                    G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   T+
Sbjct  391   -------GLRDVCRSLPQAIQL--FQDIAQEFSDDLHHIASLIGKVVDFEESLAENRFTV  441

Query  614   VKDGFCNELDELRQIYEGLPDFLEEVSSLEL----ARLPRMVGENGLPCIVYIHQIGYLL  447
             + +    E+D  ++   GLP FL EV+  EL    AR+P          ++YI  IG+LL
Sbjct  442   LPN-IDPEIDSKKRRLTGLPSFLTEVAQKELDNLDARIPSC-------SVIYIPLIGFLL  493

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I       E      DFE                                FL ED    
Sbjct  494   SIPRLPFMVEAS----DFEIEGLEFM-------------------------FLSED----  520

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  521   KLHYRSTRTKELDTLLGDLHCEI  543



>ref|XP_008260819.1| PREDICTED: mutS protein homolog 5 isoform X4 [Oryctolagus cuniculus]
Length=786

 Score =   154 bits (388),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 233/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E
Sbjct  50    IHLCVLWNAGHLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEVSPRSVVTSAKQDE  108

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++       +  + S  F  E +  RL+    + M DS+   E+I FL
Sbjct  109   AMTQFLGKLASQEHREPRRPEIVYLPSVDFGLEISKQRLLCGNYSFMPDSMTATEKILFL  168

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N ++ + +  +  L   + +D  
Sbjct  169   SSIIPFDCLLLVRALGGLLKFLSRRRI---GVELEDHNVNVPILAFKKFVLTHLVSIDQD  225

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  226   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  285

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+    +      DW    K++ S 
Sbjct  286   SRLDVIQFFLLPQNLDMAQMLHRLLSHIKNVPLILKRMKLSNTKV--NDWHVLYKTVYSA  343

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  344   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  393

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  394   TVLPN-IDPEIDEKKRRLVGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  447

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I             P   F V                 A   +   L   FL E+    
Sbjct  448   SI-------------PRLPFMV----------------EASDFEIDGLDFMFLSEE----  474

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  475   KLHYRSARTKELDTLLGDLHCEI  497



>ref|XP_008260818.1| PREDICTED: mutS protein homolog 5 isoform X3 [Oryctolagus cuniculus]
Length=804

 Score =   154 bits (388),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 233/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E
Sbjct  50    IHLCVLWNAGHLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEVSPRSVVTSAKQDE  108

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++       +  + S  F  E +  RL+    + M DS+   E+I FL
Sbjct  109   AMTQFLGKLASQEHREPRRPEIVYLPSVDFGLEISKQRLLCGNYSFMPDSMTATEKILFL  168

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N ++ + +  +  L   + +D  
Sbjct  169   SSIIPFDCLLLVRALGGLLKFLSRRRI---GVELEDHNVNVPILAFKKFVLTHLVSIDQD  225

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  226   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  285

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+    +      DW    K++ S 
Sbjct  286   SRLDVIQFFLLPQNLDMAQMLHRLLSHIKNVPLILKRMKLSNTKV--NDWHVLYKTVYSA  343

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  344   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  393

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  394   TVLPN-IDPEIDEKKRRLVGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  447

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I             P   F V                 A   +   L   FL E+    
Sbjct  448   SI-------------PRLPFMV----------------EASDFEIDGLDFMFLSEE----  474

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  475   KLHYRSARTKELDTLLGDLHCEI  497



>ref|XP_009863415.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Apaloderma 
vittatum]
Length=807

 Score =   154 bits (388),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 146/508 (29%), Positives = 239/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +++ + +  ++ V+YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THVSVLWYAGQLAVTYYDTEDCSVYFMPDIPD-NEDLKLLHRVIEEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDRRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++ AV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTTAVPILAFKKFVLSDTVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  ++ 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTCNVT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K++
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTV  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              + +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YNAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIASLISKVVDFEGST  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENCFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++TRELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTRELDSLLGDLHCEI  475



>ref|XP_003985987.1| PREDICTED: mutS protein homolog 5 isoform X1 [Felis catus]
 ref|XP_006931632.1| PREDICTED: mutS protein homolog 5 isoform X2 [Felis catus]
Length=833

 Score =   154 bits (388),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 146/503 (29%), Positives = 230/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +Y+  +     +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  49    IYLCALWTSGYLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEINPRSVVTSAKQDE  107

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  108   NMTRFLGKLASQEHREPKRPEIVFLPSVDFGLEISKQRLLAGNYSFIPDSMTTTEKILFL  167

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N S+ +    +  L   + +D  
Sbjct  168   SSIIPFDCLLTVRALGGLLKFLGRRRI---GVELEDYNVSVPILGFKKFVLTHLVSIDQD  224

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G++LLR WF RP  DL +LN
Sbjct  225   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCHCKWGQKLLRLWFTRPTHDLGELN  284

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  285   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  342

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  343   L--------GLRDACRSLPQSIQL--FQDIAQEFSDDLYHIASLIGKVVDFEGSLAENRF  392

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  393   TVLPN-IDPEIDEKKRRLMGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  446

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
             CI       E      DFE                                FL E+    
Sbjct  447   CIPRLPFMVEAS----DFEIEGLDFM-------------------------FLSEE----  473

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELD LLGD++  I
Sbjct  474   KLHYRSARTKELDALLGDLHCDI  496



>ref|XP_008260815.1| PREDICTED: mutS protein homolog 5 isoform X1 [Oryctolagus cuniculus]
 ref|XP_008260816.1| PREDICTED: mutS protein homolog 5 isoform X1 [Oryctolagus cuniculus]
Length=834

 Score =   154 bits (388),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 233/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E
Sbjct  50    IHLCVLWNAGHLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEVSPRSVVTSAKQDE  108

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++       +  + S  F  E +  RL+    + M DS+   E+I FL
Sbjct  109   AMTQFLGKLASQEHREPRRPEIVYLPSVDFGLEISKQRLLCGNYSFMPDSMTATEKILFL  168

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N ++ + +  +  L   + +D  
Sbjct  169   SSIIPFDCLLLVRALGGLLKFLSRRRI---GVELEDHNVNVPILAFKKFVLTHLVSIDQD  225

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  226   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  285

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+    +      DW    K++ S 
Sbjct  286   SRLDVIQFFLLPQNLDMAQMLHRLLSHIKNVPLILKRMKLSNTKV--NDWHVLYKTVYSA  343

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  344   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  393

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  394   TVLPN-IDPEIDEKKRRLVGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  447

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I             P   F V                 A   +   L   FL E+    
Sbjct  448   SI-------------PRLPFMV----------------EASDFEIDGLDFMFLSEE----  474

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  475   KLHYRSARTKELDTLLGDLHCEI  497



>gb|KFP24238.1| MutS protein 5, partial [Colius striatus]
Length=790

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 242/508 (48%), Gaps = 74/508 (15%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMTDTPD-NEDLKLLYKVIEEVNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  +     DN  +   V L  +  F  E +  R++  Q   +   ++ +E+I +
Sbjct  69    NIAKFLTNITATAGDNRGKPEIV-LFPNIDFGLEVSKQRILSRQFPFIPSHMSAREKILY  127

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E +SIAV   +     L+  + +
Sbjct  128   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESSIAVPILAFKRFVLSDIVSM  182

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  183   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  242

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  243   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMILSNTKV--SDWQALYKTA  300

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  301   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLNYIANLISKVVDFEGSI  348

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +D  ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  349   SENRFT-VRPNVDPTIDAKKRKLSGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  402

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  403   IGFLLSI--PRLPNMVDKS--DFEIEGLDFM-------------------------FLSE  433

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  434   D----KLHYRSARTKELDSLLGDLHCEI  457



>ref|XP_010158520.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Eurypyga 
helias]
Length=806

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 147/508 (29%), Positives = 238/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDTPD-NEDLQLLHKVIGEVNPQSIVTSAKQDQ  85

Query  1499  SFLAALQRCDNTSEAATVK-----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +    L     T+    V+     L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDVRKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + VRA GGLL  L+  R+       E E ++I V   +  +  L+  + +
Sbjct  146   LSSIISFESPLMVRALGGLLKFLDRRRV-----GVELEESTITVPILAFKKFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K+ 
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLAHTKV--SDWQALYKTA  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPSTIELFQTISRVFTDDLHYIASLIGRVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_009072377.1| PREDICTED: mutS protein homolog 5 [Acanthisitta chloris]
Length=807

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 145/508 (29%), Positives = 242/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  27    THMSVMWYAGQLAIAYYDTEDCSIYFMSEIPD-NEDLKLLQKVIGELNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    + ++ +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NMAKFLTNLTATAGDKDTGKPEIVVLPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++     + ++A GGLL  L D R + V    E E++SIAV   +     L+  + +
Sbjct  146   LSSIIPFECPLMIQALGGLLKFL-DRRRVGV----ELEDSSIAVPILAFKSFVLSDTVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQ+F+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +  
Sbjct  201   DQDTYCVLQVFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNST  260

Query  983   dlnarldAISFLLFA--EELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I+F L A  +E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  261   ELNKRLDVINFFLLAQNQETVLTLQNCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLISKVVDFEGST  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SENRFT-VRPNVDPSIDEKKRKLMGLSDFLTEVARKELETL-----DNQIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPHMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_008260817.1| PREDICTED: mutS protein homolog 5 isoform X2 [Oryctolagus cuniculus]
Length=818

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 233/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E
Sbjct  50    IHLCVLWNAGHLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEVSPRSVVTSAKQDE  108

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++       +  + S  F  E +  RL+    + M DS+   E+I FL
Sbjct  109   AMTQFLGKLASQEHREPRRPEIVYLPSVDFGLEISKQRLLCGNYSFMPDSMTATEKILFL  168

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N ++ + +  +  L   + +D  
Sbjct  169   SSIIPFDCLLLVRALGGLLKFLSRRRI---GVELEDHNVNVPILAFKKFVLTHLVSIDQD  225

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  226   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  285

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+    +      DW    K++ S 
Sbjct  286   SRLDVIQFFLLPQNLDMAQMLHRLLSHIKNVPLILKRMKLSNTKV--NDWHVLYKTVYSA  343

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  344   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  393

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  394   TVLPN-IDPEIDEKKRRLVGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  447

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I             P   F V                 A   +   L   FL E+    
Sbjct  448   SI-------------PRLPFMV----------------EASDFEIDGLDFMFLSEE----  474

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  475   KLHYRSARTKELDTLLGDLHCEI  497



>ref|XP_006896237.1| PREDICTED: mutS protein homolog 5 [Elephantulus edwardii]
Length=833

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 147/505 (29%), Positives = 234/505 (46%), Gaps = 68/505 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  +++P  I TS K EE
Sbjct  49    IHLCMLWNSGYLGIAYYDTSDSTIYFMPDAPD-HETLKLLQRVLDEIKPLSIVTSAKQEE  107

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++  S+   + L  S  F  E +  R++    + + D++   E+I FL
Sbjct  108   NMTRFLGKLASQEHAESKRPEIVLFPSVDFGLEISKQRILSASYSFIPDTMTATEKILFL  167

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VR  GGLL  L   RI     + E  N S+ +    +  L   + +D  
Sbjct  168   SSIIPFDCLLTVRTLGGLLKFLGRRRI---GVELEDSNVSVPILGFKKFVLTHLVSIDQD  224

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP LDL +LN
Sbjct  225   TYSVLQIFKSESHPSVYKVATGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTLDLRELN  284

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  285   SRLDVIQFFLLPQNLDMAQMLHRLLSHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  342

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  343   L--------GLRDACRSLPQSIQL--FRNIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  392

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLEL----ARLPRMVGENGLPCIVYIHQIGY  453
             T++ +    E+DE ++   GLP FL EV+  EL    +R+P          ++YI  IG+
Sbjct  393   TVLPN-IDPEIDEKKRRLMGLPSFLTEVARKELDILDSRIPSC-------SVIYIPLIGF  444

Query  452   LLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGD  273
             LL I   +L   ++    DFE                                FL E+  
Sbjct  445   LLSI--PRLPSMVEAS--DFEIEGLDFM-------------------------FLSEE--  473

Query  272   TKKFFYRTSKTRELDTLLGDIYHKI  198
               K  YR+++T+ELD LLGD++ +I
Sbjct  474   --KLHYRSARTKELDALLGDLHCEI  496



>ref|XP_009816016.1| PREDICTED: LOW QUALITY PROTEIN: mutS protein homolog 5 [Gavia 
stellata]
Length=807

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 147/508 (29%), Positives = 239/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDTPD-NEDLKLLHKVIGEINPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   ++I +
Sbjct  86    NIAKFLTNLTATAGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATQKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +     L+  + +
Sbjct  146   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKRFVLSDIVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D  A   LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDAYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+          +DW A  K+ 
Sbjct  261   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMTLSHTKV--SDWQALYKTA  318

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  319   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLISKVVDFEGSI  366

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  367   SESRFT-VRPNVDPTIDEKKRKLMGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  420

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  421   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  451

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  452   D----KLHYRSARTKELDSLLGDLHCEI  475



>ref|XP_005965433.1| PREDICTED: mutS protein homolog 5 [Pantholops hodgsonii]
Length=832

 Score =   153 bits (387),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 145/501 (29%), Positives = 237/501 (47%), Gaps = 66/501 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWNSGYLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEIDPRSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIPDSMTTTEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERI-IDVHEQNEFENASIAVDSVSEISLNKFLKVDS  1155
             SS++     + VRA GGLL  L   RI +++ E N     S+ +    +  L   + +D 
Sbjct  166   SSIIPFDCLLTVRALGGLLKFLGRRRIGVELEEYN----VSVPILGFKKFVLTNLVSIDQ  221

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ + HPS   +    KEGFS+FG++N+C    G +LLR WF RP  DL +L
Sbjct  222   DTYSVLQIFKSESHPSVYKVASGLKEGFSLFGILNRCRCKWGEKLLRLWFTRPTQDLGEL  281

Query  977   narldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N+RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S
Sbjct  282   NSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYS  339

Query  803   LLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGY  624
              L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +  
Sbjct  340   AL--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENR  389

Query  623   ETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYL  450
              T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+L
Sbjct  390   FTVLPN-IDPEIDEKKRRLMGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFL  443

Query  449   LCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDT  270
             L I           +LP    ++   +NF               +   L   FL E+   
Sbjct  444   LSI----------PRLP----SMVETSNF---------------EIEGLDFMFLSEE---  471

Query  269   KKFFYRTSKTRELDTLLGDIY  207
              K  YR+++T+ELD LLGD++
Sbjct  472   -KLHYRSARTKELDALLGDLH  491



>gb|KFP70259.1| MutS protein 5, partial [Acanthisitta chloris]
Length=790

 Score =   153 bits (386),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 143/508 (28%), Positives = 241/508 (47%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  10    THMSVMWYAGQLAIAYYDTEDCSIYFMSEIPD-NEDLKLLQKVIGELNPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D  +    + ++ +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NMAKFLTNLTATAGDKDTGKPEIVVLPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++     + ++A GGLL  L+  R+       E E++SIAV   +     L+  + +
Sbjct  129   LSSIIPFECPLMIQALGGLLKFLDRRRV-----GVELEDSSIAVPILAFKSFVLSDTVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQ+F+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +  
Sbjct  184   DQDTYCVLQVFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNST  243

Query  983   dlnarldAISFLLFA--EELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I+F L A  +E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  244   ELNKRLDVINFFLLAQNQETVLTLQNCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLISKVVDFEGST  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPSIDEKKRKLMGLSDFLTEVARKELETL-----DNQIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  404   IGFLLSI--PRLPHMVDKS--DFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_010816610.1| PREDICTED: mutS protein homolog 5 isoform X2 [Bos taurus]
Length=787

 Score =   153 bits (386),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 146/507 (29%), Positives = 234/507 (46%), Gaps = 64/507 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  47    IHLCVLWNSGYLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEIDPRSVVTSAKQDE  105

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  106   NMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFLPDSMTTTEKILFL  165

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N S+ +    +  L   + +D  
Sbjct  166   SSIIPFDCLLMVRALGGLLKFLGRRRI---GVELEDYNVSVPILGFKKFVLTNLVSIDQD  222

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  223   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLGELN  282

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  283   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMTLSHTKV--SDWQVLYKTVYSA  340

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  341   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  390

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  391   TVLPN-IDPEIDEKKRRLMGLPSFLTEVARKELENL-----DSRIPSCSVIYIPLIGFLL  444

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I   +L   ++    DFE                                FL E+    
Sbjct  445   SI--PRLPSMVETS--DFEIEGLDFM-------------------------FLSEE----  471

Query  266   KFFYRTSKTRELDTLLGDIYHKILGMP  186
             K  YR+++T+ELD LLGD++  I G P
Sbjct  472   KLHYRSARTKELDALLGDLHCDIRGDP  498



>ref|XP_010193789.1| PREDICTED: mutS protein homolog 5 [Colius striatus]
Length=807

 Score =   153 bits (387),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 242/508 (48%), Gaps = 74/508 (15%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  +V P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMTDTPD-NEDLKLLYKVIEEVNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  +     DN  +   V L  +  F  E +  R++  Q   +   ++ +E+I +
Sbjct  86    NIAKFLTNITATAGDNRGKPEIV-LFPNIDFGLEVSKQRILSRQFPFIPSHMSAREKILY  144

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E +SIAV   +     L+  + +
Sbjct  145   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESSIAVPILAFKRFVLSDIVSM  199

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  200   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  259

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  260   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVPLILKRMILSNTKV--SDWQALYKTA  317

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L   + + +      + DL +I  L+  V+D   S 
Sbjct  318   YSAVC------------LRDTCRSLPNTIELFQTISRVFTDDLNYIANLISKVVDFEGSI  365

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +D  ++   GL DFL EV+  EL  L     +N +P  C++YI  
Sbjct  366   SENRFT-VRPNVDPTIDAKKRKLSGLSDFLTEVARKELETL-----DNHIPSCCVIYIPL  419

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  420   IGFLLSI--PRLPNMVDKS--DFEIEGLDFM-------------------------FLSE  450

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  451   D----KLHYRSARTKELDSLLGDLHCEI  474



>ref|XP_005418535.1| PREDICTED: mutS protein homolog 5-like [Geospiza fortis]
Length=784

 Score =   153 bits (386),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 148/512 (29%), Positives = 241/512 (47%), Gaps = 81/512 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTEDCSVYFMPDIPD-NEDLKLLQKVIEELNPQCIVTSAKQDQ  85

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  86    NIAKFLTNLTATAGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKILY  145

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E++SIAV   +  +  L+  + +
Sbjct  146   LSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEDSSIAVPILAFKKFVLSDTVNM  200

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS+FG++N+C    G +LLR W  RP  +L 
Sbjct  201   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLFGILNRCRCKWGEKLLRLWLTRPTRNLT  260

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKS-  813
             +LN RLD I+F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A  K+ 
Sbjct  261   ELNKRLDVINFFLLAQNHETVLTLQNCLKNIKNVPLILKRMTLSNTKV--SDWQALYKTA  318

Query  812   ---ICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDV  648
                +C                LR+  + L   + + +      + DL +I  L+  V+D 
Sbjct  319   YNAVC----------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLISKVVDF  362

Query  647   NRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIV  474
               S  +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P   ++
Sbjct  363   EGSLSENRFT-VRPNVDATIDEKKRKLMGLSDFLTEVARKELETL-----DNQIPSCAVI  416

Query  473   YIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*  294
             YI  IG+LL I   +L   + +   DFE                                
Sbjct  417   YIPLIGFLLSI--PRLPNMVDKT--DFEIEGLDFM-------------------------  447

Query  293   FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             FL ED    K  YR+++T+ELD+LLGD++ +I
Sbjct  448   FLSED----KLHYRSARTKELDSLLGDLHCEI  475



>gb|KFZ54273.1| MutS protein 5, partial [Podiceps cristatus]
Length=794

 Score =   153 bits (386),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 150/508 (30%), Positives = 243/508 (48%), Gaps = 73/508 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  10    THMSVLWYAGQLAITYYDTEDCSVYFMPDTPD-NEDLKLLHKVIGEINPQCIVTSAKQDQ  68

Query  1499  S---FLAALQRC--DNTSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L     D       + L  +  F  E +  R++  Q   +   +   E+I +
Sbjct  69    NIAKFLTNLTATAGDKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTPTEKILY  128

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++   S + +RA GGLL  L+  R+       E E ++IAV   +  +  L+  + +
Sbjct  129   LSSVIPFESPLMIRALGGLLKFLDRRRV-----GVELEESTIAVPILAFKKFVLSDTVNM  183

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP  +L 
Sbjct  184   DQDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRPTRNLT  243

Query  983   dlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN RLD I F L A+  E  ++L+  LK++K+V  ILK+  S S T  S DW A  K++
Sbjct  244   ELNKRLDVIHFFLLAQNHETVLTLQGCLKNIKNVSLILKRM-SLSHTKVS-DWQALYKTV  301

Query  809   CSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSK  636
              S +             LR+  + L  N+ + +      + DL +I  L+  V+D   S 
Sbjct  302   YSAVC------------LRDTCRSLPNNIELFQTISRVFTDDLHYIASLISKVVDFEGST  349

Query  635   QKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQ  462
              +   T V+      +DE ++   GL DFL +V+  EL  L     +N +P  C++YI  
Sbjct  350   SENRFT-VRPNVDPTIDEKKRKLMGLSDFLTDVARKELETL-----DNHIPSCCVIYIPL  403

Query  461   IGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDE  282
             IG+LL I   +L   + +   DFE                                FL E
Sbjct  404   IGFLLSI--PRLPTMVDKS--DFEIEGLDFM-------------------------FLSE  434

Query  281   DGDTKKFFYRTSKTRELDTLLGDIYHKI  198
             D    K  YR+++T+ELD+LLGD++ +I
Sbjct  435   D----KLHYRSARTKELDSLLGDLHCEI  458



>ref|XP_007949535.1| PREDICTED: mutS protein homolog 5 isoform X1 [Orycteropus afer 
afer]
Length=831

 Score =   153 bits (386),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 145/502 (29%), Positives = 232/502 (46%), Gaps = 62/502 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  ++ P  I TS K +E
Sbjct  46    IHLCVLWNSGYLGIAYYDTSDSTIYFMPDAPD-HETLKLLQRVLDEINPRSIVTSAKQDE  104

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   + T  +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  105   NMTQFLGKLASQEQTEPKRPEIVFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  164

Query  1331  SSMMDISSDVQVRASGGLLAILEDERI-IDVHEQNEFENASIAVDSVSEISLNKFLKVDS  1155
             SS++     + VRA GGLL  L   RI +++ E N     S+ +    +  L   + +D 
Sbjct  165   SSIIPFDCLLTVRALGGLLKFLNRRRIGVELEECN----VSVPILGFKKFVLTHLVSIDQ  220

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +L
Sbjct  221   DTYSVLQIFKSESHPSVYKVATGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTRDLGEL  280

Query  977   narldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N+RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S
Sbjct  281   NSRLDVIQFFLLPQNLEMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYS  338

Query  803   LLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGY  624
              L        G+ +  R   + + L   +      S DL  +  L+  V+D   S  +  
Sbjct  339   AL--------GLRDACRSLPQSIQL--FQDIAQEFSDDLHHVASLIGKVVDFEGSLAENR  388

Query  623   ETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLC  444
              T++ +    E+DE ++   GLP FL EV+  EL  L   +       ++YI  IG+LL 
Sbjct  389   FTVLPN-IDPEIDEKKRKLMGLPSFLTEVARKELETLDFRIPSCS---VIYIPLIGFLLS  444

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  445   I--PRLPSMVEAS--DFEIEGLDFM-------------------------FLSEE----K  471

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++ +I
Sbjct  472   LHYRSARTKELDALLGDLHCEI  493



>ref|XP_007949536.1| PREDICTED: mutS protein homolog 5 isoform X2 [Orycteropus afer 
afer]
Length=830

 Score =   153 bits (386),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 145/502 (29%), Positives = 232/502 (46%), Gaps = 62/502 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   +Y M    D  +   LL  +  ++ P  I TS K +E
Sbjct  46    IHLCVLWNSGYLGIAYYDTSDSTIYFMPDAPD-HETLKLLQRVLDEINPRSIVTSAKQDE  104

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   + T  +   +  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  105   NMTQFLGKLASQEQTEPKRPEIVFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  164

Query  1331  SSMMDISSDVQVRASGGLLAILEDERI-IDVHEQNEFENASIAVDSVSEISLNKFLKVDS  1155
             SS++     + VRA GGLL  L   RI +++ E N     S+ +    +  L   + +D 
Sbjct  165   SSIIPFDCLLTVRALGGLLKFLNRRRIGVELEECN----VSVPILGFKKFVLTHLVSIDQ  220

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +L
Sbjct  221   DTYSVLQIFKSESHPSVYKVATGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTRDLGEL  280

Query  977   narldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N+RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S
Sbjct  281   NSRLDVIQFFLLPQNLEMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYS  338

Query  803   LLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGY  624
              L        G+ +  R   + + L   +      S DL  +  L+  V+D   S  +  
Sbjct  339   AL--------GLRDACRSLPQSIQL--FQDIAQEFSDDLHHVASLIGKVVDFEGSLAENR  388

Query  623   ETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLC  444
              T++ +    E+DE ++   GLP FL EV+  EL  L   +       ++YI  IG+LL 
Sbjct  389   FTVLPN-IDPEIDEKKRKLMGLPSFLTEVARKELETLDFRIPSCS---VIYIPLIGFLLS  444

Query  443   IFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKK  264
             I   +L   ++    DFE                                FL E+    K
Sbjct  445   I--PRLPSMVEAS--DFEIEGLDFM-------------------------FLSEE----K  471

Query  263   FFYRTSKTRELDTLLGDIYHKI  198
               YR+++T+ELD LLGD++ +I
Sbjct  472   LHYRSARTKELDALLGDLHCEI  493



>ref|XP_007556242.1| PREDICTED: mutS protein homolog 5 isoform X2 [Poecilia formosa]
Length=816

 Score =   152 bits (385),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 140/513 (27%), Positives = 239/513 (47%), Gaps = 81/513 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V ++ ++   ++G+ +YDS    L+ M    D + +  LL  +  +V+P VI TS K E 
Sbjct  32    VLLSVLVQRGQLGLCFYDSGDSSLHYMVDSPD-NYELHLLSRVIQEVRPHVILTSAKQER  90

Query  1499  SFLAALQRCDN----TSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
                  LQ+  +      E  T   V    F  E    RL+   +  +   ++ ++++S+L
Sbjct  91    CLTQYLQQLGSDPHYKPEVVTYPYVD---FGLEVGKQRLLSAHLPFLPPCISERDKMSYL  147

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVD  1158
             SS +   S + +RA G LL  L+  R+       E E++++ V        +L + + +D
Sbjct  148   SSCITFDSPLMLRAVGALLKCLDRRRV-----GVELEDSTVGVPILQFHAYTLKEVVYID  202

Query  1157  SAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldldd  981
                   LQIF+ D HPS   +    KEG S++G++N+C +  G +LLR WFLRP  DL  
Sbjct  203   RDTYSVLQIFKSDLHPSVYKLQSGEKEGLSLYGILNRCKSKFGSKLLRQWFLRPTRDLAV  262

Query  980   lnarldAISFLLFAEELSV--SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSIC  807
             L  R + I F        V  +L+ +L++++++P +L++    S     TDW    K++ 
Sbjct  263   LYRRQEVIRFFTSPRNSDVLNTLQASLRNIRNIPGVLRRMTLSSTKV--TDWQCLYKTVY  320

Query  806   SLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQ  633
             S + I            R+ +++L  ++ +  +  + LS DL ++  L+  V+D + S +
Sbjct  321   SAVCI------------RDSMRHLPQSIQLFWEISEKLSEDLHYVAALINRVVDFDASLE  368

Query  632   KGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGY  453
             +   T VK      +DE ++   GL DFL +V+  EL  L   +      C++Y+  IG+
Sbjct  369   ESRFT-VKPNVDPAIDEKKRRMMGLSDFLTDVARRELEHLDSRISSC---CVIYLPLIGF  424

Query  452   LLCI-----FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FL  288
             LL +       EK D EM+     FEF                               FL
Sbjct  425   LLSVPRLPSMVEKEDFEME----GFEFM------------------------------FL  450

Query  287   DEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
              +D    +  YR+ +TRELD+LLGD++  I  M
Sbjct  451   SDD----RLHYRSQRTRELDSLLGDLHCDIRDM  479



>ref|XP_006995336.1| PREDICTED: mutS protein homolog 5 [Peromyscus maniculatus bairdii]
Length=836

 Score =   152 bits (385),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 144/506 (28%), Positives = 234/506 (46%), Gaps = 70/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V++  +     +G++YYD+S   ++ M    D  +   LL  +  +V P  + TS K +E
Sbjct  52    VHLCVLWSSGSLGIAYYDTSDSTIHFMPDAPD-HESLKLLQRVLDEVNPQSVITSAKQDE  110

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   V L+ S  F  E +  RL+    + + +S+   E+I FL
Sbjct  111   TMTRFLGKLASQEHREPKRPEVILLPSVDFGPEISKQRLLSGNYSFIPESMTATEKILFL  170

Query  1331  SSMMDISSDVQVRASGGLLAILEDERI-IDVHEQNEFENASIAVDSVSEISLNKFLKVDS  1155
             SS++     + VRA GGLL  L   R+ +++ +QN      + +    +  L   + +D 
Sbjct  171   SSIVPFDCVLTVRALGGLLKFLSRRRVGVELEDQN----VGVPILGFKKFVLTHLVSIDQ  226

Query  1154  AALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddl  978
                  LQIF+ + HPS   +    KEG S+FG++N+C +  G++LLR WF RP  +L +L
Sbjct  227   DTYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRSKWGQKLLRLWFTRPTQELREL  286

Query  977   narldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICS  804
             N+RLD I F L  + L  +  +   L  +K+VP ILK+          +DW    K++ S
Sbjct  287   NSRLDVIQFFLMPQNLDTAQMMHRLLSHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYS  344

Query  803   LLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGY  624
              L        G+ +  R   + + L   +      S DL  I  L+  V++   S  +  
Sbjct  345   AL--------GLRDACRSLPQSIQL--FQDIAQEFSDDLHHIASLIGKVVNFEESLAENR  394

Query  623   ETIVKDGFCNELDELRQIYEGLPDFLEEVSSLEL----ARLPRMVGENGLPCIVYIHQIG  456
              T++ +    E+D  ++   GLP FL EV+  EL    AR+P          ++YI  IG
Sbjct  395   FTVLPN-IDPEIDAKKRRLMGLPSFLTEVAQKELENLDARIPSC-------SVIYIPLIG  446

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I   +L   M+    DFE                                FL ED 
Sbjct  447   FLLSI--PRLPFMMEAS--DFEIEGLDFM-------------------------FLSED-  476

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
                K  YR+++T+ELD LLGD++ +I
Sbjct  477   ---KLHYRSARTKELDALLGDLHCEI  499



>ref|XP_006154349.1| PREDICTED: mutS protein homolog 5 isoform X2 [Tupaia chinensis]
Length=805

 Score =   152 bits (384),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 144/503 (29%), Positives = 233/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + H   +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  51    IHLCVLWHSGFLGIAYYDTSDSTVHFMPDTPD-HESLRLLQRVLNEINPRSVVTSAKQDE  109

Query  1499  SFLAALQRCDNTSEAATVK----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +    L +  +      ++     + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  110   TMTQFLGKLASQEHREPMRPEIIFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  169

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI    E  +F N S+ +    +  L   + +D  
Sbjct  170   SSIIPFDCLLTVRALGGLLKFLGRRRI--GVELEDF-NVSVPILGFKKFVLTHLVSIDQD  226

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  227   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTHDLGELN  286

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  287   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  344

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  345   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  394

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL +V+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  395   TVLPN-IDPEIDEKKRRLMGLPSFLTDVARKELEDL-----DSRIPSCSVIYIPLIGFLL  448

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I   +L   ++    DFE                                FL E+    
Sbjct  449   SI--PRLPSMIESS--DFEIEGLDFM-------------------------FLSEE----  475

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  476   KLHYRSARTKELDTLLGDLHCEI  498



>ref|XP_005043626.1| PREDICTED: mutS protein homolog 5-like [Ficedula albicollis]
Length=811

 Score =   152 bits (383),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 147/517 (28%), Positives = 244/517 (47%), Gaps = 91/517 (18%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              +M+ + +  ++ ++YYD+    +Y M    D ++D  LL  +  ++ P  I TS K ++
Sbjct  27    THMSVLWYAGQLAITYYDTENCSVYFMPEIPD-NEDLKLLQKVIGELNPQCIVTSAKQDQ  85

Query  1499  SFLAALQRCDNTSEAATVKLVKSSL-------FSYEQAWHRLMYLQVTGMDDSLNIKERI  1341
             +    L     T+ AA   + K  +       F  E +  R++  Q   +   +   E+I
Sbjct  86    NIAKFLTNL--TATAAEKDIGKPEIVLFPNIDFGLEVSKQRILSRQFPFIPSHMTATEKI  143

Query  1340  SFLSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKV  1161
              +LSS++   S + +RA GGLL  L+  R+       E E++SIAV     ++  KF+  
Sbjct  144   LYLSSIIPFESPLMIRALGGLLKFLDRRRV-----GVELEDSSIAVPI---LAFKKFVLS  195

Query  1160  DSAALE-----ALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRP  999
             D+  ++      LQIF+ D HPS   +    KEGFS++G++N+C    G +LLR W  RP
Sbjct  196   DTVDMDEDTYCVLQIFKSDIHPSVYKLSSGLKEGFSLYGILNRCRCKWGEKLLRLWLTRP  255

Query  998   IldlddlnarldAISFLLFAE--ELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAA  825
               +L +LN RLD I+F L A+  E  ++L+  LK++K+VP ILK+    +     +DW A
Sbjct  256   TRNLTELNKRLDVINFFLLAQNYETVLTLQNCLKNIKNVPLILKRMTLSNTKV--SDWQA  313

Query  824   FLKS----ICSLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVI  663
               K+    +C                LR+  + L   + + +      + DL +I  L+ 
Sbjct  314   LYKTAYNAVC----------------LRDTCRSLPNTIELFQTISRVFTDDLHYIANLIS  357

Query  662   GVLDVNRSKQKGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP  483
              V+D   S  +   T V+      +DE ++   GL DFL EV+  EL  L     +N +P
Sbjct  358   KVVDFEGSLSESRFT-VRSNVDATIDEKKRKLMGLSDFLTEVAQKELETL-----DNHIP  411

Query  482   --CIVYIHQIGYLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCC  309
                ++YI  IG+LL I   +L   + +   DFE                           
Sbjct  412   FCSVIYIPLIGFLLSI--PRLPNMVDKT--DFEIEGLDFM--------------------  447

Query  308   WLIS*FLDEDGDTKKFFYRTSKTRELDTLLGDIYHKI  198
                  FL ED    K  YR+++T+ELD+LLGD++ ++
Sbjct  448   -----FLSED----KLHYRSARTKELDSLLGDLHSEV  475



>ref|XP_003768976.1| PREDICTED: mutS protein homolog 5 [Sarcophilus harrisii]
Length=824

 Score =   152 bits (383),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 147/506 (29%), Positives = 238/506 (47%), Gaps = 70/506 (14%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
              Y+  + H  R+G++YYDS+   +Y +    D      LL  +  ++ P  I TS K +E
Sbjct  42    TYLCVLWHSGRLGLAYYDSADSTIYFLPDTPD-CDHLKLLRRVVDEINPRSIITSAKQDE  100

Query  1499  S---FLAALQRCDNT--SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISF  1335
             +   FL  L   ++       TV L +   F  E +  R++    + + +SL   E+I F
Sbjct  101   NMARFLGGLVSPEHKELGSPETVLLPRVD-FGLEISKQRILSGNFSFIPESLTYTEKILF  159

Query  1334  LSSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKV  1161
             LSS++     + ++A GGLL  L   R+       E E+ S+ V      +  L   + +
Sbjct  160   LSSIIPFDCPLMIQALGGLLKFLNRRRV-----SVELEDGSVNVPILGFKKFVLTHLVSI  214

Query  1160  DSAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldld  984
             D      LQIF+ + HPS   +    KEG S+FG++N+C +  G +LLR W +RP  DL+
Sbjct  215   DQDTYSVLQIFKSETHPSVYKVTSGLKEGLSLFGILNRCRSKRGEKLLRLWLMRPTQDLE  274

Query  983   dlnarldAISFLLFA--EELSVSLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSI  810
             +LN+RLD I F L    +E++++L   L  +K+VP ILK+          +DW    +++
Sbjct  275   ELNSRLDVIQFFLLPQNQEMALTLHRLLSHIKNVPLILKRMLLSQTKV--SDWKILYETV  332

Query  809   CSLLHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQK  630
              S L        G+ +  R   +   L   +      S DL  I  L+  V+D   S  +
Sbjct  333   YSAL--------GLRDTCRSLPQSTQL--FRDIAQEFSDDLCHIACLINKVVDFEGSIAE  382

Query  629   GYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIG  456
                T V+     +LDE ++   GLP FL EV+  EL  L     ++ +P  C++YI  IG
Sbjct  383   NRFT-VRPNIDPDLDEKKRRLMGLPSFLTEVARKELETL-----DSRIPSCCVLYIPLIG  436

Query  455   YLLCIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDG  276
             +LL I             P   F V   ++F     I+ L   +L +             
Sbjct  437   FLLSI-------------PRLPFMVDR-SDF----EIVGLDFMFLSE-------------  465

Query  275   DTKKFFYRTSKTRELDTLLGDIYHKI  198
               +K  YR+S+T+ELD++LGD++ +I
Sbjct  466   --EKLHYRSSRTKELDSILGDLHCEI  489



>ref|XP_006154348.1| PREDICTED: mutS protein homolog 5 isoform X1 [Tupaia chinensis]
Length=835

 Score =   152 bits (383),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 144/503 (29%), Positives = 233/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + H   +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  51    IHLCVLWHSGFLGIAYYDTSDSTVHFMPDTPD-HESLRLLQRVLNEINPRSVVTSAKQDE  109

Query  1499  SFLAALQRCDNTSEAATVK----LVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +    L +  +      ++     + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  110   TMTQFLGKLASQEHREPMRPEIIFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  169

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI    E  +F N S+ +    +  L   + +D  
Sbjct  170   SSIIPFDCLLTVRALGGLLKFLGRRRI--GVELEDF-NVSVPILGFKKFVLTHLVSIDQD  226

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  227   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTHDLGELN  286

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  287   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  344

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  345   L--------GLRDACRSLPQSIQL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  394

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL +V+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  395   TVLPN-IDPEIDEKKRRLMGLPSFLTDVARKELEDL-----DSRIPSCSVIYIPLIGFLL  448

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I   +L   ++    DFE                                FL E+    
Sbjct  449   SI--PRLPSMIESS--DFEIEGLDFM-------------------------FLSEE----  475

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELDTLLGD++ +I
Sbjct  476   KLHYRSARTKELDTLLGDLHCEI  498



>ref|XP_004847022.1| PREDICTED: mutS protein homolog 5 isoform X2 [Heterocephalus 
glaber]
Length=844

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 143/501 (29%), Positives = 230/501 (46%), Gaps = 60/501 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V++  + +   +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  60    VHLCVLWNSGHLGIAYYDTSDSAIHFMPDAPD-QESLKLLQRVLDEINPRSLVTSAKQDE  118

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   + L+ S  F  E +  RL+    + + +S+   E+I FL
Sbjct  119   NMTHFLGKLASQEHREPKKPEIILLPSVDFGLEISKQRLLSGNYSFIPESMTATEKILFL  178

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++  +  + VRA GGLL  L   R   V  + E  N S+ +    +  L   + +D  
Sbjct  179   SSIIPFNCLLTVRALGGLLKFLGRRR---VGVELEDYNVSVPILGFKKFVLTHLVSIDQE  235

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++L+
Sbjct  236   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLEELS  295

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   +  +K+VP ILK+          +DW    K++ S 
Sbjct  296   SRLDVIEFFLLPQNLDIAQMLHRLMSHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  353

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  354   L--------GLRDACRSLPQSIRL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  403

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCI  441
             T++ +    E+DE ++   GLP FL EV+  EL  L   V       ++YI  IG+LL I
Sbjct  404   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDSRVPSCS---VIYIPLIGFLLSI  459

Query  440   FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKF  261
                    E      DFE                                FL E+    K 
Sbjct  460   PRLPFMVEAS----DFEIEGLDFM-------------------------FLSEE----KL  486

Query  260   FYRTSKTRELDTLLGDIYHKI  198
              YR+++T+ELD LLGD++ +I
Sbjct  487   HYRSTRTKELDALLGDLHCEI  507



>ref|XP_004390814.1| PREDICTED: mutS protein homolog 5 isoform 1 [Trichechus manatus 
latirostris]
Length=830

 Score =   151 bits (382),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 146/503 (29%), Positives = 231/503 (46%), Gaps = 64/503 (13%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             +++  + +   +G++YYD+S   ++ M    D  +   LL  +  +V P  I TS K +E
Sbjct  46    IHLCVLWNSGYLGIAYYDTSDSSIHFMPDTPD-HETLKLLQRVLDEVNPRSIVTSAKQDE  104

Query  1499  SFLAALQRCDNTSEA----ATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +    L +  +   A      V  + S  F  E +  RL+    + + DS+   E+I FL
Sbjct  105   NMTRFLGKLASQEHAEPKRPEVVFLPSVDFGLEISKQRLLSGNYSFIPDSMTATEKILFL  164

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++     + VRA GGLL  L   RI     + E  N S+ +    +  L   + +D  
Sbjct  165   SSIIPFDCLLTVRALGGLLKFLGRRRI---GVELEDYNVSVPILGFKKFVLTHLVSIDQD  221

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL +LN
Sbjct  222   TYSVLQIFKSESHPSVYKVATGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLVELN  281

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   L  +K+VP ILK+          +DW    K++ S 
Sbjct  282   SRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  339

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  340   L--------GLRDACRSLPQSIQL--FQDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  389

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLP--CIVYIHQIGYLL  447
             T++ +    E+DE ++   GLP FL EV+  EL  L     ++ +P   ++YI  IG+LL
Sbjct  390   TVLSN-IDPEIDEKKRRLMGLPSFLTEVARKELETL-----DSRIPSCSVIYIPLIGFLL  443

Query  446   CIFNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTK  267
              I   +L   ++    DFE                                FL E+    
Sbjct  444   SI--PRLPSMVEAS--DFEIEGLDFM-------------------------FLSEE----  470

Query  266   KFFYRTSKTRELDTLLGDIYHKI  198
             K  YR+++T+ELD LLGD++ +I
Sbjct  471   KLHYRSARTKELDALLGDLHCEI  493



>ref|XP_004847021.1| PREDICTED: mutS protein homolog 5 isoform X1 [Heterocephalus 
glaber]
Length=847

 Score =   151 bits (382),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 143/501 (29%), Positives = 230/501 (46%), Gaps = 60/501 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V++  + +   +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  63    VHLCVLWNSGHLGIAYYDTSDSAIHFMPDAPD-QESLKLLQRVLDEINPRSLVTSAKQDE  121

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   + L+ S  F  E +  RL+    + + +S+   E+I FL
Sbjct  122   NMTHFLGKLASQEHREPKKPEIILLPSVDFGLEISKQRLLSGNYSFIPESMTATEKILFL  181

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++  +  + VRA GGLL  L   R   V  + E  N S+ +    +  L   + +D  
Sbjct  182   SSIIPFNCLLTVRALGGLLKFLGRRR---VGVELEDYNVSVPILGFKKFVLTHLVSIDQE  238

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++L+
Sbjct  239   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLEELS  298

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   +  +K+VP ILK+          +DW    K++ S 
Sbjct  299   SRLDVIEFFLLPQNLDIAQMLHRLMSHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  356

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  357   L--------GLRDACRSLPQSIRL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  406

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCI  441
             T++ +    E+DE ++   GLP FL EV+  EL  L   V       ++YI  IG+LL I
Sbjct  407   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDSRVPSCS---VIYIPLIGFLLSI  462

Query  440   FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKF  261
                    E      DFE                                FL E+    K 
Sbjct  463   PRLPFMVEAS----DFEIEGLDFM-------------------------FLSEE----KL  489

Query  260   FYRTSKTRELDTLLGDIYHKI  198
              YR+++T+ELD LLGD++ +I
Sbjct  490   HYRSTRTKELDALLGDLHCEI  510



>ref|XP_004905508.1| PREDICTED: mutS protein homolog 5 isoform X2 [Heterocephalus 
glaber]
Length=847

 Score =   151 bits (382),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 143/501 (29%), Positives = 230/501 (46%), Gaps = 60/501 (12%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V++  + +   +G++YYD+S   ++ M    D  +   LL  +  ++ P  + TS K +E
Sbjct  63    VHLCVLWNSGHLGIAYYDTSDSAIHFMPDAPD-QESLKLLQRVLDEINPRSLVTSAKQDE  121

Query  1499  S---FLAALQRCDNT-SEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
             +   FL  L   ++   +   + L+ S  F  E +  RL+    + + +S+   E+I FL
Sbjct  122   NMTHFLGKLASQEHREPKKPEIILLPSVDFGLEISKQRLLSGNYSFIPESMTATEKILFL  181

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVDSVSEISLNKFLKVDSA  1152
             SS++  +  + VRA GGLL  L   R   V  + E  N S+ +    +  L   + +D  
Sbjct  182   SSIIPFNCLLTVRALGGLLKFLGRRR---VGVELEDYNVSVPILGFKKFVLTHLVSIDQD  238

Query  1151  ALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldlddln  975
                 LQIF+ + HPS   +    KEG S+FG++N+C    G +LLR WF RP  DL++L+
Sbjct  239   TYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCRCKWGEKLLRLWFTRPTQDLEELS  298

Query  974   arldAISFLLFAEELSVS--LRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSICSL  801
             +RLD I F L  + L ++  L   +  +K+VP ILK+          +DW    K++ S 
Sbjct  299   SRLDVIEFFLLPQNLDIAQMLHRLMSHIKNVPLILKRMKLSHTKV--SDWQVLYKTVYSA  356

Query  800   LHINKIFEVGISEDLREQLKYLNLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQKGYE  621
             L        G+ +  R   + + L   +      S DL  I  L+  V+D   S  +   
Sbjct  357   L--------GLRDACRSLPQSIRL--FRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRF  406

Query  620   TIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGYLLCI  441
             T++ +    E+DE ++   GLP FL EV+  EL  L   V       ++YI  IG+LL I
Sbjct  407   TVLPN-IDPEIDEKKRRLTGLPSFLTEVARKELENLDSRVPSCS---VIYIPLIGFLLSI  462

Query  440   FNEKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FLDEDGDTKKF  261
                    E      DFE                                FL E+    K 
Sbjct  463   PRLPFMVEAS----DFEIEGLDFM-------------------------FLSEE----KL  489

Query  260   FYRTSKTRELDTLLGDIYHKI  198
              YR+++T+ELD LLGD++ +I
Sbjct  490   HYRSTRTKELDALLGDLHCEI  510



>ref|XP_008430898.1| PREDICTED: mutS protein homolog 5 [Poecilia reticulata]
Length=816

 Score =   151 bits (382),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 138/513 (27%), Positives = 240/513 (47%), Gaps = 81/513 (16%)
 Frame = -1

Query  1679  VYMACIMHGHRIGVSYYDSSIRQLYVMEIWEDGSKDFPLLDMIKYQVQPGVIYTSTKSEE  1500
             V ++ ++   ++G+ +YDS    L+ M    D + +  LL  +  +V+P VI TS K E 
Sbjct  32    VLLSVLVQRGQLGLCFYDSGDSSLHYMVDSPD-NYELHLLSRVIQEVRPHVILTSAKQER  90

Query  1499  SFLAALQRCDN----TSEAATVKLVKSSLFSYEQAWHRLMYLQVTGMDDSLNIKERISFL  1332
                  L++  +      E  T   V    F  E    RL+   +  +   ++ ++++S+L
Sbjct  91    CLTQYLKQLGSDPHYKPEVVTYPYVD---FGLEVGKQRLLSAHLPFLPACISERDKMSYL  147

Query  1331  SSMMDISSDVQVRASGGLLAILEDERIIDVHEQNEFENASIAVD--SVSEISLNKFLKVD  1158
             SS +   S + +RA G LL  L+  R+       E E++++ V        +L + + +D
Sbjct  148   SSCITFDSPLMLRAVGALLKCLDRRRV-----GVELEDSAVGVPILQFHAYTLKEVVYID  202

Query  1157  SAALEALQIFQIDKHPSHMGIGRA-KEGFSVFGMMNKCVTPMGRRLLRNWFLRPIldldd  981
                   LQIF+ D HPS   +    KEG S++G++N+C +  G +LLR WFLRP  DL  
Sbjct  203   RDTYSVLQIFKSDLHPSVYKLQSGEKEGLSLYGILNRCKSKFGSKLLRQWFLRPTRDLAV  262

Query  980   lnarldAISFLLFAEELSV--SLRETLKSVKDVPCILKKFNSPSCTCTSTDWAAFLKSIC  807
             L  R + I F        V  +L+ +L++++++P +L++    S     TDW +  K++ 
Sbjct  263   LYRRQEVIRFFTSPRNSDVLNTLQASLRNIRNIPGVLRRMTLSSTKV--TDWQSLYKTVF  320

Query  806   SLLHINKIFEVGISEDLREQLKYL--NLGIVKKAGDHLSSDLAFICELVIGVLDVNRSKQ  633
             S + I            R+ +++L  ++ + ++  + LS DL ++  L+  V+D + S +
Sbjct  321   SAVCI------------RDSMRHLPQSIQLFREISEKLSEDLHYVAALINRVVDFDASLE  368

Query  632   KGYETIVKDGFCNELDELRQIYEGLPDFLEEVSSLELARLPRMVGENGLPCIVYIHQIGY  453
             +   T VK      +DE ++   GL DFL +V+  EL  L   +      C++Y+  IG+
Sbjct  369   ENRFT-VKPNVDPAIDEKKRRMMGLSDFLTDVARRELEHLDSRISSC---CVIYLPLIGF  424

Query  452   LLCIFN-----EKLDEEMQEKLPDFEFAVCHLANFYY*LHILQL*HAYLHQCCWLIS*FL  288
             LL +       EK D EM+      EF                               FL
Sbjct  425   LLSVPRLPSMVEKEDFEME----GLEFM------------------------------FL  450

Query  287   DEDGDTKKFFYRTSKTRELDTLLGDIYHKILGM  189
              +D    +  YR+ +TRELD+LLGD++  I  M
Sbjct  451   SDD----RLHYRSQRTRELDSLLGDLHCDIRDM  479



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4791533042520