BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18810_g1_i2 len=1218 path=[1:0-503 505:504-847 849:848-1026
1028:1027-1027 1029:1028-1217]

Length=1218
                                                                      Score     E

ref|XP_009600775.1|  PREDICTED: probable protein phosphatase 2C 72      440   1e-149   
ref|XP_006355322.1|  PREDICTED: probable protein phosphatase 2C 7...    433   6e-147   
ref|XP_009786454.1|  PREDICTED: probable protein phosphatase 2C 72      429   3e-145   
ref|XP_009616668.1|  PREDICTED: probable protein phosphatase 2C 72      422   1e-142   
ref|XP_004245116.1|  PREDICTED: probable protein phosphatase 2C 72      422   1e-142   
ref|XP_002276954.2|  PREDICTED: probable protein phosphatase 2C 72      422   3e-142   Vitis vinifera
ref|XP_004245370.1|  PREDICTED: probable protein phosphatase 2C 72      420   4e-142   
ref|XP_007012238.1|  Phosphatase 2C family protein                      412   8e-139   
ref|XP_002516470.1|  protein phosphatase-2c, putative                   410   9e-138   Ricinus communis
ref|XP_009794190.1|  PREDICTED: probable protein phosphatase 2C 72      410   9e-138   
ref|XP_002324150.2|  hypothetical protein POPTR_0018s04620g             408   5e-137   Populus trichocarpa [western balsam poplar]
ref|XP_010047315.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    405   3e-136   
emb|CDP08235.1|  unnamed protein product                                405   5e-136   
ref|XP_011081705.1|  PREDICTED: probable protein phosphatase 2C 72      404   1e-135   
gb|KHG16709.1|  hypothetical protein F383_04170                         404   2e-135   
ref|XP_011019530.1|  PREDICTED: probable protein phosphatase 2C 72      403   3e-135   
ref|XP_002308579.1|  hypothetical protein POPTR_0006s24880g             402   5e-135   Populus trichocarpa [western balsam poplar]
ref|XP_011010711.1|  PREDICTED: probable protein phosphatase 2C 72      402   5e-135   
emb|CBI20616.3|  unnamed protein product                                400   2e-134   
ref|XP_004245372.1|  PREDICTED: probable protein phosphatase 2C 72      398   3e-133   
ref|XP_006450797.1|  hypothetical protein CICLE_v10010157mg             396   1e-132   
ref|XP_006355321.1|  PREDICTED: probable protein phosphatase 2C 7...    395   4e-132   
gb|KDP34123.1|  hypothetical protein JCGZ_07694                         393   3e-131   
emb|CAN66210.1|  hypothetical protein VITISV_021774                     389   6e-125   Vitis vinifera
ref|XP_010097090.1|  putative protein phosphatase 2C 72                 375   2e-124   
ref|XP_007136811.1|  hypothetical protein PHAVU_009G076300g             374   1e-123   
ref|XP_010244345.1|  PREDICTED: probable protein phosphatase 2C 7...    368   2e-121   
ref|XP_009337147.1|  PREDICTED: probable protein phosphatase 2C 72      367   3e-121   
ref|XP_008220444.1|  PREDICTED: probable protein phosphatase 2C 72      367   4e-121   
ref|XP_010244344.1|  PREDICTED: probable protein phosphatase 2C 7...    367   1e-120   
ref|XP_003525982.1|  PREDICTED: probable protein phosphatase 2C 72      366   1e-120   
ref|XP_010267059.1|  PREDICTED: probable protein phosphatase 2C 12      365   2e-120   
ref|XP_008357359.1|  PREDICTED: probable protein phosphatase 2C 7...    364   6e-120   
gb|AFK42819.1|  unknown                                                 364   8e-120   
ref|XP_003589034.1|  hypothetical protein MTR_1g016620                  362   7e-119   
ref|XP_004291019.1|  PREDICTED: probable protein phosphatase 2C 7...    361   1e-118   
ref|XP_004498917.1|  PREDICTED: probable protein phosphatase 2C 7...    357   3e-117   
ref|XP_010669214.1|  PREDICTED: probable protein phosphatase 2C 72      344   1e-112   
ref|XP_010915312.1|  PREDICTED: probable protein phosphatase 2C 12      340   2e-110   
ref|XP_008782499.1|  PREDICTED: probable protein phosphatase 2C 1...    332   4e-107   
ref|XP_003549361.1|  PREDICTED: probable protein phosphatase 2C 7...    330   2e-106   
ref|XP_007160990.1|  hypothetical protein PHAVU_001G033800g             329   4e-106   
ref|XP_008452701.1|  PREDICTED: probable protein phosphatase 2C 7...    326   3e-105   
ref|XP_004141421.1|  PREDICTED: probable protein phosphatase 2C 7...    325   5e-105   
ref|XP_008782500.1|  PREDICTED: probable protein phosphatase 2C 1...    327   5e-105   
ref|XP_006853933.1|  hypothetical protein AMTR_s00036p00202740          325   1e-104   
gb|AAC36699.1|  protein phosphatase-2C                                  324   4e-104   Mesembryanthemum crystallinum
ref|XP_008452702.1|  PREDICTED: probable protein phosphatase 2C 7...    323   5e-104   
ref|XP_010536209.1|  PREDICTED: probable protein phosphatase 2C 7...    322   8e-104   
ref|XP_009408871.1|  PREDICTED: probable protein phosphatase 2C 12      322   2e-103   
ref|XP_008357360.1|  PREDICTED: probable protein phosphatase 2C 7...    315   2e-101   
gb|AFW71293.1|  putative protein phosphatase 2C family protein          317   3e-101   
gb|KFK26385.1|  hypothetical protein AALP_AA8G241700                    315   6e-101   
ref|XP_009388680.1|  PREDICTED: probable protein phosphatase 2C 12      315   6e-101   
ref|XP_002451800.1|  hypothetical protein SORBIDRAFT_04g007930          316   1e-100   Sorghum bicolor [broomcorn]
ref|XP_008645636.1|  PREDICTED: probable protein phosphatase 2C 12      315   3e-100   
gb|KHN37016.1|  Hypothetical protein glysoja_009044                     312   4e-100   
ref|XP_007227318.1|  hypothetical protein PRUPE_ppa016423mg             312   6e-100   
ref|XP_006290118.1|  hypothetical protein CARUB_v10003772mg             312   6e-100   
ref|XP_010669211.1|  PREDICTED: probable protein phosphatase 2C 72      311   7e-100   
ref|NP_197973.2|  putative protein phosphatase 2C 72                    311   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454947.1|  PREDICTED: probable protein phosphatase 2C 72      311   4e-99    
ref|XP_010493859.1|  PREDICTED: probable protein phosphatase 2C 72      309   2e-98    
dbj|BAJ98729.1|  predicted protein                                      309   3e-98    
gb|AFW66022.1|  putative protein phosphatase 2C family protein          308   2e-97    
ref|NP_001151594.1|  catalytic/ protein phosphatase type 2C             307   3e-97    Zea mays [maize]
ref|XP_010421458.1|  PREDICTED: probable protein phosphatase 2C 72      306   3e-97    
emb|CDX88210.1|  BnaA06g28010D                                          306   4e-97    
gb|AAD40128.1|AF149413_9  similiar to protein phosphatase 2C; Pfa...    305   4e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003571750.1|  PREDICTED: probable protein phosphatase 2C 12      306   4e-97    
gb|EYU20377.1|  hypothetical protein MIMGU_mgv1a012801mg                301   7e-97    
ref|XP_010536207.1|  PREDICTED: probable protein phosphatase 2C 7...    305   8e-97    
ref|XP_006394849.1|  hypothetical protein EUTSA_v10004521mg             304   2e-96    
ref|XP_010536208.1|  PREDICTED: probable protein phosphatase 2C 7...    305   2e-96    
ref|XP_009151115.1|  PREDICTED: probable protein phosphatase 2C 72      304   2e-96    
emb|CDX80553.1|  BnaC07g28910D                                          302   1e-95    
ref|XP_010669220.1|  PREDICTED: probable protein phosphatase 2C 12      301   2e-95    
ref|XP_009108822.1|  PREDICTED: probable protein phosphatase 2C 61      299   8e-95    
ref|NP_195021.1|  putative protein phosphatase 2C 61                    298   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437828.1|  PREDICTED: probable protein phosphatase 2C 61      298   3e-94    
emb|CDY45023.1|  BnaA08g11960D                                          297   5e-94    
ref|XP_002874294.1|  phosphatase 2C-like protein                        297   6e-94    
ref|XP_006647079.1|  PREDICTED: probable protein phosphatase 2C 1...    296   3e-93    
ref|XP_010432632.1|  PREDICTED: probable protein phosphatase 2C 61      293   1e-92    
ref|XP_010447315.1|  PREDICTED: probable protein phosphatase 2C 61      291   1e-91    
ref|XP_004951406.1|  PREDICTED: probable protein phosphatase 2C 1...    291   4e-91    
emb|CDY28276.1|  BnaC03g66830D                                          289   5e-91    
gb|EMT26930.1|  Putative protein phosphatase 2C 12                      288   6e-91    
gb|KFK29906.1|  hypothetical protein AALP_AA7G193700                    289   7e-91    
ref|NP_001046332.1|  Os02g0224100                                       291   8e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006284094.1|  hypothetical protein CARUB_v10005231mg             289   9e-91    
ref|XP_006412407.1|  hypothetical protein EUTSA_v10025704mg             288   2e-90    
ref|XP_010526067.1|  PREDICTED: probable protein phosphatase 2C 6...    288   2e-90    
ref|XP_002867218.1|  hypothetical protein ARALYDRAFT_328437             287   3e-90    
gb|EAY85062.1|  hypothetical protein OsI_06419                          288   7e-90    Oryza sativa Indica Group [Indian rice]
emb|CDX72381.1|  BnaC07g44030D                                          286   1e-89    
ref|XP_010546507.1|  PREDICTED: probable protein phosphatase 2C 61      284   6e-89    
gb|KCW79206.1|  hypothetical protein EUGRSUZ_C00635                     278   6e-88    
ref|XP_009138153.1|  PREDICTED: probable protein phosphatase 2C 61      281   6e-88    
gb|AFW66021.1|  putative protein phosphatase 2C family protein          283   1e-87    
ref|XP_010669230.1|  PREDICTED: probable protein phosphatase 2C 72      281   1e-87    
gb|AFW71290.1|  putative protein phosphatase 2C family protein          280   2e-87    
ref|XP_006828159.1|  hypothetical protein AMTR_s00023p00095420          281   9e-87    
ref|XP_008676760.1|  PREDICTED: putative protein phosphatase 2C f...    285   1e-86    
ref|XP_001764662.1|  predicted protein                                  281   1e-86    
ref|XP_011084661.1|  PREDICTED: probable protein phosphatase 2C 33      283   1e-86    
ref|NP_001152031.1|  LOC100285668                                       284   1e-86    Zea mays [maize]
gb|AFW66020.1|  putative protein phosphatase 2C family protein          276   2e-86    
ref|XP_009340340.1|  PREDICTED: probable protein phosphatase 2C 33      282   3e-86    
ref|XP_002444805.1|  hypothetical protein SORBIDRAFT_07g028300          282   6e-86    Sorghum bicolor [broomcorn]
tpg|DAA47842.1|  TPA: putative protein phosphatase 2C family protein    282   6e-86    
ref|XP_009340399.1|  PREDICTED: probable protein phosphatase 2C 33      281   7e-86    
ref|XP_010247822.1|  PREDICTED: probable protein phosphatase 2C 33      280   1e-85    
ref|XP_011085339.1|  PREDICTED: probable protein phosphatase 2C 52      280   1e-85    
ref|XP_007222732.1|  hypothetical protein PRUPE_ppa006494mg             278   2e-85    
gb|EPS66665.1|  hypothetical protein M569_08112                         281   2e-85    
ref|XP_009609263.1|  PREDICTED: probable protein phosphatase 2C 33      281   2e-85    
ref|XP_002514837.1|  protein phosphatase-2c, putative                   280   3e-85    Ricinus communis
ref|XP_006447330.1|  hypothetical protein CICLE_v10015132mg             279   3e-85    
emb|CBI28905.3|  unnamed protein product                                278   4e-85    
ref|XP_010931503.1|  PREDICTED: probable protein phosphatase 2C 73      278   4e-85    
gb|KDO40767.1|  hypothetical protein CISIN_1g012129mg                   279   4e-85    
ref|XP_002517960.1|  protein phosphatase-2c, putative                   278   5e-85    Ricinus communis
ref|XP_010657270.1|  PREDICTED: probable protein phosphatase 2C 52      278   7e-85    
ref|XP_010100647.1|  putative protein phosphatase 2C 33                 277   8e-85    
ref|XP_010549876.1|  PREDICTED: probable protein phosphatase 2C 33      281   9e-85    
ref|XP_007029293.1|  Phosphatase 2C family protein isoform 1            278   1e-84    
ref|XP_008370833.1|  PREDICTED: probable protein phosphatase 2C 33      278   1e-84    
ref|XP_006847475.1|  hypothetical protein AMTR_s00163p00051750          278   1e-84    
ref|XP_004243332.1|  PREDICTED: probable protein phosphatase 2C 52      278   1e-84    
gb|KDP26876.1|  hypothetical protein JCGZ_18034                         278   1e-84    
gb|EYU27523.1|  hypothetical protein MIMGU_mgv1a004849mg                278   1e-84    
ref|XP_004973821.1|  PREDICTED: probable protein phosphatase 2C 6...    279   1e-84    
gb|EPS70212.1|  hypothetical protein M569_04548                         278   1e-84    
ref|XP_006659550.1|  PREDICTED: probable protein phosphatase 2C 6...    276   2e-84    
ref|XP_008244425.1|  PREDICTED: probable protein phosphatase 2C 33      275   2e-84    
ref|XP_007142603.1|  hypothetical protein PHAVU_007G001500g             275   3e-84    
ref|XP_009371152.1|  PREDICTED: probable protein phosphatase 2C 33      275   3e-84    
ref|XP_008337529.1|  PREDICTED: probable protein phosphatase 2C 33      274   4e-84    
ref|XP_009776219.1|  PREDICTED: probable protein phosphatase 2C 52      276   4e-84    
ref|XP_009629131.1|  PREDICTED: probable protein phosphatase 2C 33      276   5e-84    
ref|XP_010673906.1|  PREDICTED: probable protein phosphatase 2C 33      276   5e-84    
ref|XP_009766558.1|  PREDICTED: probable protein phosphatase 2C 33      278   6e-84    
ref|XP_010928896.1|  PREDICTED: probable protein phosphatase 2C 66      278   6e-84    
emb|CDP13625.1|  unnamed protein product                                277   8e-84    
ref|XP_002992818.1|  hypothetical protein SELMODRAFT_187001             275   8e-84    
ref|XP_008341905.1|  PREDICTED: probable protein phosphatase 2C 52      275   8e-84    
ref|XP_002987553.1|  hypothetical protein SELMODRAFT_183192             275   8e-84    
gb|ABR16508.1|  unknown                                                 277   8e-84    Picea sitchensis
emb|CDY53743.1|  BnaAnng12710D                                          275   1e-83    
ref|XP_003574715.1|  PREDICTED: probable protein phosphatase 2C 66      276   1e-83    
ref|XP_009619304.1|  PREDICTED: probable protein phosphatase 2C 52      275   1e-83    
ref|XP_004296680.1|  PREDICTED: probable protein phosphatase 2C 3...    273   1e-83    
ref|XP_010556832.1|  PREDICTED: probable protein phosphatase 2C 52      275   2e-83    
ref|XP_006345821.1|  PREDICTED: probable protein phosphatase 2C 3...    275   2e-83    
ref|XP_006350422.1|  PREDICTED: probable protein phosphatase 2C 3...    278   2e-83    
ref|XP_006357501.1|  PREDICTED: probable protein phosphatase 2C 5...    275   2e-83    
ref|XP_004239696.1|  PREDICTED: probable protein phosphatase 2C 33      275   2e-83    
ref|XP_011039750.1|  PREDICTED: probable protein phosphatase 2C 52      275   2e-83    
ref|XP_008388813.1|  PREDICTED: probable protein phosphatase 2C 33      275   2e-83    
gb|EYU39712.1|  hypothetical protein MIMGU_mgv1a008325mg                271   3e-83    
ref|XP_009118526.1|  PREDICTED: probable protein phosphatase 2C 33      274   3e-83    
ref|XP_008782938.1|  PREDICTED: probable protein phosphatase 2C 6...    276   3e-83    
ref|XP_009783863.1|  PREDICTED: probable protein phosphatase 2C 33      275   3e-83    
ref|XP_004304122.1|  PREDICTED: probable protein phosphatase 2C 5...    274   3e-83    
ref|XP_008777864.1|  PREDICTED: probable protein phosphatase 2C 3...    275   3e-83    
ref|XP_011095667.1|  PREDICTED: probable protein phosphatase 2C 6       275   3e-83    
ref|XP_009147325.1|  PREDICTED: probable protein phosphatase 2C 33      273   3e-83    
ref|XP_003539901.1|  PREDICTED: probable protein phosphatase 2C 5...    274   4e-83    
gb|KDO54036.1|  hypothetical protein CISIN_1g011218mg                   273   4e-83    
ref|XP_004170792.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    271   4e-83    
ref|XP_009415101.1|  PREDICTED: probable protein phosphatase 2C 33      272   5e-83    
gb|KDO63278.1|  hypothetical protein CISIN_1g045692mg                   272   5e-83    
ref|XP_011045478.1|  PREDICTED: probable protein phosphatase 2C 52      273   5e-83    
ref|XP_004140875.1|  PREDICTED: probable protein phosphatase 2C 3...    271   5e-83    
ref|XP_003534509.1|  PREDICTED: probable protein phosphatase 2C 3...    274   6e-83    
ref|XP_004492843.1|  PREDICTED: probable protein phosphatase 2C 3...    274   6e-83    
ref|XP_006371587.1|  phosphatase 2C family protein                      273   6e-83    
gb|KDO73929.1|  hypothetical protein CISIN_1g011968mg                   273   7e-83    
gb|KHN41141.1|  Hypothetical protein glysoja_017185                     273   7e-83    
ref|XP_009766317.1|  PREDICTED: probable protein phosphatase 2C 52      273   8e-83    
ref|XP_010907919.1|  PREDICTED: probable protein phosphatase 2C 33      273   8e-83    
ref|XP_008445704.1|  PREDICTED: probable protein phosphatase 2C 33      271   9e-83    
dbj|BAJ88611.1|  predicted protein                                      271   1e-82    
ref|XP_003552448.1|  PREDICTED: probable protein phosphatase 2C 3...    273   1e-82    
ref|XP_007149875.1|  hypothetical protein PHAVU_005G106100g             273   1e-82    
ref|XP_011077163.1|  PREDICTED: probable protein phosphatase 2C 33      273   1e-82    
gb|EMT27153.1|  Putative protein phosphatase 2C 64                      271   1e-82    
gb|KDO73930.1|  hypothetical protein CISIN_1g011968mg                   272   1e-82    
emb|CBI39869.3|  unnamed protein product                                271   1e-82    
ref|XP_003527445.1|  PREDICTED: probable protein phosphatase 2C 5...    272   1e-82    
ref|XP_006480437.1|  PREDICTED: probable protein phosphatase 2C 3...    273   1e-82    
gb|KHN31949.1|  Hypothetical protein glysoja_025783                     272   1e-82    
gb|KDO54033.1|  hypothetical protein CISIN_1g011218mg                   273   2e-82    
ref|XP_002319366.1|  phosphatase 2C family protein                      272   2e-82    Populus trichocarpa [western balsam poplar]
ref|XP_006452792.1|  hypothetical protein CICLE_v10007997mg             273   2e-82    
ref|XP_007139720.1|  hypothetical protein PHAVU_008G053700g             273   2e-82    
ref|XP_009410548.1|  PREDICTED: probable protein phosphatase 2C 73      270   2e-82    
ref|XP_010069369.1|  PREDICTED: probable protein phosphatase 2C 33      270   2e-82    
ref|XP_008230255.1|  PREDICTED: probable protein phosphatase 2C 52      272   2e-82    
gb|KHG26837.1|  putative phosphatase 2C 33 -like protein                272   2e-82    
ref|XP_007215329.1|  hypothetical protein PRUPE_ppa005246mg             272   2e-82    
ref|XP_004305101.1|  PREDICTED: probable protein phosphatase 2C 7...    271   2e-82    
ref|XP_007043535.1|  Phosphatase 2C 52 isoform 1                        271   2e-82    
ref|XP_008806175.1|  PREDICTED: probable protein phosphatase 2C 66      273   3e-82    
gb|EYU26137.1|  hypothetical protein MIMGU_mgv1a005757mg                271   3e-82    
emb|CDP04194.1|  unnamed protein product                                272   3e-82    
gb|EYU39458.1|  hypothetical protein MIMGU_mgv1a005481mg                272   3e-82    
ref|XP_003624186.1|  Protein phosphatase 2c                             272   3e-82    
ref|XP_006481121.1|  PREDICTED: probable protein phosphatase 2C 6...    268   3e-82    
ref|XP_010095801.1|  putative protein phosphatase 2C 52                 271   3e-82    
ref|XP_009406352.1|  PREDICTED: probable protein phosphatase 2C 33      269   4e-82    
ref|XP_004952485.1|  PREDICTED: probable protein phosphatase 2C 1...    273   4e-82    
gb|KCW84581.1|  hypothetical protein EUGRSUZ_B01420                     270   4e-82    
gb|KDP24167.1|  hypothetical protein JCGZ_25824                         271   4e-82    
emb|CDY53741.1|  BnaAnng12690D                                          271   4e-82    
ref|XP_004237585.1|  PREDICTED: probable protein phosphatase 2C 33      276   4e-82    
dbj|BAJ88000.1|  predicted protein                                      268   5e-82    
gb|AAV73837.1|  protein phosphatase 2c                                  272   5e-82    Medicago sativa [alfalfa]
ref|XP_008218455.1|  PREDICTED: probable protein phosphatase 2C 33      272   5e-82    
ref|XP_009357075.1|  PREDICTED: probable protein phosphatase 2C 52      271   5e-82    
ref|XP_008379553.1|  PREDICTED: probable protein phosphatase 2C 52      271   5e-82    
ref|XP_007132652.1|  hypothetical protein PHAVU_011G113300g             270   6e-82    
ref|XP_003543347.1|  PREDICTED: probable protein phosphatase 2C 5...    271   7e-82    
ref|XP_004159488.1|  PREDICTED: probable protein phosphatase 2C 6...    272   8e-82    
ref|XP_009390619.1|  PREDICTED: probable protein phosphatase 2C 66      272   1e-81    
emb|CBI17615.3|  unnamed protein product                                270   1e-81    
ref|XP_009782883.1|  PREDICTED: probable protein phosphatase 2C 65      269   1e-81    
ref|XP_006474744.1|  PREDICTED: probable protein phosphatase 2C 6...    271   1e-81    
ref|XP_002325473.1|  phosphatase 2C family protein                      271   1e-81    Populus trichocarpa [western balsam poplar]
ref|XP_010268762.1|  PREDICTED: probable protein phosphatase 2C 1       270   1e-81    
ref|XP_009413563.1|  PREDICTED: probable protein phosphatase 2C 3...    270   1e-81    
ref|XP_007205041.1|  hypothetical protein PRUPE_ppa004533mg             271   1e-81    
ref|XP_003562890.1|  PREDICTED: probable protein phosphatase 2C 64      268   1e-81    
ref|XP_004975270.1|  PREDICTED: probable protein phosphatase 2C 1...    271   1e-81    
ref|XP_010908969.1|  PREDICTED: probable protein phosphatase 2C 33      270   1e-81    
ref|XP_002277393.1|  PREDICTED: probable protein phosphatase 2C 33      270   2e-81    Vitis vinifera
ref|XP_008441722.1|  PREDICTED: probable protein phosphatase 2C 33      270   2e-81    
ref|XP_010644704.1|  PREDICTED: probable protein phosphatase 2C 6       271   2e-81    
emb|CDY51389.1|  BnaC08g46260D                                          268   2e-81    
ref|XP_004506557.1|  PREDICTED: probable protein phosphatase 2C 5...    269   2e-81    
ref|XP_010278294.1|  PREDICTED: probable protein phosphatase 2C 52      269   2e-81    
ref|NP_001060016.1|  Os07g0566200                                       268   2e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009379076.1|  PREDICTED: probable protein phosphatase 2C 6       271   2e-81    
emb|CDY51537.1|  BnaA05g33370D                                          271   3e-81    
ref|XP_002319268.2|  phosphatase 2C family protein                      269   3e-81    Populus trichocarpa [western balsam poplar]
ref|XP_010500496.1|  PREDICTED: probable protein phosphatase 2C 33      270   3e-81    
ref|XP_003605716.1|  hypothetical protein MTR_4g037470                  269   3e-81    
ref|XP_002529215.1|  protein phosphatase-2c, putative                   270   3e-81    Ricinus communis
ref|XP_008348116.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    268   4e-81    
ref|XP_006307438.1|  hypothetical protein CARUB_v10009068mg             268   4e-81    
ref|XP_004147974.1|  PREDICTED: probable protein phosphatase 2C 6...    270   4e-81    
ref|XP_010111089.1|  putative protein phosphatase 2C 33                 269   5e-81    
emb|CDP14742.1|  unnamed protein product                                268   5e-81    
ref|XP_006429502.1|  hypothetical protein CICLE_v10013751mg             270   5e-81    
ref|XP_004487307.1|  PREDICTED: probable protein phosphatase 2C 5...    267   5e-81    
ref|XP_010045969.1|  PREDICTED: probable protein phosphatase 2C 33      270   5e-81    
ref|XP_010463699.1|  PREDICTED: probable protein phosphatase 2C 33      269   5e-81    
dbj|BAK00637.1|  predicted protein                                      270   5e-81    
gb|ACN40371.1|  unknown                                                 270   6e-81    Picea sitchensis
ref|XP_008370206.1|  PREDICTED: probable protein phosphatase 2C 65      268   6e-81    
ref|XP_006418222.1|  hypothetical protein EUTSA_v10007577mg             268   6e-81    
ref|XP_011007021.1|  PREDICTED: probable protein phosphatase 2C 6       269   6e-81    
ref|XP_009622508.1|  PREDICTED: probable protein phosphatase 2C 65      267   6e-81    
ref|XP_009394985.1|  PREDICTED: probable protein phosphatase 2C 66      270   6e-81    
gb|ABR16400.1|  unknown                                                 270   6e-81    Picea sitchensis
ref|XP_010476727.1|  PREDICTED: probable protein phosphatase 2C 6       268   6e-81    
ref|XP_010522631.1|  PREDICTED: probable protein phosphatase 2C 52      268   6e-81    
ref|XP_003540353.1|  PREDICTED: probable protein phosphatase 2C 5...    268   7e-81    
gb|KHN04271.1|  Hypothetical protein glysoja_037951                     268   7e-81    
ref|XP_008448968.1|  PREDICTED: probable protein phosphatase 2C 6       270   7e-81    
gb|EMS49236.1|  putative protein phosphatase 2C 66                      270   9e-81    
ref|XP_002986464.1|  hypothetical protein SELMODRAFT_235030             267   9e-81    
gb|KHG02830.1|  hypothetical protein F383_26202                         269   1e-80    
ref|XP_002978948.1|  hypothetical protein SELMODRAFT_153020             267   1e-80    
gb|KDP29523.1|  hypothetical protein JCGZ_19236                         268   1e-80    
ref|XP_006658703.1|  PREDICTED: probable protein phosphatase 2C 6...    266   1e-80    
ref|XP_010245945.1|  PREDICTED: probable protein phosphatase 2C 33      267   1e-80    
ref|NP_001169432.1|  putative protein phosphatase 2C family protein     269   1e-80    Zea mays [maize]
ref|XP_011013066.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    268   1e-80    
ref|NP_001062155.1|  Os08g0500300                                       269   1e-80    
ref|XP_004138909.1|  PREDICTED: probable protein phosphatase 2C 3...    267   2e-80    
ref|XP_009415964.1|  PREDICTED: probable protein phosphatase 2C 33      266   2e-80    
ref|XP_010485598.1|  PREDICTED: probable protein phosphatase 2C 3...    267   2e-80    
emb|CDX92009.1|  BnaC03g33110D                                          267   2e-80    
ref|XP_009128377.1|  PREDICTED: probable protein phosphatase 2C 1...    266   2e-80    
gb|KHG11990.1|  hypothetical protein F383_16619                         266   2e-80    
ref|XP_010089720.1|  putative protein phosphatase 2C 6                  266   2e-80    
ref|XP_009401502.1|  PREDICTED: probable protein phosphatase 2C 66      268   3e-80    
ref|XP_011077507.1|  PREDICTED: probable protein phosphatase 2C 65      265   3e-80    
ref|XP_008354142.1|  PREDICTED: probable protein phosphatase 2C 6       268   3e-80    
ref|XP_010913240.1|  PREDICTED: probable protein phosphatase 2C 66      268   3e-80    
ref|XP_006366012.1|  PREDICTED: probable protein phosphatase 2C 5...    266   3e-80    
ref|XP_006363628.1|  PREDICTED: probable protein phosphatase 2C 3...    265   4e-80    
ref|XP_010526068.1|  PREDICTED: probable protein phosphatase 2C 6...    259   4e-80    
ref|XP_010035700.1|  PREDICTED: probable protein phosphatase 2C 52      266   4e-80    
gb|KEH21866.1|  phosphatase 2C family protein                           264   4e-80    
ref|XP_004136816.1|  PREDICTED: probable protein phosphatase 2C 5...    266   4e-80    
ref|XP_006857543.1|  hypothetical protein AMTR_s00061p00041440          268   4e-80    
ref|XP_009416608.1|  PREDICTED: probable protein phosphatase 2C 33      265   4e-80    
ref|XP_009602255.1|  PREDICTED: probable protein phosphatase 2C 65      265   5e-80    
ref|XP_008455336.1|  PREDICTED: probable protein phosphatase 2C 5...    266   5e-80    
ref|XP_010457365.1|  PREDICTED: probable protein phosphatase 2C 1       266   5e-80    
ref|XP_008792186.1|  PREDICTED: probable protein phosphatase 2C 73      263   5e-80    
ref|XP_009373099.1|  PREDICTED: probable protein phosphatase 2C 65      265   6e-80    
ref|NP_173072.1|  putative protein phosphatase 2C 6                     266   6e-80    
ref|XP_009800840.1|  PREDICTED: probable protein phosphatase 2C 65      265   6e-80    
ref|XP_011035437.1|  PREDICTED: probable protein phosphatase 2C 66      266   7e-80    
emb|CDX88554.1|  BnaC06g39980D                                          265   7e-80    
ref|XP_011009964.1|  PREDICTED: probable protein phosphatase 2C 33      265   7e-80    
ref|XP_008246536.1|  PREDICTED: probable protein phosphatase 2C 6       266   8e-80    
ref|NP_001130320.1|  uncharacterized protein LOC100191414               264   8e-80    
ref|XP_010474982.1|  PREDICTED: probable protein phosphatase 2C 1       265   8e-80    
ref|XP_006665077.1|  PREDICTED: probable protein phosphatase 2C 7...    262   9e-80    
ref|XP_006297511.1|  hypothetical protein CARUB_v10013536mg             266   9e-80    
ref|XP_009374430.1|  PREDICTED: probable protein phosphatase 2C 6       267   9e-80    
ref|XP_010683599.1|  PREDICTED: probable protein phosphatase 2C 73      264   1e-79    
ref|XP_008384641.1|  PREDICTED: probable protein phosphatase 2C 6       267   1e-79    
emb|CDY28706.1|  BnaCnng05920D                                          266   1e-79    
dbj|BAD17062.1|  putative protein phosphatase-2C                        261   1e-79    
ref|XP_007140186.1|  hypothetical protein PHAVU_008G091200g             263   1e-79    
ref|XP_006283724.1|  hypothetical protein CARUB_v10004792mg             264   1e-79    
ref|XP_010482259.1|  PREDICTED: probable protein phosphatase 2C 1       265   1e-79    
gb|KEH39098.1|  catalytic/protein phosphatase type 2C                   265   1e-79    
gb|KFK30642.1|  hypothetical protein AALP_AA6G008500                    264   1e-79    
ref|XP_006395907.1|  hypothetical protein EUTSA_v10004207mg             264   1e-79    
ref|XP_008678656.1|  PREDICTED: probable protein phosphatase 2C 75      264   1e-79    
gb|KHG10565.1|  hypothetical protein F383_11203                         265   1e-79    
ref|XP_009106686.1|  PREDICTED: probable protein phosphatase 2C 18      265   2e-79    
ref|XP_003621670.1|  Protein phosphatase 2c                             264   2e-79    
ref|NP_001065952.2|  Os12g0108600                                       264   2e-79    
ref|XP_002868461.1|  hypothetical protein ARALYDRAFT_493662             263   2e-79    
ref|XP_006408386.1|  hypothetical protein EUTSA_v10020601mg             265   2e-79    
ref|XP_006301326.1|  hypothetical protein CARUB_v10021735mg             265   2e-79    
ref|XP_010272535.1|  PREDICTED: probable protein phosphatase 2C 66      265   2e-79    
ref|XP_010455891.1|  PREDICTED: probable protein phosphatase 2C 52      264   3e-79    
ref|XP_004249060.1|  PREDICTED: probable protein phosphatase 2C 65      263   3e-79    
gb|KHG17181.1|  hypothetical protein F383_23069                         262   3e-79    
ref|XP_003533680.1|  PREDICTED: probable protein phosphatase 2C 7...    263   3e-79    
ref|XP_002884336.1|  phosphatase 2C family protein                      264   3e-79    
gb|KHG03244.1|  putative phosphatase 2C 33 -like protein                264   3e-79    
ref|XP_008244796.1|  PREDICTED: probable protein phosphatase 2C 65      263   3e-79    
ref|XP_004248152.1|  PREDICTED: probable protein phosphatase 2C 52      263   3e-79    
ref|XP_002890154.1|  phosphatase 2C family protein                      264   4e-79    
ref|XP_004294864.1|  PREDICTED: probable protein phosphatase 2C 6...    265   4e-79    
ref|XP_010431054.1|  PREDICTED: probable protein phosphatase 2C 52      263   4e-79    
ref|XP_009623039.1|  PREDICTED: probable protein phosphatase 2C 52      263   4e-79    
gb|KHN29557.1|  Hypothetical protein glysoja_005281                     262   5e-79    
gb|AAL31255.1|  AT5g36250/T30G6_11                                      262   5e-79    
emb|CDX74239.1|  BnaA03g28080D                                          263   5e-79    
ref|XP_010529005.1|  PREDICTED: probable protein phosphatase 2C 74      266   5e-79    
ref|NP_001241841.1|  putative protein phosphatase 2C family protein     259   5e-79    
ref|XP_010928162.1|  PREDICTED: probable protein phosphatase 2C 66      265   5e-79    
ref|NP_198474.1|  putative protein phosphatase 2C 74                    262   5e-79    
ref|XP_006306059.1|  hypothetical protein CARUB_v10011374mg             263   5e-79    
ref|XP_002305698.2|  phosphatase 2C family protein                      263   6e-79    
ref|XP_010061374.1|  PREDICTED: probable protein phosphatase 2C 6       264   6e-79    
ref|XP_004249617.2|  PREDICTED: probable protein phosphatase 2C 65      260   6e-79    
ref|XP_010422463.1|  PREDICTED: probable protein phosphatase 2C 52      263   6e-79    
ref|XP_002300600.2|  hypothetical protein POPTR_0001s47730g             264   6e-79    
ref|XP_004958055.1|  PREDICTED: probable protein phosphatase 2C 6...    261   7e-79    
ref|XP_007206493.1|  hypothetical protein PRUPE_ppa019111mg             262   7e-79    
gb|ABA96190.1|  protein phosphatase 2c, putative, expressed             265   8e-79    
ref|XP_010689685.1|  PREDICTED: probable protein phosphatase 2C 52      263   9e-79    
ref|XP_009121881.1|  PREDICTED: probable protein phosphatase 2C 52      262   9e-79    
gb|EMS48353.1|  putative protein phosphatase 2C 73                      262   1e-78    
emb|CDX87369.1|  BnaA07g35040D                                          263   1e-78    
ref|XP_006339274.1|  PREDICTED: probable protein phosphatase 2C 6...    261   1e-78    
gb|EMT03415.1|  Putative protein phosphatase 2C 66                      262   1e-78    
gb|EAY79673.1|  hypothetical protein OsI_34819                          260   2e-78    
ref|XP_008464241.1|  PREDICTED: probable protein phosphatase 2C 6...    261   2e-78    
ref|NP_680572.4|  putative protein phosphatase 2C 52                    261   2e-78    
gb|KHN40686.1|  Hypothetical protein glysoja_001184                     260   2e-78    
emb|CDX89881.1|  BnaA10g02010D                                          260   2e-78    
emb|CDY69821.1|  BnaCnng65520D                                          259   2e-78    
ref|XP_010924065.1|  PREDICTED: probable protein phosphatase 2C 64      261   2e-78    
ref|XP_010921096.1|  PREDICTED: probable protein phosphatase 2C 6...    263   2e-78    
ref|XP_006287679.1|  hypothetical protein CARUB_v10000888mg             261   2e-78    
ref|XP_007023520.1|  Phosphatase 2C family protein isoform 1            263   2e-78    
ref|XP_003568624.1|  PREDICTED: probable protein phosphatase 2C 48      257   2e-78    
ref|XP_003555649.1|  PREDICTED: probable protein phosphatase 2C 3...    258   2e-78    
ref|XP_008799822.1|  PREDICTED: probable protein phosphatase 2C 73      260   2e-78    
ref|NP_001065550.1|  Os11g0109000                                       259   2e-78    
gb|EAZ04367.1|  hypothetical protein OsI_26509                          260   2e-78    
ref|XP_009627195.1|  PREDICTED: probable protein phosphatase 2C 6       262   3e-78    
ref|XP_004248325.1|  PREDICTED: probable protein phosphatase 2C 6       263   3e-78    
gb|EAZ17162.1|  hypothetical protein OsJ_32667                          259   3e-78    
ref|XP_002463038.1|  hypothetical protein SORBIDRAFT_02g036610          260   3e-78    
ref|XP_010922660.1|  PREDICTED: probable protein phosphatase 2C 7...    260   3e-78    
ref|XP_010070158.1|  PREDICTED: probable protein phosphatase 2C 33      262   3e-78    
ref|XP_002892170.1|  predicted protein                                  261   3e-78    
gb|KEH29533.1|  catalytic/protein phosphatase type 2C                   261   3e-78    
ref|XP_006396571.1|  hypothetical protein EUTSA_v10028637mg             261   4e-78    
ref|XP_002872779.1|  hypothetical protein ARALYDRAFT_490221             261   4e-78    
ref|XP_010440790.1|  PREDICTED: probable protein phosphatase 2C 74      260   4e-78    
ref|XP_004962337.1|  PREDICTED: probable protein phosphatase 2C 4...    256   4e-78    
dbj|BAB84699.1|  protein phosphatase 2C                                 259   5e-78    
ref|XP_009119530.1|  PREDICTED: probable protein phosphatase 2C 1       259   5e-78    
ref|XP_010450435.1|  PREDICTED: probable protein phosphatase 2C 74      260   5e-78    
ref|XP_009618055.1|  PREDICTED: probable protein phosphatase 2C 6       262   5e-78    
ref|XP_009413564.1|  PREDICTED: probable protein phosphatase 2C 3...    261   6e-78    
ref|NP_186924.1|  putative protein phosphatase 2C 33                    261   6e-78    
ref|XP_006648631.1|  PREDICTED: probable protein phosphatase 2C 1...    258   6e-78    
emb|CDY33350.1|  BnaC05g12330D                                          260   6e-78    
ref|XP_009134702.1|  PREDICTED: probable protein phosphatase 2C 33      261   6e-78    
gb|EYU41970.1|  hypothetical protein MIMGU_mgv1a017784mg                259   6e-78    
gb|AAL32574.1|  putative protein phosphatase-2C (PP2C)                  261   7e-78    
ref|NP_001151041.1|  catalytic/ protein phosphatase type 2C             256   7e-78    
ref|XP_010264517.1|  PREDICTED: probable protein phosphatase 2C 6...    259   8e-78    
ref|XP_004302165.1|  PREDICTED: probable protein phosphatase 2C 3...    260   9e-78    
ref|XP_008782937.1|  PREDICTED: probable protein phosphatase 2C 6...    263   9e-78    
ref|XP_009787955.1|  PREDICTED: probable protein phosphatase 2C 6...    261   1e-77    
dbj|BAJ88930.1|  predicted protein                                      258   1e-77    
ref|XP_002889260.1|  phosphatase 2C family protein                      260   1e-77    
emb|CDY15466.1|  BnaA08g27500D                                          258   1e-77    
emb|CDY21964.1|  BnaC09g00700D                                          258   1e-77    
gb|KHN13836.1|  Hypothetical protein glysoja_016120                     258   1e-77    
ref|XP_010435503.1|  PREDICTED: probable protein phosphatase 2C 74      259   1e-77    
ref|XP_006416840.1|  hypothetical protein EUTSA_v10007474mg             259   2e-77    
gb|AFW83059.1|  putative protein phosphatase 2C family protein          259   2e-77    
gb|EPS62214.1|  hypothetical protein M569_12579                         256   2e-77    
ref|XP_002264900.2|  PREDICTED: probable protein phosphatase 2C 65      258   2e-77    
ref|NP_178081.2|  putative protein phosphatase 2C 18                    260   2e-77    
ref|NP_171856.4|  putative protein phosphatase 2C 1                     259   2e-77    
emb|CAN65584.1|  hypothetical protein VITISV_019794                     258   2e-77    
emb|CDY48559.1|  BnaA09g01550D                                          258   2e-77    
ref|XP_009149058.1|  PREDICTED: probable protein phosphatase 2C 6       259   2e-77    
ref|XP_010264518.1|  PREDICTED: probable protein phosphatase 2C 6...    258   2e-77    
ref|NP_001147784.1|  LOC100281394                                       259   2e-77    
emb|CDY35072.1|  BnaA06g10820D                                          259   3e-77    
ref|XP_006352576.1|  PREDICTED: probable protein phosphatase 2C 6...    261   3e-77    
ref|XP_003627112.1|  Protein phosphatase 2c                             255   3e-77    
ref|XP_002458047.1|  hypothetical protein SORBIDRAFT_03g026120          258   3e-77    
ref|XP_010264516.1|  PREDICTED: probable protein phosphatase 2C 6...    258   3e-77    
gb|KDP22816.1|  hypothetical protein JCGZ_00403                         256   3e-77    
ref|XP_009384412.1|  PREDICTED: probable protein phosphatase 2C 34      254   5e-77    
ref|XP_002440955.1|  hypothetical protein SORBIDRAFT_09g017821          254   5e-77    
ref|XP_003576070.2|  PREDICTED: probable protein phosphatase 2C 75      257   5e-77    
ref|NP_001150759.1|  LOC100284392                                       257   5e-77    
ref|XP_003568623.1|  PREDICTED: probable protein phosphatase 2C 48      254   5e-77    
ref|XP_009793154.1|  PREDICTED: probable protein phosphatase 2C 6       259   6e-77    
ref|XP_003552650.1|  PREDICTED: probable protein phosphatase 2C 3...    257   6e-77    
ref|XP_008668080.1|  PREDICTED: LOC100284392 isoform X1                 256   7e-77    
ref|XP_009418745.1|  PREDICTED: probable protein phosphatase 2C 64      258   7e-77    
emb|CDY37649.1|  BnaC04g29910D                                          256   8e-77    
ref|XP_002453807.1|  hypothetical protein SORBIDRAFT_04g018090          258   9e-77    
ref|XP_007026551.1|  Phosphatase 2C family protein, putative            258   1e-76    
ref|XP_011095082.1|  PREDICTED: probable protein phosphatase 2C 65      256   1e-76    
ref|XP_010459160.1|  PREDICTED: probable protein phosphatase 2C 6       258   1e-76    
ref|XP_008679738.1|  PREDICTED: probable protein phosphatase 2C 1...    258   1e-76    
ref|XP_004494566.1|  PREDICTED: probable protein phosphatase 2C 7...    254   1e-76    
emb|CDY63003.1|  BnaAnng18490D                                          256   1e-76    
ref|XP_006286743.1|  hypothetical protein CARUB_v10003011mg             254   1e-76    
emb|CDY49740.1|  BnaA02g19320D                                          270   1e-76    
ref|XP_002526696.1|  protein phosphatase-2c, putative                   256   1e-76    
ref|XP_009124235.1|  PREDICTED: probable protein phosphatase 2C 74      255   2e-76    
gb|EEE68422.1|  hypothetical protein OsJ_26787                          255   2e-76    
gb|EAY82001.1|  hypothetical protein OsI_37184                          263   2e-76    
ref|XP_010524855.1|  PREDICTED: probable protein phosphatase 2C 7...    251   2e-76    
ref|XP_003554628.1|  PREDICTED: probable protein phosphatase 2C 7...    253   3e-76    
ref|XP_010472827.1|  PREDICTED: probable protein phosphatase 2C 18      256   3e-76    
ref|NP_001067763.2|  Os11g0417400                                       255   3e-76    
ref|XP_010257126.1|  PREDICTED: probable protein phosphatase 2C 73      256   3e-76    
ref|XP_007144971.1|  hypothetical protein PHAVU_007G198700g             253   3e-76    
ref|XP_009128378.1|  PREDICTED: probable protein phosphatase 2C 1...    253   4e-76    
ref|XP_006662878.1|  PREDICTED: probable protein phosphatase 2C 7...    254   4e-76    
ref|XP_008775900.1|  PREDICTED: probable protein phosphatase 2C 34      252   4e-76    
ref|XP_007163346.1|  hypothetical protein PHAVU_001G227100g             252   4e-76    
ref|XP_006855364.1|  hypothetical protein AMTR_s00057p00118530          253   5e-76    
ref|XP_004148601.1|  PREDICTED: probable protein phosphatase 2C 6...    254   5e-76    
ref|XP_010429862.1|  PREDICTED: probable protein phosphatase 2C 1...    256   6e-76    
ref|XP_010524853.1|  PREDICTED: probable protein phosphatase 2C 7...    251   7e-76    
ref|XP_009411656.1|  PREDICTED: probable protein phosphatase 2C 73      251   7e-76    
gb|KHN36617.1|  Hypothetical protein glysoja_001348                     252   1e-75    
ref|XP_009111151.1|  PREDICTED: probable protein phosphatase 2C 1       254   1e-75    
gb|AFK36323.1|  unknown                                                 253   1e-75    
ref|XP_004497423.1|  PREDICTED: probable protein phosphatase 2C 3...    250   2e-75    
ref|NP_001046835.1|  Os02g0471500                                       255   2e-75    
gb|EAY93570.1|  hypothetical protein OsI_15356                          249   2e-75    
ref|XP_004492043.1|  PREDICTED: probable protein phosphatase 2C 3...    253   2e-75    
ref|XP_010537844.1|  PREDICTED: probable protein phosphatase 2C 6       254   2e-75    
dbj|BAB84697.1|  protein phosphatase 2C                                 249   2e-75    
ref|XP_006346061.1|  PREDICTED: probable protein phosphatase 2C 6...    254   3e-75    
ref|XP_004243998.1|  PREDICTED: probable protein phosphatase 2C 6       254   4e-75    
gb|ACN27728.1|  unknown                                                 250   4e-75    
ref|XP_009125400.1|  PREDICTED: probable protein phosphatase 2C 6...    249   5e-75    
ref|XP_007205060.1|  hypothetical protein PRUPE_ppa004458mg             254   5e-75    
ref|XP_010486022.1|  PREDICTED: probable protein phosphatase 2C 3...    249   5e-75    
ref|XP_010546744.1|  PREDICTED: probable protein phosphatase 2C 73      249   5e-75    
ref|XP_002884522.1|  hypothetical protein ARALYDRAFT_477856             249   5e-75    
ref|XP_010674092.1|  PREDICTED: probable protein phosphatase 2C 34      249   5e-75    
ref|XP_002872251.1|  hypothetical protein ARALYDRAFT_489539             249   6e-75    
gb|AGV54512.1|  protein phosphatase 2C 73-like protein                  249   6e-75    
ref|XP_010486021.1|  PREDICTED: probable protein phosphatase 2C 3...    250   7e-75    
dbj|BAC43045.1|  putative protein phosphatase 2C                        249   9e-75    
dbj|BAJ89888.1|  predicted protein                                      248   1e-74    
ref|NP_568503.1|  putative protein phosphatase 2C 73                    249   1e-74    
dbj|BAF01792.1|  protein phosphatase 2C like protein                    249   1e-74    
ref|XP_009124867.1|  PREDICTED: probable protein phosphatase 2C 34      248   1e-74    
gb|AAM64353.1|  protein phosphatase-like                                249   1e-74    



>ref|XP_009600775.1| PREDICTED: probable protein phosphatase 2C 72 [Nicotiana tomentosiformis]
Length=341

 Score =   440 bits (1131),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 228/336 (68%), Positives = 269/336 (80%), Gaps = 9/336 (3%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD-----CNGVEVIASAFSHPGSKGINQDAAILYQ  195
             MGICIS AS EIH  DYG EN+VH+ D      NG + I S +S  GSKG+NQD+AILYQ
Sbjct  1     MGICISTASFEIHAIDYGHENLVHYEDNNNNGANGYQQIGSVYSQQGSKGLNQDSAILYQ  60

Query  196   GYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTT  375
             GYG E+G F G+FDGHG+NG  VSKLV N LPSL LK    LPKI +     K  D ++ 
Sbjct  61    GYGVENGVFSGVFDGHGENGQIVSKLVMNKLPSLLLKHILSLPKITSPKQKVKEVD-ESV  119

Query  376   ENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVL  555
             +NK F KWKEAC+S+FK++DK IK +EKLD   SG+TAV+AIRQD+DL++ANLGDSRAVL
Sbjct  120   KNKKFNKWKEACLSSFKVVDKDIKSLEKLDFSCSGTTAVVAIRQDDDLIIANLGDSRAVL  179

Query  556   GRKTDNGV-KAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAM  732
             GRKTD G  +A+QLTTDLKPS+P EAERIR C GRV+AL++EPHIQRVWLPNED PGLAM
Sbjct  180   GRKTDEGTTEAVQLTTDLKPSLPSEAERIRNCGGRVLALEKEPHIQRVWLPNEDAPGLAM  239

Query  733   SRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGe  912
             SRAFGDFMLK +GIIS P+VSYH+LSPND FLVLA+DGVWDVLSND+V+S VCS  +   
Sbjct  240   SRAFGDFMLKNYGIISRPDVSYHHLSPNDQFLVLASDGVWDVLSNDQVVSIVCSTND--G  297

Query  913   emaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
               AAKAVVEA++DAWK +FPNS+RDDCTAICLF Q+
Sbjct  298   SAAAKAVVEASIDAWKMKFPNSKRDDCTAICLFFQQ  333



>ref|XP_006355322.1| PREDICTED: probable protein phosphatase 2C 72-like [Solanum tuberosum]
Length=336

 Score =   433 bits (1113),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 268/338 (79%), Gaps = 11/338 (3%)
 Frame = +1

Query  31    MGIC-----ISKASSEIHDADYGQENVVHFGDCN---GVEVIASAFSHPGSKGINQDAAI  186
             MGIC     IS  S EI   D+G ENVVH+ D N     +VI S FS  G+KGINQD+AI
Sbjct  1     MGICGLVSCISSTSFEIQPVDFGNENVVHYDDNNINGNQQVIGSVFSQQGNKGINQDSAI  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             LYQGYG E+G F G+FDGHGKNG  VSK V N LPSL LK    LPKI +     KL D 
Sbjct  61    LYQGYGVENGVFGGVFDGHGKNGQVVSKFVMNKLPSLLLKYILSLPKITSPKQNVKLVDE  120

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSR  546
             ++ +NK+F KWKEAC+S+FK+MDK IK +EKLDC  SG+T V+AIRQD+DL++ANLGDSR
Sbjct  121   ESMKNKNFNKWKEACLSSFKVMDKDIKSLEKLDCSCSGTTTVVAIRQDDDLIIANLGDSR  180

Query  547   AVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             A+LGRKT+ G ++A+QLTTDLKPS+P EAERIR C+GRV+ALKEEPHIQRVWLP+ED PG
Sbjct  181   AILGRKTEEGIIEAVQLTTDLKPSLPSEAERIRNCDGRVLALKEEPHIQRVWLPHEDVPG  240

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDFMLK +GIIS P+VSYH++SPND FLVLATDGVWDVLSND+V+S VC+   
Sbjct  241   LAMSRAFGDFMLKNYGIISKPDVSYHHISPNDQFLVLATDGVWDVLSNDQVISIVCATNN  300

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
                  AA+AVV+A++DAWK++FPNS+RDD T ICLFLQ
Sbjct  301   A--AAAAEAVVQASLDAWKQKFPNSKRDDSTVICLFLQ  336



>ref|XP_009786454.1| PREDICTED: probable protein phosphatase 2C 72 [Nicotiana sylvestris]
Length=334

 Score =   429 bits (1102),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 269/338 (80%), Gaps = 13/338 (4%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCNGV-------EVIASAFSHPGSKGINQDAAIL  189
             MGICIS AS EIH  DYG EN+VH+ D N         +VI S +S  G KG+NQD+AIL
Sbjct  1     MGICISTASFEIHAIDYGHENLVHYEDNNNNNGANGNQQVIGSVYSQQGGKGLNQDSAIL  60

Query  190   YQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRA-KLNTNKLDDG  366
             YQGYG E+G F G+FDGHG+NG  VSKLV N LPSL LK    LPKI + K N  ++D+ 
Sbjct  61    YQGYGVENGVFSGVFDGHGENGQIVSKLVMNKLPSLLLKHILSLPKITSPKQNVKEVDE-  119

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSR  546
              + +NK+F KWKEAC+S+FK++DK IK +EKLD   SG+TAV+AIRQD+DL++ANLGDSR
Sbjct  120   -SVKNKNFNKWKEACLSSFKVVDKDIKSLEKLDFSCSGTTAVVAIRQDDDLIIANLGDSR  178

Query  547   AVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             AVLGRKTD G ++A+QLTTDLKPS+P EAERIR C GRV+AL++E HIQRVWLP ED PG
Sbjct  179   AVLGRKTDEGTIEAVQLTTDLKPSLPSEAERIRNCGGRVLALEKEAHIQRVWLPYEDAPG  238

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDFMLK +GIIS P+VSYH+LSPND FLVLA+DGVWDVLSND+V+S VCS  +
Sbjct  239   LAMSRAFGDFMLKNYGIISRPDVSYHHLSPNDQFLVLASDGVWDVLSNDQVVSIVCSTND  298

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
                   AKA+VEA++DAWK +FPNS+RDD TAICLFLQ
Sbjct  299   --GSTVAKALVEASIDAWKMKFPNSKRDDSTAICLFLQ  334



>ref|XP_009616668.1| PREDICTED: probable protein phosphatase 2C 72 [Nicotiana tomentosiformis]
Length=338

 Score =   422 bits (1084),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 270/334 (81%), Gaps = 8/334 (2%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCN--GVEVIASAFSHPGSKGINQDAAILYQGYG  204
             MGICIS  S EIH  +YG  N+VH+ D N  G + I S +S  G KG+NQD+AILYQGYG
Sbjct  1     MGICISSESFEIHAINYGHANLVHYEDNNNNGYQQIGSVYSQQGCKGLNQDSAILYQGYG  60

Query  205   DESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRA-KLNTNKLDDGDTTEN  381
              E+G F G+FDGHG+NG  VSKLV N LPSL LK    LPKI + K N  ++D+  + +N
Sbjct  61    VENGVFSGVFDGHGENGQIVSKLVMNKLPSLLLKHILSLPKITSPKQNVKEVDE--SAKN  118

Query  382   KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGR  561
             K+F KWKEA +S+FK++DK+IK +EKLDC  SG+TAV+AIRQD+DL++ANLGDSRAVLGR
Sbjct  119   KNFNKWKEAFLSSFKVVDKEIKCLEKLDCSCSGTTAVVAIRQDDDLIIANLGDSRAVLGR  178

Query  562   KTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSR  738
             KT+ G ++ + LTTDLKPS+P EAERIR C GRV+AL++EPHIQRVWLPNED PGLAMSR
Sbjct  179   KTEEGTIEPVPLTTDLKPSLPSEAERIRNCGGRVLALEKEPHIQRVWLPNEDAPGLAMSR  238

Query  739   AFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeem  918
             AFGDFMLK +GIIS P+V+YH+LS ND FL LATDGVWDVLSND+V+S VCS  +     
Sbjct  239   AFGDFMLKNYGIISRPDVTYHHLSSNDQFLFLATDGVWDVLSNDQVVSIVCSTND--GAA  296

Query  919   aakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             AAKAVVEA++DAWK++FPN++RDDCTAICLFLQ+
Sbjct  297   AAKAVVEASIDAWKQKFPNTKRDDCTAICLFLQQ  330



>ref|XP_004245116.1| PREDICTED: probable protein phosphatase 2C 72 [Solanum lycopersicum]
Length=336

 Score =   422 bits (1084),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 221/338 (65%), Positives = 268/338 (79%), Gaps = 11/338 (3%)
 Frame = +1

Query  31    MGIC-----ISKASSEIHDADYGQENVVHFGDCNGVE---VIASAFSHPGSKGINQDAAI  186
             MGIC     IS  S EI   D+G ENVVH+ D N  E   VI S FS  G+KGINQD+AI
Sbjct  1     MGICGLVSCISSTSFEIQPVDFGNENVVHYDDNNINENQCVIGSVFSQQGNKGINQDSAI  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             LYQGYG E+G F G+FDGHGKNG  VSK V N LPSL LK    LPKI +     KL D 
Sbjct  61    LYQGYGVENGVFGGVFDGHGKNGQVVSKFVMNKLPSLLLKYILSLPKITSPKQNVKLVDE  120

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSR  546
             ++ ++K+F KWK+AC+S+FK+MD+ IK +EKLDC  SG+TAV+AIRQD+DL++ANLGDSR
Sbjct  121   ESVKSKNFNKWKDACLSSFKVMDRDIKSLEKLDCSCSGTTAVVAIRQDDDLIIANLGDSR  180

Query  547   AVLGRKTDNGV-KAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             AVLGRKT+ GV +A+QLTTDLKP +P EAERIR C+GRV+ALKEEPHIQRVWLP+ED PG
Sbjct  181   AVLGRKTEEGVIEAVQLTTDLKPGLPSEAERIRNCDGRVLALKEEPHIQRVWLPHEDVPG  240

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDFMLK +G+IS P+VSYH++S ND F+VLATDGVWDVLSND+V+S VC+A  
Sbjct  241   LAMSRAFGDFMLKNYGVISKPDVSYHHISQNDQFVVLATDGVWDVLSNDQVVSIVCAANN  300

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
                  AA+AVV+A++DAW+++FPNS+RDD T ICLFLQ
Sbjct  301   A--ASAAEAVVQASLDAWEQKFPNSKRDDSTVICLFLQ  336



>ref|XP_002276954.2| PREDICTED: probable protein phosphatase 2C 72 [Vitis vinifera]
Length=365

 Score =   422 bits (1085),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 221/344 (64%), Positives = 259/344 (75%), Gaps = 11/344 (3%)
 Frame = +1

Query  16    IISWEMGICISKASSEIHDADYGQENVVHFGDCN---GVEVIASAFSHPGSKGINQDAAI  186
             ++S EMGICIS  SSEI D+  G EN+V F D     G++ + S  S PGSKG+NQDAAI
Sbjct  12    VLSAEMGICISTVSSEIQDSGDGHENMVFFEDSTASIGIQRLGSLHSQPGSKGLNQDAAI  71

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD--  360
             L+QGYG E G FCG+FDGHGKNGH VSK+VRNHLPSL L Q   L K    +    L   
Sbjct  72    LHQGYGMEDGAFCGVFDGHGKNGHIVSKIVRNHLPSLLLNQKNALLKANTAMKGEDLHTQ  131

Query  361   ----DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVA  528
                 DG    NK F KW+EACV AFK+MDK+IK  E LDC  SG+TAV+ ++Q +DLV+A
Sbjct  132   KERRDGMVMPNKIFRKWQEACVGAFKVMDKEIKLQEDLDCSCSGTTAVVIVKQGDDLVIA  191

Query  529   NLGDSRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPN  708
             NLGDSRAVLG  T+NGV A+QLTTDLKP +P EA+RIRKCNGRVI+LKEEPHIQRVWLPN
Sbjct  192   NLGDSRAVLGTITENGVTAVQLTTDLKPGLPMEADRIRKCNGRVISLKEEPHIQRVWLPN  251

Query  709   EDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTV  888
             ED+PGLAMSRAFGDF+LK HGII+ P++SY  L+ ND FLVLATDGVWDVLSN +V   V
Sbjct  252   EDSPGLAMSRAFGDFLLKNHGIIAIPDISYRRLASNDQFLVLATDGVWDVLSNSQVAGIV  311

Query  889   CSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              SA     E AAKAVV+AA  AWK +FP+S+ DDCT +CLFLQK
Sbjct  312   WSAESE--EEAAKAVVDAATAAWKHKFPSSKVDDCTVVCLFLQK  353



>ref|XP_004245370.1| PREDICTED: probable protein phosphatase 2C 72 [Solanum lycopersicum]
Length=336

 Score =   420 bits (1080),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 267/338 (79%), Gaps = 11/338 (3%)
 Frame = +1

Query  31    MGIC-----ISKASSEIHDADYGQENVVHFGDCNGVE---VIASAFSHPGSKGINQDAAI  186
             MGIC     IS  S EI   D+G ENVVH+ D N  E   VI S FS  G+KGINQD+AI
Sbjct  1     MGICGLVSCISSTSFEIQPVDFGNENVVHYDDNNINENQCVIGSVFSQQGNKGINQDSAI  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             LYQGYG E+G F G+FDGHGKNG  VSK V N LPSL LK    LPKI +     K  D 
Sbjct  61    LYQGYGVENGVFGGVFDGHGKNGQVVSKFVMNKLPSLLLKCILSLPKITSPKQNVKHVDE  120

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSR  546
             +  +NK+F KWK+AC+++FK+MDK IK +EKLDC  SG+TAV+AIRQD+DL++ANLGDSR
Sbjct  121   ELVKNKNFDKWKDACLNSFKVMDKDIKSLEKLDCSCSGTTAVVAIRQDDDLIIANLGDSR  180

Query  547   AVLGRKTDNGV-KAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             AVLGRKT+ GV +A+QLTTDLKPS+P EAERIR C+GRV+ALKEE HIQRVWLP+ED PG
Sbjct  181   AVLGRKTEEGVIEAVQLTTDLKPSLPSEAERIRNCDGRVLALKEELHIQRVWLPHEDVPG  240

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDFMLK +GIIS P+VSYH++SPND FLVLATDGVWDVLSND+V+S VC+A  
Sbjct  241   LAMSRAFGDFMLKNYGIISKPDVSYHHISPNDQFLVLATDGVWDVLSNDQVVSIVCAANN  300

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
                  AA+AVV+A++DAW+++FPNS+RDD T ICLFLQ
Sbjct  301   A--AAAAEAVVQASLDAWEQKFPNSKRDDSTVICLFLQ  336



>ref|XP_007012238.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOY29857.1| Phosphatase 2C family protein [Theobroma cacao]
Length=348

 Score =   412 bits (1060),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 209/339 (62%), Positives = 257/339 (76%), Gaps = 11/339 (3%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGICIS ASSEIH+A+  QENVV+  +     G++ + S +S  GSKG+NQDAAILYQ Y
Sbjct  1     MGICISVASSEIHEAEDCQENVVYLAENIASIGIQRLGSLYSRQGSKGLNQDAAILYQDY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDD------  363
             G E G  CG+FDGHGKNGH VS  VRN LPSL L Q   L  ++   +     D      
Sbjct  61    GMEGGALCGVFDGHGKNGHIVSNKVRNRLPSLLLSQKNALATMKTSADHKNFQDQVADLK  120

Query  364   GDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDS  543
               +  +K  LKW+EAC+SAFK+MDK+IK  E LDC TSG+TAV+ +RQ EDL++ANLGDS
Sbjct  121   SGSVLSKDLLKWQEACISAFKVMDKEIKLQENLDCSTSGTTAVVVVRQGEDLMIANLGDS  180

Query  544   RAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             RA+LG  T NG+KA+QL+TDLKP +P EAERIR CNGRV+ALKEE HIQRVWLP+ED+PG
Sbjct  181   RAILGTTTANGIKAVQLSTDLKPGLPSEAERIRSCNGRVLALKEESHIQRVWLPHEDSPG  240

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDF+LK HGII+ P+V YH+L+PND F+VLATDGVWDVL+N +V S V  A  
Sbjct  241   LAMSRAFGDFLLKNHGIIAIPDVFYHHLTPNDQFIVLATDGVWDVLNNSQVASIVMEA--  298

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
               E+ AA+AVVEAA  +WK++FP+S+ DDCT +CLFLQK
Sbjct  299   ESEQAAARAVVEAATASWKKKFPSSKVDDCTVVCLFLQK  337



>ref|XP_002516470.1| protein phosphatase-2c, putative [Ricinus communis]
 gb|EEF45811.1| protein phosphatase-2c, putative [Ricinus communis]
Length=345

 Score =   410 bits (1053),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 217/335 (65%), Positives = 257/335 (77%), Gaps = 8/335 (2%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGICIS ASSEIH A+   EN V+ G+    NGV+ + S +S  GSK +NQDAAIL+QGY
Sbjct  1     MGICISSASSEIHQAEDEHENGVYLGENIAFNGVDGLGSLYSKEGSKKLNQDAAILHQGY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPK--IRAKLNTNKLDDGDTT  375
             G+E G FCG+FDGHGKNGH VSK+VRN LPSL L Q   L K  I A  NT K++DG   
Sbjct  61    GEEDGAFCGVFDGHGKNGHIVSKIVRNMLPSLLLSQKNALAKTKIIADGNTQKIEDG-LF  119

Query  376   ENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVL  555
              +K+F  W EAC+SAFK MDK++K  E LD   SG+TAV+ +RQ EDLV+ANLGDSRA+L
Sbjct  120   PSKNFHLWNEACISAFKAMDKEVKLQESLDFSCSGTTAVVVVRQGEDLVIANLGDSRAIL  179

Query  556   GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMS  735
             G   DNG+ A+QLT DLKPSVP EA RIRKCNGRV+ALKEEPHIQRVWLP+ED PGLAMS
Sbjct  180   GTIKDNGIMAVQLTNDLKPSVPSEAARIRKCNGRVLALKEEPHIQRVWLPHEDLPGLAMS  239

Query  736   RAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGee  915
             RAFGDF+LK HGII+ PE+SYH L+ +D F+VLA+DGVWDVLSN+EV S V +A    E 
Sbjct  240   RAFGDFLLKTHGIIALPEISYHRLTSDDQFIVLASDGVWDVLSNNEVASIVWAADS--ET  297

Query  916   maakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              AAKAVVEAA   WK ++P S+ DDCTA+CLFL K
Sbjct  298   AAAKAVVEAATATWKTKYPFSKVDDCTAVCLFLHK  332



>ref|XP_009794190.1| PREDICTED: probable protein phosphatase 2C 72 [Nicotiana sylvestris]
Length=342

 Score =   410 bits (1053),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 222/338 (66%), Positives = 273/338 (81%), Gaps = 12/338 (4%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD------CNGVEVIASAFSHPGSKGINQDAAILY  192
             MGICIS  S EIH  DYG EN+VH+ D       N  + I S ++  GSKG+NQD+AILY
Sbjct  1     MGICISSESFEIHAIDYGHENLVHYEDNNNNNGANCCQQIGSVYTQQGSKGLNQDSAILY  60

Query  193   QGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRA-KLNTNKLDDGD  369
             QG+  E+G F G+FDGHGKNG  VSKL+ N LPSL LK    LPKI + K N  ++D+  
Sbjct  61    QGFRVENGVFGGVFDGHGKNGQTVSKLIMNKLPSLLLKHILSLPKITSPKQNVKEVDE--  118

Query  370   TTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRA  549
             + +NK+F KWK+AC+S+FK++DK+IK +EKLDC  SG+TAV+ IRQD+DLV+ANLGDSRA
Sbjct  119   SVKNKNFNKWKKACLSSFKMVDKEIKSLEKLDCSCSGTTAVVVIRQDDDLVIANLGDSRA  178

Query  550   VLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGL  726
             +LGRKTD G ++A+QLTTDLKPS+P EAERIRKC GRV+AL++E HIQRVWLP+ED PGL
Sbjct  179   LLGRKTDEGTIEAVQLTTDLKPSLPSEAERIRKCGGRVLALEKEAHIQRVWLPHEDAPGL  238

Query  727   AMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEY  906
             AMSRAFGDFMLK +GIIS P+VSYH+LS ND FLVLATDGVWDVLSND+V+S VCS  + 
Sbjct  239   AMSRAFGDFMLKNYGIISRPDVSYHHLSSNDQFLVLATDGVWDVLSNDQVVSIVCSTND-  297

Query  907   GeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
                 AAKAVVEA++DAWK++FPN++RDDCTAICLFLQ+
Sbjct  298   -GAAAAKAVVEASIDAWKQKFPNTKRDDCTAICLFLQQ  334



>ref|XP_002324150.2| hypothetical protein POPTR_0018s04620g [Populus trichocarpa]
 gb|EEF02715.2| hypothetical protein POPTR_0018s04620g [Populus trichocarpa]
Length=342

 Score =   408 bits (1048),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 213/336 (63%), Positives = 256/336 (76%), Gaps = 9/336 (3%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDC---NGVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGICIS ASSEIH AD G ENV+H  +    +G+E + S +S  GSKG+NQDAA+L+QGY
Sbjct  1     MGICISSASSEIHQADDGLENVMHVQETIVSHGIEKLGSLYSKEGSKGVNQDAAVLHQGY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRA--KLNTNKLDDGDTT  375
             G E G FCG+FDGHGKNGH VSK+VRN LPSL L Q     K++     N  K DDG   
Sbjct  61    GMEHGAFCGVFDGHGKNGHIVSKIVRNTLPSLLLNQKNASAKMKTVRDHNNEKADDG-LA  119

Query  376   ENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVL  555
              ++ F KWKEAC+SAFK MDK+IK    LDC  SG+TAV+ +RQ +DL++ANLGDSRAVL
Sbjct  120   PSEGFHKWKEACISAFKEMDKEIKIQGSLDCSCSGATAVVVLRQGDDLIIANLGDSRAVL  179

Query  556   GRKTDN-GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAM  732
             GR     G+  +QLTTDLKP VP EAERIRKCNGRV+ALKEEPHI RVWLP+ED+PGLAM
Sbjct  180   GRINHQIGIMPVQLTTDLKPGVPGEAERIRKCNGRVLALKEEPHIHRVWLPHEDSPGLAM  239

Query  733   SRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGe  912
             SRAFGDF+LK HGIIS P++SYH ++  D F+VLA+DGVWDVLSN EV+S + +A    E
Sbjct  240   SRAFGDFILKNHGIISLPDISYHRVTSKDQFVVLASDGVWDVLSNKEVVSIISTADS--E  297

Query  913   emaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
               AAK+VVEAA  AWKR+F +S+ DDCT +CLFLQK
Sbjct  298   LAAAKSVVEAATAAWKRKFTSSKVDDCTVVCLFLQK  333



>ref|XP_010047315.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 72 [Eucalyptus grandis]
Length=333

 Score =   405 bits (1041),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 205/331 (62%), Positives = 257/331 (78%), Gaps = 4/331 (1%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCNG-VEVIASAFSHPGSKGINQDAAILYQGYGD  207
             MGIC+S   SEIHD +  QEN V   + NG  +   S  S  GSKG+NQDAAILYQGYG 
Sbjct  1     MGICMSSVPSEIHDTEDVQENAVFIDETNGKTKRNGSVHSRTGSKGLNQDAAILYQGYGK  60

Query  208   ESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS  387
             + G FCG+FDGHGKNGH VSKLVRNHLP L L Q   L K++     +  D G +  ++ 
Sbjct  61    DDGVFCGVFDGHGKNGHLVSKLVRNHLPLLVLNQRNSLAKVKVTAVQDDCDQG-SVPSRD  119

Query  388   FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKT  567
              L+W++A +SAFK+MDK+IK  E LDC TSGSTAV+ IRQ EDLV+ANLGDSRAVLG  T
Sbjct  120   LLEWRDAFISAFKVMDKEIKLQEGLDCSTSGSTAVVVIRQGEDLVIANLGDSRAVLGTLT  179

Query  568   DNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFG  747
             ++G++ +QLTTDLKP+VP EA+RIRKC GRV+ALKEEPHIQR WLP++D PGLAMSRAFG
Sbjct  180   EDGLRTVQLTTDLKPNVPSEADRIRKCKGRVLALKEEPHIQRXWLPHQDMPGLAMSRAFG  239

Query  748   DFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaak  927
             D++LK HG+I+ P++SYH ++P D F+VLATDGVWDVL+NDEV + V SA +  EE AAK
Sbjct  240   DYLLKDHGVIAIPDISYHRITPKDQFIVLATDGVWDVLNNDEVAAVVRSAKD--EEEAAK  297

Query  928   avveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             A+VEAA+ +WK++FP+++ DDC+A CLFL K
Sbjct  298   ALVEAAIASWKKKFPSAKVDDCSASCLFLHK  328



>emb|CDP08235.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   405 bits (1041),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 212/334 (63%), Positives = 258/334 (77%), Gaps = 6/334 (2%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCNGVE----VIASAFSHPGSKGINQDAAILYQG  198
             MG CIS ASSEI +A+  QENVV+  D N  +     + S  SH GSKG+NQDAAILYQG
Sbjct  1     MGSCISTASSEILNAESAQENVVYHEDTNYSDESQVRVGSIHSHQGSKGLNQDAAILYQG  60

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTE  378
             YG E G FCG+FDGHG  GH VSK+VRN LPSL L Q   + K+ +    N+  +G+   
Sbjct  61    YGMEEGAFCGVFDGHGYYGHKVSKMVRNRLPSLLLNQMNAMAKVISPPKYNEKVNGEVQF  120

Query  379   NKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG  558
             +K F KWK+A VSAFK+MDK+IK +E +DC  SG+TAV+ +RQ + L+V NLGDSRA++G
Sbjct  121   SKRFNKWKDAFVSAFKVMDKEIKLLENVDCSCSGTTAVVVVRQGDYLIVGNLGDSRAIVG  180

Query  559   RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSR  738
              K++NG+  +QLTTDLKP +P EA+RIRKCNGRV+ALKEEPH+QRVWLP +D+PGLAMSR
Sbjct  181   TKSENGIVPVQLTTDLKPGLPGEADRIRKCNGRVLALKEEPHVQRVWLPLDDSPGLAMSR  240

Query  739   AFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeem  918
             AFGDF LK HGII+ PEVSYH LS  D FLVLATDGVWDVLSND+V S V SA    EE 
Sbjct  241   AFGDFALKNHGIIAIPEVSYHQLSQKDQFLVLATDGVWDVLSNDQVTSLVSSAAS--EEA  298

Query  919   aakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             AAKAVV+A++ AWK++FPNS+RDDCT +CLFLQK
Sbjct  299   AAKAVVDASIAAWKQKFPNSKRDDCTVLCLFLQK  332



>ref|XP_011081705.1| PREDICTED: probable protein phosphatase 2C 72 [Sesamum indicum]
Length=340

 Score =   404 bits (1038),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 214/338 (63%), Positives = 259/338 (77%), Gaps = 11/338 (3%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFG-----DCNGVEVIASAFSHPGSKGINQDAAILYQ  195
             MGIC S +SS IHD  YG EN V++      + N  + I S +SH GSKG+NQD+AIL++
Sbjct  1     MGICASISSSVIHDDTYGHENAVYYRGTISLNANESQRIGSTYSHTGSKGLNQDSAILFE  60

Query  196   GYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQ----AKFLPKIRAKLNTNKLDD  363
             GYG E G F  +FDGHGKNGH VSK+VRN LPSL L Q    AK  P   +   + +L+ 
Sbjct  61    GYGIEDGAFGAVFDGHGKNGHIVSKIVRNRLPSLLLSQRNGIAKISPSGVSTKQSERLES  120

Query  364   GDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDS  543
               +  +K+FLKWKEACVSAFK+MDK+IK ++ LDC  SG+TA + ++Q EDLV+ANLGDS
Sbjct  121   DQSGPSKNFLKWKEACVSAFKVMDKEIKLLDSLDCSCSGTTAAVVVKQGEDLVIANLGDS  180

Query  544   RAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             RAVLG +T+NG++A+QLTTD KP V  EAERIRK  GRV ALKEEPHIQRVWLP +D+PG
Sbjct  181   RAVLGTRTENGIRAVQLTTDSKPGVTSEAERIRKFKGRVFALKEEPHIQRVWLPYDDSPG  240

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDF+LK HGII+ P+VSYH +SPND FLVLA+DGVWDVLSNDEV+S V     
Sbjct  241   LAMSRAFGDFVLKNHGIIAIPDVSYHCVSPNDQFLVLASDGVWDVLSNDEVVSIVSVVRS  300

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
               EE AAKAVV+AAV +WK +FPNS+RDDCT ICLFLQ
Sbjct  301   --EEAAAKAVVDAAVASWKHKFPNSKRDDCTVICLFLQ  336



>gb|KHG16709.1| hypothetical protein F383_04170 [Gossypium arboreum]
 gb|KHG17937.1| hypothetical protein F383_23434 [Gossypium arboreum]
Length=343

 Score =   404 bits (1037),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/340 (61%), Positives = 255/340 (75%), Gaps = 12/340 (4%)
 Frame = +1

Query  31    MGICISKASSEIHDAD-YGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQG  198
             MGICIS  SSEIH+AD    ENVV   +     G++ + S ++  GSKG+NQDAAILYQ 
Sbjct  1     MGICISVVSSEIHEADDCHHENVVFLAENISSLGIQGLGSLYTKQGSKGLNQDAAILYQD  60

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD------  360
             YG E G FCG+FDGHGKNGH VS +VRN LPSL L Q   L KIR   +           
Sbjct  61    YGIEGGAFCGVFDGHGKNGHLVSNMVRNRLPSLLLNQKNALEKIRTAADDKSFQHQVAKT  120

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
             D  +  NK FL W+EAC+ AFK++DK+I   E LDC TSG+TAV+ +RQ EDLV+ANLGD
Sbjct  121   DIKSIPNKDFLNWQEACIGAFKVLDKEIMLQENLDCSTSGTTAVVVVRQSEDLVIANLGD  180

Query  541   SRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             SRAVLG  T+NG+KA+QLTTDLKP +P EAERIR CNGRV+ALK EPHIQRVWLP+ED+P
Sbjct  181   SRAVLGTMTENGIKAVQLTTDLKPGLPNEAERIRNCNGRVLALKGEPHIQRVWLPHEDSP  240

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
             GLAMSRAFGDF+LK HGII+ P+V +H+L+P+D F+VLATDGVWDVL+N++V S V  A 
Sbjct  241   GLAMSRAFGDFLLKNHGIIAVPDVFHHHLTPDDQFIVLATDGVWDVLNNNQVASIVMEAG  300

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
                E+ AAKAVVEAA  +WK++FP+S+ DDCT +CLF  K
Sbjct  301   S--EQEAAKAVVEAATASWKKKFPSSKVDDCTVVCLFFHK  338



>ref|XP_011019530.1| PREDICTED: probable protein phosphatase 2C 72 [Populus euphratica]
Length=337

 Score =   403 bits (1035),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 209/336 (62%), Positives = 257/336 (76%), Gaps = 9/336 (3%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGIC+S ASSEIH AD G ENV+H  +    +G+E + S +S  GSKG+NQDAA+++QGY
Sbjct  1     MGICVSSASSEIHQADDGLENVMHVQEDIVSHGIEKLGSLYSKEGSKGVNQDAAVVHQGY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRA--KLNTNKLDDG-DT  372
             G E G FCG+FDGHGKNGH VS+ VRN LPSL L Q   L KI+     N  K D G   
Sbjct  61    GMEHGAFCGVFDGHGKNGHIVSRTVRNRLPSLLLNQKNALEKIKTVRDHNNEKTDGGLAP  120

Query  373   TENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAV  552
               ++SF KW+EAC+ AFK+MDK+IK  E LDC  SG+TAV+ +RQ EDL++ANLGDSRAV
Sbjct  121   LPSESFHKWREACICAFKVMDKEIKLQEGLDCSCSGTTAVVVVRQGEDLIIANLGDSRAV  180

Query  553   LGRKTDN-GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLA  729
             +GR  D  G+  +QLTTDLKP VP EA RIR+CNGRV+ALKEEPH+ RVWLP+ED+PGLA
Sbjct  181   MGRTNDQKGIMPVQLTTDLKPGVPSEARRIRQCNGRVLALKEEPHVHRVWLPHEDSPGLA  240

Query  730   MSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYG  909
             MSRAFGDF+LK HGII+ P++SYH ++  D F+VLA+DGVWDVLSN EV+S V +A    
Sbjct  241   MSRAFGDFLLKNHGIIALPDISYHRVTSKDQFIVLASDGVWDVLSNKEVVSIVSAADS--  298

Query  910   eemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             E+ AAKAVVEAA  AWKR+F +S+ DDCT +CLFLQ
Sbjct  299   EQAAAKAVVEAATAAWKRKFTSSKVDDCTVVCLFLQ  334



>ref|XP_002308579.1| hypothetical protein POPTR_0006s24880g [Populus trichocarpa]
 gb|ABK92447.1| unknown [Populus trichocarpa]
 gb|EEE92102.1| hypothetical protein POPTR_0006s24880g [Populus trichocarpa]
Length=337

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 211/336 (63%), Positives = 256/336 (76%), Gaps = 9/336 (3%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGICIS ASSEIH AD G ENV+H  +    +G+E   S +S  GSKG+NQDAA+++QGY
Sbjct  1     MGICISSASSEIHQADDGLENVMHVQEDIVSHGIEKRGSLYSKEGSKGVNQDAAVVHQGY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRA--KLNTNKLDDG-DT  372
             G E G FCG+FDGHGKNGH VS+ VRN LPSL L Q   L KI+     N  K D G   
Sbjct  61    GMEHGAFCGVFDGHGKNGHIVSRTVRNRLPSLLLNQKNALEKIKTVRDHNNEKADGGLAP  120

Query  373   TENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAV  552
               ++SF KWKEAC+ AFK+MDK+IK  E LDC  SG+TAV+ +RQ EDL++ANLGDSRAV
Sbjct  121   LPSESFHKWKEACICAFKVMDKEIKLQEGLDCSCSGTTAVVVVRQGEDLIIANLGDSRAV  180

Query  553   LGRKTDN-GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLA  729
             LGR  D  G+  +QLTTDLKP VP EA RIR+CNGRV+ALKEEPH+ RVWLP+ED+PGLA
Sbjct  181   LGRTNDQKGIMPVQLTTDLKPGVPSEARRIRQCNGRVLALKEEPHVHRVWLPHEDSPGLA  240

Query  730   MSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYG  909
             MSRAFGDF+LK HGII+ P++SYH ++  D F++LA+DGVWDVLSN EV+S V +A    
Sbjct  241   MSRAFGDFLLKNHGIIALPDISYHRVTSKDQFIILASDGVWDVLSNKEVVSIVSAADS--  298

Query  910   eemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             E+ AAKAVVEAA  AWKR+F +S+ DDCT +CLFLQ
Sbjct  299   EQAAAKAVVEAATAAWKRKFTSSKVDDCTVVCLFLQ  334



>ref|XP_011010711.1| PREDICTED: probable protein phosphatase 2C 72 [Populus euphratica]
Length=342

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 212/336 (63%), Positives = 254/336 (76%), Gaps = 9/336 (3%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGICIS ASSEIH  D G ENV+H       +G+E + S +S  GSKG+NQDAAIL+QGY
Sbjct  1     MGICISSASSEIHQVDDGLENVMHVQINIVSHGIEKLGSLYSKEGSKGVNQDAAILHQGY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRA--KLNTNKLDDGDTT  375
             G E G FCG+FDGHGKNGH VSK+VRN LPSL L Q     K++     N  K DDG   
Sbjct  61    GMEHGAFCGVFDGHGKNGHIVSKIVRNTLPSLLLNQKNASAKMKTVRDHNNEKADDG-LA  119

Query  376   ENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVL  555
               + F KWKEAC+SAFK MDK+IK    LDC  SGST V+ +RQ + L++ANLGDSRAVL
Sbjct  120   PCEGFHKWKEACISAFKEMDKEIKLQRSLDCSCSGSTGVVVLRQGDGLIIANLGDSRAVL  179

Query  556   GRKTD-NGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAM  732
             GR  D NG+  +QLTTDLKP VP EAERIRKCNGR++ALKEEPHI RVWLP+ED+PGLAM
Sbjct  180   GRINDQNGIMPVQLTTDLKPRVPSEAERIRKCNGRLLALKEEPHIHRVWLPHEDSPGLAM  239

Query  733   SRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGe  912
             SRAFGDF+LK HGIIS P++SYH ++  D F+VLA+DGVWDVLSN EV+S + +A    E
Sbjct  240   SRAFGDFLLKNHGIISLPDISYHRVTSKDQFVVLASDGVWDVLSNKEVVSIISTADS--E  297

Query  913   emaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              +AAK+VVEAA  AWKR+F +S+ DDCT +CLFL+K
Sbjct  298   LVAAKSVVEAATAAWKRKFTSSKVDDCTVVCLFLRK  333



>emb|CBI20616.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   400 bits (1028),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 212/333 (64%), Positives = 247/333 (74%), Gaps = 24/333 (7%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCN---GVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGICIS  SSEI D+  G EN+V F D     G++ + S  S PGSKG+NQDAAIL+QGY
Sbjct  1     MGICISTVSSEIQDSGDGHENMVFFEDSTASIGIQRLGSLHSQPGSKGLNQDAAILHQGY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTEN  381
             G E G FCG+FDGHGKNGH VSK+VRNHLPSL L Q   L K    +             
Sbjct  61    GMEDGAFCGVFDGHGKNGHIVSKIVRNHLPSLLLNQKNALLKANTAM-------------  107

Query  382   KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGR  561
                   KEACV AFK+MDK+IK  E LDC  SG+TAV+ ++Q +DLV+ANLGDSRAVLG 
Sbjct  108   ------KEACVGAFKVMDKEIKLQEDLDCSCSGTTAVVIVKQGDDLVIANLGDSRAVLGT  161

Query  562   KTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRA  741
              T+NGV A+QLTTDLKP +P EA+RIRKCNGRVI+LKEEPHIQRVWLPNED+PGLAMSRA
Sbjct  162   ITENGVTAVQLTTDLKPGLPMEADRIRKCNGRVISLKEEPHIQRVWLPNEDSPGLAMSRA  221

Query  742   FGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeema  921
             FGDF+LK HGII+ P++SY  L+ ND FLVLATDGVWDVLSN +V   V SA     E A
Sbjct  222   FGDFLLKNHGIIAIPDISYRRLASNDQFLVLATDGVWDVLSNSQVAGIVWSAESE--EEA  279

Query  922   akavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             AKAVV+AA  AWK +FP+S+ DDCT +CLFLQK
Sbjct  280   AKAVVDAATAAWKHKFPSSKVDDCTVVCLFLQK  312



>ref|XP_004245372.1| PREDICTED: probable protein phosphatase 2C 72 [Solanum lycopersicum]
Length=332

 Score =   398 bits (1022),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 210/335 (63%), Positives = 253/335 (76%), Gaps = 16/335 (5%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCNGVE---VIASAFSHPGSKGINQDAAILYQGY  201
             MGICIS  S EI    +G ENVVH+ D N  E   VI S FS  G+KGINQD+AILYQ Y
Sbjct  1     MGICISSESFEIQPVGFGNENVVHYDDNNINENQCVIGSVFSQQGNKGINQDSAILYQRY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKI-RAKLNTNKLDDGDTTE  378
             G E+G F G+FDGHG+NGH VSK V   LPSL LK    LPKI   K N  +        
Sbjct  61    GVENGVFGGVFDGHGENGHIVSKFVMTKLPSLLLKLTFSLPKIFSVKQNVMR--------  112

Query  379   NKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG  558
              ++F KWK+ C S+F +MDK IK +E LDC  SG+TAV+AIRQD+DLV+ANLGDSRAVLG
Sbjct  113   -RNFNKWKKVCWSSFMVMDKDIKSLENLDCSFSGTTAVVAIRQDDDLVIANLGDSRAVLG  171

Query  559   RKTDNGV-KAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMS  735
             RKT+ GV +A+QLTTDLKPS+  E ERIR+C GRV A KEEPHIQRV+LPNED PGLAM+
Sbjct  172   RKTEEGVIEAVQLTTDLKPSLTSEVERIRRCGGRVFARKEEPHIQRVYLPNEDVPGLAMT  231

Query  736   RAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGee  915
             R++GD MLKY GIIS P+VSYH+++PND F+VLATDGVWDVLSND+V+S VC+       
Sbjct  232   RSYGDLMLKYFGIISEPDVSYHHITPNDQFVVLATDGVWDVLSNDQVVSIVCATNN--AA  289

Query  916   maakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              AA+ VV+A++DAWK+RFPNS+RDD T ICL+LQ+
Sbjct  290   AAAETVVQASLDAWKQRFPNSKRDDSTVICLYLQQ  324



>ref|XP_006450797.1| hypothetical protein CICLE_v10010157mg [Citrus clementina]
 ref|XP_006475963.1| PREDICTED: probable protein phosphatase 2C 72-like [Citrus sinensis]
 gb|ESR64037.1| hypothetical protein CICLE_v10010157mg [Citrus clementina]
 gb|KDO80016.1| hypothetical protein CISIN_1g044967mg [Citrus sinensis]
Length=329

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/336 (63%), Positives = 256/336 (76%), Gaps = 14/336 (4%)
 Frame = +1

Query  31    MGICISKASSEIHD-ADYGQENVVHFGDCN----GVEVIASAFSHPGSKGINQDAAILYQ  195
             MGIC+S ASSEIHD  D GQENV+ F + N    GV+ + S +S  GSKG+NQDA IL Q
Sbjct  1     MGICVSTASSEIHDQVDNGQENVI-FVEGNIVSHGVKKLCSLYSKQGSKGLNQDAGILCQ  59

Query  196   GYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTT  375
             GYG E G+FCG+FDGHGK+GH VS+LVRN LPSL L Q   L     K N   +      
Sbjct  60    GYGTEDGEFCGVFDGHGKHGHVVSELVRNRLPSLILSQKNALSNSNVKANGEVM-----M  114

Query  376   ENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVL  555
              +  F KW+EACV AFK+MDK++K  E LDC  SG+TAV+ IRQ EDLV+ANLGDSRAVL
Sbjct  115   PSIDFYKWQEACVKAFKVMDKEVKLQENLDCFCSGTTAVVVIRQGEDLVIANLGDSRAVL  174

Query  556   GRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAM  732
             G  +DNG +KA+QLTTDLKPS+P EAERI++C GRV+ALKEEPHIQRVWLP+EDTPGLAM
Sbjct  175   GTVSDNGELKAVQLTTDLKPSLPSEAERIKQCRGRVLALKEEPHIQRVWLPHEDTPGLAM  234

Query  733   SRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGe  912
             SRAFGDF+LK HGII+ P+VSY  L+ ND F++LATDGV DVLS+++V + V  A    +
Sbjct  235   SRAFGDFLLKNHGIIAIPDVSYRRLTSNDQFILLATDGVLDVLSSNQVATIVWEADN--K  292

Query  913   emaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             + AA+ VVEAA  AWK++FP+S+ DDCT +CLFLQK
Sbjct  293   QEAARKVVEAANAAWKKKFPSSKMDDCTVVCLFLQK  328



>ref|XP_006355321.1| PREDICTED: probable protein phosphatase 2C 72-like [Solanum tuberosum]
Length=332

 Score =   395 bits (1014),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 209/334 (63%), Positives = 255/334 (76%), Gaps = 14/334 (4%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCN---GVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGICIS AS EI   D+G  NVV + D N     +VI S FS  G+KGINQD AILYQGY
Sbjct  1     MGICISSASFEIQPVDFGNGNVVLYEDYNINRYKQVIGSVFSEQGNKGINQDFAILYQGY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTEN  381
             G E+G F G+FDGHG+NG  VSK V N LPSL LK    LPKI + +N N +        
Sbjct  61    GVENGVFGGVFDGHGENGQIVSKFVMNKLPSLLLKLTFSLPKIFS-VNQNVM-------R  112

Query  382   KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGR  561
             ++F KWK AC  +F +MD+ I+ +E LD   SG+TAV+AIRQD+DLV+ANLGDSRAVLGR
Sbjct  113   RNFNKWKRACWGSFMVMDRNIQSLENLDSSFSGTTAVVAIRQDDDLVIANLGDSRAVLGR  172

Query  562   KTDNGV-KAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSR  738
             K + GV +A+QLTTDLKPS+  EAERIR+C GRV A +E+PHIQRV+LPNED PGLAM+R
Sbjct  173   KKEEGVIEAVQLTTDLKPSLTSEAERIRRCGGRVFARQEQPHIQRVYLPNEDVPGLAMTR  232

Query  739   AFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeem  918
             +FGDFMLKY GIIS P+VSYH+++PND F+VLATDGVWDVLSND+V+S VC+        
Sbjct  233   SFGDFMLKYLGIISEPDVSYHHITPNDQFVVLATDGVWDVLSNDQVVSIVCATNN--AAA  290

Query  919   aakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             AA+AVV+A++DAWK+RFPNS+RDD T ICLFLQ+
Sbjct  291   AAEAVVQASLDAWKQRFPNSKRDDSTVICLFLQQ  324



>gb|KDP34123.1| hypothetical protein JCGZ_07694 [Jatropha curcas]
Length=338

 Score =   393 bits (1009),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 255/332 (77%), Gaps = 4/332 (1%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCN-GVEVIASAFSHPGSKGINQDAAILYQGYGD  207
             MGICIS ASSEIH A+   E V  + + N   + + S +S  GSKG+NQD+AIL+QGYG 
Sbjct  1     MGICISSASSEIHQAEDSLEKVTVYIEENIAFQGLGSLYSKEGSKGLNQDSAILHQGYGA  60

Query  208   ESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNT-NKLDDGDTTENK  384
             E G FCG+FDGHGKNGH VSK+VRN LP L L Q   L K +  +++ N+  + D   + 
Sbjct  61    EGGAFCGVFDGHGKNGHIVSKIVRNGLPLLLLNQRNVLAKTKTVVDSKNEKVEDDLVPSN  120

Query  385   SFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK  564
             +F  WKEAC++AFK+MDK++K  E LDC  SG+TAVI +RQ +DL +ANLGDSRAVLG  
Sbjct  121   NFYIWKEACINAFKVMDKEVKLQENLDCSCSGTTAVIVMRQGKDLAIANLGDSRAVLGTI  180

Query  565   TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAF  744
              +N +  +QLTTDLKP+VP EA+RIRKCNGRV+ALKEEPHI RVWLP+ED+PGLAMSRAF
Sbjct  181   NENKIMPVQLTTDLKPNVPSEADRIRKCNGRVLALKEEPHIHRVWLPHEDSPGLAMSRAF  240

Query  745   GDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaa  924
             GDF+LK HGII+ PE+SY  L+ ND F++LATDGVWDVLSN++V S V +A    E+ AA
Sbjct  241   GDFLLKNHGIIALPEISYRRLTSNDQFIILATDGVWDVLSNEQVASIVWAA--ESEQAAA  298

Query  925   kavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             KAVV+AA  AWK+++P S+ DDCTA+CLFL+K
Sbjct  299   KAVVDAATAAWKKKYPASKVDDCTAVCLFLRK  330



>emb|CAN66210.1| hypothetical protein VITISV_021774 [Vitis vinifera]
Length=691

 Score =   389 bits (998),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 211/338 (62%), Positives = 252/338 (75%), Gaps = 18/338 (5%)
 Frame = +1

Query  16    IISWEMGICISKASSEIHDADYGQENVVHFGDCN---GVEVIASAFSHPGSKGINQDAAI  186
             ++S EMGICIS  SSEI D+  G EN+V F D     G++ + S  S PGSKG+NQDAAI
Sbjct  357   VLSAEMGICISTVSSEIQDSGDGHENMVFFEDSTASIGIQRLGSLHSQPGSKGLNQDAAI  416

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             L+QGYG E G FCG+FDGHGKNGH VSK+VRNHLPSL L Q   L K    +   K +D 
Sbjct  417   LHQGYGMEDGAFCGVFDGHGKNGHIVSKIVRNHLPSLLLNQKNALLKANTAM---KGEDL  473

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSR  546
              T + +     ++  V     MDK+IK  E LDC  SG+TAV+ ++Q +DLV+ANLGDSR
Sbjct  474   HTQKER-----RDGMV-----MDKEIKLQEDLDCSCSGTTAVVIVKQGDDLVIANLGDSR  523

Query  547   AVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGL  726
             AVLG  T+NGV A+QLTTDLKP +P EA+RIRKCNGRVI+LKEEPHIQRVWLPNED+PGL
Sbjct  524   AVLGTITENGVTAVQLTTDLKPGLPMEADRIRKCNGRVISLKEEPHIQRVWLPNEDSPGL  583

Query  727   AMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEY  906
             AMSRAFGDF+LK HGII+ P++SY  L+ ND FLVLATDGVWDVLSN +V   V SA   
Sbjct  584   AMSRAFGDFLLKNHGIIAIPDISYRRLASNDQFLVLATDGVWDVLSNSQVAGIVWSAES-  642

Query  907   GeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              EE AAKAVV+AA  AWK +FP+S+ DDCT +CLFLQK
Sbjct  643   -EEEAAKAVVDAATAAWKHKFPSSKVDDCTVVCLFLQK  679



>ref|XP_010097090.1| putative protein phosphatase 2C 72 [Morus notabilis]
 gb|EXB66891.1| putative protein phosphatase 2C 72 [Morus notabilis]
Length=343

 Score =   375 bits (964),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 204/336 (61%), Positives = 249/336 (74%), Gaps = 13/336 (4%)
 Frame = +1

Query  31    MGICISKASS-EIHDAD--YGQENVVHF----GDCNGVEVIASAFSHPGSKGINQDAAIL  189
             MGICIS ASS +IH+A+  +G  N V F     D  G+  + S +S  GSKG+NQD+AIL
Sbjct  1     MGICISVASSDQIHNAESEHGHGNAVLFFDNQNDSTGIHGLCSVYSKEGSKGLNQDSAIL  60

Query  190   YQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGD  369
             YQGYG + G FCG+FDGHGKNGH VS++VRN LP L   Q +    +  K N +  D   
Sbjct  61    YQGYGMKDGAFCGVFDGHGKNGHVVSEMVRNRLPLLLQSQKE---SVITKFNEDT-DGKS  116

Query  370   TTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRA  549
               E +   KWKE  +SAFK+MDK+IK  + LD   SG+TAV+AIRQ +DL++ANLGDSRA
Sbjct  117   VPEVEDCEKWKETVISAFKVMDKEIKLQDHLDFSCSGTTAVVAIRQGDDLIIANLGDSRA  176

Query  550   VLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLA  729
             VLG  T+NG+KA+QLTTDLKP +P EAERIR C GRVIALK EPHIQRVWLP+ED PGLA
Sbjct  177   VLGTITENGIKAVQLTTDLKPGLPSEAERIRTCKGRVIALKNEPHIQRVWLPHEDVPGLA  236

Query  730   MSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYG  909
             MSRAFGDF+LK +GII+ P+VS+H L+ ND FLVLATDGVWDV+SND+V + V  A    
Sbjct  237   MSRAFGDFLLKDYGIIAIPDVSFHRLTSNDQFLVLATDGVWDVMSNDQVAAVVWEAATE-  295

Query  910   eemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              E AA+AVVEAA  AWKR+FP ++ DDCT +CLFLQ
Sbjct  296   -EAAARAVVEAANAAWKRKFPAAKIDDCTVVCLFLQ  330



>ref|XP_007136811.1| hypothetical protein PHAVU_009G076300g [Phaseolus vulgaris]
 gb|ESW08805.1| hypothetical protein PHAVU_009G076300g [Phaseolus vulgaris]
Length=346

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 249/344 (72%), Gaps = 14/344 (4%)
 Frame = +1

Query  31    MGICISKASSEIHDA--DYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYG  204
             MGICIS  SS IH A  +   E+V+ F     +  ++SA+S  GSKG+NQDAA L Q YG
Sbjct  1     MGICISSESSAIHGAPEEARDESVLVFEATKLLRGLSSAYSKQGSKGLNQDAATLCQVYG  60

Query  205   DESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTE--  378
              E+  FCG+FDGHG+NGH VSK+V + L SL L Q K   KI     TN LD+ D  E  
Sbjct  61    TENTAFCGVFDGHGRNGHVVSKIVNSRLCSLILNQKKVHAKIE---KTNTLDNVDEVEDD  117

Query  379   -----NKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                  NK+F +WKEA +  F++MDK++K  E LDC  SG+TAV+ IRQ EDLV+ANLGDS
Sbjct  118   SSAPLNKNFEEWKEAILDGFRVMDKEVKLQENLDCSCSGTTAVVIIRQGEDLVMANLGDS  177

Query  544   RAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             RA+LG  +D  + AIQLTTD+KP +PCEAERI+ CNGRV ALKEEPHIQRVWLPNE++PG
Sbjct  178   RAILGTISDGEIMAIQLTTDMKPGLPCEAERIKSCNGRVFALKEEPHIQRVWLPNENSPG  237

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDF+LK HGII+ P++S+  L+ +D F+VLA+DGVWDVLSN EV S V +A  
Sbjct  238   LAMSRAFGDFVLKDHGIIAIPDISHRTLTSSDQFIVLASDGVWDVLSNKEVSSIVWAA--  295

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK*SLFF  1035
               E  AA+AVVEA+  AWK ++P+S+ DDCT +CLFLQK   F 
Sbjct  296   DSENEAARAVVEASALAWKNKYPSSKPDDCTVVCLFLQKKPQFL  339



>ref|XP_010244345.1| PREDICTED: probable protein phosphatase 2C 72 isoform X2 [Nelumbo 
nucifera]
Length=344

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 242/329 (74%), Gaps = 10/329 (3%)
 Frame = +1

Query  49    KASSEIHDADYGQENVVHFGDC---NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD  219
             + +SE H+ D G EN+V   D    N +  + S  S  G+KG NQDAAILYQGYG E G 
Sbjct  4     RDTSETHEVDGGNENLVRIQDALQNNRILRLDSLHSQQGNKGPNQDAAILYQGYGTEDGT  63

Query  220   FCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDD-----GDTTENK  384
             FCG+FDGHGKNGH +SKLVRN LPSL L +   L  + A +N +  D       D   NK
Sbjct  64    FCGVFDGHGKNGHVISKLVRNRLPSLVLDRKNALSALNATVNQDYGDQEDELSDDLVPNK  123

Query  385   SFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK  564
             +F +WKEAC+S FK++DK++K  E LDC  SG+TAV+ I+Q EDLV+ANLGDSRA+LG  
Sbjct  124   TFREWKEACLSVFKVIDKELKLHENLDCSCSGTTAVVIIKQAEDLVIANLGDSRAILGTM  183

Query  565   TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAF  744
             T++G+ A+QLTTDLKPS+P EAERI+K +GR+ +LK EPHIQRVWLPN++ PGLAM+RAF
Sbjct  184   TEDGLVAVQLTTDLKPSLPKEAERIKKNSGRIFSLKNEPHIQRVWLPNDNFPGLAMTRAF  243

Query  745   GDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaa  924
             GDF LK HGII+ PE+++H LS ND FLVLATDGVWDVLS  EV S V  A    E+ AA
Sbjct  244   GDFKLKNHGIIAIPEITHHRLSVNDQFLVLATDGVWDVLSIKEVTSIVWLA--KSEKEAA  301

Query  925   kavveaavdaWKRRFPNSRRDDCTAICLF  1011
             +AVV+AAV AW+ +FP S+ DDCT +CLF
Sbjct  302   RAVVDAAVTAWRSKFPTSKMDDCTVLCLF  330



>ref|XP_009337147.1| PREDICTED: probable protein phosphatase 2C 72 [Pyrus x bretschneideri]
Length=344

 Score =   367 bits (943),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 244/345 (71%), Gaps = 19/345 (6%)
 Frame = +1

Query  31    MGICISKASS--EIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYG  204
             MG+CIS ASS  +I D +          D +G+ ++ S  S  GSKG+NQD+A+L QGYG
Sbjct  1     MGLCISCASSSHKIQDGNRTSMPYEENNDSSGIPMLGSFHSMEGSKGVNQDSAMLCQGYG  60

Query  205   DESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNT------------  348
              E    CG+FDGHGK GH VS+LVRN+LPSL L + K L   R                 
Sbjct  61    MEDEAVCGVFDGHGKFGHQVSQLVRNNLPSLLLNKMKALDHQRVTAEAEVDGSQNPVSCK  120

Query  349   -NKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVV  525
              N+ +D +T+  K F KWKEA VS+F++MDK+IK  + +D   SG+TAV+ ++Q EDL +
Sbjct  121   DNEPEDSETS--KKFQKWKEAFVSSFRVMDKEIKLQQNMDSSCSGTTAVVVVKQGEDLFI  178

Query  526   ANLGDSRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLP  705
             ANLGDSRAVLG  T+NG+KAIQLTTDLKP VP EAERIR C GRV+ALK+EP+IQRVW P
Sbjct  179   ANLGDSRAVLGTITENGIKAIQLTTDLKPGVPSEAERIRACGGRVLALKQEPNIQRVWQP  238

Query  706   NEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMST  885
             + D PGLAMSRAFGDF+LK HGII+TP+VS+H L+ ND F+VLATDGVWDVLSN EV S 
Sbjct  239   HVDLPGLAMSRAFGDFILKDHGIIATPDVSHHRLTSNDQFVVLATDGVWDVLSNSEVASI  298

Query  886   VCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             V  A     + A +AV EAA   W+++FPN++RDDCT +CLFLQ+
Sbjct  299   VWEA--ESAQAATRAVTEAASAMWRKKFPNAKRDDCTVVCLFLQE  341



>ref|XP_008220444.1| PREDICTED: probable protein phosphatase 2C 72 [Prunus mume]
Length=349

 Score =   367 bits (943),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/339 (57%), Positives = 246/339 (73%), Gaps = 12/339 (4%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDE  210
             MG+CIS ++ ++ D      +     D NG+++  S +S  GSKG+NQD+AILYQGYG E
Sbjct  1     MGLCISSSAHKVQDGHEAPMSFERSEDSNGIQMHGSLYSLEGSKGVNQDSAILYQGYGLE  60

Query  211   SGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKL-----NTNKLD-----  360
             +  FCG+FDGHG+ GH VS+LVR++LPSL   Q K L +    +     + N +D     
Sbjct  61    AEAFCGVFDGHGRFGHQVSQLVRSNLPSLLQGQMKALDQQATAVAEDDDSKNHIDRIETE  120

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
               D+  +K F KWKEA VS+FK+MDK+IK  E LD   SG+TAV+ I+Q EDL +ANLGD
Sbjct  121   SEDSEPSKKFHKWKEAFVSSFKVMDKEIKLQENLDSSCSGTTAVVVIKQGEDLFIANLGD  180

Query  541   SRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             SRAVLG   DNG++AIQLTTDLKP++P EAERIR C+GRV+ALK+EP+IQRVWLP+ D P
Sbjct  181   SRAVLGTTRDNGIEAIQLTTDLKPALPSEAERIRACDGRVVALKQEPNIQRVWLPHIDLP  240

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
             GLAMSRAFGDF+LK HGII+TP+VSY +L+  D F+VLATDGVWDVLSN EV S V  A 
Sbjct  241   GLAMSRAFGDFILKDHGIIATPDVSYRHLTSKDQFVVLATDGVWDVLSNSEVASIVWEAD  300

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
                 + AAKAV E AV  W+R+FP+++ DDCT +CLFL 
Sbjct  301   SA--QAAAKAVTETAVATWRRKFPSAKIDDCTVVCLFLH  337



>ref|XP_010244344.1| PREDICTED: probable protein phosphatase 2C 72 isoform X1 [Nelumbo 
nucifera]
Length=366

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 242/329 (74%), Gaps = 10/329 (3%)
 Frame = +1

Query  49    KASSEIHDADYGQENVVHFGDC---NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD  219
             +A +E H+ D G EN+V   D    N +  + S  S  G+KG NQDAAILYQGYG E G 
Sbjct  26    QAHAETHEVDGGNENLVRIQDALQNNRILRLDSLHSQQGNKGPNQDAAILYQGYGTEDGT  85

Query  220   FCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDD-----GDTTENK  384
             FCG+FDGHGKNGH +SKLVRN LPSL L +   L  + A +N +  D       D   NK
Sbjct  86    FCGVFDGHGKNGHVISKLVRNRLPSLVLDRKNALSALNATVNQDYGDQEDELSDDLVPNK  145

Query  385   SFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK  564
             +F +WKEAC+S FK++DK++K  E LDC  SG+TAV+ I+Q EDLV+ANLGDSRA+LG  
Sbjct  146   TFREWKEACLSVFKVIDKELKLHENLDCSCSGTTAVVIIKQAEDLVIANLGDSRAILGTM  205

Query  565   TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAF  744
             T++G+ A+QLTTDLKPS+P EAERI+K +GR+ +LK EPHIQRVWLPN++ PGLAM+RAF
Sbjct  206   TEDGLVAVQLTTDLKPSLPKEAERIKKNSGRIFSLKNEPHIQRVWLPNDNFPGLAMTRAF  265

Query  745   GDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaa  924
             GDF LK HGII+ PE+++H LS ND FLVLATDGVWDVLS  EV S V  A    E+ AA
Sbjct  266   GDFKLKNHGIIAIPEITHHRLSVNDQFLVLATDGVWDVLSIKEVTSIVWLA--KSEKEAA  323

Query  925   kavveaavdaWKRRFPNSRRDDCTAICLF  1011
             +AVV+AAV AW+ +FP S+ DDCT +CLF
Sbjct  324   RAVVDAAVTAWRSKFPTSKMDDCTVLCLF  352



>ref|XP_003525982.1| PREDICTED: probable protein phosphatase 2C 72 [Glycine max]
 gb|KHN32220.1| Hypothetical protein glysoja_035313 [Glycine soja]
Length=343

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 245/343 (71%), Gaps = 10/343 (3%)
 Frame = +1

Query  31    MGICISKASSEIHDA--DYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYG  204
             MGICIS  SS IH A  +   ENV+ F     +  + SA++  GSKG+NQDAA L+QGYG
Sbjct  1     MGICISSESSAIHGAPEEARDENVLVFEATKVLSGLCSAYTKQGSKGLNQDAATLFQGYG  60

Query  205   DESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENK  384
              E+  FCG+FDGHGKNGH VSK+V + L  L L Q K   KI      +K++  DT E+ 
Sbjct  61    TENAAFCGVFDGHGKNGHIVSKIVNSRLSPLILSQKKVHAKIDTVQKGDKINHVDTDEDN  120

Query  385   SFL------KWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSR  546
             S        +WKEA + AF++M+K++K  E +D   SG+TAV+ IRQ EDLV+ANLGDSR
Sbjct  121   SSAPNTNCHEWKEAILDAFRVMEKELKLQENIDSTCSGTTAVVVIRQGEDLVIANLGDSR  180

Query  547   AVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGL  726
             A+LG  +D  +  IQLTTD+KP +P EAERIR CNGRV ALKEEPHIQRVWLPNE++PGL
Sbjct  181   AILGTISDGEIIPIQLTTDMKPGLPREAERIRSCNGRVFALKEEPHIQRVWLPNENSPGL  240

Query  727   AMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEY  906
             AMSRAFGDFMLK HGII+ P++SY  L+ +D F+VLA+DGVWDVLSN EV S V  A   
Sbjct  241   AMSRAFGDFMLKDHGIIAVPDISYRTLTSSDQFVVLASDGVWDVLSNKEVSSVVWEADT-  299

Query  907   GeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK*SLFF  1035
              E+ AA+AVVEAA  AWK+++P+S+ DDCT +CLFL K   F 
Sbjct  300   -EKDAARAVVEAATAAWKQKYPSSKVDDCTVLCLFLHKKPQFL  341



>ref|XP_010267059.1| PREDICTED: probable protein phosphatase 2C 12 [Nelumbo nucifera]
Length=341

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/341 (58%), Positives = 245/341 (72%), Gaps = 13/341 (4%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCNGVEVIA---SAFSHPGSKGINQDAAILYQGY  201
             MGIC+S ASSE H A+ G +NVV   +    E I    S  S  GSKG NQDAAIL+QGY
Sbjct  1     MGICVSTASSETHKAEDGSDNVVVIQNSLQNEEIPKLDSFHSQQGSKGPNQDAAILFQGY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKL-------NTNKLD  360
             G E G FCG+FDGHGKNGH +SK+VRN LPSL L +   L  +   +         ++L+
Sbjct  61    GGEDGVFCGVFDGHGKNGHIISKIVRNRLPSLLLDRKNALSVLDTAVRDQDCGDQEDRLE  120

Query  361   -DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLG  537
              D     NK F +WKEA +SAFK+MDK++K  EKLDC TSG+TAV  I+Q EDLV+ANLG
Sbjct  121   SDSKLMSNKVFHEWKEAYLSAFKVMDKELKLNEKLDCSTSGTTAVTIIKQGEDLVIANLG  180

Query  538   DSRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDT  717
             DSRA+LG  T+NG+  +QLTTDLKPS+P EAERI+K NGR+ AL+ EP   RVWLPN++ 
Sbjct  181   DSRAMLGTLTENGLMVVQLTTDLKPSLPSEAERIKKNNGRIFALRNEPDTLRVWLPNDNF  240

Query  718   PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSA  897
             PGLAM+RAFGDF LK +GIIS P++SYH L+ ND FLVLATDGVWDVLS  +V S +   
Sbjct  241   PGLAMTRAFGDFQLKNYGIISIPKISYHRLTVNDQFLVLATDGVWDVLSVKQVASILW--  298

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             +    E AAKAVV+AAV  W+ +FP+S+ DDCT +CLFLQ+
Sbjct  299   FAENRETAAKAVVDAAVTKWRYKFPSSKVDDCTVVCLFLQE  339



>ref|XP_008357359.1| PREDICTED: probable protein phosphatase 2C 72 isoform X1 [Malus 
domestica]
Length=344

 Score =   364 bits (935),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 245/345 (71%), Gaps = 19/345 (6%)
 Frame = +1

Query  31    MGICISKASS--EIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYG  204
             MG+CIS ASS  +I D +          D +G+ ++ S  S  GSKG+NQD+A+L QGYG
Sbjct  1     MGLCISCASSSHKIQDGNRTSMPYEENNDSSGIPMLGSLHSMEGSKGVNQDSAMLCQGYG  60

Query  205   DESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNT------------  348
              E    CG+FDGHGK GH VS+LVR++LPSL L + K L   R                 
Sbjct  61    KEGEALCGVFDGHGKFGHRVSQLVRSNLPSLLLNKMKALDHQRVTAEAEVDGSQNPVSCK  120

Query  349   -NKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVV  525
              N+ +D +T+  K F KWKEA VS+F++MDK+IK  + LD   SG+TAV+ ++Q EDL +
Sbjct  121   DNEPEDSETS--KKFQKWKEAFVSSFRVMDKEIKLQQNLDNSCSGTTAVVVVKQXEDLFI  178

Query  526   ANLGDSRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLP  705
             ANLGDSRAVLG  T++G+KAIQLTTDLKP VP EAERIR C GRV+ALK+EP+IQRVWLP
Sbjct  179   ANLGDSRAVLGTITEBGIKAIQLTTDLKPGVPSEAERIRACGGRVLALKQEPNIQRVWLP  238

Query  706   NEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMST  885
             + D PGLAMSRAFGDF+LK HGII+TP+VS+H L+ ND F+VLATDGVWDVLSN EV S 
Sbjct  239   HVDLPGLAMSRAFGDFILKDHGIIATPDVSHHRLTSNDQFVVLATDGVWDVLSNSEVASI  298

Query  886   VCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             V  A       AA+AV EAA   W+++FPN++RDDCT +CLFLQ+
Sbjct  299   VWEAESA--HAAARAVTEAASAMWRKKFPNAKRDDCTVVCLFLQE  341



>gb|AFK42819.1| unknown [Lotus japonicus]
Length=353

 Score =   364 bits (934),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 204/347 (59%), Positives = 247/347 (71%), Gaps = 25/347 (7%)
 Frame = +1

Query  31    MGICISKASSEIHDA--DYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQ  195
             MGICIS ASSEIH    +   ENV  F      NG + + S +S  G+KG+NQDAA LYQ
Sbjct  1     MGICISLASSEIHGVPEEVHDENVTIFESNKVLNGNKRLCSVYSKQGTKGLNQDAASLYQ  60

Query  196   GYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGD--  369
             GYG E G FCG++DGHG+ GH VSK+V +HLPSL L Q        A +  NK+++GD  
Sbjct  61    GYGMEDGAFCGVYDGHGRYGHIVSKMVNSHLPSLILSQG------NAPVEINKIENGDDN  114

Query  370   ------TTEN----KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
                   T E+    K+F KWK A VSAF +MDK +K  E LDC  SG+TAV+ IRQ E L
Sbjct  115   TPSNFNTVEDDLAPKNFQKWKRAIVSAFMVMDKLVKLQENLDCSCSGTTAVVVIRQGEGL  174

Query  520   VVANLGDSRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVW  699
             ++ANLGDSRAVLG   D  + AIQLTTDLKP +P EAERIR+CNG V ALKEEPHIQRVW
Sbjct  175   IIANLGDSRAVLGTIHDEKLTAIQLTTDLKPGLPSEAERIRRCNGCVYALKEEPHIQRVW  234

Query  700   LPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVM  879
             LPNE+ PGLAMSRAFGDFMLK HG+I+ P++ YH+++  D F+VLA+DGVWDVLSN EV 
Sbjct  235   LPNENFPGLAMSRAFGDFMLKDHGVIAIPDIWYHHVTSRDQFIVLASDGVWDVLSNSEVA  294

Query  880   STVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             S V       EE AAKAVVEAA  AW++++P+S+ DDCT +CLFLQK
Sbjct  295   SIVWMVDT--EEEAAKAVVEAATAAWEKKYPSSKVDDCTVVCLFLQK  339



>ref|XP_003589034.1| hypothetical protein MTR_1g016620 [Medicago truncatula]
 ref|XP_003609746.1| hypothetical protein MTR_4g121770 [Medicago truncatula]
 gb|AES59285.1| protein phosphatase 2C-like protein [Medicago truncatula]
Length=344

 Score =   362 bits (928),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 234/334 (70%), Gaps = 8/334 (2%)
 Frame = +1

Query  31    MGICISKASSEIHD-ADYGQENVVHFGDC---NGVEVIASAFSHPGSKGINQDAAILYQG  198
             MGICIS ASSEIH       ENV+ F      N  + + S +S  G+KG+NQDAA L+Q 
Sbjct  1     MGICISVASSEIHGIPQVHDENVMIFEASKVQNETKRLCSVYSKQGTKGLNQDAASLHQD  60

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTE  378
             YG E+G FCG++DGHGKNGH VSK+V N LPSL L Q   L +I      N +D+     
Sbjct  61    YGMENGAFCGVYDGHGKNGHIVSKIVNNTLPSLILSQKNALEEIHT--TKNGVDNKQNKF  118

Query  379   NKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG  558
             + ++L+WKEA + AF +MD+++K+ E LDC  SG+TAV+ IRQ E LV+ NLGDSRA+LG
Sbjct  119   SNNYLRWKEAILGAFNVMDEEVKKQENLDCSCSGTTAVVVIRQGEGLVIVNLGDSRAILG  178

Query  559   RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSR  738
                D  +KAIQLTTDLKP +PCEA+RIR CNG V ALKEEPH+QRVWLPNE+ PGLAMSR
Sbjct  179   TIQDEKLKAIQLTTDLKPGLPCEAKRIRSCNGCVYALKEEPHVQRVWLPNENYPGLAMSR  238

Query  739   AFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeem  918
             AFGDF+LK HG+I+TP++ YH L+ +D F+VLA+DGVWDVLSN+EV S V       E  
Sbjct  239   AFGDFILKDHGVIATPDIWYHRLTSSDQFIVLASDGVWDVLSNEEVASIVWMVESEEEAA  298

Query  919   aakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              A      A     ++FP+SR DDCT +C FLQK
Sbjct  299   RAVVEAATAAW--AKKFPSSRVDDCTVVCHFLQK  330



>ref|XP_004291019.1| PREDICTED: probable protein phosphatase 2C 72-like [Fragaria 
vesca subsp. vesca]
Length=336

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 236/338 (70%), Gaps = 15/338 (4%)
 Frame = +1

Query  31    MGICIS-KASSEIHDADYGQENVVHFGDCN---GVEVIASAFSHPGSKGINQDAAILYQG  198
             MGICIS  AS +I D   G EN + FG  +   G + + S +S  GSKG+NQD+AILYQG
Sbjct  1     MGICISCSASQKIQD---GNENAMFFGKNSSFFGDQSLGSLYSRAGSKGLNQDSAILYQG  57

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLF------LKQAKFLPKIRAKLNTNKLD  360
             YG     FCG+FDGHGKNGH VS++V+N LP+L       L+Q   + K   + N N   
Sbjct  58    YGVGGASFCGVFDGHGKNGHVVSEMVKNRLPALLQSQMEALEQVTLVTKSDGEQNCNNET  117

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
             D +   +K+F KW+ A V+AF++MDK+IK  + LDC +SGSTAV+ IRQ EDL +ANLGD
Sbjct  118   DAEAEPSKNFAKWEAALVNAFRVMDKEIKLQQDLDCSSSGSTAVVVIRQGEDLFIANLGD  177

Query  541   SRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             SRAVLG  T+NG++ IQLTTDLKP +P E ERI  CNGRV ALK E HIQRVWLP+E  P
Sbjct  178   SRAVLGTMTENGIEGIQLTTDLKPGLPSETERITACNGRVFALKNEKHIQRVWLPHELLP  237

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
             GLAMSRAFGDF+LK +GII+ P+VS+  L+  D F+VLATDG+WDVLSN+EV S V  A 
Sbjct  238   GLAMSRAFGDFVLKDYGIIAIPDVSHRRLTSKDQFIVLATDGIWDVLSNNEVASIVWEAK  297

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
                 E AA+ V E A+  W  ++P ++ DDCT +CLF 
Sbjct  298   S--AEAAARRVTETAIATWSTKYPTTKIDDCTVVCLFF  333



>ref|XP_004498917.1| PREDICTED: probable protein phosphatase 2C 72-like [Cicer arietinum]
Length=344

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 197/334 (59%), Positives = 240/334 (72%), Gaps = 8/334 (2%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCNGVE----VIASAFSHPGSKGINQDAAILYQG  198
             MGICIS ASSEIH      +  V   + N V+     + S +S  G+KG+NQDAA LYQG
Sbjct  1     MGICISVASSEIHGIPQVHDENVMIFEANKVQHETHRLCSVYSKKGTKGLNQDAASLYQG  60

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTE  378
             Y  E G FCG++DGHG+NGH VSKLV ++L SL L Q     +I  +  TN +D      
Sbjct  61    YEMEDGAFCGVYDGHGRNGHIVSKLVNSNLSSLILSQKNGFEEIDTQ--TNIVDYKQNHF  118

Query  379   NKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG  558
              K+FLKWKEA + AFK+MDK++K  E +DC  SG+TAV+ IRQ + L++ANLGDSRA+LG
Sbjct  119   PKNFLKWKEAILGAFKVMDKEVKLQENIDCSCSGTTAVVVIRQGKGLIIANLGDSRAILG  178

Query  559   RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSR  738
                +  ++AIQLTTDLKP +PCEAERIR CNG V ALKEEPH+QRVWLPNE  PGLAMSR
Sbjct  179   TIHNAKLEAIQLTTDLKPGLPCEAERIRNCNGCVYALKEEPHVQRVWLPNETYPGLAMSR  238

Query  739   AFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeem  918
             AFGDF+LK HG+IS P+V YH L+ +D F+VLA+DGVWDVLSNDEV S V       EE 
Sbjct  239   AFGDFILKDHGVISIPDVCYHPLTSSDQFVVLASDGVWDVLSNDEVASIVWKVES--EEA  296

Query  919   aakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             AAKAVV AA  AW  ++P+SR DDCT +CLFLQK
Sbjct  297   AAKAVVAAATAAWANKYPSSRVDDCTVVCLFLQK  330



>ref|XP_010669214.1| PREDICTED: probable protein phosphatase 2C 72 [Beta vulgaris 
subsp. vulgaris]
Length=318

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 229/333 (69%), Gaps = 30/333 (9%)
 Frame = +1

Query  31    MGICISKASSEIHDADYG-QENVVHFG---DCNGVEVIASAFSHPGSKGINQDAAILYQG  198
             MG C S  +S+I   +YG  EN +      D N    + S  SH G+KG+NQD+AILYQG
Sbjct  1     MGNCTSCVTSDIQVHEYGSHENALQIQAAVDGNVRHKVGSVHSHQGAKGVNQDSAILYQG  60

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTE  378
             YG E G+ C +FDGHG NGH VS++ RN LPSL L Q KF+                   
Sbjct  61    YGMEDGELCAVFDGHGSNGHIVSRVARNQLPSLLLNQRKFM-------------------  101

Query  379   NKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG  558
                  +W +A VSAFK +DK+IK +E +DC  SGSTAV+ +RQ EDLV+ANLGDSRAVLG
Sbjct  102   -----EWDQAFVSAFKALDKEIKLLETVDCSFSGSTAVVVVRQGEDLVIANLGDSRAVLG  156

Query  559   RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSR  738
               T+NG++A QLT DLKP VP EA+RI+K NGRV A + +PHIQRVWLPNED PGLAMSR
Sbjct  157   TSTENGIQATQLTEDLKPDVPGEADRIKKANGRVFAHESQPHIQRVWLPNEDIPGLAMSR  216

Query  739   AFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeem  918
             AFGDF +K  GII+TP V++  L+  D FLVLA DGVWDVLSNDEV+S V SA     E 
Sbjct  217   AFGDFDMKNCGIIATPVVTHRRLTSKDQFLVLACDGVWDVLSNDEVVSVVVSAKNK--EA  274

Query  919   aakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             AAKAVV+ A  AWK++FP ++ DDCT +CLFL+
Sbjct  275   AAKAVVDEAHAAWKQKFPLAKIDDCTVVCLFLE  307



>ref|XP_010915312.1| PREDICTED: probable protein phosphatase 2C 12 [Elaeis guineensis]
Length=355

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 244/346 (71%), Gaps = 22/346 (6%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENV-----VHFGDCNGVEVIASAFSHPGSKGINQDAAILYQ  195
             MGIC+S AS E  + D     V      ++G+   V ++AS +S    KG NQDAAIL  
Sbjct  1     MGICLSSASLEKQECDENVVYVVEEEGFNYGE-GAVRMLASLYSRQWKKGPNQDAAILCT  59

Query  196   GYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTT  375
             GYG E G FCG+FDGHG++GH VS+ VR++LPSL L Q   L  + A+  ++   DG+ T
Sbjct  60    GYGIEEGVFCGVFDGHGRSGHVVSRQVRDYLPSLLLSQRDAL--LLAEEESDDSSDGNDT  117

Query  376   EN-----------KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLV  522
              +           + F +WK  C+ AF++MDK++K +  LDC  SG+TAV  I+Q EDL+
Sbjct  118   SSVDADDSSISSPEMFDEWKTVCIQAFRIMDKELKLLPNLDCSFSGTTAVSIIKQGEDLI  177

Query  523   VANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVW  699
             +ANLGDSRA++G  +D G ++AIQLTTDLKPSVP EAERIRK NGR+ +LK+EPH QRVW
Sbjct  178   IANLGDSRAIMGTISDEGRLEAIQLTTDLKPSVPKEAERIRKNNGRIFSLKDEPHTQRVW  237

Query  700   LPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVM  879
             LPN++ PGLAM+RAFGDF LK +G+IS P+VSY  LS  D F+VLATDGVWDVLSN+ V+
Sbjct  238   LPNQNFPGLAMARAFGDFQLKNYGVISIPQVSYRRLSERDQFIVLATDGVWDVLSNERVV  297

Query  880   STVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             S V SA    +E A+KA+VEAAV AWK +FP S+ DDC+A CLFLQ
Sbjct  298   SIVWSA--KSKEDASKALVEAAVRAWKSKFPTSKVDDCSAACLFLQ  341



>ref|XP_008782499.1| PREDICTED: probable protein phosphatase 2C 12 isoform X1 [Phoenix 
dactylifera]
Length=363

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 240/346 (69%), Gaps = 22/346 (6%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVV------HFGDCNG-VEVIASAFSHPGSKGINQDAAIL  189
             MGIC+S    E  ++D   EN+V       FG   G V ++AS +S  G KG NQDAAIL
Sbjct  1     MGICLSSEPLEKQESD---ENIVCVVEEDEFGYGEGEVRMLASLYSRQGKKGPNQDAAIL  57

Query  190   YQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNK-----  354
               GYG E G FCG+FDGHG+NGH VS+LVR++LPSL L+Q   L     + + +      
Sbjct  58    CTGYGMEEGVFCGVFDGHGRNGHIVSRLVRDYLPSLLLRQRNALLLAEEESDDSSDGTDA  117

Query  355   ----LDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLV  522
                  DD   +  ++F +WK   + AF++MDK++K    LD   SG+TAV  I+Q +DL+
Sbjct  118   SSVDADDSSLSSPETFDEWKAVFIQAFRVMDKELKLQPNLDFSFSGTTAVSIIKQGKDLI  177

Query  523   VANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVW  699
             +ANLGDSRA++G  ++ G ++A+QLTTDLKP VP EA RIRK NGR+ ALK+EPH QRVW
Sbjct  178   IANLGDSRAIMGTISEEGRLEAMQLTTDLKPCVPKEAARIRKNNGRIFALKDEPHTQRVW  237

Query  700   LPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVM  879
             LPN++ PGLAM+RAFGDF LK +G+IS P+VSY  LS  D F+VLATDGVWDVLSN+ V+
Sbjct  238   LPNDNYPGLAMARAFGDFQLKDYGVISIPQVSYRRLSERDQFIVLATDGVWDVLSNERVV  297

Query  880   STVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             S V SA    +E A+KA+VEAAV AW+ +FP S+ DDC+A CLFLQ
Sbjct  298   SIVWSA--ESKEDASKALVEAAVRAWRSKFPTSKVDDCSAACLFLQ  341



>ref|XP_003549361.1| PREDICTED: probable protein phosphatase 2C 72-like [Glycine max]
Length=344

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 233/341 (68%), Gaps = 18/341 (5%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGICIS A  E HD D    NV  F      NG + + S +S  GSKG+NQDAA +++GY
Sbjct  1     MGICISVAE-EAHDDD----NVTIFEARKVLNGSQRLCSVYSKQGSKGLNQDAASVHEGY  55

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKI----RAKLNTNKLDDGD  369
             G E G FCG++DGHG NGH VSK+V + L SL L Q   L +I        NT K     
Sbjct  56    GMEDGTFCGVYDGHGGNGHKVSKIVSSRLSSLILDQKNVLERIDEIENGYNNTTKKHVNS  115

Query  370   TTEN---KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
               E    ++F KWKEA VSAFK+MDK++K  + LDC +SG+TAV+ I+Q E LV+ANLGD
Sbjct  116   VKEELPARNFQKWKEAIVSAFKVMDKEVKLQKNLDCFSSGTTAVVIIKQGEGLVIANLGD  175

Query  541   SRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLP-NEDT  717
             SRAVLG   D  + AIQLTTDLKP +P EAERIR+CNG V    EEP IQRVW+P NE++
Sbjct  176   SRAVLGTIYDEKLVAIQLTTDLKPELPREAERIRRCNGCVCGSNEEPDIQRVWMPNNENS  235

Query  718   PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSA  897
             PGLAMSR+ GDF+LK HG+I+ P+VSYH L+  D F+VLA+DGVWDVLSN+EV S V S 
Sbjct  236   PGLAMSRSLGDFLLKDHGVIAIPDVSYHPLTSTDQFIVLASDGVWDVLSNNEVASIVWSV  295

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
                 EE AA AVVEAA  AW  ++P+   DDCT +CLFL K
Sbjct  296   --DSEEAAAMAVVEAATAAWNEKYPSYMADDCTVVCLFLHK  334



>ref|XP_007160990.1| hypothetical protein PHAVU_001G033800g [Phaseolus vulgaris]
 gb|ESW32984.1| hypothetical protein PHAVU_001G033800g [Phaseolus vulgaris]
Length=346

 Score =   329 bits (843),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 191/343 (56%), Positives = 240/343 (70%), Gaps = 19/343 (6%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQG  198
             MGICIS   SE  D D   ENV  F +     NG + + S +S  G+KG+NQDAA ++Q 
Sbjct  1     MGICIS--VSEKDDDD--DENVTIFEERKKVPNGSQRLFSVYSKQGTKGLNQDAASIHQD  56

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLN-----TNKLDD  363
             YG E G +CG++DGHG NGH VSK+V + L SL L Q   L KI A  N     T+K   
Sbjct  57    YGMEDGTYCGVYDGHGGNGHRVSKMVSSRLSSLILDQKNVLEKIDAIENGYYNTTSKNHV  116

Query  364   GDTTENKS---FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANL  534
             G   ++ +   F KWKEA VSAFK+M+K++K    LDC  SG+TAV+ I+Q E LV+ANL
Sbjct  117   GTMKKDSAANNFQKWKEAIVSAFKVMEKEVKLQHNLDCSCSGTTAVVIIKQGEGLVIANL  176

Query  535   GDSRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNED  714
             GDSRAV+G   D  + A QLTTDLKP +P EAERIR+CNG V A KEEP IQRVW+PN D
Sbjct  177   GDSRAVMGTICDEKLIATQLTTDLKPELPREAERIRRCNGCVCASKEEPEIQRVWIPNND  236

Query  715   -TPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVC  891
              +PGLAMSR+FGDF+LK HG+I+ P++SYH+L+ +D F+VLA+DGVWDVL+N+EV S V 
Sbjct  237   NSPGLAMSRSFGDFLLKNHGVIAVPDISYHSLTSSDQFIVLASDGVWDVLNNNEVASIVW  296

Query  892   SAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             SA    EE+AA+AVVEAA  AWK +FP+   DDCT  CLFL +
Sbjct  297   SA--ESEEVAARAVVEAATTAWKDKFPSYMADDCTVACLFLHQ  337



>ref|XP_008452701.1| PREDICTED: probable protein phosphatase 2C 72 isoform X1 [Cucumis 
melo]
Length=325

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 238/338 (70%), Gaps = 26/338 (8%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVV----HFGDCN---GVEVIASAFSHPGSKGINQDAAIL  189
             MGICIS ASS+I        +++    H+  C    G++ + S  S  GSKGINQDAA  
Sbjct  1     MGICISSASSQIRHETNKVGSIIEEDDHYKSCYSVCGIQKLESICSKQGSKGINQDAAFA  60

Query  190   YQGYGD-ESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             YQ +G+ E  D  G+FDGHG+NGH VS LV+N LPSL L++      + AK +  K    
Sbjct  61    YQEFGEVEESDLFGVFDGHGQNGHIVSNLVKNRLPSLLLRE------VTAKSSLVK----  110

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSR  546
                  KSF  WKEA  ++FK+MDK+IK  E LD   SGSTAV+ ++Q + LV+ NLGDSR
Sbjct  111   ----RKSFNTWKEAFETSFKVMDKEIKLQENLDGSFSGSTAVVIVKQGDYLVIGNLGDSR  166

Query  547   AVLGR-KTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             AV+GR + D G+KA+QLTTDLKP +  E ERIR+C GRV+ALK+E HIQRVWLPNED PG
Sbjct  167   AVMGRMRDDGGIKAVQLTTDLKPGLASEGERIRRCKGRVLALKDEAHIQRVWLPNEDAPG  226

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDF LK +GII+ P+VS+  L+ +D F+VLATDG+WDVLSNDEV S V +A  
Sbjct  227   LAMSRAFGDFALKDYGIINLPDVSFRPLTSHDRFIVLATDGIWDVLSNDEVASIVWAAES  286

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
               EE AAKAVV+AA +AWK R+P+S+ DDCT IC FLQ
Sbjct  287   --EEAAAKAVVDAAAEAWK-RYPSSKHDDCTVICHFLQ  321



>ref|XP_004141421.1| PREDICTED: probable protein phosphatase 2C 72-like [Cucumis sativus]
 ref|XP_004165596.1| PREDICTED: probable protein phosphatase 2C 72-like [Cucumis sativus]
 gb|KGN55319.1| hypothetical protein Csa_4G645920 [Cucumis sativus]
Length=325

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 190/338 (56%), Positives = 239/338 (71%), Gaps = 26/338 (8%)
 Frame = +1

Query  31    MGICISKASSEI-HDADYGQENVV---HFGDCN---GVEVIASAFSHPGSKGINQDAAIL  189
             MGICIS ASS+I H+ +     ++   H+  C    G++ + S  S  GSKGINQDAA  
Sbjct  1     MGICISSASSQIRHETNKVGSIIIEEDHYKSCYSVCGIQKLESICSKQGSKGINQDAAFA  60

Query  190   YQGYGD-ESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             YQ YG+ E  D  G+FDGHG NGH VS LV+N LPSL L +      + AK +  K    
Sbjct  61    YQEYGEVEESDLFGVFDGHGPNGHIVSNLVKNRLPSLLLGE------VTAKSSLVK----  110

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSR  546
                  KSF  WKEA  ++FK+MDK+IK  E LD   SGSTAV+ ++Q++ LV+ NLGDSR
Sbjct  111   ----RKSFNAWKEAFETSFKVMDKEIKLQENLDGSCSGSTAVVMVKQEDYLVIGNLGDSR  166

Query  547   AVLGR-KTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             AV+GR + D G+KA+QLTTDLKP +  E ERIR+C GRV+ALK+E HIQRVWLPNED+PG
Sbjct  167   AVMGRMREDGGIKAVQLTTDLKPGLESEGERIRRCKGRVLALKDEAHIQRVWLPNEDSPG  226

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDF LK +GII+ P+VS+  L+  D F+VLATDG+WDVLSNDEV S V +A  
Sbjct  227   LAMSRAFGDFALKDYGIINLPDVSFRPLTSLDRFIVLATDGIWDVLSNDEVASIVWAAES  286

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
                E AAKAVV+AA +AWK R+P+S++DDCT +C FLQ
Sbjct  287   E--EAAAKAVVDAATEAWK-RWPSSKQDDCTVVCHFLQ  321



>ref|XP_008782500.1| PREDICTED: probable protein phosphatase 2C 12 isoform X2 [Phoenix 
dactylifera]
Length=362

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 240/346 (69%), Gaps = 23/346 (7%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVV------HFGDCNG-VEVIASAFSHPGSKGINQDAAIL  189
             MGIC+S    E  ++D   EN+V       FG   G V ++AS +S  G KG NQDAAIL
Sbjct  1     MGICLSSEPLEKQESD---ENIVCVVEEDEFGYGEGEVRMLASLYSRQGKKGPNQDAAIL  57

Query  190   YQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNK-----  354
               GYG E G FCG+FDGHG+NGH VS+LVR++LPSL L+Q   L     + + +      
Sbjct  58    CTGYGMEEGVFCGVFDGHGRNGHIVSRLVRDYLPSLLLRQRNALLLAEEESDDSSDGTDA  117

Query  355   ----LDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLV  522
                  DD   +  ++F +WK   + AF++MDK++K    LD   SG+TAV  I+Q +DL+
Sbjct  118   SSVDADDSSLSSPETFDEWKAVFIQAFRVMDKELKLQPNLDFSFSGTTAVSIIKQGKDLI  177

Query  523   VANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVW  699
             +ANLGDSRA++G  ++ G ++A+QLTTDLKP VP +A RIRK NGR+ ALK+EPH QRVW
Sbjct  178   IANLGDSRAIMGTISEEGRLEAMQLTTDLKPCVP-KAARIRKNNGRIFALKDEPHTQRVW  236

Query  700   LPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVM  879
             LPN++ PGLAM+RAFGDF LK +G+IS P+VSY  LS  D F+VLATDGVWDVLSN+ V+
Sbjct  237   LPNDNYPGLAMARAFGDFQLKDYGVISIPQVSYRRLSERDQFIVLATDGVWDVLSNERVV  296

Query  880   STVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             S V SA    +E A+KA+VEAAV AW+ +FP S+ DDC+A CLFLQ
Sbjct  297   SIVWSA--ESKEDASKALVEAAVRAWRSKFPTSKVDDCSAACLFLQ  340



>ref|XP_006853933.1| hypothetical protein AMTR_s00036p00202740 [Amborella trichopoda]
 gb|ERN15400.1| hypothetical protein AMTR_s00036p00202740 [Amborella trichopoda]
Length=334

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/338 (54%), Positives = 227/338 (67%), Gaps = 25/338 (7%)
 Frame = +1

Query  31    MGICISKASSEIH---DADYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAIL  189
             MG C+S A+ E H   +A Y +E    F      CNG    AS +S  G KG NQDA IL
Sbjct  1     MGACVSCAAHETHLISEASYDEEGHDIFVKGGLVCNGFNSFASFYSQQGRKGCNQDAFIL  60

Query  190   YQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGD  369
              QGYG+  G FCG+FDGHG+ GH VSK VR  LPS+ L+Q   L         N    G 
Sbjct  61    CQGYGEGDGLFCGVFDGHGQYGHLVSKRVREWLPSMLLRQRDGL--------MNGFSQG-  111

Query  370   TTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRA  549
                   F  W EAC+  FK +DK +K    LDC  SG+TAV  I+Q   LVVANLGDSRA
Sbjct  112   ------FEAWDEACIRGFKALDKNLKLSNDLDCSFSGTTAVTIIKQGGYLVVANLGDSRA  165

Query  550   VLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGL  726
             VLG  +++G + AIQLTTD KP+VP EAERIR+CNGRV ALKEEP IQRVWLP+ED+PGL
Sbjct  166   VLGTISEDGTLTAIQLTTDQKPNVPQEAERIRQCNGRVFALKEEPKIQRVWLPDEDSPGL  225

Query  727   AMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEY  906
             AM+RAFGDF LK  G+ + P+V++H L+  D F++LA+DGVWD LSN EV+S V SA   
Sbjct  226   AMARAFGDFQLKDFGLSAVPQVTHHKLTSKDQFVILASDGVWDALSNTEVVSIVSSAET-  284

Query  907   GeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              +E AAK VVE+A+ AW+ +FP+SR DDC+ +CLF+Q+
Sbjct  285   -KETAAKDVVESAIQAWQHKFPSSRVDDCSVVCLFVQE  321



>gb|AAC36699.1| protein phosphatase-2C [Mesembryanthemum crystallinum]
Length=344

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 221/309 (72%), Gaps = 8/309 (3%)
 Frame = +1

Query  109   DCNGV-----EVIA-SAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSK  270
             D NGV     ++IA S  S  G KG+NQDAAIL QG+G E G FCG+FDGHGK GH VSK
Sbjct  22    DQNGVYGNRDQIIAGSVHSQKGGKGVNQDAAILCQGFGSEDGVFCGVFDGHGKFGHVVSK  81

Query  271   LVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQ  450
             +VR  LP L L +   +     + + +    G ++  K F  W+EACV  F+ MDK++K 
Sbjct  82    IVRQRLPVLLLDEKIAVAPADTESDDDSTQGGLSSSEKKFFDWEEACVKTFEEMDKELKH  141

Query  451   VEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNGVKAIQLTTDLKPSVPCEA  630
              +K D   SG+TAV+ ++Q +D  +ANLGDSRAVLG KT+NGV  +QLTTDLKP  P EA
Sbjct  142   TKKADFSFSGTTAVVVLKQAQDFFIANLGDSRAVLGTKTENGVTPLQLTTDLKPGTPDEA  201

Query  631   ERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLS  810
             +RIRK NGRV AL+EEP ++R WLP    PG+AMSR FGDF++K HG+ISTP V++H+++
Sbjct  202   DRIRKSNGRVFALREEPGVERAWLPRIQCPGIAMSRCFGDFVMKKHGLISTPVVTHHSIT  261

Query  811   PNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDD  990
              +D F+VLATDGVWDVLSN+EV+S V    +  EEMAA+A+V+AA+ AWK + P  + DD
Sbjct  262   SDDLFIVLATDGVWDVLSNEEVISIVTKVEK--EEMAAQALVDAALVAWKTKLPYGKPDD  319

Query  991   CTAICLFLQ  1017
             CTA+CLFLQ
Sbjct  320   CTALCLFLQ  328



>ref|XP_008452702.1| PREDICTED: probable protein phosphatase 2C 72 isoform X2 [Cucumis 
melo]
Length=324

 Score =   323 bits (827),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 235/337 (70%), Gaps = 25/337 (7%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVV----HFGDCN---GVEVIASAFSHPGSKGINQDAAIL  189
             MGICIS ASS+I        +++    H+  C    G++ + S  S  GSKGINQDAA  
Sbjct  1     MGICISSASSQIRHETNKVGSIIEEDDHYKSCYSVCGIQKLESICSKQGSKGINQDAAFA  60

Query  190   YQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGD  369
             YQ    E  D  G+FDGHG+NGH VS LV+N LPSL L++      + AK +  K     
Sbjct  61    YQFGEVEESDLFGVFDGHGQNGHIVSNLVKNRLPSLLLRE------VTAKSSLVK-----  109

Query  370   TTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRA  549
                 KSF  WKEA  ++FK+MDK+IK  E LD   SGSTAV+ ++Q + LV+ NLGDSRA
Sbjct  110   ---RKSFNTWKEAFETSFKVMDKEIKLQENLDGSFSGSTAVVIVKQGDYLVIGNLGDSRA  166

Query  550   VLGR-KTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGL  726
             V+GR + D G+KA+QLTTDLKP +  E ERIR+C GRV+ALK+E HIQRVWLPNED PGL
Sbjct  167   VMGRMRDDGGIKAVQLTTDLKPGLASEGERIRRCKGRVLALKDEAHIQRVWLPNEDAPGL  226

Query  727   AMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEY  906
             AMSRAFGDF LK +GII+ P+VS+  L+ +D F+VLATDG+WDVLSNDEV S V +A   
Sbjct  227   AMSRAFGDFALKDYGIINLPDVSFRPLTSHDRFIVLATDGIWDVLSNDEVASIVWAAES-  285

Query  907   GeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              EE AAKAVV+AA +AWK R+P+S+ DDCT IC FLQ
Sbjct  286   -EEAAAKAVVDAAAEAWK-RYPSSKHDDCTVICHFLQ  320



>ref|XP_010536209.1| PREDICTED: probable protein phosphatase 2C 72 isoform X3 [Tarenaya 
hassleriana]
Length=332

 Score =   322 bits (826),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 180/341 (53%), Positives = 223/341 (65%), Gaps = 32/341 (9%)
 Frame = +1

Query  31    MGICISKASSEIHDAD----------YGQENVVHFGDCNGVEVIASAFSHPGSKGINQDA  180
             MG C S +SSEIH+ +          YG+E+    GD   V    S +S  GSKG+NQDA
Sbjct  1     MGHCFSVSSSEIHEENEFSDGNTMVCYGEES--GLGDDGPVWPSGSVWSIQGSKGLNQDA  58

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD  360
             A+LY GYG   G+ CG+FDGHGK+GH VSK+VRN LPSL L      P            
Sbjct  59    AVLYLGYGRGEGEMCGVFDGHGKSGHLVSKMVRNRLPSLLLTFKNQSPDDDDDG------  112

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
                        +W+EAC+SAF+L+D+++  ++  DC  SG+TAVIAIRQ  DLV+ANLGD
Sbjct  113   -----------EWEEACLSAFRLIDREL-LLQTFDCSFSGTTAVIAIRQGNDLVLANLGD  160

Query  541   SRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDT  717
             SRAVLG  +++G + A+QLTTDLKP VP E ERI +CNGRV ALK EP+  RVWLPN D 
Sbjct  161   SRAVLGTVSEDGELGAVQLTTDLKPGVPREEERITRCNGRVFALKAEPYNPRVWLPNRDV  220

Query  718   PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSA  897
             PGLAMSRAFGDF+LK +GII+ PEVS+  L+PND FLVLATDGVWDVLSNDEV+S V S 
Sbjct  221   PGLAMSRAFGDFVLKDYGIIAVPEVSHRRLTPNDQFLVLATDGVWDVLSNDEVVSIVSSE  280

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              +        A    A    K++  +++ DD T  CLFLQK
Sbjct  281   RKPASAAKLVAETAKAAWK-KKKLQSTKVDDITVACLFLQK  320



>ref|XP_009408871.1| PREDICTED: probable protein phosphatase 2C 12 [Musa acuminata 
subsp. malaccensis]
Length=353

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 240/350 (69%), Gaps = 30/350 (9%)
 Frame = +1

Query  31    MGICIS------KASSEIHDADYGQENVVHFGDCNGV-----EVIASAFSHPGSKGINQD  177
             MG C S      +ASSE  + +   +  V  GD +G+       IAS +SH G+KG+NQD
Sbjct  1     MGSCFSSASLKNQASSERKECEEEIQVCVERGD-DGLSPDEKRRIASLYSHRGNKGLNQD  59

Query  178   AAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKL  357
             AAIL +GYG E G FCG+FDGHG +GH VS++VR++L +L L +       R  L  ++ 
Sbjct  60    AAILCKGYGTEEGLFCGVFDGHGTSGHTVSRVVRDYLHALLLGE-------RNALLLSQE  112

Query  358   DDG--------DTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDE  513
             DDG         T   +   +WKEAC++AFK MD+++K    LDC  SG+TAV  I+Q E
Sbjct  113   DDGFTDSTDTSSTDGEEVLDEWKEACINAFKTMDEELKVRPNLDCSFSGTTAVSVIKQGE  172

Query  514   DLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQ  690
             DL++ANLGDSRAV+G  ++ G ++AIQLTTDLKPSVP E ERIRK NGRV AL+ EPHIQ
Sbjct  173   DLIIANLGDSRAVMGTVSEEGHLEAIQLTTDLKPSVPQETERIRKSNGRVFALEREPHIQ  232

Query  691   RVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSND  870
             RVWLP+ED PGLAM+RA GDF LK +GIIS P+V++  ++  D  +VLATDGVWD LSN+
Sbjct  233   RVWLPDEDFPGLAMARALGDFQLKNYGIISVPQVAHRRVTSRDMLIVLATDGVWDALSNE  292

Query  871   EVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             EV+S V S      E A+K +VEAA +AWK +FP+++ DDCTA CLF Q+
Sbjct  293   EVVSIVWSTET--NEDASKTLVEAARNAWKSKFPSAKVDDCTAACLFFQE  340



>ref|XP_008357360.1| PREDICTED: probable protein phosphatase 2C 72 isoform X2 [Malus 
domestica]
Length=299

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 204/287 (71%), Gaps = 17/287 (6%)
 Frame = +1

Query  31   MGICISKASS--EIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYG  204
            MG+CIS ASS  +I D +          D +G+ ++ S  S  GSKG+NQD+A+L QGYG
Sbjct  1    MGLCISCASSSHKIQDGNRTSMPYEENNDSSGIPMLGSLHSMEGSKGVNQDSAMLCQGYG  60

Query  205  DESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNT------------  348
             E    CG+FDGHGK GH VS+LVR++LPSL L + K L   R                 
Sbjct  61   KEGEALCGVFDGHGKFGHRVSQLVRSNLPSLLLNKMKALDHQRVTAEAEVDGSQNPVSCK  120

Query  349  -NKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVV  525
             N+ +D +T+  K F KWKEA VS+F++MDK+IK  + LD   SG+TAV+ ++Q EDL +
Sbjct  121  DNEPEDSETS--KKFQKWKEAFVSSFRVMDKEIKLQQNLDNSCSGTTAVVVVKQXEDLFI  178

Query  526  ANLGDSRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLP  705
            ANLGDSRAVLG  T++G+KAIQLTTDLKP VP EAERIR C GRV+ALK+EP+IQRVWLP
Sbjct  179  ANLGDSRAVLGTITEBGIKAIQLTTDLKPGVPSEAERIRACGGRVLALKQEPNIQRVWLP  238

Query  706  NEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDG  846
            + D PGLAMSRAFGDF+LK HGII+TP+VS+H L+ ND F+VLATDG
Sbjct  239  HVDLPGLAMSRAFGDFILKDHGIIATPDVSHHRLTSNDQFVVLATDG  285



>gb|AFW71293.1| putative protein phosphatase 2C family protein [Zea mays]
Length=353

 Score =   317 bits (811),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 174/349 (50%), Positives = 232/349 (66%), Gaps = 35/349 (10%)
 Frame = +1

Query  31    MGICIS--KASSEIHDADYGQENVVHFGD---------------CNGVEVIASAFSHPGS  159
             MGIC S  +   E  D+D   ENVV+  D                     +AS FS  G 
Sbjct  1     MGICASSKRVRQEEQDSD---ENVVYVMDEQGGGGEGEDGRGARAAASRKVASLFSQKGK  57

Query  160   KGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFL--KQAKFLPKIR  333
             KG NQDA IL QG+G E G FCG+FDGHG+ G ++SKLVR++LP + L  + A  +    
Sbjct  58    KGPNQDAVILCQGFGMEDGVFCGVFDGHGRCGQFISKLVRDYLPFMILSHRNALLMGSDD  117

Query  334   AKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDE  513
                +  +L            +W+EAC +AF+ MDK++K    +DC  SG+TAV AI+Q +
Sbjct  118   DDDDPAQL----------LEEWREACANAFEAMDKELKLQANVDCNFSGTTAVCAIKQGK  167

Query  514   DLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQ  690
             DL+VANLGDSRAVL   +D G +KA+QLTTD KP+VP EAERI++CNGRV ALK+EP + 
Sbjct  168   DLIVANLGDSRAVLATMSDTGYLKAVQLTTDQKPNVPQEAERIKRCNGRVFALKDEPSVL  227

Query  691   RVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSND  870
             RVWLP+ED PGLAM+R+ GD+ LK HG++S PEV++  ++P D F++LATDGVWDVLSN+
Sbjct  228   RVWLPDEDCPGLAMARSLGDYRLKRHGVVSEPEVTHRRVAPGDLFIILATDGVWDVLSNE  287

Query  871   EVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             EV+S VC+     ++ A+KAV EAA   W+ R+P SR DDC+A+CLFL+
Sbjct  288   EVVSIVCATPR--KQHASKAVAEAAAQRWRTRYPTSRVDDCSAVCLFLR  334



>gb|KFK26385.1| hypothetical protein AALP_AA8G241700 [Arabis alpina]
Length=334

 Score =   315 bits (807),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 177/341 (52%), Positives = 230/341 (67%), Gaps = 24/341 (7%)
 Frame = +1

Query  31    MGICISKASS--EIH-DADYGQEN-VVHFGDCNG------VEVIASAFSHPGSKGINQDA  180
             MG C S  SS  EIH D +YG  N VV +G+  G      V  + S  S  GSK  NQD 
Sbjct  1     MGHCFSLPSSQSEIHEDNEYGDGNAVVCYGEEFGLDQDLPVHRLGSVCSVQGSKAHNQDN  60

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD  360
             AILY GYG    + CG+FDGHGKNGH VSK VRN LPSL       +   + +LN     
Sbjct  61    AILYLGYGTGDAELCGVFDGHGKNGHMVSKTVRNRLPSL-------MSTFKKELN----Q  109

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
             +    E     KW++AC++AF+++D+++  ++  DC  SGSTAV+A+ Q +DL++ANLGD
Sbjct  110   ESHVGEEDEAHKWEQACLAAFRIVDREL-LLQVFDCAFSGSTAVVAVTQGDDLMIANLGD  168

Query  541   SRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDT  717
             SRAVLG   ++G + A+QLT+DL P+VP EAERIR C GRV+A+K EP  QRVWLPN D 
Sbjct  169   SRAVLGTMNEDGEISAVQLTSDLTPAVPSEAERIRMCKGRVLAMKTEPSSQRVWLPNHDI  228

Query  718   PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSA  897
             PGLAMSRAFGDF LK HG+I+ PEVS+H ++  D F+VLA+DGVWD+L+NDEV+S + S+
Sbjct  229   PGLAMSRAFGDFRLKDHGVIAVPEVSHHRITSRDQFIVLASDGVWDMLTNDEVVSLIWSS  288

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              +  +  AAK V EAA   WK++  +S+ DD T ICLFL K
Sbjct  289   VKK-QATAAKLVAEAAEATWKKKLKSSKIDDITVICLFLHK  328



>ref|XP_009388680.1| PREDICTED: probable protein phosphatase 2C 12 [Musa acuminata 
subsp. malaccensis]
Length=338

 Score =   315 bits (808),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 178/340 (52%), Positives = 232/340 (68%), Gaps = 14/340 (4%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDC---NGVEVIASAFSHPGSKGINQDAAILYQGY  201
             MGIC S AS E    D     V+   D     G+  +A  +S  G KG+NQDAAIL + Y
Sbjct  1     MGICFSSASLEKQVRDENSVFVLEDDDSCPERGMRRLACLYSQQGKKGLNQDAAILCKDY  60

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTEN  381
             G E G FCG+FDGHG++GH VS++VR++LP+L L Q   L        +   DD  + + 
Sbjct  61    GVEDGVFCGVFDGHGRSGHIVSRMVRDNLPALLLSQHNALLLDDEDHRSAGGDDTSSADG  120

Query  382   KSFL--------KWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLG  537
             + F         +WKEAC+ AF+ MD ++++   LDC  SGSTAV  I+Q  D+++ANLG
Sbjct  121   EEFSDVSPDMFDEWKEACIKAFRDMDNELEEQLHLDCSCSGSTAVSVIQQGRDMIIANLG  180

Query  538   DSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNED  714
             DSRAVLG  + +G ++A+QLT DLKP+VP EAERI+K NGRV A K+EPH+QRVWLP+ D
Sbjct  181   DSRAVLGTVSVDGRLEAVQLTIDLKPNVPQEAERIKKNNGRVFARKDEPHVQRVWLPDVD  240

Query  715   TPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCS  894
              PGLAM+RAFGDF LK +G+IS P+V+YH LS  D F+VLATDGVWDVL N+ V+S V S
Sbjct  241   FPGLAMARAFGDFELKNYGVISIPQVAYHRLSDRDRFVVLATDGVWDVLDNEMVVSIVSS  300

Query  895   AYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
               +  +E A+KAVVEAAV AW+  FP+S+ DDC+A CLF 
Sbjct  301   TGK--KEEASKAVVEAAVRAWRFTFPSSKVDDCSAACLFF  338



>ref|XP_002451800.1| hypothetical protein SORBIDRAFT_04g007930 [Sorghum bicolor]
 gb|EES04776.1| hypothetical protein SORBIDRAFT_04g007930 [Sorghum bicolor]
Length=381

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 231/360 (64%), Gaps = 35/360 (10%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD----------CNGVEVIASAFSHPGSKGINQDA  180
             MGIC S  S  +   +   ENVV+  D                +AS FS  G KG NQDA
Sbjct  1     MGICAS--SKRVQQEEDSDENVVYVMDEQGGGGGPDGDGHGRKVASLFSQKGKKGPNQDA  58

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQ---------------AK  315
              IL QG+G E G FCG+FDGHG+ G Y+SKLVR++LP + L                 A 
Sbjct  59    VILCQGFGMEDGVFCGVFDGHGRCGQYISKLVRDYLPFMILSHRNALLLGSSEDDDDAAV  118

Query  316   FLPKIRAKLNTNKLDDGDTTENKS-----FLKWKEACVSAFKLMDKQIKQVEKLDCCTSG  480
             F        +     DG    + +       +W+EAC +AF+ MDK++K    +DC  SG
Sbjct  119   FSDASPVASSAASSTDGSGRSSPAPAAQLLEEWREACANAFQAMDKELKLQANVDCNFSG  178

Query  481   STAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGR  657
             +TAV AI+Q +DL+VANLGDSRAVL   +D G +KA+QLTTD KP+VP EAERI++CNGR
Sbjct  179   TTAVCAIKQGKDLIVANLGDSRAVLATMSDTGYLKAVQLTTDQKPNVPQEAERIKRCNGR  238

Query  658   VIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLA  837
             V ALK+EP + RVWLP+ED PGLAM+R+ GD+ LK HG++S PEV++  ++P D F++LA
Sbjct  239   VFALKDEPSVLRVWLPDEDCPGLAMARSLGDYRLKRHGVVSEPEVTHRRVAPGDLFIILA  298

Query  838   TDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             TDGVWDVLSN+EV+S VC+     ++ A+KAV EAA   W+ R+P SR DDC+A+CLFL+
Sbjct  299   TDGVWDVLSNEEVVSIVCATPR--KQHASKAVAEAAAQRWRTRYPASRVDDCSAVCLFLR  356



>ref|XP_008645636.1| PREDICTED: probable protein phosphatase 2C 12 [Zea mays]
 gb|AFW71292.1| putative protein phosphatase 2C family protein [Zea mays]
Length=377

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/363 (48%), Positives = 232/363 (64%), Gaps = 39/363 (11%)
 Frame = +1

Query  31    MGICIS--KASSEIHDADYGQENVVHFGD---------------CNGVEVIASAFSHPGS  159
             MGIC S  +   E  D+D   ENVV+  D                     +AS FS  G 
Sbjct  1     MGICASSKRVRQEEQDSD---ENVVYVMDEQGGGGEGEDGRGARAAASRKVASLFSQKGK  57

Query  160   KGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFL------  321
             KG NQDA IL QG+G E G FCG+FDGHG+ G ++SKLVR++LP + L     L      
Sbjct  58    KGPNQDAVILCQGFGMEDGVFCGVFDGHGRCGQFISKLVRDYLPFMILSHRNALLMGSDD  117

Query  322   ----PKIRAKLNTNKLDDGDTTENKS------FLKWKEACVSAFKLMDKQIKQVEKLDCC  471
                 P       +      D +   S        +W+EAC +AF+ MDK++K    +DC 
Sbjct  118   DDDDPAFSDASASASASSTDGSGQSSPAPAQLLEEWREACANAFEAMDKELKLQANVDCN  177

Query  472   TSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKC  648
              SG+TAV AI+Q +DL+VANLGDSRAVL   +D G +KA+QLTTD KP+VP EAERI++C
Sbjct  178   FSGTTAVCAIKQGKDLIVANLGDSRAVLATMSDTGYLKAVQLTTDQKPNVPQEAERIKRC  237

Query  649   NGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFL  828
             NGRV ALK+EP + RVWLP+ED PGLAM+R+ GD+ LK HG++S PEV++  ++P D F+
Sbjct  238   NGRVFALKDEPSVLRVWLPDEDCPGLAMARSLGDYRLKRHGVVSEPEVTHRRVAPGDLFI  297

Query  829   VLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICL  1008
             +LATDGVWDVLSN+EV+S VC+     ++ A+KAV EAA   W+ R+P SR DDC+A+CL
Sbjct  298   ILATDGVWDVLSNEEVVSIVCATPR--KQHASKAVAEAAAQRWRTRYPTSRVDDCSAVCL  355

Query  1009  FLQ  1017
             FL+
Sbjct  356   FLR  358



>gb|KHN37016.1| Hypothetical protein glysoja_009044 [Glycine soja]
Length=313

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 207/299 (69%), Gaps = 16/299 (5%)
 Frame = +1

Query  31   MGICISKASSEIHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQGY  201
            MGICIS A  E HD D    NV  F      NG + + S +S  GSKG+NQDAA +++GY
Sbjct  1    MGICISVAE-EAHDDD----NVTIFEARKVLNGSQRLCSVYSKQGSKGLNQDAASVHEGY  55

Query  202  GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKI----RAKLNTNKLDDGD  369
            G E G FCG++DGHG NGH VSK+V + L SL L Q   L +I        NT K     
Sbjct  56   GMEDGTFCGVYDGHGGNGHKVSKIVSSRLSSLILDQKNVLERIDEIENGYNNTTKKHVNS  115

Query  370  TTEN---KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
              E    ++F KWKEA VSAFK+MDK++K  + LDC +SG+TAV+ I+Q E LV+ANLGD
Sbjct  116  VKEELPARNFQKWKEAIVSAFKVMDKEVKLQKNLDCFSSGTTAVVIIKQGEGLVIANLGD  175

Query  541  SRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLP-NEDT  717
            SRAVLG   D  + AIQLTTDLKP +P EAERIR+CNG V    EEP IQRVW+P NE++
Sbjct  176  SRAVLGTIYDEKLVAIQLTTDLKPELPREAERIRRCNGCVCGSNEEPDIQRVWMPNNENS  235

Query  718  PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCS  894
            PGLAMSR+ GDF+LK HG+I+ P+VSYH L+  D F+VLA+DGVWDVLSN+EV S V S
Sbjct  236  PGLAMSRSLGDFLLKDHGVIAIPDVSYHPLTSTDQFIVLASDGVWDVLSNNEVASIVWS  294



>ref|XP_007227318.1| hypothetical protein PRUPE_ppa016423mg [Prunus persica]
 gb|EMJ28517.1| hypothetical protein PRUPE_ppa016423mg [Prunus persica]
Length=326

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 225/339 (66%), Gaps = 35/339 (10%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDE  210
             MG+CIS ++ +I D      +     D NG+++  S +S  GSKG+NQD+AILYQGYG E
Sbjct  1     MGLCISSSAHKIQDGHEAPMSFERTDDSNGIQMHGSLYSLEGSKGVNQDSAILYQGYGLE  60

Query  211   SGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPK----------IRAKLNTNKLD  360
             +  FCG+FDGHG+ GH VS+LVR++LPSL   Q K L +           +  ++  + +
Sbjct  61    AEAFCGVFDGHGRFGHRVSQLVRSNLPSLLQGQMKALDQQAIAVAEDDDSKNHIDRIETE  120

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
               D+  +K F KWKEA VS+FK+MDK+IK  E LD   SG+TAV+ I+Q EDL +ANLGD
Sbjct  121   SEDSEPSKKFHKWKEAFVSSFKVMDKEIKLQENLDSSCSGTTAVVVIKQGEDLFIANLGD  180

Query  541   SRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             SRAVLG   +NG++AIQLTTDLKP++P EAERIR C+GRV+ALK+EP+IQR         
Sbjct  181   SRAVLGTTRENGIEAIQLTTDLKPALPSEAERIRACDGRVVALKQEPNIQR---------  231

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
                            HGII+TP+VSY  L+  D F+VLATDGVWDVLSN EV S V  A 
Sbjct  232   --------------DHGIIATPDVSYRRLTSKDRFVVLATDGVWDVLSNLEVASIVWEAD  277

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
                 + AAKAV E AV  W+R+FP+++ DDCT +CLFLQ
Sbjct  278   SA--QAAAKAVTETAVATWRRKFPSAKIDDCTVVCLFLQ  314



>ref|XP_006290118.1| hypothetical protein CARUB_v10003772mg [Capsella rubella]
 gb|EOA23016.1| hypothetical protein CARUB_v10003772mg [Capsella rubella]
Length=331

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 233/337 (69%), Gaps = 25/337 (7%)
 Frame = +1

Query  31    MGICIS--KASSEIHDA-DYGQEN-VVHFGDCNGVEV---IASAFSHPGSKGINQDAAIL  189
             MG C S   +SSEIH+  ++G  N VV +G+ + + V   + S  S  G+KG NQD A+L
Sbjct  1     MGHCFSLPSSSSEIHEENEHGDGNAVVCYGEDHDLMVHHRLGSVCSIQGTKGHNQDHAVL  60

Query  190   YQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGD  369
             Y GYG    + CG+FDGHGKNGH VSK+VRN LPS+ L              T K  + +
Sbjct  61    YLGYGTRDTELCGVFDGHGKNGHMVSKMVRNRLPSVLL--------------TLKNQESN  106

Query  370   TTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRA  549
               E +   KW++AC +AF+L+D+++  ++  DC  SGST V+AI Q +DLV+ANLGDSRA
Sbjct  107   VCEEEDH-KWEKACFTAFRLIDREL-NLQVFDCSFSGSTGVVAITQGDDLVIANLGDSRA  164

Query  550   VLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGL  726
             VLG  T++G ++A+QLT+DL P VP EAERIR C GRV A+K EP  QRVWLPN+D PGL
Sbjct  165   VLGTMTEDGDIRAVQLTSDLTPDVPSEAERIRMCKGRVFAMKAEPCSQRVWLPNQDIPGL  224

Query  727   AMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEY  906
             AMSRAFGDF LK HG+I+ PEVS + ++  D FLVLATDGVWD+LSNDEV+S V S+ + 
Sbjct  225   AMSRAFGDFRLKDHGVIAVPEVSRYRMTSKDQFLVLATDGVWDMLSNDEVVSLVWSSRKK  284

Query  907   GeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              ++ AAK V EAA   WK++  +++ DD + ICLFLQ
Sbjct  285   -QDTAAKLVAEAAEATWKKKLKSTKIDDISIICLFLQ  320



>ref|XP_010669211.1| PREDICTED: probable protein phosphatase 2C 72 [Beta vulgaris 
subsp. vulgaris]
Length=307

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 170/335 (51%), Positives = 223/335 (67%), Gaps = 34/335 (10%)
 Frame = +1

Query  31    MGICISKASSEIHDADYG-QENVVHF----GDCNGVEVIASAFSHPGSKGINQDAAILYQ  195
             MG C S + +++H+  YG  +N  H      D    + +    S  G+KG+NQDAAILY+
Sbjct  1     MGNCTS-SKTQVHE--YGFHDNSWHVEADVDDNRNHKKVGCMQSQQGAKGLNQDAAILYE  57

Query  196   GYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTT  375
             GYG + G  C +FDGHG+ GH VSK +RN LPSL L Q K +                  
Sbjct  58    GYGMKDGTLCAVFDGHGRLGHKVSKFIRNQLPSLLLDQRKSM------------------  99

Query  376   ENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVL  555
                   KW EA VS F+ MD++IK  E +D   SG+TA++AI+Q +D+V+ANLGDSRAVL
Sbjct  100   ------KWNEAFVSTFEAMDEEIKLHEDVDFINSGTTALVAIKQGDDVVIANLGDSRAVL  153

Query  556   GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMS  735
             G  T+NG++A QLT DLKP +P EAERI+ CNG V ALK +P +QRVW P ED P LAMS
Sbjct  154   GTLTENGIEATQLTVDLKPDLPAEAERIKICNGLVYALKHQPDVQRVWSPEEDGPCLAMS  213

Query  736   RAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGee  915
             R FGDF +K +G+I+TPE+S+H ++  D F+VLA+DGVWD LSN+EV+S V +     +E
Sbjct  214   RTFGDFDMKSYGVIATPEISHHRVTTKDQFIVLASDGVWDALSNEEVVSVVWAT--KNKE  271

Query  916   maakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              AAKAVV  A  AWKR+FP++R DDCT +CLFLQ+
Sbjct  272   SAAKAVVYEARTAWKRKFPSTRVDDCTVVCLFLQE  306



>ref|NP_197973.2| putative protein phosphatase 2C 72 [Arabidopsis thaliana]
 sp|Q9XGZ9.2|P2C72_ARATH RecName: Full=Probable protein phosphatase 2C 72; Short=AtPP2C72 
[Arabidopsis thaliana]
 gb|AED93513.1| putative protein phosphatase 2C 72 [Arabidopsis thaliana]
Length=331

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 235/339 (69%), Gaps = 24/339 (7%)
 Frame = +1

Query  31    MGICISKASS--EIH-DADYGQENVVHFGDCNG------VEVIASAFSHPGSKGINQDAA  183
             MG C S  SS  EIH D ++G  NVV +G+  G      V  + S  S  G+K +NQD A
Sbjct  1     MGHCFSLPSSQSEIHEDNEHGDGNVVCYGEEFGLDQDLPVHRLGSVCSIQGTKVLNQDHA  60

Query  184   ILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDD  363
             +LYQGYG    + CG+FDGHGKNGH VSK+VRN LPS+ L        ++ +LN     +
Sbjct  61    VLYQGYGTRDTELCGVFDGHGKNGHMVSKMVRNRLPSVLLA-------LKEELN----QE  109

Query  364   GDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDS  543
              +  E ++  KW++AC +AF+L+D+++  ++  +C  SGST V+AI Q +DLV+ANLGDS
Sbjct  110   SNVCEEEAS-KWEKACFTAFRLIDRELN-LQVFNCSFSGSTGVVAITQGDDLVIANLGDS  167

Query  544   RAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RAVLG  T++G +KA+QLT+DL P VP EAERIR C GRV A+K EP  QRVWLPN++ P
Sbjct  168   RAVLGTMTEDGEIKAVQLTSDLTPDVPSEAERIRMCKGRVFAMKTEPSSQRVWLPNQNIP  227

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
             GLAMSRAFGDF LK HG+I+ PE+S H ++  D FLVLATDGVWD+LSNDEV+S + S+ 
Sbjct  228   GLAMSRAFGDFRLKDHGVIAVPEISQHRITSKDQFLVLATDGVWDMLSNDEVVSLIWSSG  287

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             +  +  AAK V EAA  AWK+R   ++ DD T ICLFLQ
Sbjct  288   KK-QASAAKMVAEAAEAAWKKRLKYTKVDDITVICLFLQ  325



>ref|XP_010454947.1| PREDICTED: probable protein phosphatase 2C 72 [Camelina sativa]
Length=338

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 174/341 (51%), Positives = 232/341 (68%), Gaps = 26/341 (8%)
 Frame = +1

Query  31    MGICIS--KASSEIHDA-DYGQENVV------HFGDCNGVEV--IASAFSHPGSKGINQD  177
             MG C S   +SSEIH+  ++G  N V       FG  + + V  + S  S  G+KG+NQD
Sbjct  1     MGHCFSLPSSSSEIHEENEHGDGNAVVCYGEDQFGSDHDLPVHRLGSVCSIQGTKGLNQD  60

Query  178   AAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKL  357
              A+L  GYG    + CG+FDGHGKNGH VSK+VRN LPS+ L        ++ +LN    
Sbjct  61    HAVLNLGYGTRDTELCGVFDGHGKNGHMVSKVVRNRLPSILLT-------LKKELN----  109

Query  358   DDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLG  537
              + +  E ++  KW++AC +AF+L+D+++  ++  DC  SGST V+AI Q +DLV+ANLG
Sbjct  110   QESNVCEEEAH-KWEKACFTAFRLIDREL-NLQVFDCSFSGSTGVVAITQGDDLVIANLG  167

Query  538   DSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNED  714
             DSRAVLG  T++G ++A+QLT+DL P VP EAERIR C GRV A+K EP  QRVWLP +D
Sbjct  168   DSRAVLGTMTEDGEIRAVQLTSDLTPDVPSEAERIRMCKGRVFAMKTEPCSQRVWLPKQD  227

Query  715   TPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCS  894
              PGLAMSRAFGDF LK HG+I+ PEV  H L+  D FLVLATDGVWD+LSNDEV+S + S
Sbjct  228   IPGLAMSRAFGDFRLKDHGVIAVPEVFQHRLTSKDQFLVLATDGVWDMLSNDEVVSLIWS  287

Query  895   AYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             + +  +  AAK V E+A   WK++  +++ DD T +CLFLQ
Sbjct  288   SGKK-QVAAAKLVAESAEATWKKKLKSTKIDDITVVCLFLQ  327



>ref|XP_010493859.1| PREDICTED: probable protein phosphatase 2C 72 [Camelina sativa]
Length=337

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 177/341 (52%), Positives = 231/341 (68%), Gaps = 27/341 (8%)
 Frame = +1

Query  31    MGICIS--KASSEIHDA-DYGQENVV------HFGDCNGVEV--IASAFSHPGSKGINQD  177
             MG C S   +SSEIH+  ++G  N V       FG  + + V  + S  S  G+KG+NQD
Sbjct  1     MGHCFSLPSSSSEIHEENEHGDGNAVVCYGEDQFGLDHDLPVHRLGSVCSIQGTKGLNQD  60

Query  178   AAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKL  357
              A+L  GYG    + CG+FDGHGKNGH VSK+VRN LPS+ L   K L +      +N  
Sbjct  61    HAVLNLGYGTRDTELCGVFDGHGKNGHMVSKMVRNRLPSVLLTLKKELNQ-----ESNVC  115

Query  358   DDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLG  537
             D+G         KW++AC +AF+L+D+++  ++  DC  SGST V+AI Q +DLV+ANLG
Sbjct  116   DEGH--------KWEKACFTAFRLIDREL-NLQVFDCSFSGSTGVVAITQGDDLVIANLG  166

Query  538   DSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNED  714
             DSRAVLG  T++G ++A+QLT+DL P VP EAERIR C GRV A+K EP  QRVWLP +D
Sbjct  167   DSRAVLGTMTEDGEIRAVQLTSDLTPDVPSEAERIRMCKGRVFAMKTEPCSQRVWLPKQD  226

Query  715   TPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCS  894
              PGLAMSRAFGDF LK HG+I+ PEV  H ++  D FLVLATDGVWD+LSNDEV+S + S
Sbjct  227   IPGLAMSRAFGDFRLKDHGVIAVPEVFQHRITSKDQFLVLATDGVWDMLSNDEVVSLIWS  286

Query  895   AYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             + +  +  AAK+V EAA   WK++  +++ DD T ICLFLQ
Sbjct  287   SGKK-QVAAAKSVAEAAEATWKKKLKSTKIDDITVICLFLQ  326



>dbj|BAJ98729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 230/353 (65%), Gaps = 30/353 (8%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQ---ENVVHFGDCNG------VEVIASAFSHPGSKGINQDAA  183
             MGIC   ASSE H    GQ   E++V+  D  G         +AS FS  G KG NQDA 
Sbjct  1     MGIC---ASSE-HLGQQGQDADESIVYVMDEEGGGGASSPREVASLFSQKGKKGPNQDAV  56

Query  184   ILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTN----  351
             IL QG+G E G FCG+FDGHG+ GH VSKLVR++LP + L     L    A+ N +    
Sbjct  57    ILCQGFGMEDGVFCGVFDGHGRCGHLVSKLVRDYLPFMVLSHRNALLLADAEANADDPVF  116

Query  352   ----------KLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAI  501
                          +     ++   +W EAC +AFK MD ++K    +DC  SG+TAV AI
Sbjct  117   SDASPSSSADSSGNSSPHPSQMLEEWTEACTNAFKAMDNELKLQANMDCAFSGTTAVCAI  176

Query  502   RQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEE  678
             +Q +DL++ANLGDSRAVL   +    +KA+QLTTD KP +P EAERI++C GRV AL+EE
Sbjct  177   KQGKDLIIANLGDSRAVLATMSGACYLKAVQLTTDQKPGLPEEAERIKRCEGRVFALREE  236

Query  679   PHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDV  858
             P + RVWLP E+ PGLAM+RA GD  LK+HG+ISTP+V+ H +S  D F++LATDGVWDV
Sbjct  237   PGVMRVWLPGENLPGLAMARALGDSRLKHHGVISTPQVTGHRISEADLFIILATDGVWDV  296

Query  859   LSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             LSN+EV+S VC+     ++ A+KAV EAAV  WK ++P+SR DDC+A+CLFL 
Sbjct  297   LSNEEVVSIVCATPR--KQHASKAVAEAAVQRWKTKYPSSRVDDCSAVCLFLH  347



>gb|AFW66022.1| putative protein phosphatase 2C family protein [Zea mays]
Length=382

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/315 (53%), Positives = 213/315 (68%), Gaps = 20/315 (6%)
 Frame = +1

Query  127   VIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLK  306
             V AS FS  G KG NQDA IL QG+G E G FCG+FDGHG+ G  VSKL R+HLP + L 
Sbjct  50    VAASLFSQKGKKGPNQDAVILCQGFGMEDGVFCGVFDGHGRCGQLVSKLARDHLPFMILS  109

Query  307   QAKFL-----------PKIRAKLNTNKLDDGDTTENKS------FLKWKEACVSAFKLMD  435
             Q   L               A    +   DG  +E  S        +W+EAC +AF+ MD
Sbjct  110   QRNALLLGSDDDGDGPAFSDASPAASSSTDGSRSERSSPAPAQMLEEWREACANAFEAMD  169

Query  436   KQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKP  612
             +++    K+DC  SG+TAV AI+Q EDLVVANLGDSRAVL   ++ G +KA+QLTTD KP
Sbjct  170   RELGVQAKVDCDFSGTTAVCAIKQGEDLVVANLGDSRAVLATVSETGYLKAVQLTTDQKP  229

Query  613   SVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEV  792
             +VP EAERI++CNGRV ALK+E  + RVWLP+ED PGLAM+R+ GD  LK HG++S PEV
Sbjct  230   NVPQEAERIKRCNGRVFALKDEASVPRVWLPDEDCPGLAMARSLGDHRLKRHGVVSEPEV  289

Query  793   SYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFP  972
             ++  ++P D FLVLATDGVWDVLSN EV+S VC+     ++ A+KAV +AA   W+ R+P
Sbjct  290   AHRRVAPGDLFLVLATDGVWDVLSNQEVVSIVCATPR--KQHASKAVAQAAAQRWRTRYP  347

Query  973   NSRRDDCTAICLFLQ  1017
              SR DDC+A CLFL+
Sbjct  348   ASRVDDCSAACLFLR  362



>ref|NP_001151594.1| catalytic/ protein phosphatase type 2C [Zea mays]
 gb|ACG43472.1| catalytic/ protein phosphatase type 2C [Zea mays]
Length=379

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 213/315 (68%), Gaps = 20/315 (6%)
 Frame = +1

Query  127   VIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLK  306
             V AS FS  G KG NQDA IL QG+G E G FCG+FDGHG+ G  VSKL R+HLP + L 
Sbjct  47    VAASLFSQKGKKGPNQDAVILCQGFGMEDGVFCGVFDGHGRCGQLVSKLARDHLPFMILS  106

Query  307   QAKFL-----------PKIRAKLNTNKLDDGDTTENKS------FLKWKEACVSAFKLMD  435
             Q   L               A    +   DG  +E  S        +W+EAC +AF+ MD
Sbjct  107   QRNALLLGSDDDGDGPAFSDASPAASSSTDGSRSERSSPAPAQMLEEWREACANAFEAMD  166

Query  436   KQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKP  612
             +++    K+DC  SG+TAV AI+Q EDLVVANLGDSRAVL   ++ G +KA QLTTD KP
Sbjct  167   RELGVQAKVDCDFSGTTAVCAIKQGEDLVVANLGDSRAVLATVSETGYLKAGQLTTDQKP  226

Query  613   SVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEV  792
             SVP EAERI++CNGRV ALK+E  + RVWLP+ED PGLAM+R+ GD  LK HG++S PEV
Sbjct  227   SVPQEAERIKRCNGRVFALKDEASVPRVWLPDEDCPGLAMARSLGDHRLKRHGVVSEPEV  286

Query  793   SYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFP  972
             ++  ++P D FLVLATDGVWDVLSN+EV+S VC+     ++ A+KAV +AA   W+ R+P
Sbjct  287   AHRRVAPGDLFLVLATDGVWDVLSNEEVVSIVCATPR--KQHASKAVAQAAAQRWRTRYP  344

Query  973   NSRRDDCTAICLFLQ  1017
              SR DDC+A CLFL+
Sbjct  345   ASRVDDCSAACLFLR  359



>ref|XP_010421458.1| PREDICTED: probable protein phosphatase 2C 72 [Camelina sativa]
Length=338

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 174/341 (51%), Positives = 232/341 (68%), Gaps = 26/341 (8%)
 Frame = +1

Query  31    MGICIS--KASSEIHDA-DYGQENVV------HFGDCNGVEV--IASAFSHPGSKGINQD  177
             MG C S   +SSEIH+  ++G  N V       FG  + + V  + S  S  G+KG+NQD
Sbjct  1     MGHCFSLPSSSSEIHEENEHGDGNAVVCYGEDQFGLDHDLLVHRLGSVCSIQGTKGLNQD  60

Query  178   AAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKL  357
              A+L  GYG    + CG+FDGHGKNGH VSK+VRN LPS+ L        ++ +LN    
Sbjct  61    HAVLNLGYGTRDTELCGVFDGHGKNGHMVSKMVRNRLPSILLT-------LKKELN----  109

Query  358   DDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLG  537
              + +  E ++  KW++AC +AF+L+D+++  ++  DC  SGST V+AI Q +DLV+ANLG
Sbjct  110   QESNVCEEEAH-KWEKACFTAFRLIDREL-NLQVFDCSFSGSTGVVAITQGDDLVIANLG  167

Query  538   DSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNED  714
             DSRAVLG  T++G ++A+QLT+DL P VP EAERIR C GRV A+K EP  QRVWLP +D
Sbjct  168   DSRAVLGTMTEDGEIRAVQLTSDLTPDVPSEAERIRMCKGRVFAMKTEPCSQRVWLPKQD  227

Query  715   TPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCS  894
              PGLAMSRAFGDF LK HG+I+ PEV  H ++  D FLVLATDGVWD+LSNDEV+S + S
Sbjct  228   IPGLAMSRAFGDFRLKDHGVIAVPEVFQHRITSKDQFLVLATDGVWDMLSNDEVVSLIWS  287

Query  895   AYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             + +  +  AAK V EAA   WK++  +++ DD T +CLFLQ
Sbjct  288   SGKK-QVAAAKLVAEAAEATWKKKLKSTKIDDITVVCLFLQ  327



>emb|CDX88210.1| BnaA06g28010D [Brassica napus]
Length=338

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 178/340 (52%), Positives = 234/340 (69%), Gaps = 24/340 (7%)
 Frame = +1

Query  31    MGICIS--KASSEIHDA-DYGQEN-VVHFGDCNG------VEVIASAFSHPGSKGINQDA  180
             MG C S   +SSEIH+  ++G  N VV +GD  G      V    S  S  G+K INQD 
Sbjct  1     MGHCFSLPSSSSEIHEENEHGDGNAVVCYGDEFGLDHYRPVHRPGSVCSIQGTKAINQDN  60

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD  360
             AILY GYG E  + CG+FDGHGKNGH VSK+ RN LPSL L        ++ +LN    +
Sbjct  61    AILYLGYGTEEAELCGVFDGHGKNGHMVSKMARNRLPSLLLT-------LKKELN----E  109

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
             +    E    LKW++AC +AF+L+D+++  ++  +C  SGSTAV+AI Q +DL++ANLGD
Sbjct  110   EPHACEEDEALKWEKACFNAFRLIDREL-MLQVFNCSFSGSTAVVAITQGDDLMIANLGD  168

Query  541   SRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDT  717
             SRAVLG  T++G + A+QLT+DL P VP EAERIR C GRV A+K EP  QRVWLPN+D 
Sbjct  169   SRAVLGTMTEDGEICAVQLTSDLTPDVPSEAERIRACRGRVHAMKAEPSSQRVWLPNQDI  228

Query  718   PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSA  897
             PGLAMSRAFGDF LK +G+I+ PEVS+H ++  D FLVLA+DGVWD+L+NDEV+S + ++
Sbjct  229   PGLAMSRAFGDFRLKDYGVIAVPEVSHHRITSKDRFLVLASDGVWDMLTNDEVVSLIWNS  288

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              +  ++MAAK V E A   WK++  + + DD T ICLFLQ
Sbjct  289   GKT-QDMAAKLVAEVAEATWKKKLKSKKIDDITVICLFLQ  327



>gb|AAD40128.1|AF149413_9 similiar to protein phosphatase 2C; Pfam PF00481, Score=156.7, 
E=1.5e-43, N=1 [Arabidopsis thaliana]
Length=337

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 180/345 (52%), Positives = 235/345 (68%), Gaps = 30/345 (9%)
 Frame = +1

Query  31    MGICISKASS--EIH-DADYGQENVVHFGDCNG------VEVIASAFSHPGSKGINQDAA  183
             MG C S  SS  EIH D ++G  NVV +G+  G      V  + S  S  G+K +NQD A
Sbjct  1     MGHCFSLPSSQSEIHEDNEHGDGNVVCYGEEFGLDQDLPVHRLGSVCSIQGTKVLNQDHA  60

Query  184   ILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDD  363
             +LYQGYG    + CG+FDGHGKNGH VSK+VRN LPS+ L        ++ +LN     +
Sbjct  61    VLYQGYGTRDTELCGVFDGHGKNGHMVSKMVRNRLPSVLLA-------LKEELN----QE  109

Query  364   GDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDS  543
              +  E ++  KW++AC +AF+L+D+++  ++  +C  SGST V+AI Q +DLV+ANLGDS
Sbjct  110   SNVCEEEAS-KWEKACFTAFRLIDRELN-LQVFNCSFSGSTGVVAITQGDDLVIANLGDS  167

Query  544   RAVLGRKTDNG-VKAIQLTTDLKPSVPC------EAERIRKCNGRVIALKEEPHIQRVWL  702
             RAVLG  T++G +KA+QLT+DL P VP       EAERIR C GRV A+K EP  QRVWL
Sbjct  168   RAVLGTMTEDGEIKAVQLTSDLTPDVPTSSSVSGEAERIRMCKGRVFAMKTEPSSQRVWL  227

Query  703   PNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMS  882
             PN++ PGLAMSRAFGDF LK HG+I+ PE+S H ++  D FLVLATDGVWD+LSNDEV+S
Sbjct  228   PNQNIPGLAMSRAFGDFRLKDHGVIAVPEISQHRITSKDQFLVLATDGVWDMLSNDEVVS  287

Query  883   TVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              + S+ +  +  AAK V EAA  AWK+R   ++ DD T ICLFLQ
Sbjct  288   LIWSSGKK-QASAAKMVAEAAEAAWKKRLKYTKVDDITVICLFLQ  331



>ref|XP_003571750.1| PREDICTED: probable protein phosphatase 2C 12 [Brachypodium distachyon]
Length=366

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 223/351 (64%), Gaps = 25/351 (7%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD--------CNGVEVIASAFSHPGSKGINQDAAI  186
             MGIC S    E        EN+V+  D         +    +AS FS  G KG NQDA I
Sbjct  1     MGICASSERLE-QQGQEADENIVYVMDEQGGGGGGASSPRKVASLFSQKGKKGPNQDAVI  59

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAK------------FLPKI  330
             L QG+G E G FCG+FDGHG+ GH +SKLVR++LP + L                F    
Sbjct  60    LCQGFGMEEGVFCGVFDGHGRCGHLISKLVRDYLPFMVLSHRNALLLADADDDPVFSDAS  119

Query  331   RAKLNTNKLDDGDTTENKSFLK-WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQ  507
              +  +T              L+ W+EAC +AF  MD ++K    +DC  SG+TAV AI+Q
Sbjct  120   PSSSSTGCSGGSSPQHPSQLLEEWREACTNAFNAMDNELKLQAGMDCSFSGTTAVCAIKQ  179

Query  508   DEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPH  684
              +DL++ANLGDSRAVL   +  G +KA+QLTTD KP VP EAERI++  GRV ALKEEP 
Sbjct  180   GKDLIIANLGDSRAVLATMSGTGFLKAVQLTTDQKPCVPQEAERIKRSEGRVFALKEEPG  239

Query  685   IQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLS  864
             + RVWLP ED PGLAM+RA GD  LK HG+ISTP+V+ H ++  D F++LATDGVWDVLS
Sbjct  240   VMRVWLPGEDCPGLAMARALGDARLKRHGVISTPQVTGHRVTAADLFIILATDGVWDVLS  299

Query  865   NDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             N+EV+S VC+     ++ A+KAVVEAAV  WK ++P+SR DDC+A+CLFLQ
Sbjct  300   NEEVVSIVCATPR--KQHASKAVVEAAVQRWKTKYPSSRVDDCSAVCLFLQ  348



>gb|EYU20377.1| hypothetical protein MIMGU_mgv1a012801mg [Erythranthe guttata]
Length=239

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 197/251 (78%), Gaps = 14/251 (6%)
 Frame = +1

Query  271   LVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENK--SFLKWKEACVSAFKLMDKQI  444
             +VRN LP+L L Q            T K   GD +     + +KWKEAC+S+FK++DK+I
Sbjct  1     MVRNRLPALILSQM-----------TEKFGSGDQSGLSIINLVKWKEACMSSFKVVDKEI  49

Query  445   KQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNGVKAIQLTTDLKPSVPC  624
             K V+ LDC  SGSTAV+ I+Q EDLVVANLGDSRAVLG ++++G+ A+QLTTDLKP V  
Sbjct  50    KLVDGLDCSCSGSTAVVVIKQGEDLVVANLGDSRAVLGTRSEDGIMAVQLTTDLKPGVKS  109

Query  625   EAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHN  804
             EAERIR+ NGRV+AL+ EPHIQRVWLP E++PGLAMSRAFGDF+LK HGII  P+V+YH 
Sbjct  110   EAERIRRLNGRVVALEAEPHIQRVWLPYENSPGLAMSRAFGDFVLKNHGIICIPDVTYHR  169

Query  805   LSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRR  984
             L+PND F+VLA+DGVWDV+SN+EVM  V S+  + EE AAKAVV+AA+ +WK +FPNS+R
Sbjct  170   LTPNDEFIVLASDGVWDVMSNNEVMGVVSSS-AHNEEAAAKAVVDAAIASWKHKFPNSKR  228

Query  985   DDCTAICLFLQ  1017
             DDCTAICLFLQ
Sbjct  229   DDCTAICLFLQ  239



>ref|XP_010536207.1| PREDICTED: probable protein phosphatase 2C 72 isoform X1 [Tarenaya 
hassleriana]
Length=364

 Score =   305 bits (782),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 181/373 (49%), Positives = 224/373 (60%), Gaps = 64/373 (17%)
 Frame = +1

Query  31    MGICISKASSEIHDAD----------YGQENVVHFGDCNGVEVIASAFSHPGSKGINQDA  180
             MG C S +SSEIH+ +          YG+E+    GD   V    S +S  GSKG+NQDA
Sbjct  1     MGHCFSVSSSEIHEENEFSDGNTMVCYGEES--GLGDDGPVWPSGSVWSIQGSKGLNQDA  58

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD  360
             A+LY GYG   G+ CG+FDGHGK+GH VSK+VRN LPSL L      P            
Sbjct  59    AVLYLGYGRGEGEMCGVFDGHGKSGHLVSKMVRNRLPSLLLTFKNQSPDDDDD-------  111

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
                        +W+EAC+SAF+L+D+++  ++  DC  SG+TAVIAIRQ  DLV+ANLGD
Sbjct  112   ----------GEWEEACLSAFRLIDREL-LLQTFDCSFSGTTAVIAIRQGNDLVLANLGD  160

Query  541   SRAVLGRKTDNG-VKAIQLTTDLKPSVP---------------C----------------  624
             SRAVLG  +++G + A+QLTTDLKP VP               C                
Sbjct  161   SRAVLGTVSEDGELGAVQLTTDLKPGVPREFLLLLLPPSLVSGCAKGLNQYRYPEFSCAA  220

Query  625   -EAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYH  801
              E ERI +CNGRV ALK EP+  RVWLPN D PGLAMSRAFGDF+LK +GII+ PEVS+ 
Sbjct  221   GEEERITRCNGRVFALKAEPYNPRVWLPNRDVPGLAMSRAFGDFVLKDYGIIAVPEVSHR  280

Query  802   NLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSR  981
              L+PND FLVLATDGVWDVLSNDEV+S V S  +        A    A    K++  +++
Sbjct  281   RLTPNDQFLVLATDGVWDVLSNDEVVSIVSSERKPASAAKLVAETAKAAWK-KKKLQSTK  339

Query  982   RDDCTAICLFLQK  1020
              DD T  CLFLQK
Sbjct  340   VDDITVACLFLQK  352



>ref|XP_006394849.1| hypothetical protein EUTSA_v10004521mg [Eutrema salsugineum]
 gb|ESQ32135.1| hypothetical protein EUTSA_v10004521mg [Eutrema salsugineum]
Length=342

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 180/340 (53%), Positives = 233/340 (69%), Gaps = 21/340 (6%)
 Frame = +1

Query  31    MGICIS--KASSEIHDA-DYGQEN-VVHFGDCNG------VEVIASAFSHPGSKGINQDA  180
             MG C S   +SSEIH+  D+G  N V+ +GD  G      V  + S  S  GSK +NQD 
Sbjct  1     MGHCFSLPSSSSEIHEENDHGDGNAVIRYGDEFGLDHDLPVHRLGSVCSIQGSKALNQDN  60

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD  360
             AILY GYG    + CG+FDGHGKNGH VSK++RN LPSL L        ++ +LN     
Sbjct  61    AILYLGYGTGDAELCGVFDGHGKNGHMVSKMLRNRLPSLLLT-------LKKELNQESHV  113

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
               +  E ++  KW++AC +AF+L+DK++  ++  DC  SGST+V+AI Q +DL++ANLGD
Sbjct  114   CEEEEEEETH-KWEKACFTAFRLIDKEL-LLQVFDCSFSGSTSVVAITQGDDLMIANLGD  171

Query  541   SRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDT  717
             SRAVLG  T++G + A+QLT+DL P VP EAERIR C GRV A+K EP  QRVWLPN D 
Sbjct  172   SRAVLGTMTEDGEISAVQLTSDLTPDVPSEAERIRMCKGRVHAMKGEPSSQRVWLPNHDI  231

Query  718   PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSA  897
             PGLAMSRAFGDF LK HG+I+ P VS+H ++  D FLVLATDGVWD+LSN+EV+S + S+
Sbjct  232   PGLAMSRAFGDFRLKDHGVIAVPVVSHHRITSKDRFLVLATDGVWDMLSNEEVVSLIWSS  291

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              +  + MAAK V EAA   WK++  + + DD T ICLFLQ
Sbjct  292   GKK-QAMAAKLVAEAAEATWKKKLKSKKIDDITVICLFLQ  330



>ref|XP_010536208.1| PREDICTED: probable protein phosphatase 2C 72 isoform X2 [Tarenaya 
hassleriana]
Length=362

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 181/373 (49%), Positives = 224/373 (60%), Gaps = 64/373 (17%)
 Frame = +1

Query  31    MGICISKASSEIHDAD----------YGQENVVHFGDCNGVEVIASAFSHPGSKGINQDA  180
             MG C S +SSEIH+ +          YG+E+    GD   V    S +S  GSKG+NQDA
Sbjct  1     MGHCFSVSSSEIHEENEFSDGNTMVCYGEES--GLGDDGPVWPSGSVWSIQGSKGLNQDA  58

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD  360
             A+LY GYG   G+ CG+FDGHGK+GH VSK+VRN LPSL L      P            
Sbjct  59    AVLYLGYGRGEGEMCGVFDGHGKSGHLVSKMVRNRLPSLLLTFKNQSPDDDDD-------  111

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
                        +W+EAC+SAF+L+D+++  ++  DC  SG+TAVIAIRQ  DLV+ANLGD
Sbjct  112   ----------GEWEEACLSAFRLIDREL-LLQTFDCSFSGTTAVIAIRQGNDLVLANLGD  160

Query  541   SRAVLGRKTDNG-VKAIQLTTDLKPSVP---------------C----------------  624
             SRAVLG  +++G + A+QLTTDLKP VP               C                
Sbjct  161   SRAVLGTVSEDGELGAVQLTTDLKPGVPREFLLLLLPPSLVSGCAKGLNQYRYPEFSCAA  220

Query  625   -EAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYH  801
              E ERI +CNGRV ALK EP+  RVWLPN D PGLAMSRAFGDF+LK +GII+ PEVS+ 
Sbjct  221   GEEERITRCNGRVFALKAEPYNPRVWLPNRDVPGLAMSRAFGDFVLKDYGIIAVPEVSHR  280

Query  802   NLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSR  981
              L+PND FLVLATDGVWDVLSNDEV+S V S  +        A    A    K++  +++
Sbjct  281   RLTPNDQFLVLATDGVWDVLSNDEVVSIVSSERKPASAAKLVAETAKAAWK-KKKLQSTK  339

Query  982   RDDCTAICLFLQK  1020
              DD T  CLFLQK
Sbjct  340   VDDITVACLFLQK  352



>ref|XP_009151115.1| PREDICTED: probable protein phosphatase 2C 72 [Brassica rapa]
Length=338

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 231/340 (68%), Gaps = 24/340 (7%)
 Frame = +1

Query  31    MGICIS--KASSEIHDA-DYGQEN-VVHFGDCNG------VEVIASAFSHPGSKGINQDA  180
             MG C S   +SSEIH+  ++G  N VV +GD  G      V    S  S  G+K INQD 
Sbjct  1     MGHCFSLPSSSSEIHEENEHGDGNAVVCYGDEFGLDHYRPVHRPGSVCSIQGTKAINQDN  60

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD  360
             AILY GYG E  + CG+FDGHGKNGH VSK+ RN LPSL L   K L            +
Sbjct  61    AILYLGYGTEEAELCGVFDGHGKNGHMVSKMARNRLPSLLLTLKKELD-----------E  109

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
             +    +    LKW++AC +AF+L+D+++  ++  +C  SGSTAV+AI Q +DL++ANLGD
Sbjct  110   EPHACQEDEALKWEKACFNAFRLIDREL-MLQVFNCSFSGSTAVVAITQGDDLMIANLGD  168

Query  541   SRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDT  717
             SRAVLG  T++G + A+QLT+DL P VP EAERIR C GRV A+K EP  QRVWLPN+D 
Sbjct  169   SRAVLGTMTEDGEICAVQLTSDLTPDVPSEAERIRACRGRVHAMKAEPSSQRVWLPNQDI  228

Query  718   PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSA  897
             PGLAMSRAFGDF LK +G+I+ PEVS+H ++  D FLVLA+DGVWD+L+NDEV+S + ++
Sbjct  229   PGLAMSRAFGDFRLKDYGVIAVPEVSHHRITSKDRFLVLASDGVWDMLTNDEVVSLIWNS  288

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              +  ++MAAK V E A   WK++  + + DD T ICLFLQ
Sbjct  289   GKT-QDMAAKLVAEVAEATWKKKLKSKKIDDITVICLFLQ  327



>emb|CDX80553.1| BnaC07g28910D [Brassica napus]
Length=338

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 179/340 (53%), Positives = 234/340 (69%), Gaps = 24/340 (7%)
 Frame = +1

Query  31    MGICIS--KASSEIHDA-DYGQEN-VVHFGDCNG------VEVIASAFSHPGSKGINQDA  180
             MG C S   +SSEIH+  ++G  N VV +GD  G      V    S  S  G+K INQD 
Sbjct  1     MGHCFSLPSSSSEIHEENEHGDGNAVVCYGDEFGLDHYRPVHRPGSVCSIQGTKAINQDN  60

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD  360
             AILY GYG E  + CG+FDGHGKNGH VSK+VRN LPSL L        ++ +LN    +
Sbjct  61    AILYLGYGTEEAELCGVFDGHGKNGHMVSKMVRNRLPSLVLT-------LKKELN----E  109

Query  361   DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGD  540
             +    E    LKW++AC +AF+L+D+++  ++  +C  SGSTAV+AI Q +DL++ANLGD
Sbjct  110   EPHACEEDEDLKWEKACFNAFRLIDREL-MLQVFNCSFSGSTAVVAITQGDDLMIANLGD  168

Query  541   SRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDT  717
             SRAVLG  T++G + A+QLT+DL P VP EAERIR C GRV A+K EP  QRVWLPN+D 
Sbjct  169   SRAVLGTMTEDGEICAVQLTSDLTPDVPSEAERIRACRGRVHAMKVEPSSQRVWLPNQDI  228

Query  718   PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSA  897
             PGLAMSRAFGDF LK +G+I+ PEVS+H ++  D FLVLA+DGVWD+LSNDEV+S + ++
Sbjct  229   PGLAMSRAFGDFRLKDYGVIAVPEVSHHRITSKDRFLVLASDGVWDMLSNDEVVSLIWNS  288

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              +  ++ AAK V EAA   WK++  + + DD T ICLFL 
Sbjct  289   GKT-QDAAAKLVAEAAEATWKKKLKSKKIDDITVICLFLH  327



>ref|XP_010669220.1| PREDICTED: probable protein phosphatase 2C 12 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/301 (53%), Positives = 218/301 (72%), Gaps = 11/301 (4%)
 Frame = +1

Query  133   ASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQA  312
              S  S  G K +NQD+A+L QGYG + G  CG+FDGHGKNGH+VSK ++  LP L +   
Sbjct  33    GSVHSQRGGKVVNQDSAVLCQGYGSQDGVLCGVFDGHGKNGHFVSKAIKQRLPLLIIDHK  92

Query  313   KFLPKIRAKLNTNKLDDGDTT-----ENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTS  477
               +    +K N +  +   TT       +   +W+EAC++AF+ MD++IK V+KLD   S
Sbjct  93    NAV----SKANEHYSECQSTTFKSSLPTQELREWEEACMNAFEEMDEEIKMVKKLDYSFS  148

Query  478   GSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGR  657
             GSTAVIA++Q +DL++ANLGDSRA+LG K +NGV A+QLT DLKP  P EA+RIR+  GR
Sbjct  149   GSTAVIALKQGDDLLIANLGDSRAILGTKGENGVTAVQLTIDLKPGTPDEADRIRRSRGR  208

Query  658   VIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLA  837
             V ALK+EP ++R WLP   +PG+AMSRAFGD ++K++GII+TP +++H ++ +D F++LA
Sbjct  209   VFALKDEPGMERAWLPRICSPGIAMSRAFGDCVMKHYGIIATPVITHHCITSDDQFILLA  268

Query  838   TDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             +DG+WDVLSN+EV S VCS     EEMAAKAVV+AAV  WK++    +RDDCTA+C FLQ
Sbjct  269   SDGIWDVLSNEEVASIVCSVEH--EEMAAKAVVDAAVAEWKKKVLFDKRDDCTAVCYFLQ  326

Query  1018  K  1020
             K
Sbjct  327   K  327



>ref|XP_009108822.1| PREDICTED: probable protein phosphatase 2C 61 [Brassica rapa]
Length=326

 Score =   299 bits (766),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 171/341 (50%), Positives = 222/341 (65%), Gaps = 34/341 (10%)
 Frame = +1

Query  31    MGICISKAS------SEIHD-ADYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAI  186
             MG C   +S      ++I++  DYGQEN V   + + V +   S  S  G KG NQDAA+
Sbjct  1     MGFCFCLSSGGSTDRNQIYEIKDYGQENAVLHSEQHDVHQGFGSVSSLAGGKGYNQDAAV  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             L+ GYG E G  CG+FDGHG+ G  VSK+VRN LPSL L                    G
Sbjct  61    LHLGYGTEEGALCGVFDGHGEKGELVSKIVRNQLPSLLL--------------------G  100

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEK-LDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                 +     WK  C + F LMDK+I +++  LDC +SG+TAV+A+     ++VANLGDS
Sbjct  101   HMNNHSGTRDWKLICETTFLLMDKRILKLKNTLDCSSSGTTAVLAVTHGNQVMVANLGDS  160

Query  544   RAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RAV+   ++NG +K +QLTTDLKPSVP EAERI+K NGRV+AL+ EPHIQRVWLP+E+ P
Sbjct  161   RAVMIGASENGEIKVVQLTTDLKPSVPSEAERIKKRNGRVLALESEPHIQRVWLPHENRP  220

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVC-SA  897
             GLAMSRA GDF LK +G+I+TP+VS H ++  D FL+LA+DGVWDVLSN+EV   V  S 
Sbjct  221   GLAMSRALGDFALKSYGVIATPQVSTHQITSRDQFLLLASDGVWDVLSNEEVAVVVMKSE  280

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              E G   AA AV EAA +AW+ ++P  + DD + +CLFL K
Sbjct  281   NEAG---AANAVTEAAANAWREKYPTVKVDDISVVCLFLNK  318



>ref|NP_195021.1| putative protein phosphatase 2C 61 [Arabidopsis thaliana]
 sp|O82637.1|P2C61_ARATH RecName: Full=Probable protein phosphatase 2C 61; Short=AtPP2C61 
[Arabidopsis thaliana]
 emb|CAA21204.1| putative protein [Arabidopsis thaliana]
 emb|CAB80012.1| putative protein [Arabidopsis thaliana]
 gb|AEE86151.1| putative protein phosphatase 2C 61 [Arabidopsis thaliana]
Length=326

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 220/341 (65%), Gaps = 34/341 (10%)
 Frame = +1

Query  31    MGICISKAS------SEIHD-ADYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAI  186
             MG C   +S      S+I++  DYGQEN V + D + V + + S  S  G KG+NQDAAI
Sbjct  1     MGFCFCLSSGGSTDKSQIYEITDYGQENAVLYSDHHVVPQNLGSVSSLAGGKGLNQDAAI  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             L+ GYG E G  CG+FDGHG  G +VSK VRN LPS+ L                    G
Sbjct  61    LHLGYGTEEGALCGVFDGHGPRGAFVSKNVRNQLPSILL--------------------G  100

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEKL-DCCTSGSTAVIAIRQDEDLVVANLGDS  543
                 +     WK  C ++   MDK+I +V+K+ DC  SG+TAV+A++    ++VANLGDS
Sbjct  101   HMNNHSVTRDWKLICETSCLEMDKRILKVKKIHDCSASGTTAVLAVKHGNQVMVANLGDS  160

Query  544   RAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RAV+ G   D   K  QLT DLKPSVP EAERIRK NGRV+AL+ EPHI RVWLP E+ P
Sbjct  161   RAVMIGTSEDGETKVAQLTNDLKPSVPSEAERIRKRNGRVLALESEPHILRVWLPTENRP  220

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVC-SA  897
             GLAMSRAFGDF+LK +G+I+TP+VS H ++ +D FL+LA+DGVWDVLSN+EV + V  SA
Sbjct  221   GLAMSRAFGDFLLKSYGVIATPQVSTHQITSSDQFLLLASDGVWDVLSNEEVATVVMKSA  280

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              E G   AA  V EAA +AW ++FP  + DD + +CL L K
Sbjct  281   SEAG---AANEVAEAATNAWIQKFPTVKIDDISVVCLSLNK  318



>ref|XP_010437828.1| PREDICTED: probable protein phosphatase 2C 61 [Camelina sativa]
Length=326

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 167/335 (50%), Positives = 221/335 (66%), Gaps = 30/335 (9%)
 Frame = +1

Query  40    CISKASS----EIHD-ADYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAILYQGY  201
             CIS   S    +I++  DYGQEN V + D + V +   S  S  G KG+NQDAAIL+ GY
Sbjct  6     CISSGGSTDRNQIYEITDYGQENAVLYSDHHDVPQGFGSVSSLAGGKGLNQDAAILHLGY  65

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTEN  381
             G E G  CG+FDGHG+ G +VSK+VRN LPS+ L                    G    +
Sbjct  66    GTEEGALCGVFDGHGEKGEFVSKIVRNQLPSILL--------------------GHMNNH  105

Query  382   KSFLKWKEACVSAFKLMDKQIKQVEKL-DCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG  558
                  WK  C +    MDK+I +V+K+ DC +SG+TAV+A++    ++VANLGDSRAV+ 
Sbjct  106   SVTRDWKLICETTCLEMDKRILKVKKIHDCSSSGTTAVLAVKHGNQVMVANLGDSRAVMI  165

Query  559   RKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMS  735
               ++NG  K +QLT DLKPSVP EA+RIRK NGRV+AL+ EPHI RVWLP E+ PGLAMS
Sbjct  166   GTSENGETKVVQLTNDLKPSVPSEADRIRKRNGRVLALESEPHILRVWLPTENRPGLAMS  225

Query  736   RAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGee  915
             RAFGDF+LK +G+I+TP+VS H ++P D +LVLA+DGVWDVLSN+EV + V  +    E 
Sbjct  226   RAFGDFLLKSYGVIATPQVSTHQITPRDQYLVLASDGVWDVLSNEEVATVVMKSES--EA  283

Query  916   maakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              AA AV EAA  AW +++P ++ DD + +CL + K
Sbjct  284   GAANAVAEAATSAWIQKYPTAKVDDISVVCLSINK  318



>emb|CDY45023.1| BnaA08g11960D [Brassica napus]
Length=326

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 220/340 (65%), Gaps = 32/340 (9%)
 Frame = +1

Query  31    MGICISKAS------SEIHD-ADYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAI  186
             MG C   +S      ++I++  DYGQEN V   + + V +   S  S  G KG NQDAA+
Sbjct  1     MGFCFCLSSGGSTDRNQIYEIKDYGQENAVLHSEQHDVHQGFGSVSSLAGGKGYNQDAAV  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             L+ GYG E G  CG+FDGHG+ G  VSK+VRN LPSL L                    G
Sbjct  61    LHLGYGTEEGALCGVFDGHGEKGELVSKIVRNQLPSLLL--------------------G  100

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEK-LDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                +N     WK  C + F LMDK+I +++  LDC +SG+TAV+A+     ++VANLGDS
Sbjct  101   HMNKNSVTRDWKLICETTFLLMDKRILKLKNTLDCSSSGTTAVLAVTHGNQVMVANLGDS  160

Query  544   RAVLGRKTDNGV-KAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RAV+   ++NG  K +QLTTDLKPSVP EAERI+K NGRV+AL+ EPHIQRVWLP+E+ P
Sbjct  161   RAVMIGTSENGENKVVQLTTDLKPSVPSEAERIKKRNGRVLALESEPHIQRVWLPHENRP  220

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
             GLAMSRA GDF LK +G+I+TP+VS H ++  D FL+LA+DGVWDVLSN+EV   V  + 
Sbjct  221   GLAMSRALGDFALKSYGVIATPQVSTHQITSRDQFLLLASDGVWDVLSNEEVAVVVMKSE  280

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
                +  AA AV EAA +AW+ ++P  + DD + +C FL K
Sbjct  281   N--KAGAANAVTEAAANAWREKYPTVKVDDISVVCFFLNK  318



>ref|XP_002874294.1| phosphatase 2C-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50553.1| phosphatase 2C-like protein [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   297 bits (761),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 178/349 (51%), Positives = 233/349 (67%), Gaps = 37/349 (11%)
 Frame = +1

Query  31    MGICIS--KASSEIH-DADYGQENVVHFGDCNGVEV----------IASAFSHPGSKGIN  171
             MG C S   +SSEIH D ++G  N V F   NG+E           + S  S  G+K +N
Sbjct  1     MGHCFSLPSSSSEIHEDNEHGDGNAVVF---NGLEFGLDHDLPVHRLGSVCSIQGTKVLN  57

Query  172   QDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTN  351
             QD A+LY GYG    + CG+FDGHGKNGH VSK+VRN LPS+ L            L   
Sbjct  58    QDHAVLYLGYGTRDSELCGVFDGHGKNGHMVSKMVRNRLPSVLLA-----------LKEE  106

Query  352   KLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVAN  531
             +  + +  E ++  KW+ AC +AF+L+D+++  ++  DC  SGST V+AI Q +DLV+AN
Sbjct  107   QNQESNVCEEEAN-KWENACFTAFRLIDRELN-LQVFDCSFSGSTGVVAITQGDDLVIAN  164

Query  532   LGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPC------EAERIRKCNGRVIALKEEPHIQ  690
             LGDSRAVLG  T++G ++A+QLT+DL P+VP       EAERIR C GRV A+K EP  Q
Sbjct  165   LGDSRAVLGTTTEDGEIRAVQLTSDLTPNVPTSSSVAGEAERIRMCKGRVFAMKAEPCNQ  224

Query  691   RVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSND  870
             RVWLPN+D PGLAMSRAFG+F LK HG+I+ PE+S H ++ ND FLVLATDGVWD+LSND
Sbjct  225   RVWLPNQDIPGLAMSRAFGNFRLKEHGVIAVPEISQHRITSNDRFLVLATDGVWDMLSND  284

Query  871   EVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             EV+S + S+ +  +  AAK V EAA  AWK++  +++ DD T ICLFLQ
Sbjct  285   EVVSLIWSSGKK-QAEAAKLVAEAAEAAWKKKLKSTKIDDITVICLFLQ  332



>ref|XP_006647079.1| PREDICTED: probable protein phosphatase 2C 12-like [Oryza brachyantha]
Length=376

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 224/365 (61%), Gaps = 50/365 (14%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCN----------GVEVIASAFSHPGSKGINQDA  180
             MG+C S  S  +       E++V+  D            G   +AS FS  G KG NQD+
Sbjct  1     MGLCAS--SEHLEQVQEADESIVYVKDEQGGGGGRGLECGARKVASLFSQRGKKGPNQDS  58

Query  181   AILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFL--KQAKFLPKIRAKLNTNK  354
              IL QG+G E G F G FDGHG+ G  +SKLVR++LP + L  + A FL           
Sbjct  59    VILCQGFGMEDGVFVGAFDGHGRCGQVISKLVRDYLPFMILSHRNALFLAG---------  109

Query  355   LDDGD-----------------------TTENKSFLKWKEACVSAFKLMDKQIKQVEKLD  465
              DDGD                           +   +W+EAC +AF  MD ++K    LD
Sbjct  110   -DDGDDLAFSDASPPPSSTDSSGRSSPQAASAQVLEEWREACTNAFAAMDGELKLQANLD  168

Query  466   CCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIR  642
             C  SG+TAV AI+Q +DLVVANLGDSRAVL   ++ G ++A+QLT D KPSVP EA RI+
Sbjct  169   CSFSGTTAVCAIKQGKDLVVANLGDSRAVLATMSETGYLQAVQLTVDHKPSVPEEAARIK  228

Query  643   KCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDH  822
             +  GRV  LK+EP + RVWLP E++PGLAM+R+ GDF LK HG+ISTPEV+   +S  D 
Sbjct  229   RSEGRVFGLKDEPGVMRVWLPAENSPGLAMARSLGDFRLKRHGVISTPEVTSRRVSAADL  288

Query  823   FLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAI  1002
             F+VLATDGVWDVLSN+EV+S VC+     ++ A+KAVVEAAV  W+ +FP SR DDC+A+
Sbjct  289   FIVLATDGVWDVLSNEEVVSIVCATPR--KQHASKAVVEAAVQRWRSKFPTSRVDDCSAV  346

Query  1003  CLFLQ  1017
             CLFL+
Sbjct  347   CLFLR  351



>ref|XP_010432632.1| PREDICTED: probable protein phosphatase 2C 61 [Camelina sativa]
Length=322

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 166/333 (50%), Positives = 219/333 (66%), Gaps = 30/333 (9%)
 Frame = +1

Query  40    CISKASS----EIHD-ADYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAILYQGY  201
             CIS   S    +I++  DYGQEN V + D + V +   S  S  G KG+NQDAAIL+ GY
Sbjct  6     CISSGGSTDRNQIYEITDYGQENAVLYSDHHDVPQDFGSVSSLAGGKGLNQDAAILHLGY  65

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTEN  381
             G E G  CG+FDGHG+ G +VSK+VRN LPS+ L                    G    +
Sbjct  66    GTEEGALCGVFDGHGEKGEFVSKIVRNQLPSILL--------------------GHMNNH  105

Query  382   KSFLKWKEACVSAFKLMDKQIKQVEKL-DCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG  558
                  WK  C +    MDK+I +V+K+ DC +SG+TAV+A++    ++VANLGDSRAV+ 
Sbjct  106   SVTRDWKLICETTCLEMDKRILKVKKIHDCSSSGTTAVLAVKHGNQVMVANLGDSRAVMI  165

Query  559   RKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMS  735
               ++NG  K +QLT DLKPSVP EA+RIRK NGRV+AL+ EPHI RVWLP E+ PGLAMS
Sbjct  166   GTSENGETKVVQLTNDLKPSVPSEADRIRKRNGRVLALESEPHILRVWLPTENRPGLAMS  225

Query  736   RAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGee  915
             RAFGDF+LK +G+I+TP+VS H ++P D FL+LA+DGVWDVLSN+EV + V  +      
Sbjct  226   RAFGDFLLKSYGVIATPQVSTHQITPRDQFLLLASDGVWDVLSNEEVATVVMKSGSE--A  283

Query  916   maakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
              AA AV EAA +AW +++P +  DD + +CL L
Sbjct  284   GAANAVAEAATNAWIQKYPTANIDDISVVCLPL  316



>ref|XP_010447315.1| PREDICTED: probable protein phosphatase 2C 61 [Camelina sativa]
Length=326

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 165/335 (49%), Positives = 218/335 (65%), Gaps = 30/335 (9%)
 Frame = +1

Query  40    CISKASS----EIHD-ADYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAILYQGY  201
             CIS   S    +I++  DYGQEN V + D + V +   S  S  G KG+NQDAAIL+ GY
Sbjct  6     CISSGGSTDRNQIYEITDYGQENAVLYSDHHDVPQDFGSVSSLAGGKGLNQDAAILHLGY  65

Query  202   GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTEN  381
             G E G  CG+FDGHG+ G +VSK VRN LPS+ L                    G    +
Sbjct  66    GTEEGALCGVFDGHGEKGEFVSKNVRNQLPSILL--------------------GHMNNH  105

Query  382   KSFLKWKEACVSAFKLMDKQIKQVEKL-DCCTSGSTAVIAIRQDEDLVVANLGDSRAVL-  555
                  WK  C +    MDK+I +V+K+ DC +SG+TAV+A++    ++VANLGDSRAV+ 
Sbjct  106   SVTRDWKLICETTCLEMDKRILKVKKIHDCSSSGTTAVLAVKHGNQVMVANLGDSRAVMI  165

Query  556   GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMS  735
             G   +   K +QLT DLKPSVP EA+RIRK NGRV+AL+ EPHI RVWLP E+ PGLAMS
Sbjct  166   GTSENEETKVVQLTNDLKPSVPSEADRIRKRNGRVLALESEPHILRVWLPTENRPGLAMS  225

Query  736   RAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGee  915
             RAFGDF+LK +G+I+TP+VS H ++P D FL+LA+DGVWDVLSN+EV + V  +      
Sbjct  226   RAFGDFLLKSYGVIATPQVSTHQITPRDQFLLLASDGVWDVLSNEEVATVVMKSGNE--A  283

Query  916   maakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              AA AV EAA +AW +++P ++ DD + +CL + K
Sbjct  284   GAANAVAEAATNAWIQKYPTAKIDDISVVCLSINK  318



>ref|XP_004951406.1| PREDICTED: probable protein phosphatase 2C 12-like [Setaria italica]
Length=386

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 206/312 (66%), Gaps = 18/312 (6%)
 Frame = +1

Query  130   IASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQ  309
             +AS FS  G KG NQDA IL QG+G E G FCG+FDGHG+ G YVSKLVR++LP + L  
Sbjct  49    VASLFSQKGKKGPNQDAVILCQGFGMEDGVFCGVFDGHGRCGQYVSKLVRDYLPFMILSH  108

Query  310   ---------------AKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQI  444
                              F     +            +  +   +W+EAC +AF+ MD+++
Sbjct  109   RNALLLGAGDDDDGDPAFSDASPSSSTDGSGGGSSPSPAQLLDEWREACANAFEAMDREL  168

Query  445   KQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVP  621
             K    +DC  SG+TAV AI+Q  DL++ANLGDSRAVL   +D G ++A+QLT D KP V 
Sbjct  169   KLQPNMDCNFSGTTAVCAIKQGRDLILANLGDSRAVLATMSDAGYLRAVQLTADHKPGVA  228

Query  622   CEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYH  801
              EAERI++C GRV ALK+EP +QRVWLP ED PGLAM+R+ GD  LK HG++S PEV++ 
Sbjct  229   QEAERIKRCGGRVFALKDEPSVQRVWLPGEDCPGLAMARSLGDHRLKPHGVVSEPEVAHR  288

Query  802   NLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSR  981
              +   D F+VLATDGVWDVLSN+EV+S VC+     ++ A+KAV EAA   W+ R+P SR
Sbjct  289   RVGRGDLFIVLATDGVWDVLSNEEVVSIVCATPR--KQHASKAVAEAAAQRWRTRYPLSR  346

Query  982   RDDCTAICLFLQ  1017
              DDC+A+CLFL+
Sbjct  347   VDDCSAVCLFLR  358



>emb|CDY28276.1| BnaC03g66830D [Brassica napus]
Length=326

 Score =   289 bits (740),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 171/342 (50%), Positives = 222/342 (65%), Gaps = 36/342 (11%)
 Frame = +1

Query  31    MGICISKASSEIHDA-------DYGQEN-VVHFGDCNGV-EVIASAFSHPGSKGINQDAA  183
             MG C   +S    D        DYGQEN V+H    + V +   S  S  G KG NQDAA
Sbjct  1     MGFCFCLSSGGSTDGNQIYEIKDYGQENAVLHSEQHDHVHQGFGSVSSLAGGKGYNQDAA  60

Query  184   ILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDD  363
             +L+ GYG E G  CG+FDGHG+ G  VSK+VRN LPSL                +  +++
Sbjct  61    VLHLGYGTE-GALCGVFDGHGEKGELVSKIVRNQLPSLL---------------SGHMNN  104

Query  364   GDTTENKSFLKWKEACVSAFKLMDKQIKQVEK-LDCCTSGSTAVIAIRQDEDLVVANLGD  540
                T +     WK    + F LMDK+I +++  LDC +SG+TAV+A+     ++VANLGD
Sbjct  105   HSVTRD-----WKLIFETTFLLMDKRILKLKNTLDCSSSGTTAVLAVTHGNQVMVANLGD  159

Query  541   SRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDT  717
             SRAV+   ++NG +K +QLTTDLKPSVP EAERIRK NGRV+AL+ EPHIQRVWLP+E+ 
Sbjct  160   SRAVMIGTSENGEIKVVQLTTDLKPSVPSEAERIRKRNGRVLALESEPHIQRVWLPHENR  219

Query  718   PGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVC-S  894
             PGLAMSRA GDF LK +G+I+TP+VS H ++  D FL+LA+DGVWDVLSN+EV   V  S
Sbjct  220   PGLAMSRALGDFALKSYGVIATPQVSTHQITSRDQFLLLASDGVWDVLSNEEVAVVVMKS  279

Query  895   AYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
               E G   AA AV EAA +AW++++P  + DD + +CLFL K
Sbjct  280   ENEAG---AANAVTEAAANAWRQKYPTVKVDDISVVCLFLNK  318



>gb|EMT26930.1| Putative protein phosphatase 2C 12 [Aegilops tauschii]
Length=302

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 169/339 (50%), Positives = 216/339 (64%), Gaps = 57/339 (17%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQE---NVVHFGDCNG------VEVIASAFSHPGSKGINQDAA  183
             MGIC   ASSE H    GQE   ++V+  D  G         +AS FS  G KG NQDA 
Sbjct  1     MGIC---ASSE-HLGQQGQEADESIVYVMDEEGGGGASSPRKVASLFSQKGKKGPNQDAV  56

Query  184   ILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDD  363
             IL QG+G E G FCG+FDGHG+ GH            L L++                  
Sbjct  57    ILCQGFGMEDGVFCGVFDGHGRCGH------------LMLEE------------------  86

Query  364   GDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                        W+EAC +AFK MD ++K    +DC  SG+TAV AI+Q +DL++ANLGDS
Sbjct  87    -----------WREACSNAFKAMDNELKLQANMDCAFSGTTAVCAIKQGKDLIIANLGDS  135

Query  544   RAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RAVL   +  G +KA+QLTTD KP +P EAERI++C GRV AL+EEP + RVWLP E+ P
Sbjct  136   RAVLATMSGAGYLKAVQLTTDQKPGLPEEAERIKRCEGRVFALREEPGVMRVWLPGENLP  195

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
             GLAM+RA GD  LK+HG+ISTP+V+ H +S  D F++LATDGVWDVLSN+EV+S VC+  
Sbjct  196   GLAMARALGDSRLKHHGVISTPQVTAHRISDADLFIILATDGVWDVLSNEEVVSIVCATP  255

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
                ++ A+KAVVEAAV  WK ++P+SR DDC+A+CLFL 
Sbjct  256   R--KQHASKAVVEAAVQRWKTKYPSSRVDDCSAVCLFLH  292



>gb|KFK29906.1| hypothetical protein AALP_AA7G193700 [Arabis alpina]
Length=326

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 165/340 (49%), Positives = 221/340 (65%), Gaps = 32/340 (9%)
 Frame = +1

Query  31    MGICISKAS------SEIHDA-DYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAI  186
             MG C   +S      S+I++  DYGQEN V + + + V +  AS  S  G KG NQDAAI
Sbjct  1     MGFCFCLSSGGSTDQSQIYETNDYGQENAVLYSEMHHVPQDFASVSSLTGGKGFNQDAAI  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             ++ GYG E G  C +FDGHG  G  VSK+VRN LPS+ L                    G
Sbjct  61    IHLGYGTEEGALCAVFDGHGPGGELVSKIVRNQLPSILL--------------------G  100

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEK-LDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                 +     WK  C +AF  MDK+I Q++K LDC  SG+ AV+A++    +++ANLGDS
Sbjct  101   HMNNHSVTRDWKLICENAFLAMDKRILQLKKTLDCSASGTAAVLAVKHGNQVMIANLGDS  160

Query  544   RAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RA++  K+++G ++ +QLT+DLKPSVP EAERI K  GRV+AL+ EPHI RVWLP E+ P
Sbjct  161   RALMIGKSESGEIEVVQLTSDLKPSVPSEAERITKRKGRVLALQSEPHILRVWLPTENRP  220

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
             GLAMSRA GDF+LK +G+I+TP+VS H ++P D FL+LA DGVWDVLSN+EV +TV    
Sbjct  221   GLAMSRALGDFLLKSYGVIATPQVSTHQITPRDQFLLLACDGVWDVLSNEEV-ATVAMNS  279

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             E  E  AA AV EAA +AW++++P  + DD + +CL + K
Sbjct  280   E-NEAEAANAVTEAAANAWRQKYPTVKVDDISVVCLSINK  318



>ref|NP_001046332.1| Os02g0224100 [Oryza sativa Japonica Group]
 sp|Q6Z8B9.1|P2C12_ORYSJ RecName: Full=Probable protein phosphatase 2C 12; Short=OsPP2C12 
[Oryza sativa Japonica Group]
 dbj|BAD17061.1| putative protein phosphatase-2C [Oryza sativa Japonica Group]
 dbj|BAF08246.1| Os02g0224100 [Oryza sativa Japonica Group]
 gb|EAZ22288.1| hypothetical protein OsJ_05942 [Oryza sativa Japonica Group]
 dbj|BAG90314.1| unnamed protein product [Oryza sativa Japonica Group]
Length=389

 Score =   291 bits (745),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 170/366 (46%), Positives = 225/366 (61%), Gaps = 38/366 (10%)
 Frame = +1

Query  31    MGICISKASSE-IHDADYGQENVVHFGD----------CNGVEVIASAFSHPGSKGINQD  177
             MGIC S    E +H+ D   E++V+  D            G   +AS FS  G KG NQD
Sbjct  1     MGICASSEQLEHVHETD---ESIVYVKDEQGRGGRGVESGGARKVASLFSQRGKKGPNQD  57

Query  178   AAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNT---  348
             + IL QG+G E G FCG+FDGHG+ G ++SKLVR++LP + L     L    A  +    
Sbjct  58    SVILCQGFGMEDGVFCGVFDGHGRCGQFISKLVRDYLPFMILSHRNALLLADAAADDDDD  117

Query  349   -----------------NKLDDGDTTENKSFLK-WKEACVSAFKLMDKQIKQVEKLDCCT  474
                              N       + +   L+ W++AC SAF  MD ++K    LDC  
Sbjct  118   AAFSDDAAASSSADSSGNSSPQPSASASAQMLEEWRQACASAFAAMDGELKLQPNLDCAF  177

Query  475   SGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCN  651
             SG+TAV AI+Q  DL++ANLGDSRAVL   +D G ++A+QLT D KPSVP EA RI++  
Sbjct  178   SGTTAVCAIKQGRDLIIANLGDSRAVLATMSDTGYLQAVQLTVDHKPSVPEEAARIKRSG  237

Query  652   GRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLV  831
             GRV  LK+EP + RVWLP E++PGLAM+R+ GD  LK HG+I  PEV+   ++  D F+V
Sbjct  238   GRVFGLKDEPGVMRVWLPGENSPGLAMARSLGDMRLKRHGVIPAPEVTSRRVTGADLFMV  297

Query  832   LATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLF  1011
             LATDGVWDVLSN+EV+S VC+     ++ A+KAVVEAAV  W+ +FP SR DDC+A+CLF
Sbjct  298   LATDGVWDVLSNEEVVSIVCATPR--KQHASKAVVEAAVQRWRAKFPTSRVDDCSAVCLF  355

Query  1012  LQK*SL  1029
             L   +L
Sbjct  356   LHDHTL  361



>ref|XP_006284094.1| hypothetical protein CARUB_v10005231mg [Capsella rubella]
 gb|EOA16992.1| hypothetical protein CARUB_v10005231mg [Capsella rubella]
Length=327

 Score =   289 bits (739),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 223/337 (66%), Gaps = 31/337 (9%)
 Frame = +1

Query  37    ICISKASS----EIHD-ADYGQENVVHFGDCNG--VEVIASAFSHPGSKGINQDAAILYQ  195
             +CIS   S    +I++  DYGQ++ V + D +    +   S  S  G KG+NQDAAIL+ 
Sbjct  5     LCISSGGSTDRNQIYEITDYGQDSAVLYSDQHDHVPQDFGSVSSLAGGKGLNQDAAILHL  64

Query  196   GYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTT  375
             GYG E G  CG+FDGHG+ G +VSK+VR+ LPS+ L+                +++   T
Sbjct  65    GYGTEEGALCGVFDGHGEKGEFVSKIVRSQLPSILLRH---------------MNNHSVT  109

Query  376   ENKSFLKWKEACVSAFKLMDKQIKQVEKL-DCCTSGSTAVIAIRQDEDLVVANLGDSRAV  552
              +     WK  C +    MDK+I +V+K+ DC +SG+TAV A++    ++VANLGDSRAV
Sbjct  110   RD-----WKLICETTCLEMDKRILKVKKIHDCSSSGTTAVFAVKHGNQVMVANLGDSRAV  164

Query  553   LGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLA  729
             +   ++NG  K +QLT DLKPSVP EAERIRK NGRV+AL+ EPHI RVWLP E+ PGLA
Sbjct  165   MIGTSENGETKVVQLTNDLKPSVPSEAERIRKRNGRVLALESEPHILRVWLPTENRPGLA  224

Query  730   MSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYG  909
             MSRAFGDF+LK +G+I+TP+VS H ++  DHFL+LA+DGVWDVLSN+EV   V  +    
Sbjct  225   MSRAFGDFLLKSYGVIATPQVSTHEITSRDHFLLLASDGVWDVLSNEEVAEVVMKSGSE-  283

Query  910   eemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
                AA AV EAA +AW +++P ++ DD + +CL + K
Sbjct  284   -AGAANAVAEAATNAWVQKYPTAKVDDISVVCLSINK  319



>ref|XP_006412407.1| hypothetical protein EUTSA_v10025704mg [Eutrema salsugineum]
 gb|ESQ53860.1| hypothetical protein EUTSA_v10025704mg [Eutrema salsugineum]
Length=326

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/341 (49%), Positives = 220/341 (65%), Gaps = 34/341 (10%)
 Frame = +1

Query  31    MGICISKAS------SEIHD-ADYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAI  186
             MG C+  +S      ++I++  DYGQEN V + + + V +   S  S  G KG NQDAAI
Sbjct  1     MGFCLCLSSGGSTDRNQIYEITDYGQENAVLYSEQHEVPQDFGSVSSLAGGKGFNQDAAI  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             L+ GYG E G  CG+FDGHG+ G  VSK+VRN LPSL L                    G
Sbjct  61    LHLGYGTEEGALCGVFDGHGEKGEMVSKIVRNQLPSLLL--------------------G  100

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEK-LDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                 +     WK  C +A   MDK+I +++  LDC +SG+ AV A++    ++VANLGDS
Sbjct  101   HMNNHSVTRDWKLICETACLAMDKRILKLKNTLDCSSSGTAAVFAVKHGNQVLVANLGDS  160

Query  544   RAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RAV+   + NG  + +QLT+DLKPSVP EAERIRK NGRV+AL+ EPHI RVWLPNE+ P
Sbjct  161   RAVMIGTSVNGETEVVQLTSDLKPSVPSEAERIRKRNGRVLALESEPHILRVWLPNENRP  220

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVC-SA  897
             GLAMSRA GDF+LK +G+I+TP+VS H ++    FL+LA+DGVWDVLSN+EV + V  S 
Sbjct  221   GLAMSRALGDFVLKSYGVIATPQVSTHQITSRHQFLLLASDGVWDVLSNEEVATVVLKSE  280

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              E G   AA AV EAA +AW+ ++P ++ DD + +CL L K
Sbjct  281   NEAG---AANAVTEAAANAWRHKYPTAKVDDISVVCLSLNK  318



>ref|XP_010526067.1| PREDICTED: probable protein phosphatase 2C 61 isoform X1 [Tarenaya 
hassleriana]
Length=330

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 223/342 (65%), Gaps = 38/342 (11%)
 Frame = +1

Query  40    CISKASS---EIHD-ADYGQENVVHF------GDCNGVEVIASAFSHPGSKGINQDAAIL  189
             C S   S   +IH+  DYG  + V +      G  +G+E   S  S PG+KG+NQD+A+L
Sbjct  6     CFSGGGSTENQIHEITDYGDRDAVLYPQLETVGFGSGLEGFGSVCSLPGTKGLNQDSALL  65

Query  190   YQGYG-DESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             + G+G       CG+FDGHG+NGH VSK+VRN LP++        P+             
Sbjct  66    HPGFGIGGEASLCGVFDGHGENGHLVSKIVRNELPAILSGNMNTWPE-------------  112

Query  367   DTTENKSFLKWKEACVSAFKLMDKQI-KQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                      +WKE C   F  MDK+I K+ + LDC +SG+TAV+A+R+ E+L++ANLGDS
Sbjct  113   --------KQWKEICHDTFSTMDKRILKRKKTLDCSSSGTTAVLALRRGEELMIANLGDS  164

Query  544   RAVL---GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNED  714
             RAV+   G   +   +A+QLT DLKPSVP EAERIRK NGRV+AL+ EP++ RVWLP +D
Sbjct  165   RAVMVMAGTNENEDARALQLTNDLKPSVPSEAERIRKSNGRVLALEAEPNVHRVWLPFKD  224

Query  715   TPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCS  894
              PGLAMSRA GDF+LK +G+I  PEV  H ++ +D FLVLA+DGVWDVLSN+EV + V +
Sbjct  225   YPGLAMSRALGDFVLKNYGVIQFPEVFTHRITSDDRFLVLASDGVWDVLSNEEVATVVVA  284

Query  895   AYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             A    E++AA AV +AA +AWK +FP ++ DD +A+CL L +
Sbjct  285   AES--EKVAANAVAKAAAEAWKMKFPAAKVDDISAVCLSLNQ  324



>ref|XP_002867218.1| hypothetical protein ARALYDRAFT_328437 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43477.1| hypothetical protein ARALYDRAFT_328437 [Arabidopsis lyrata subsp. 
lyrata]
Length=322

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 222/337 (66%), Gaps = 33/337 (10%)
 Frame = +1

Query  31    MGICISKAS------SEIHD-ADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAIL  189
             MG C+  +S      ++I++  DYGQEN V + D    +   S  S  G KG+NQDAAIL
Sbjct  1     MGFCLCLSSGGSTDRNQIYEITDYGQENAVLYSDVP--QDFGSVSSLAGGKGLNQDAAIL  58

Query  190   YQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGD  369
             + GYG + G  CG+FDGHG  G +VSK+VRN LPS+ L                 +++  
Sbjct  59    HLGYGTQEGALCGVFDGHGPRGEFVSKIVRNQLPSILLSH---------------MNNHS  103

Query  370   TTENKSFLKWKEACVSAFKLMDKQIKQVEKL-DCCTSGSTAVIAIRQDEDLVVANLGDSR  546
              T +     WK  C ++   MDK+I +V+K+ DC +SG+TAV+A++    ++VANLGDSR
Sbjct  104   VTRD-----WKLICETSCLEMDKRILKVKKIHDCSSSGTTAVLAVKHGNQVMVANLGDSR  158

Query  547   AVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             AV+   ++NG  K +QLT DLKPSVP EAERI+K NGRV+AL+ EPH+ RVWLP E+ PG
Sbjct  159   AVMIGTSENGETKVVQLTNDLKPSVPSEAERIKKRNGRVLALESEPHLLRVWLPTENRPG  218

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAMSRAFGDF+LK +G+I+ P+VS H ++ +D FL+LA+DGVWDVLSN+EV + V  +  
Sbjct  219   LAMSRAFGDFLLKSYGVIAIPQVSTHQITSSDQFLLLASDGVWDVLSNEEVATVVMKSES  278

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
                  AA AV EAA +AW +++P  + DD + +CL L
Sbjct  279   E--AGAANAVAEAATNAWIQKYPTVKVDDISVVCLPL  313



>gb|EAY85062.1| hypothetical protein OsI_06419 [Oryza sativa Indica Group]
Length=388

 Score =   288 bits (738),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 225/366 (61%), Gaps = 38/366 (10%)
 Frame = +1

Query  31    MGICISKASSE-IHDADYGQENVVHFGD----------CNGVEVIASAFSHPGSKGINQD  177
             MGIC S    E +H+ D   E++V+  D            G   +AS FS  G KG NQD
Sbjct  1     MGICASSEQLEHVHETD---ESIVYVKDEQGRGGRGVESGGARKVASLFSQRGKKGPNQD  57

Query  178   AAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNT---  348
             + IL QG+G E G FCG+FDGHG+ G ++SKLVR++LP + L     L    A  +    
Sbjct  58    SVILCQGFGMEDGVFCGVFDGHGRCGQFISKLVRDYLPFMILSHRNALLLADAAADDDDD  117

Query  349   -----------------NKLDDGDTTENKSFLK-WKEACVSAFKLMDKQIKQVEKLDCCT  474
                              N       + +   L+ W++AC SAF  MD ++K    LDC  
Sbjct  118   AAFSDDAAASSSADSSGNSSPQPSASASAQMLEEWRQACASAFAAMDGELKLQPNLDCAF  177

Query  475   SGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCN  651
             SG+TAV AI+  +DL++ANLGDSRAVL   +D G ++A+QLT D KPSVP EA RI++  
Sbjct  178   SGTTAVCAIKLGKDLIIANLGDSRAVLATMSDTGYLQAVQLTVDHKPSVPEEAARIKRSG  237

Query  652   GRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLV  831
             GRV  LK+EP + RVWLP E++PGLAM+R+ GD  LK HG+I  PEV+   ++  D F+V
Sbjct  238   GRVFGLKDEPGVMRVWLPGENSPGLAMARSLGDMRLKRHGVIPAPEVTSRRVTGADLFMV  297

Query  832   LATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLF  1011
             LATDGVWDVLSN+EV+S VC+     ++ A+KAVVEAAV  W+ +FP SR DDC+A+CLF
Sbjct  298   LATDGVWDVLSNEEVVSIVCATPR--KQHASKAVVEAAVQRWRAKFPTSRVDDCSAVCLF  355

Query  1012  LQK*SL  1029
             L   +L
Sbjct  356   LHDHTL  361



>emb|CDX72381.1| BnaC07g44030D [Brassica napus]
Length=326

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 166/341 (49%), Positives = 220/341 (65%), Gaps = 34/341 (10%)
 Frame = +1

Query  31    MGICISKAS------SEIHDA-DYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAI  186
             MG C   +S      ++I++  DYGQEN V + +   V +   S  S  G KG NQDAAI
Sbjct  1     MGFCFCLSSGGSTDRNQIYEINDYGQENAVLYSEQLEVPQDFGSVSSLAGGKGFNQDAAI  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             L+ GYG E G  CG+FDGHG+ G  VSK+VRN LPSL L                    G
Sbjct  61    LHLGYGTEEGALCGVFDGHGEKGELVSKIVRNQLPSLLL--------------------G  100

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEK-LDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                 +     WK  C +    MDK+I +++  +DC +SG+ AV A++    ++VANLGDS
Sbjct  101   HMNNHSVTRDWKLICETTCLAMDKRILKLKNTIDCSSSGTAAVFAVKHGNQVMVANLGDS  160

Query  544   RAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RA++   ++NG  + +QLT+DLKPSV  EAERIRK NGRV+AL+ EPHI RVWLP+E+ P
Sbjct  161   RAIMIGTSENGETEVVQLTSDLKPSVLSEAERIRKRNGRVLALEAEPHILRVWLPHENRP  220

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVC-SA  897
             GLAMSRAFGDF+LK +G+I+TPEVS H ++  D FL+LA+DGVWDVLSN+EV   V  SA
Sbjct  221   GLAMSRAFGDFVLKSYGVIATPEVSTHQITSRDQFLLLASDGVWDVLSNEEVAKVVMNSA  280

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              E G   AA AV EAA +AW++++P ++ DD T +CL + K
Sbjct  281   NEAG---AANAVTEAAANAWRQKYPTAKVDDITVVCLSVNK  318



>ref|XP_010546507.1| PREDICTED: probable protein phosphatase 2C 61 [Tarenaya hassleriana]
Length=324

 Score =   284 bits (726),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 217/340 (64%), Gaps = 34/340 (10%)
 Frame = +1

Query  37    ICISKASSE---IHDA-DYGQENVVHFGD-----CNGVEVIASAFSHPGSKGINQDAAIL  189
             +C+S  SSE   IH+  DYGQEN V + +        +E   S  S PG+KG NQD+AIL
Sbjct  5     LCLSGGSSERNKIHEINDYGQENAVLYSEDDVVLGTSLEGFGSVCSLPGTKGFNQDSAIL  64

Query  190   Y-QGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             +    G   G  CG+FDGHG NGH VSK+ RN LP++ L      P              
Sbjct  65    HLGYGGGGGGALCGVFDGHGDNGHCVSKIARNQLPAVLLGNMNTWPT-------------  111

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEK-LDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                      +WK  C   F  +DK+I  ++K LDC  SG+TAV+A+ + E+L+VANLGDS
Sbjct  112   --------RQWKRICHDTFSAVDKKILNLKKTLDCSCSGTTAVLAVTRGEELMVANLGDS  163

Query  544   RAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RAVL R  + G  KA+QLT DLKPSVP EAERIRK NGRV+AL+ EPHIQRVWLP +D P
Sbjct  164   RAVLIRANEKGEAKALQLTNDLKPSVPSEAERIRKRNGRVLALEAEPHIQRVWLPFQDYP  223

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
             GLAMSRA GDF+LK +G+I  P+VS H ++ +D FLVLA+DGVWDVLSN+EV + V    
Sbjct  224   GLAMSRALGDFVLKNYGVIEFPDVSTHRITHHDRFLVLASDGVWDVLSNEEV-AKVVMGK  282

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             E  +  AA A  EAA +AW+ +FP ++ DD + +CL L K
Sbjct  283   ERDDGAAANAGAEAAAEAWRLKFPAAKVDDISVVCLSLNK  322



>gb|KCW79206.1| hypothetical protein EUGRSUZ_C00635 [Eucalyptus grandis]
Length=238

 Score =   278 bits (712),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 169/227 (74%), Gaps = 2/227 (1%)
 Frame = +1

Query  31   MGICISKASSEIHDADYGQENVVHFGDCNG-VEVIASAFSHPGSKGINQDAAILYQGYGD  207
            MGIC+S   SEIHD +  QEN V   + NG  +   S  S  GSKG+NQDAAILYQGYG 
Sbjct  1    MGICMSSVPSEIHDTEDVQENAVFIDETNGKTKRNGSVHSRTGSKGLNQDAAILYQGYGK  60

Query  208  ESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS  387
            + G FCG+FDGHGKNGH VSKLVRNHLP L L Q   L K++     +  D G +  ++ 
Sbjct  61   DDGVFCGVFDGHGKNGHLVSKLVRNHLPLLVLNQRNSLAKVKVTAVQDDCDQG-SVPSRD  119

Query  388  FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKT  567
             L+W++A +SAFK+MDK+IK  E LDC TSGSTAV+ IRQ EDLV+ANLGDSRAVLG  T
Sbjct  120  LLEWRDAFISAFKVMDKEIKLQEGLDCSTSGSTAVVVIRQGEDLVIANLGDSRAVLGTLT  179

Query  568  DNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPN  708
            ++G++ +QLTTDLKP+VP EA+RIRKC GRV+ALKEEPHIQRV  P+
Sbjct  180  EDGLRTVQLTTDLKPNVPSEADRIRKCKGRVLALKEEPHIQRVATPS  226



>ref|XP_009138153.1| PREDICTED: probable protein phosphatase 2C 61 [Brassica rapa]
 emb|CDY13509.1| BnaA03g52270D [Brassica napus]
Length=326

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 162/341 (48%), Positives = 220/341 (65%), Gaps = 34/341 (10%)
 Frame = +1

Query  31    MGICISKAS------SEIHDA-DYGQENVVHFGDCNGV-EVIASAFSHPGSKGINQDAAI  186
             MG C   +S      ++I++  DYGQEN V + + +   +   S  S  G KG NQDAAI
Sbjct  1     MGFCFCLSSGGSTDRNQIYEINDYGQENAVLYSEQHDFPQDFGSVSSLAGGKGFNQDAAI  60

Query  187   LYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDG  366
             L+ GYG E G  CG+FDGHG+ G  VSK++RN LPSL L                    G
Sbjct  61    LHLGYGTEEGALCGVFDGHGEKGELVSKIIRNQLPSLLL--------------------G  100

Query  367   DTTENKSFLKWKEACVSAFKLMDKQIKQVEK-LDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                 +     WK  C +    MDK+I +++  +DC +SG+ AV A++    ++VANLGDS
Sbjct  101   HMNNHSVTRDWKLICETTCLAMDKRILKLKNTIDCSSSGTAAVFAVKHGNQVMVANLGDS  160

Query  544   RAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RA++   ++NG  + +QLT+DLKPSV  EA+RIRK NGRV+AL+ EPHI RVWLP+E+ P
Sbjct  161   RAIMIGTSENGETEVVQLTSDLKPSVLSEADRIRKRNGRVLALEAEPHILRVWLPHENRP  220

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVC-SA  897
             GLAMSRAFGDF+LK +G+I+TPEVS H ++  D FL+LA+DGVWDVLSN+EV   V  SA
Sbjct  221   GLAMSRAFGDFVLKSYGVIATPEVSTHQITSRDQFLLLASDGVWDVLSNEEVAKVVMKSA  280

Query  898   YEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
              E G   AA AV EAA +AW++++P ++ DD + +CL + K
Sbjct  281   NETG---AANAVTEAAANAWRQKYPTAKVDDISVVCLSINK  318



>gb|AFW66021.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|AIG52092.1| 2C-type protein phosphatase protein [Zea mays]
Length=385

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/293 (52%), Positives = 199/293 (68%), Gaps = 20/293 (7%)
 Frame = +1

Query  193   QGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFL-----------PKIRAK  339
             +G+G E G FCG+FDGHG+ G  VSKL R+HLP + L Q   L               A 
Sbjct  75    EGFGMEDGVFCGVFDGHGRCGQLVSKLARDHLPFMILSQRNALLLGSDDDGDGPAFSDAS  134

Query  340   LNTNKLDDGDTTENKS------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAI  501
                +   DG  +E  S        +W+EAC +AF+ MD+++    K+DC  SG+TAV AI
Sbjct  135   PAASSSTDGSRSERSSPAPAQMLEEWREACANAFEAMDRELGVQAKVDCDFSGTTAVCAI  194

Query  502   RQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEE  678
             +Q EDLVVANLGDSRAVL   ++ G +KA+QLTTD KP+VP EAERI++CNGRV ALK+E
Sbjct  195   KQGEDLVVANLGDSRAVLATVSETGYLKAVQLTTDQKPNVPQEAERIKRCNGRVFALKDE  254

Query  679   PHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDV  858
               + RVWLP+ED PGLAM+R+ GD  LK HG++S PEV++  ++P D FLVLATDGVWDV
Sbjct  255   ASVPRVWLPDEDCPGLAMARSLGDHRLKRHGVVSEPEVAHRRVAPGDLFLVLATDGVWDV  314

Query  859   LSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             LSN EV+S VC+     ++ A+KAV +AA   W+ R+P SR DDC+A CLFL+
Sbjct  315   LSNQEVVSIVCATPR--KQHASKAVAQAAAQRWRTRYPASRVDDCSAACLFLR  365



>ref|XP_010669230.1| PREDICTED: probable protein phosphatase 2C 72 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 217/330 (66%), Gaps = 19/330 (6%)
 Frame = +1

Query  40    CISKASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDE-SG  216
             CI     E++D D      + FG         S +S  G K +NQD+A+L QGYG    G
Sbjct  17    CIIHNEDEMNDNDQ-----IKFG---------SVYSKRGGKIVNQDSAVLCQGYGSTLDG  62

Query  217   DFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLD-DGDTTENKSFL  393
               CG+FDGHG+ GH VSK     LP L L Q   +        +   + +G ++ +K  +
Sbjct  63    VLCGVFDGHGEYGHVVSKAASRRLPLLLLNQKNAVLSSEVPTESQSTNCNGSSSLDKELV  122

Query  394   KWKEACVSAFKLMDKQI-KQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTD  570
             +WK A +++FK MD ++ K   K    TSGSTAV+A++Q +DL++ANLGDSRA+LG K D
Sbjct  123   EWKTAFLNSFKEMDDEVMKMALKERYFTSGSTAVVALKQGDDLLIANLGDSRAILGTKGD  182

Query  571   NGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGD  750
             NGVKA+QLT DL P +P EA+RIR  +GRV ALK EP ++R W+P  ++PG+AMSR+FGD
Sbjct  183   NGVKAVQLTIDLTPRIPDEADRIRSFDGRVFALKNEPGVERAWMPRRNSPGMAMSRSFGD  242

Query  751   FMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaaka  930
             F +K  GIISTP +++H+++ +D F++LATDG+WDVLSND+V S V       E+MA+KA
Sbjct  243   FFMKQCGIISTPVITHHHITSDDLFILLATDGIWDVLSNDKVASIVWGVEN--EKMASKA  300

Query  931   vveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             VV+AAV  WK ++   R DDCTA+C FLQK
Sbjct  301   VVDAAVVEWKAKYSLDRPDDCTAVCYFLQK  330



>gb|AFW71290.1| putative protein phosphatase 2C family protein [Zea mays]
Length=305

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 198/287 (69%), Gaps = 19/287 (7%)
 Frame = +1

Query  208   ESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFL----------PKIRAKLNTNKL  357
             E G FCG+FDGHG+ G ++SKLVR++LP + L     L          P       +   
Sbjct  2     EDGVFCGVFDGHGRCGQFISKLVRDYLPFMILSHRNALLMGSDDDDDDPAFSDASASASA  61

Query  358   DDGDTTENKS------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
                D +   S        +W+EAC +AF+ MDK++K    +DC  SG+TAV AI+Q +DL
Sbjct  62    SSTDGSGQSSPAPAQLLEEWREACANAFEAMDKELKLQANVDCNFSGTTAVCAIKQGKDL  121

Query  520   VVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRV  696
             +VANLGDSRAVL   +D G +KA+QLTTD KP+VP EAERI++CNGRV ALK+EP + RV
Sbjct  122   IVANLGDSRAVLATMSDTGYLKAVQLTTDQKPNVPQEAERIKRCNGRVFALKDEPSVLRV  181

Query  697   WLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEV  876
             WLP+ED PGLAM+R+ GD+ LK HG++S PEV++  ++P D F++LATDGVWDVLSN+EV
Sbjct  182   WLPDEDCPGLAMARSLGDYRLKRHGVVSEPEVTHRRVAPGDLFIILATDGVWDVLSNEEV  241

Query  877   MSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             +S VC+     ++ A+KAV EAA   W+ R+P SR DDC+A+CLFL+
Sbjct  242   VSIVCATPR--KQHASKAVAEAAAQRWRTRYPTSRVDDCSAVCLFLR  286



>ref|XP_006828159.1| hypothetical protein AMTR_s00023p00095420 [Amborella trichopoda]
 gb|ERM95575.1| hypothetical protein AMTR_s00023p00095420 [Amborella trichopoda]
Length=397

 Score =   281 bits (718),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 158/346 (46%), Positives = 221/346 (64%), Gaps = 40/346 (12%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDE  210
             MG+C SK +        G E      D N    IAS F+  G KGINQDA IL + +  +
Sbjct  1     MGVCCSKEA-------VGSEE----EDINSSGAIASMFTQQGQKGINQDAMILCEDFAWK  49

Query  211   SGD-FCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDT-----  372
             +G  FCG+FDGHG  GH V++ VR++LPS          K++++    +LD  +T     
Sbjct  50    TGTIFCGVFDGHGPYGHKVARHVRDNLPS----------KLKSECEACELDSDETEDCSE  99

Query  373   --TEN--------KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLV  522
               +EN          F  WK + + AF+ +D++++   ++DC  SG+TAV  ++Q E LV
Sbjct  100   RNSENGERKTEYPPEFSSWKASFLQAFRDIDRELRVHPEIDCFCSGTTAVALVKQGEHLV  159

Query  523   VANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVW  699
             +ANLGDSRA+L  + DN  +  +QLT DLKP++P EAERI++C GRV A++EEP + R+W
Sbjct  160   IANLGDSRAILCTRDDNNKMVPLQLTVDLKPNLPSEAERIKQCKGRVFAMEEEPDVARMW  219

Query  700   LPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVM  879
             LPNED PGLAM+RAFGDF LK +G+IS P +SY  L+P D F+VLATDGVWDVL+N EV+
Sbjct  220   LPNEDCPGLAMARAFGDFCLKDYGLISVPHLSYRKLTPKDEFVVLATDGVWDVLTNKEVI  279

Query  880   STVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             + V S+ +     AA+ +V  AV AWK ++P S+ DDC  ICL+L+
Sbjct  280   NIVASSKDRS--SAARTLVTRAVRAWKYKYPTSKIDDCAVICLYLR  323



>ref|XP_008676760.1| PREDICTED: putative protein phosphatase 2C family protein isoform 
X1 [Zea mays]
 gb|AFW65175.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB04946.1| orphans transcription factor, partial [Zea mays]
Length=523

 Score =   285 bits (728),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/324 (47%), Positives = 207/324 (64%), Gaps = 24/324 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG   +A   +  G KG NQDA ++++ +      FCG+FDGHG  GH+V+K VR+ LP 
Sbjct  64    NGASAVACLHTQQGRKGTNQDAMVVWESFNSSDSIFCGVFDGHGPYGHFVAKKVRDSLPV  123

Query  295   LFLKQAKFLP-----------KIRAKLNT--------NKLDDGDTTEN--KSFLKWKEAC  411
                 Q +               I   +N+        ++  DGD TE   + FL  K + 
Sbjct  124   KLRTQWQTSANGPCSSPHQNGSISGSINSEETASIVDDEWGDGDNTEKLPEMFLPLKRSY  183

Query  412   VSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAI  588
             + AFKLMDK++K    +DC  SGSTAV  ++Q  DLV+ NLGDSRA++G R   N + A+
Sbjct  184   LKAFKLMDKELKLHPTVDCFCSGSTAVTLVKQGLDLVIGNLGDSRAIMGTRDASNNLTAL  243

Query  589   QLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYH  768
             QLT DLKP++P EAERI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK +
Sbjct  244   QLTVDLKPNLPREAERIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDFCLKDY  303

Query  769   GIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaav  948
             G+IS PE+SY  L+  D F++LATDGVWDVLSN E +  V SA       AA+A+V++AV
Sbjct  304   GLISVPEISYRLLTEKDEFIILATDGVWDVLSNKEAVDIVASAPSRA--TAARALVDSAV  361

Query  949   daWKRRFPNSRRDDCTAICLFLQK  1020
              +W+ +FP S+ DDC  +CLFL +
Sbjct  362   RSWRLKFPTSKSDDCAVVCLFLDR  385



>ref|XP_001764662.1| predicted protein [Physcomitrella patens]
 gb|EDQ70644.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/301 (48%), Positives = 206/301 (68%), Gaps = 6/301 (2%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGD-ESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    A  F+  G KG NQDA ++++ Y   E   FCG+FDGHG  GH V++ VR+ +P
Sbjct  11    NGASSNACIFTQQGRKGTNQDAMVVWENYASMEDTVFCGVFDGHGPYGHLVARRVRDSVP  70

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCC  471
             S  L+    +      ++T+ +++G   E+  F  WKEA ++ +++MDK+++    +DC 
Sbjct  71    SKLLQSTHSVNGEHKMVSTDTVEEG--KEHPMFDVWKEAHLTGYRIMDKELRSHPGIDCF  128

Query  472   TSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNGV-KAIQLTTDLKPSVPCEAERIRKC  648
              SG+TAV  ++Q + LV+ N+GDSRA+LG K DNG  KA+QLT DLKP++P EAERIR+C
Sbjct  129   CSGTTAVTVLKQGKHLVIGNVGDSRAILGTKDDNGSWKAVQLTVDLKPNLPREAERIRQC  188

Query  649   NGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFL  828
              GRV AL +EP + RVWLP +D+PGLAM+RAFGDF LK +G+I+ PE+ Y  L+  D F+
Sbjct  189   RGRVFALHDEPEVPRVWLPFDDSPGLAMARAFGDFCLKDYGVIAVPEMCYRQLTKQDQFI  248

Query  829   VLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICL  1008
             VLATDG+WDVLSN+EV+  V  A       AA+A+VE+AV  W+ ++P S+ DDC  +CL
Sbjct  249   VLATDGIWDVLSNEEVVQVV--AQAPTRATAARALVESAVRVWRLKYPTSKVDDCAVVCL  306

Query  1009  F  1011
             +
Sbjct  307   Y  307



>ref|XP_011084661.1| PREDICTED: probable protein phosphatase 2C 33 [Sesamum indicum]
Length=485

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/351 (45%), Positives = 216/351 (62%), Gaps = 47/351 (13%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   IAS F+  G KG NQDA I+++ +G      FCG+FDG
Sbjct  38    DYRREEQLHRTPGRMFLNGSSEIASLFTQQGKKGTNQDAMIVWENFGSRKDTVFCGVFDG  97

Query  241   HGKNGHYVSKLVRNHLP--------------------------SLFLKQAKFLP---KIR  333
             HG  GH V+K VR+ LP                          SL  +   FL    + R
Sbjct  98    HGPYGHMVAKRVRDSLPLKLNAHWEANNKSDEILREVSLNTTGSLCTEDTSFLSADEEAR  157

Query  334   AKLNTNKLDDGDTTENKS-FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQD  510
             A +     D G+T ++   F   KE+ + AFK+MD++++    +DC  SG+TAV  ++QD
Sbjct  158   ASI-----DVGETGKDTDVFQTLKESFLKAFKVMDRELRMYANIDCFCSGTTAVTMVKQD  212

Query  511   EDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHI  687
             +DLV+ N+GDSRAVLG R  +N + A+QLT DLKP++P E ERIRKC GRV AL++EP +
Sbjct  213   QDLVIGNVGDSRAVLGTRDENNSLTAVQLTVDLKPNLPAEEERIRKCKGRVFALQDEPDV  272

Query  688   QRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSN  867
              RVWLPN + PGLAM+RAFGDF LK  G+IS PE+SY  ++  D F+VLATDG+WDVLSN
Sbjct  273   ARVWLPNSNAPGLAMARAFGDFCLKEFGLISVPEISYRQITDKDEFVVLATDGIWDVLSN  332

Query  868   DEVMSTV--CSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +EV+  V  C +  Y     A+ +VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  333   EEVVDIVGSCPSRSYA----ARTLVESAVKAWRSKYPTSKIDDCAVVCLFL  379



>ref|NP_001152031.1| LOC100285668 [Zea mays]
 gb|ACG45459.1| catalytic/ protein phosphatase type 2C [Zea mays]
Length=515

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 205/316 (65%), Gaps = 19/316 (6%)
 Frame = +1

Query  118   GVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSL  297
             G   +A   +  G KG NQDA ++++ +      FCG+FDGHG  GH+V+K VR+ LP  
Sbjct  67    GASAVACLHTQQGRKGTNQDAMVVWESFNSSDSIFCGVFDGHGPYGHFVAKKVRDSLPVK  126

Query  298   FLKQAKFL------PKIRAKLNT--------NKLDDGDTTEN--KSFLKWKEACVSAFKL  429
                Q +        P     +N+        ++  DGD TE   + FL  K++ + AFKL
Sbjct  127   LRTQWQTSANGGSSPHQNGSINSEETGSIVDDEWGDGDDTEKLPEMFLPLKQSYLKAFKL  186

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDL  606
             MDK++K +  +DC  SGSTAV  ++Q  DLV+ NLGDSRA++G R   N + A+QLT DL
Sbjct  187   MDKELKLLPTVDCFCSGSTAVTLVKQGLDLVIGNLGDSRAIMGTRDASNNLTALQLTVDL  246

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK +G+IS P
Sbjct  247   KPNLPREAARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDFCLKDYGLISVP  306

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E+SY  L+  D F++LATDGVWDVLSN E +  V SA       AA+A+V+ AV +W+ +
Sbjct  307   EISYRRLTEKDEFIILATDGVWDVLSNKEAVDIVASAPSRA--TAARALVDCAVRSWRLK  364

Query  967   FPNSRRDDCTAICLFL  1014
             FP S+ DDC  +CLFL
Sbjct  365   FPTSKSDDCAVVCLFL  380



>gb|AFW66020.1| putative protein phosphatase 2C family protein [Zea mays]
Length=307

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 195/288 (68%), Gaps = 20/288 (7%)
 Frame = +1

Query  208   ESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFL-----------PKIRAKLNTNK  354
             E G FCG+FDGHG+ G  VSKL R+HLP + L Q   L               A    + 
Sbjct  2     EDGVFCGVFDGHGRCGQLVSKLARDHLPFMILSQRNALLLGSDDDGDGPAFSDASPAASS  61

Query  355   LDDGDTTENKS------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDED  516
               DG  +E  S        +W+EAC +AF+ MD+++    K+DC  SG+TAV AI+Q ED
Sbjct  62    STDGSRSERSSPAPAQMLEEWREACANAFEAMDRELGVQAKVDCDFSGTTAVCAIKQGED  121

Query  517   LVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQR  693
             LVVANLGDSRAVL   ++ G +KA+QLTTD KP+VP EAERI++CNGRV ALK+E  + R
Sbjct  122   LVVANLGDSRAVLATVSETGYLKAVQLTTDQKPNVPQEAERIKRCNGRVFALKDEASVPR  181

Query  694   VWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDE  873
             VWLP+ED PGLAM+R+ GD  LK HG++S PEV++  ++P D FLVLATDGVWDVLSN E
Sbjct  182   VWLPDEDCPGLAMARSLGDHRLKRHGVVSEPEVAHRRVAPGDLFLVLATDGVWDVLSNQE  241

Query  874   VMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             V+S VC+     ++ A+KAV +AA   W+ R+P SR DDC+A CLFL+
Sbjct  242   VVSIVCATPR--KQHASKAVAQAAAQRWRTRYPASRVDDCSAACLFLR  287



>ref|XP_009340340.1| PREDICTED: probable protein phosphatase 2C 33 [Pyrus x bretschneideri]
Length=497

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 216/346 (62%), Gaps = 37/346 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDG
Sbjct  42    DYRREERLHRIPERMFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------------SLFLKQAKFLPKIRAKLNTN----------  351
             HG  GH V+K VR+ LP                LK+    P     LN++          
Sbjct  102   HGPFGHMVAKRVRDSLPLKLSVNWEVNIVNEEVLKEIS--PNTAGSLNSDDTAFVSVDED  159

Query  352   ---KLDDGDTTENKSFLK-WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
                 +D  +T +N  F +  +E+ + AFK+MD++++    +DC  SG+TAV  I+Q  DL
Sbjct  160   FRSSVDVDETEKNPEFFQTLRESFLKAFKVMDRELRTTPSIDCFCSGTTAVTLIKQGRDL  219

Query  520   VVANLGDSRAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRV  696
             ++ N+GDSRAVL  R+ D+ + AIQLT DLKP++P EAERIRKC GRV AL++EP + RV
Sbjct  220   IIGNVGDSRAVLCTRRIDDTLSAIQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVARV  279

Query  697   WLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEV  876
             WLPN D+PGLAM+RAFGDF LK  G+IS P+VSY  L+  D F+VLATDG+WDVLSN EV
Sbjct  280   WLPNTDSPGLAMARAFGDFCLKDFGLISVPDVSYRRLTERDEFIVLATDGIWDVLSNKEV  339

Query  877   MSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +  V  A       AA+A+VE AV AW++++P S+ DDC  +CLFL
Sbjct  340   VDIV--ATAPARSSAARALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_002444805.1| hypothetical protein SORBIDRAFT_07g028300 [Sorghum bicolor]
 gb|EES14300.1| hypothetical protein SORBIDRAFT_07g028300 [Sorghum bicolor]
Length=517

 Score =   282 bits (722),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 151/321 (47%), Positives = 205/321 (64%), Gaps = 23/321 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG   +A   +  G KG NQDA ++++ +      FCG+FDGHG  GH+V+K VR+ LP 
Sbjct  65    NGASAVACLHTQQGRKGTNQDAMVVWESFDSSESIFCGVFDGHGPYGHFVAKKVRDSLPV  124

Query  295   LFLKQAKFLP----------KIRAKLNT--------NKLDDGDTTEN--KSFLKWKEACV  414
                 Q +              I   +N+        ++  DGD TE   + FL  K++ +
Sbjct  125   KLRTQWQTSANGGSSPHQNGSISGSINSEETGSIVDDEWGDGDDTEKLPEMFLPLKKSYL  184

Query  415   SAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQ  591
              AFKLMDK++K    +DC  SGSTAV  ++Q  DLV+ NLGDSRA++G R   N + A+Q
Sbjct  185   KAFKLMDKELKLHPTVDCFCSGSTAVTLVKQGLDLVIGNLGDSRAIMGTRDASNNLTALQ  244

Query  592   LTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHG  771
             LT DLKP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK +G
Sbjct  245   LTVDLKPNLPREAARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDFCLKDYG  304

Query  772   IISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavd  951
             +IS PE+SY  L+  D F++LATDGVWDVLSN E +  V SA       AA+A+V+ AV 
Sbjct  305   LISVPEISYRRLTEKDEFIILATDGVWDVLSNKEAVDIVASAPSRA--TAARALVDCAVR  362

Query  952   aWKRRFPNSRRDDCTAICLFL  1014
             +W+ +FP S+ DDC  +CLFL
Sbjct  363   SWRLKFPTSKSDDCAVVCLFL  383



>tpg|DAA47842.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB05914.1| orphans transcription factor, partial [Zea mays]
Length=515

 Score =   282 bits (722),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 204/316 (65%), Gaps = 19/316 (6%)
 Frame = +1

Query  118   GVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSL  297
             G   +A   +  G KG NQDA ++++ +      FCG+FDGHG  GH+V+K VR+ LP  
Sbjct  67    GASAVACLHTQQGRKGTNQDAMVVWESFNSSDSIFCGVFDGHGPYGHFVAKKVRDSLPVK  126

Query  298   FLKQAKFL------PKIRAKLNT--------NKLDDGDTTEN--KSFLKWKEACVSAFKL  429
                Q +        P     +N+        ++  DGD TE   + FL  K++ + AFKL
Sbjct  127   LRTQWQTSANGGSSPHQNGSINSEETGSIVDDEWGDGDDTEKLPEMFLPLKQSYLKAFKL  186

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDL  606
             MDK++K    +DC  SGSTAV  ++Q  DLV+ NLGDSRA++G R   N + A+QLT DL
Sbjct  187   MDKELKLHPTVDCFCSGSTAVTLVKQGLDLVIGNLGDSRAIMGTRDASNNLTALQLTVDL  246

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK +G+IS P
Sbjct  247   KPNLPREAARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDFCLKDYGLISVP  306

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E+SY  L+  D F++LATDGVWDVLSN E +  V SA       AA+A+V+ AV +W+ +
Sbjct  307   EISYRRLTEKDEFIILATDGVWDVLSNKEAVDIVASAPSRA--TAARALVDCAVRSWRLK  364

Query  967   FPNSRRDDCTAICLFL  1014
             FP S+ DDC  +CLFL
Sbjct  365   FPTSKSDDCAVVCLFL  380



>ref|XP_009340399.1| PREDICTED: probable protein phosphatase 2C 33 [Pyrus x bretschneideri]
Length=497

 Score =   281 bits (720),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 158/346 (46%), Positives = 216/346 (62%), Gaps = 37/346 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDG
Sbjct  42    DYRREERLHRIPERMFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------------SLFLKQAKFLPKIRAKLNTN----------  351
             HG  GH V+K VR+ LP                LK+    P     LN++          
Sbjct  102   HGPFGHMVAKRVRDSLPLKLSVNWEVNIVNDEVLKEIS--PNTAGSLNSDDTAFVSVDED  159

Query  352   ---KLDDGDTTENKSFLK-WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
                 +D  +T +N  F +  +E+ + AFK+MD++++    +DC  SG+TAV  I+Q  DL
Sbjct  160   FRSSVDVDETEKNPEFFQTLRESFLKAFKVMDRELRTTPSIDCFCSGTTAVTLIKQGRDL  219

Query  520   VVANLGDSRAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRV  696
             ++ N+GDSRAVL  R+ D+ + A+QLT DLKP++P EAERIRKC GRV AL++EP + RV
Sbjct  220   IIGNVGDSRAVLCTRRIDDTLSAVQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVARV  279

Query  697   WLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEV  876
             WLPN D+PGLAM+RAFGDF LK  G+IS P+VSY  L+  D F+VLATDG+WDVLSN EV
Sbjct  280   WLPNTDSPGLAMARAFGDFCLKDFGLISVPDVSYRRLTERDEFIVLATDGIWDVLSNKEV  339

Query  877   MSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +  V  A       AA+A+VE AV AW++++P S+ DDC  +CLFL
Sbjct  340   VDIV--ATAPARSSAARALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_010247822.1| PREDICTED: probable protein phosphatase 2C 33 [Nelumbo nucifera]
Length=476

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 214/329 (65%), Gaps = 34/329 (10%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             +G   +AS F+  G KG+NQDA I+++ +G  +   FCG+FDGHG  GH V++ VR+ LP
Sbjct  113   SGASDVASLFTQQGKKGVNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVARRVRDSLP  172

Query  292   SLFLK-QAKFLPKIRAKLNTNKLDDGDT------------TENKS--------------F  390
                LK  A +   IR++  + ++                 TE KS              F
Sbjct  173   ---LKLSAHWEVNIRSEDGSREISSSVMGSMSSEETSYMYTEEKSRISVDLEEKKHPEIF  229

Query  391   LKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKT  567
             L  KE+ + AFK+MDK+++    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVLG R  
Sbjct  230   LTLKESFLKAFKVMDKELRLHPNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDQ  289

Query  568   DNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFG  747
             DN + AIQLT DLKP++P EAERI++C GRV AL++EP + RVWLPN D+PGLAM+RAFG
Sbjct  290   DNSLIAIQLTVDLKPNLPREAERIQQCKGRVFALQDEPEVVRVWLPNNDSPGLAMARAFG  349

Query  748   DFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaak  927
             DF LK  G+IS PE+SY  L+  D F+VLATDGVWDVLSN EV+  V SA       AA+
Sbjct  350   DFCLKDFGLISLPEISYRRLTEKDEFIVLATDGVWDVLSNKEVVDIVASAPVRS--SAAR  407

Query  928   avveaavdaWKRRFPNSRRDDCTAICLFL  1014
             A+VE+AV  W+ ++PNS+ DDC  +CLFL
Sbjct  408   ALVESAVRTWRFKYPNSKIDDCAVVCLFL  436



>ref|XP_011085339.1| PREDICTED: probable protein phosphatase 2C 52 [Sesamum indicum]
Length=473

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/315 (49%), Positives = 204/315 (65%), Gaps = 20/315 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    A  F+  G KGINQDA I+++ +  E   FCG+FDGHG  GH V++ VR+ LP 
Sbjct  61    NGRSSSACIFTQQGRKGINQDAMIVWEDFMAEDVTFCGVFDGHGPYGHLVARKVRDTLP-  119

Query  295   LFLKQAKFLPKIRAKLNTN---------KLDDGD-----TTENKSFLKWKEACVSAFKLM  432
               LK + F     +K N +         K D  D     +TE++    W+EA + ++K M
Sbjct  120   --LKLSSFFDSFGSKQNGSGANCCNGNMKSDVADPVKETSTEDRVESLWREAFLKSYKAM  177

Query  433   DKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLK  609
             DK+++    LDC  SGSTAV  I+Q  +L + N+GDSRA+LG K  N  + AIQLT DLK
Sbjct  178   DKELRSHPNLDCFCSGSTAVTVIKQGSNLFMGNIGDSRAILGSKDSNDSMVAIQLTVDLK  237

Query  610   PSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPE  789
             P +P EAERI++C GRV AL++EP +QRVWLP +D PGLAM+RAFGDF LK +G+IS PE
Sbjct  238   PDLPREAERIKRCKGRVFALQDEPEVQRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPE  297

Query  790   VSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRF  969
              S+  LS  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +VE+A   WK ++
Sbjct  298   FSHRVLSDQDKFVVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVESAAREWKAKY  355

Query  970   PNSRRDDCTAICLFL  1014
             P S+ DDC  +CLFL
Sbjct  356   PTSKMDDCAVVCLFL  370



>ref|XP_007222732.1| hypothetical protein PRUPE_ppa006494mg [Prunus persica]
 gb|EMJ23931.1| hypothetical protein PRUPE_ppa006494mg [Prunus persica]
Length=409

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 203/307 (66%), Gaps = 10/307 (3%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    AS F   G KG+NQDA I ++ +G     FCG+FDGHG  GH V+K VR+ LP 
Sbjct  76    NGSSDFASLFCKQGKKGVNQDAMIAWENFGSPDTIFCGVFDGHGPFGHVVAKKVRDALPL  135

Query  295   LFLKQAKFL--PKIRAKLNTNKL----DDGDTTENKSFLKWKEACVSAFKLMDKQIKQVE  456
                 Q       K  A  +TN+     D  D    + F+  K++ + AFK+MDK++K   
Sbjct  136   KLTSQWVLTNNAKKGAADDTNEAASYQDHKDNEHCELFVTLKDSFLKAFKVMDKELKLHP  195

Query  457   KLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAE  633
             ++DC  SG+TAV  ++Q +DLV+AN+GDSRA+LG R  D  + A+QLT DLKP++P EAE
Sbjct  196   RIDCYCSGTTAVTLVKQGQDLVIANVGDSRALLGTRDEDGSLVAVQLTVDLKPNLPREAE  255

Query  634   RIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSP  813
             RI +C GRV AL+ EP + RVWLPN ++PGLAM+RAFGDF LK  G+IS P++SY  L+ 
Sbjct  256   RIMRCKGRVFALQNEPEVARVWLPNSNSPGLAMARAFGDFCLKDFGLISVPDISYRRLTE  315

Query  814   NDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDC  993
             ND F+VLATDG+WDVLSN+EV+  V  A       AA+A+VE+A  AW+ ++P  + DDC
Sbjct  316   NDEFVVLATDGIWDVLSNEEVVKIVALAPR---ASAARALVESATRAWRSKYPYVKVDDC  372

Query  994   TAICLFL  1014
               +CLFL
Sbjct  373   AVVCLFL  379



>gb|EPS66665.1| hypothetical protein M569_08112, partial [Genlisea aurea]
Length=505

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 205/325 (63%), Gaps = 28/325 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQ----GYGDESGDFCGIFDGHGKNGHYVSKLVRN  282
             NG    AS ++  G KG NQDA I ++    G G E+  FCG+FDGHG  GH V++ VR+
Sbjct  76    NGAARFASLYTQQGRKGTNQDAMIFWENFLGGLG-ETSMFCGVFDGHGPYGHMVARKVRD  134

Query  283   HLPSLFLKQAKFLPKIRAKLNTNKLDD-----------GDTTEN---------KSFLKWK  402
              LP L   Q    P+I         DD           GD  E          ++++  K
Sbjct  135   ALPILLRSQWNDKPEIIGVEGMKSFDDFVEEDGCESVEGDEIEKVPEASVPVPETYIPVK  194

Query  403   EACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGV  579
              + + AFKLMDK++K    +DC  SG+TAV  I+QD +L++ N+GDSRAVL  R  DN +
Sbjct  195   RSILKAFKLMDKELKLDPSIDCFCSGTTAVTLIKQDSNLIIGNVGDSRAVLATRSRDNSL  254

Query  580   KAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFML  759
              A+QLT DLKP++P EA RI+KC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF L
Sbjct  255   VAVQLTVDLKPNLPREAARIQKCKGRVFALQDEPEVARVWLPNSDSPGLAMARAFGDFCL  314

Query  760   KYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavve  939
             K  G+IS P+V +H++S  D F++LATDGVWDVLSN E +  V SA   G   AA+A+++
Sbjct  315   KDFGLISIPDVYHHHISERDEFVILATDGVWDVLSNKEAVDIVASAPSRG--TAARALID  372

Query  940   aavdaWKRRFPNSRRDDCTAICLFL  1014
              A  AW+ ++P S+ DDC  ICLFL
Sbjct  373   CATRAWRLKYPTSKNDDCAVICLFL  397



>ref|XP_009609263.1| PREDICTED: probable protein phosphatase 2C 33, partial [Nicotiana 
tomentosiformis]
Length=529

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 213/327 (65%), Gaps = 29/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG +GH V+K VR+ LP
Sbjct  99    NGSSDVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPHGHMVAKRVRDSLP  158

Query  292   -------SLFLKQAKFLPKIR----AKLNTNKLD------------DGDTTENKS--FLK  396
                     + LK    L +I     A LN+                D +  E +   F  
Sbjct  159   LKLSAHWEVNLKSEDVLKEISLNAGASLNSEDASLISAAEESRVSIDVEEAEKQPEVFQT  218

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG  576
              KE+ + A+K+MD++++    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVLG +  +G
Sbjct  219   LKESFLKAYKVMDRELRSYTNIDCFCSGTTAVTFVKQGQDLVIGNVGDSRAVLGTRDKSG  278

Query  577   -VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP++P EAERIRKC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  279   SLTAVQLTVDLKPNLPAEAERIRKCRGRVFALRDEPEVARVWLPNSDSPGLAMARAFGDF  338

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS PE+SY  L+  D F+VLATDG+WDVLSNDEV+  + S   +    AA+++
Sbjct  339   CLKDFGLISVPEISYRRLTGKDEFIVLATDGIWDVLSNDEVVKIIASTSSH--SSAARSL  396

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             VEAAV AW+ ++P S+ DDC  +CLFL
Sbjct  397   VEAAVRAWRTKYPTSKVDDCAVVCLFL  423



>ref|XP_002514837.1| protein phosphatase-2c, putative [Ricinus communis]
 gb|EEF47391.1| protein phosphatase-2c, putative [Ricinus communis]
Length=499

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 164/346 (47%), Positives = 219/346 (63%), Gaps = 37/346 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   IAS F+  G KG NQDA I+++ +G  +   FCG+FDG
Sbjct  42    DYRREEPLHRIPGRLFLNGSSDIASLFTQQGRKGTNQDAMIVWENFGSRTDTVFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIRAKLNT-NKLDDGDTT------E  378
             HG  GH V+K VR+HLP        + +     L +I   LNT   ++  DTT      E
Sbjct  102   HGPYGHMVAKRVRDHLPLKLSAHWEVNITSEDVLKEI--SLNTAGSMNSEDTTFVSADEE  159

Query  379   NKS-------------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
             +++             F   KE+ + AFK+MD++++    +DC  SG+TAV  I+Q  +L
Sbjct  160   SRASVDLDDTVKHPEIFQTLKESFLKAFKVMDRELRIHANIDCFCSGTTAVTLIKQGRNL  219

Query  520   VVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRV  696
             VV N+GDSRAVLG R  D+ + A+QLT DLKP++P EAERIRKC GRV AL++EP + RV
Sbjct  220   VVGNVGDSRAVLGTRDKDDSLVAVQLTVDLKPNLPAEAERIRKCKGRVFALQDEPEVARV  279

Query  697   WLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEV  876
             WLPN D+PGLAM+RAFGDF LK  G+IS P+VS+  LS  D F+VLATDG+WDVLSN EV
Sbjct  280   WLPNNDSPGLAMARAFGDFCLKDFGLISVPDVSFRRLSEKDEFIVLATDGIWDVLSNKEV  339

Query  877   MSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +  V S        AA+A+VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  340   VDIVASVPTR--PSAARALVESAVRAWRYKYPTSKVDDCAVVCLFL  383



>ref|XP_006447330.1| hypothetical protein CICLE_v10015132mg [Citrus clementina]
 ref|XP_006491638.1| PREDICTED: probable protein phosphatase 2C 52-like [Citrus sinensis]
 gb|ESR60570.1| hypothetical protein CICLE_v10015132mg [Citrus clementina]
Length=470

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 206/316 (65%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  58    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARRVRDALP-  116

Query  295   LFLKQAKFLPKIRAKLN----------TNKLDDGDT-----TENKSFLKWKEACVSAFKL  429
               +K   FL   +++ N          T KL+ GD+      E+KS   W+EA + A+K 
Sbjct  117   --IKLLSFLLASQSRQNGPGKTCFNGNTKKLEAGDSEKDGPAEDKSNSLWREAYLKAYKS  174

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK++K    LDC  SGSTAV  ++Q  +L +  +GDSRAV+G K  N  + AIQLT DL
Sbjct  175   MDKELKSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAVMGSKDSNDSMVAIQLTVDL  234

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  235   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  294

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V+AA   WK +
Sbjct  295   EFSHRLLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPT--RSSAARILVDAAAREWKLK  352

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  353   YPTSKMDDCAVVCLFL  368



>emb|CBI28905.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 207/316 (66%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  +   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRASCIFTQQGRKGINQDAMIVWEDFMSDDVTFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRAKLNTN----------KLDDGDT-----TENKSFLKWKEACVSAFKL  429
               LK   FL   +++ N +          KLD GD+     TE+K    W+EA + ++K 
Sbjct  120   --LKLLSFLHSYQSRQNGSSTACFKSDLKKLDGGDSEKDSSTEDKLDCLWREAFLKSYKA  177

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK-TDNGVKAIQLTTDL  606
             MDK+++    LDC  SGSTAV  +RQ  +L +  +GDSRA+LG K + + + AIQLT DL
Sbjct  178   MDKELRSHPNLDCFCSGSTAVTIVRQGSNLFMGYIGDSRAILGSKDSSDSMVAIQLTVDL  237

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  238   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  297

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  298   EFSHRMLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVDSAAREWKLK  355

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  356   YPTSKMDDCAVVCLFL  371



>ref|XP_010931503.1| PREDICTED: probable protein phosphatase 2C 73 [Elaeis guineensis]
Length=446

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 163/340 (48%), Positives = 211/340 (62%), Gaps = 23/340 (7%)
 Frame = +1

Query  49    KASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGY-GDESGDFC  225
             KA  EI D        V      G    AS ++  G KG+NQDA  +++ + G++   FC
Sbjct  18    KAEEEIFDGKEEDGGCVRL---KGWCTFASMYTQQGWKGVNQDAMTIWEDFAGEKDTIFC  74

Query  226   GIFDGHGKNGHYVSKLVRNHLP----SLFLKQAKF------LPKIRAKLNTNKLDDGDTT  375
             G+FDGHG  GH ++  VR+ LP    S F+    F          +  ++ +  DD D  
Sbjct  75    GVFDGHGPFGHKIAGCVRDALPTKLSSDFMSSQFFDHGNNDGNLNKNNVHGDDSDDSDRF  134

Query  376   ENKS------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLG  537
              N S         WK   V AF+ MD+++ Q   +DC  SG+TAV  ++Q E L++ANLG
Sbjct  135   HNVSDDSQQCLSSWKTIFVKAFEEMDRELSQQASIDCICSGTTAVSIVKQREHLIIANLG  194

Query  538   DSRAVLGRKTD-NGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNED  714
             DSRAVL  + D N   A+QLT DLKP+VP EAERI+ C GRV AL+EEP + R+WLPNED
Sbjct  195   DSRAVLCTRDDGNRPVAVQLTVDLKPNVPSEAERIKNCKGRVFALEEEPDVHRLWLPNED  254

Query  715   TPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCS  894
             TPGLAM+RAFGDF LK +G+ISTP+VSY  LS  D F+VLATDGVWDVLSN+EV+  V S
Sbjct  255   TPGLAMARAFGDFCLKDYGLISTPQVSYRKLSEKDEFVVLATDGVWDVLSNEEVVKIVSS  314

Query  895   AYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             A +     AAK +V+ AV AW+R+ P S+ DDC  ICLFL
Sbjct  315   ASKR--HAAAKQLVDRAVRAWRRKHPTSKVDDCAVICLFL  352



>gb|KDO40767.1| hypothetical protein CISIN_1g012129mg [Citrus sinensis]
 gb|KDO40768.1| hypothetical protein CISIN_1g012129mg [Citrus sinensis]
Length=470

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 206/316 (65%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  58    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARRVRDALP-  116

Query  295   LFLKQAKFLPKIRAKLN----------TNKLDDGDT-----TENKSFLKWKEACVSAFKL  429
               +K   FL   +++ N          T KL+ GD+      E+KS   W+EA + A+K 
Sbjct  117   --IKLLSFLLASQSRQNGPGKTCFNGNTKKLEAGDSEKDGPAEDKSNSLWREAYLKAYKS  174

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK++K    LDC  SGSTAV  ++Q  +L +  +GDSRAV+G K  N  + AIQLT DL
Sbjct  175   MDKELKSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAVMGSKDSNDSMVAIQLTVDL  234

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  235   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  294

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V+AA   WK +
Sbjct  295   EFSHRLLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPT--RSSAARILVDAAAREWKLK  352

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  353   YPTSKMDDCAVVCLFL  368



>ref|XP_002517960.1| protein phosphatase-2c, putative [Ricinus communis]
 gb|EEF44478.1| protein phosphatase-2c, putative [Ricinus communis]
Length=473

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 206/316 (65%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRTSCIFTQQGRKGINQDAMIIWEDFLSEDMTFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRA----------KLNTNKLDDGD-----TTENKSFLKWKEACVSAFKL  429
               +K   FL  I++          K N+ K D GD     +TE+K    W+EA + ++K 
Sbjct  120   --IKLLSFLHSIQSRQNESGQTCFKGNSKKSDVGDCEKDASTEDKLNSVWREAFLKSYKA  177

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK+++    LDC  SGSTAV  I+Q  +L +  +GDSRA++G K  N  + AIQLT DL
Sbjct  178   MDKELRSHPNLDCFCSGSTAVTIIKQGSNLFMGYIGDSRAIMGSKDSNDSMVAIQLTVDL  237

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  238   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  297

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D FLVLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  298   EFSHRLLTERDQFLVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVDSAAREWKLK  355

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  356   YPTSKMDDCAVVCLFL  371



>ref|XP_010657270.1| PREDICTED: probable protein phosphatase 2C 52 [Vitis vinifera]
 ref|XP_010657272.1| PREDICTED: probable protein phosphatase 2C 52 [Vitis vinifera]
 ref|XP_010657273.1| PREDICTED: probable protein phosphatase 2C 52 [Vitis vinifera]
 emb|CAN68594.1| hypothetical protein VITISV_011855 [Vitis vinifera]
Length=473

 Score =   278 bits (712),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 207/316 (66%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  +   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRASCIFTQQGRKGINQDAMIVWEDFMSDDVTFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRAKLNTN----------KLDDGDT-----TENKSFLKWKEACVSAFKL  429
               LK   FL   +++ N +          KLD GD+     TE+K    W+EA + ++K 
Sbjct  120   --LKLLSFLHSYQSRQNGSSTACFKSDLKKLDGGDSEKDSSTEDKLDCLWREAFLKSYKA  177

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK-TDNGVKAIQLTTDL  606
             MDK+++    LDC  SGSTAV  +RQ  +L +  +GDSRA+LG K + + + AIQLT DL
Sbjct  178   MDKELRSHPNLDCFCSGSTAVTIVRQGSNLFMGYIGDSRAILGSKDSSDSMVAIQLTVDL  237

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  238   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  297

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  298   EFSHRMLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVDSAAREWKLK  355

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  356   YPTSKMDDCAVVCLFL  371



>ref|XP_010100647.1| putative protein phosphatase 2C 33 [Morus notabilis]
 gb|EXB83672.1| putative protein phosphatase 2C 33 [Morus notabilis]
Length=431

 Score =   277 bits (708),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 208/323 (64%), Gaps = 29/323 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDES-GDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KG+NQDA I+++ +  ++   FCG+FDGHG  GH V++ VR+ LP
Sbjct  64    NGFSDTASLFTKQGKKGVNQDAMIVWENFSSKADTTFCGVFDGHGPYGHLVARKVRDSLP  123

Query  292   SLFLKQAKFLPKIRAKLN--------------------TNKLDDGDTTENKSFLKWKEAC  411
                LK +     I +  N                    T  L +GD    + F   K++ 
Sbjct  124   ---LKLSSLWELIISSKNGLAGGSIGAMGSLNPEEIASTPALANGDK-HTQIFSTLKDSF  179

Query  412   VSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAI  588
             + AF++MDK++K    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVLG R  DN   A+
Sbjct  180   LKAFRVMDKELKLHPHIDCYCSGTTAVALVKQGQDLVIGNIGDSRAVLGTRDKDNPFIAV  239

Query  589   QLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYH  768
             QLT DLKPS+P EAERIR C GRV ALK EP I RVWLPN D+PGLAM+RAFGDF LK  
Sbjct  240   QLTVDLKPSIPKEAERIRLCKGRVFALKSEPEITRVWLPNYDSPGLAMARAFGDFCLKDF  299

Query  769   GIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaav  948
             G+IS P+VSY+ +S  D F++LATDG+WDVL+N+E ++ V SA       AA+A+VE+AV
Sbjct  300   GLISVPDVSYYRVSDKDEFVILATDGIWDVLTNEEAVNIVASAPR---STAARALVESAV  356

Query  949   daWKRRFPNSRRDDCTAICLFLQ  1017
              AW+ +FP S+ DDC  +CLFL 
Sbjct  357   RAWRFKFPASKVDDCAVVCLFLN  379



>ref|XP_010549876.1| PREDICTED: probable protein phosphatase 2C 33 [Tarenaya hassleriana]
Length=565

 Score =   281 bits (718),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 219/342 (64%), Gaps = 26/342 (8%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   IAS F+  G KG+NQDA I+++ +G  +   F G+FDG
Sbjct  132   DYRREEPLHRIPGRMFLNGSSEIASLFTQQGKKGLNQDAMIVWENFGSRADTIFTGVFDG  191

Query  241   HGKNGHYVSKLVRNHLP----SLFLKQAKFLPKIRAKLNTNKLD------------DGDT  372
             HG  GH V+K VR+ LP    + +  +A     ++A +N+                D D 
Sbjct  192   HGPYGHLVAKRVRDSLPLKLSAHWEAKAPVEDALKAGMNSKDAAFVSAEEESRPSVDLDD  251

Query  373   TEN--KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSR  546
             TE+  + F   KE+ + AFK+MD+++K    +DC  SG+TAV  ++Q   LVV N+GDSR
Sbjct  252   TEDCPEIFRTLKESFLKAFKVMDRELKFHANVDCFCSGTTAVTLVKQGRYLVVGNVGDSR  311

Query  547   AVLGRKTD-NGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPG  723
             AVLG + D N + A+QLT DLKP++P EAERIRKC GRV AL++EP + RVWLPN D+PG
Sbjct  312   AVLGTRNDENALVAVQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVSRVWLPNNDSPG  371

Query  724   LAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYE  903
             LAM+RAFGDF LK  G+IS P+VS+  L+  D F+VLATDG+WDVLSN+EV+  V S   
Sbjct  372   LAMARAFGDFCLKDFGLISVPDVSFRRLTERDEFIVLATDGIWDVLSNEEVVEIVASVPA  431

Query  904   YGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK*SL  1029
              G   AA+A+VE AV AW+ ++P S+ DDC  +CLFL   S+
Sbjct  432   RG--SAARALVETAVRAWRYKYPTSKVDDCAVVCLFLDSNSM  471



>ref|XP_007029293.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007029294.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007029295.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY09795.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY09796.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY09797.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=493

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 164/346 (47%), Positives = 219/346 (63%), Gaps = 37/346 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDG
Sbjct  42    DYRKEEPLHRIPGRLFLNGSSDVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIRAKLNT-NKLDDGDTT------E  378
             HG  GH V+K VR+HLP        + +     L +I   LNT   ++  DTT      E
Sbjct  102   HGPYGHMVAKRVRDHLPLKLCAHWEVSISSEDVLREI--SLNTAGSMNSEDTTFVSADEE  159

Query  379   NKS-------------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
             +++             F   KE+ + AFK+MD++++    +DC  SG+TAV  ++Q   L
Sbjct  160   SRASVDLEETEKHPEIFQALKESFLKAFKVMDRELRMHANIDCFCSGTTAVTLVKQGPYL  219

Query  520   VVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRV  696
             V+ N+GDSRAVLG R  DN + A+QLT DLKP++P EAERIRKC GRV AL++EP + RV
Sbjct  220   VIGNVGDSRAVLGTRDKDNSLTAVQLTVDLKPNLPAEAERIRKCKGRVFALQDEPEVARV  279

Query  697   WLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEV  876
             WLPN D+PGLAM+RAFGDF LK  G+IS PE+SY  LS  D F+VLATDG+WDVLSN EV
Sbjct  280   WLPNNDSPGLAMARAFGDFCLKDFGLISVPEISYWRLSEKDEFIVLATDGIWDVLSNKEV  339

Query  877   MSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +  V SA       AA+A+VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  340   VDIVASAPAR--SSAARALVESAVRAWRYKYPTSKVDDCAVVCLFL  383



>ref|XP_008370833.1| PREDICTED: probable protein phosphatase 2C 33 [Malus domestica]
Length=494

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 211/327 (65%), Gaps = 29/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  59    NGSSEVASLFTQQGKKGTNQDAMIVWENFGXRTDTVFCGVFDGHGPFGHMVAKRVRDSLP  118

Query  292   -------SLFLKQAKFLPKIR----AKLNTN-------------KLDDGDTTENKS-FLK  396
                     + +   + L +I       LN++              +D  +T +N   F  
Sbjct  119   LKLSANWEVNIVNDEVLKEISLNAAGSLNSDDTAFVSVDEDFRPSVDVDETEKNPEIFQT  178

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVL-GRKTDN  573
              +E+ + AFK+MD++++    +DC  SG+TAV  I+Q  DL++ N+GDSRAVL  R+ D+
Sbjct  179   LRESFLKAFKVMDRELRTTPSIDCFCSGTTAVTLIKQGRDLIIGNVGDSRAVLCTRRIDD  238

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + AIQLT DLKP++P EAERIRKC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  239   TLSAIQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVARVWLPNTDSPGLAMARAFGDF  298

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS P+VSY  L+  D F+VLATDG+WDVLSN EV+  V  A       AA+A+
Sbjct  299   CLKDFGLISVPDVSYRRLTERDEFIVLATDGIWDVLSNKEVVDIV--ATAPARSSAARAL  356

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             VE AV AW++++P S+ DDC  +CLFL
Sbjct  357   VETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_006847475.1| hypothetical protein AMTR_s00163p00051750 [Amborella trichopoda]
 gb|ERN09056.1| hypothetical protein AMTR_s00163p00051750 [Amborella trichopoda]
Length=480

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 211/331 (64%), Gaps = 38/331 (11%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  54    NGSSKVASLFTQQGRKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDSLP  113

Query  292   -------------------------SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS---  387
                                      S+  + + F+      L+    D  D  E +    
Sbjct  114   LKLSAHWEVNIGSEEGLRENSSISGSMNSEDSAFM-----CLDEESRDSMDLEEKEKLAE  168

Query  388   -FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-R  561
              F+  K++ + AFK+MDK+++    +DC  SG+TAV  ++Q +DLV+ N+GDSRA+LG R
Sbjct  169   IFMSLKDSFLKAFKVMDKELRLHPAIDCFCSGTTAVTLVKQGQDLVIGNIGDSRAILGTR  228

Query  562   KTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRA  741
               D+ + A+QLT DLKP++P EAERIR+C GRV AL++EP + RVWLPN D+PGLAM+RA
Sbjct  229   DEDDSLIAVQLTVDLKPNLPREAERIRQCRGRVFALQDEPEVARVWLPNNDSPGLAMARA  288

Query  742   FGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeema  921
             FGDF LK +G+IS P+VSY  L+  D F+VLATDGVWDVLSN EV+  V SA       A
Sbjct  289   FGDFCLKDYGLISVPDVSYRRLTERDEFIVLATDGVWDVLSNKEVVDIVASAMTR--TTA  346

Query  922   akavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             A+++VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  347   ARSLVESAVRAWRYKYPTSKVDDCAVVCLFL  377



>ref|XP_004243332.1| PREDICTED: probable protein phosphatase 2C 52 [Solanum lycopersicum]
Length=472

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 205/316 (65%), Gaps = 22/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA ++++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRTSCIFTQQGRKGINQDAMVVWEDFMAEDVTFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRAKLNTN---------KLD------DGDTTENKSFLKWKEACVSAFKL  429
               LK A FL    +K N +         KLD      DG   +   +L W+EA + ++K 
Sbjct  120   --LKLASFLQSFDSKHNGSTANCCSGDKKLDVVDPDKDGGMEDKVDYL-WREAFLKSYKA  176

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK+++    LDC  SGSTA+  ++Q  +L +  +GDSRA++  K  N  + A+QLT DL
Sbjct  177   MDKELRSHPNLDCFCSGSTAITLVKQGSNLFMGYIGDSRAIMASKDSNDSMVAVQLTVDL  236

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP +QRVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  237   KPDLPKEAERIKRCKGRVFALQDEPEVQRVWLPFDDAPGLAMARAFGDFCLKEYGVISVP  296

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+H L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  297   EFSHHILTERDKFIVLASDGVWDVLSNEEVIEIVSSAPTRA--SAARILVDSAAREWKTK  354

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  355   YPTSKMDDCAVVCLFL  370



>gb|KDP26876.1| hypothetical protein JCGZ_18034 [Jatropha curcas]
Length=495

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 164/344 (48%), Positives = 216/344 (63%), Gaps = 33/344 (10%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   IAS F+  G KG NQDA I+++ +G  +   FCG+FDG
Sbjct  42    DYRREEPLHRIPGRLFLNGSSNIASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIR----AKLNTN------------  351
             HG  GH V+K VR+HLP        + +     L +I     A +N+             
Sbjct  102   HGPYGHMVAKRVRDHLPLKLSAHWEVNITSEDVLKEISVNTTASMNSEDQSFISADEESR  161

Query  352   -KLD-DGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVV  525
               LD D    + + F   KE+ + AFK+MD++++    +DC  SG+TAV  I+Q   LVV
Sbjct  162   ASLDLDEPEKQPEIFQTLKESFLKAFKVMDRELRVHANIDCYCSGTTAVTLIKQGHYLVV  221

Query  526   ANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWL  702
              N+GDSRAVLG R  D+ + AIQLT DLKP++P EAERIRKC GRV AL++EP + RVWL
Sbjct  222   GNVGDSRAVLGTRDKDDSLVAIQLTVDLKPNLPAEAERIRKCKGRVFALQDEPEVARVWL  281

Query  703   PNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMS  882
             PN D+PGLAM+RAFGDF LK  G+IS P++S   L+ ND F+VLATDGVWDVLSN EV+ 
Sbjct  282   PNNDSPGLAMARAFGDFCLKDFGLISVPDISCRRLTENDEFIVLATDGVWDVLSNKEVVD  341

Query  883   TVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
              V SA       AA+A+VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  342   IVASAPTRS--SAARALVESAVRAWRYKYPTSKVDDCAVVCLFL  383



>gb|EYU27523.1| hypothetical protein MIMGU_mgv1a004849mg [Erythranthe guttata]
Length=507

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 211/332 (64%), Gaps = 34/332 (10%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGY---GDESGDFCGIFDGHGKNGHYVSKLVRNH  285
             NG   IAS ++  G KG NQDA I ++ +   GD +  FCG+FDGHG  GH V++ VR+ 
Sbjct  73    NGASRIASLYTQQGKKGTNQDAMIFWENFYMGGDLNATFCGVFDGHGPYGHMVARKVRDS  132

Query  286   LPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSF-------------------------  390
             LP L   ++ +  K  A+ N    ++GD    + F                         
Sbjct  133   LPILI--RSHWENKDEAEENHEHSENGDLEGMRRFDDFMDEDGCESLEVEADEAEKVPEV  190

Query  391   -LKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RK  564
              +  K++ + AFKLMDK++K    +DC  SGSTAV  I+Q ED+++ N+GDSRAVL  R 
Sbjct  191   HIPLKKSILKAFKLMDKELKLHPTIDCFCSGSTAVALIKQGEDIIIGNVGDSRAVLATRD  250

Query  565   TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAF  744
              DN + A+QLT DLKP++P EA RI+KC GRV AL++EP + RVWLPN D+PGLAM+RAF
Sbjct  251   KDNTLTAVQLTVDLKPNLPREAARIQKCKGRVFALQDEPEVARVWLPNSDSPGLAMARAF  310

Query  745   GDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaa  924
             GDF LK  G+IS P+V +H+++  D F++LATDGVWDVLSN E +  V SA   G   AA
Sbjct  311   GDFCLKDFGLISKPDVYHHSITDRDKFVILATDGVWDVLSNKEAVDIVASA--PGRGTAA  368

Query  925   kavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             +A+V+ A  AW+ ++P S+ DDC A+CLFL++
Sbjct  369   RALVDCATRAWRLKYPTSKNDDCAAVCLFLEE  400



>ref|XP_004973821.1| PREDICTED: probable protein phosphatase 2C 66-like [Setaria italica]
Length=519

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 206/328 (63%), Gaps = 28/328 (9%)
 Frame = +1

Query  103   FGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRN  282
             FG  NG   +A   +  G KG NQDA ++++ +      FCG+FDGHG  GH+V+K VR+
Sbjct  62    FG--NGASAVACLHTQQGRKGTNQDAMVVWESFSSSDSIFCGVFDGHGPYGHFVAKKVRD  119

Query  283   HLPSLFLKQ--------------AKFLPKIRAKLNTNKLDD-------GDTTEN--KSFL  393
              LP     Q                    I ++   + +DD       GD +E   + FL
Sbjct  120   SLPVKLRTQWQTGANGASSPHQNGSISGSINSEETGSVVDDEWGESINGDESEKLPEMFL  179

Query  394   KWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTD  570
               K++ + AFKLMDK++K    +DC  SGSTAV  ++Q  DLV+ NLGDSRA++G R   
Sbjct  180   PLKQSYLKAFKLMDKELKLHPTVDCFCSGSTAVTLVKQGLDLVIGNLGDSRAIMGTRDAS  239

Query  571   NGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGD  750
             N + ++QLT DLKP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGD
Sbjct  240   NNLTSVQLTVDLKPNLPREAARIQQCKGRVFALQDEPDVARVWLPNNDSPGLAMARAFGD  299

Query  751   FMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaaka  930
             F LK +G+IS PE+SY  LS  D F++LATDGVWDVLSN E +  V SA       AA+A
Sbjct  300   FCLKDYGLISVPEISYRRLSEKDEFIILATDGVWDVLSNKEAVDIVASAPSRA--TAARA  357

Query  931   vveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +V+ AV +W+ +FP S+ DDC  +CLFL
Sbjct  358   LVDCAVRSWRLKFPTSKSDDCAVVCLFL  385



>gb|EPS70212.1| hypothetical protein M569_04548, partial [Genlisea aurea]
Length=477

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 204/319 (64%), Gaps = 24/319 (8%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  87    NGRSTTSCIFTQQGRKGINQDAMIVWEDFVAEDMIFCGVFDGHGPHGHLVARKVRDTLP-  145

Query  295   LFLKQAKFLPKIRAK----------LNTNKLDDGDTTENKSFLK-------WKEACVSAF  423
               LK + FL    +K           N +   D + T N  F+        ++EA + +F
Sbjct  146   --LKLSSFLNPGESKKKKSAICGNCCNASDTPDVEETANADFIPEEGLDSLYEEAFLKSF  203

Query  424   KLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKT--DNGVKAIQLT  597
             K MDK+++    LDC  SGSTAV  I+Q  +L + N+GDSRA+LG K   D+ + A+QLT
Sbjct  204   KAMDKELRSHPNLDCFCSGSTAVTIIKQGSNLFIGNIGDSRAILGSKDGDDDAMVAVQLT  263

Query  598   TDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGII  777
              DLKP +P EAERI++C GRV AL++EP +QRVWLP +D PGLAM+RAFGDF LK +G+I
Sbjct  264   VDLKPDLPKEAERIKRCKGRVFALQDEPEVQRVWLPFDDAPGLAMARAFGDFCLKDYGVI  323

Query  778   STPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaW  957
             S PE S+  LS  D F+VLA+DGVWDVLSN+EV+  V +A       AA+ +VE A   W
Sbjct  324   SIPEFSHRILSDRDKFIVLASDGVWDVLSNEEVVGIVSTAPSR--SAAARMLVEVAAREW  381

Query  958   KRRFPNSRRDDCTAICLFL  1014
             K +FP S+ DDC  +CLFL
Sbjct  382   KTKFPTSKMDDCAVVCLFL  400



>ref|XP_006659550.1| PREDICTED: probable protein phosphatase 2C 66-like [Oryza brachyantha]
Length=465

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/322 (48%), Positives = 206/322 (64%), Gaps = 24/322 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLP-  291
             NG    A   +  G KG NQDA ++++ +      FCG+FDGHG  GH+V+K VR+ LP 
Sbjct  16    NGASAAACLHTQQGRKGTNQDAMVVWENFNTSDSVFCGVFDGHGPYGHFVAKKVRDSLPV  75

Query  292   ---SLFLKQAK--FLP----KIRAKLN---TNKLDDGDTTEN--------KSFLKWKEAC  411
                +L+   A     P     I   +N   T+ + D + +EN        + FL  K++ 
Sbjct  76    KIRTLWKTSANGGTSPHQNGSISGSVNSEETSSVVDDELSENVDDSEKLPEMFLPLKQSY  135

Query  412   VSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAI  588
               AFKLMDK++K    +DC  SGSTAV  ++Q  DLVV NLGDSRA++G R   N + A+
Sbjct  136   FKAFKLMDKELKMHPTIDCFCSGSTAVTLVKQGWDLVVGNLGDSRAIMGTRDAANNLTAV  195

Query  589   QLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYH  768
             QLT DLKP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK +
Sbjct  196   QLTVDLKPNLPKEAARIQQCRGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDFCLKDY  255

Query  769   GIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaav  948
             G+IS PE+SY  L+  D F++LATDGVWDVLSN E +  V SA       AA+A+V+ AV
Sbjct  256   GLISVPEISYRRLTEKDEFIILATDGVWDVLSNKEAVDIVASAPSRS--TAARALVDCAV  313

Query  949   daWKRRFPNSRRDDCTAICLFL  1014
              +W+ +FP S+ DDC  +CLFL
Sbjct  314   RSWRLKFPTSKSDDCAVVCLFL  335



>ref|XP_008244425.1| PREDICTED: probable protein phosphatase 2C 33 [Prunus mume]
Length=409

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/307 (49%), Positives = 201/307 (65%), Gaps = 10/307 (3%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    AS F   G KG+NQDA I ++ +G     FCG+FDGHG  GH V+K VR+ LP 
Sbjct  76    NGSSDFASLFCKQGKKGVNQDAMIAWENFGSPDTIFCGVFDGHGPFGHVVAKKVRDALPL  135

Query  295   LFLKQAKFL--PKIRAKLNTNKL----DDGDTTENKSFLKWKEACVSAFKLMDKQIKQVE  456
                 Q       K  A  +TN+     D  D    + F+  K++ + AFK+MDK++K   
Sbjct  136   KLTSQWVLTNNAKKGAADDTNETASYQDHKDNDHCELFMTLKDSFLKAFKVMDKELKLHP  195

Query  457   KLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAE  633
             ++DC  SG+TAV  ++Q +DLV+AN+GDSRA+LG R  D  + A+QLT DLKP++P E E
Sbjct  196   RIDCYCSGTTAVTLVKQGQDLVIANVGDSRALLGTRDEDGSLVAVQLTVDLKPNLPRETE  255

Query  634   RIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSP  813
             RI +C GRV AL+ EP + RVWLPN ++PGLAM+RAFGDF LK  G+IS P++SY  L+ 
Sbjct  256   RIMRCKGRVFALQNEPEVARVWLPNSNSPGLAMARAFGDFCLKDFGLISVPDISYRRLTE  315

Query  814   NDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDC  993
              D F+VLATDG+WDVLSN+EV+  V  A       AA+A+VE+A  AW+ ++P  + DDC
Sbjct  316   KDEFVVLATDGIWDVLSNEEVVKIVALAPR---ASAARALVESATRAWRSKYPYVKVDDC  372

Query  994   TAICLFL  1014
               +CLFL
Sbjct  373   AVVCLFL  379



>ref|XP_007142603.1| hypothetical protein PHAVU_007G001500g, partial [Phaseolus vulgaris]
 gb|ESW14597.1| hypothetical protein PHAVU_007G001500g, partial [Phaseolus vulgaris]
Length=425

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 164/341 (48%), Positives = 212/341 (62%), Gaps = 17/341 (5%)
 Frame = +1

Query  31    MGICISKASSEIHDADYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQG  198
             M  C     S I  +DY  E  VH        NG   +AS F   G+  INQDA +L+  
Sbjct  53    MDACDEPLCSPITFSDYRIEMRVHRVPGRLFLNGSSQVASLFCKQGNGTINQDAMLLWDN  112

Query  199   Y-GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLP-----KIRAKLNTNKLD  360
             +   +   FCG+FDGHG +GH V+K +R+  P   + Q   +        R   NT+  D
Sbjct  113   FCSKDDAVFCGVFDGHGPHGHLVAKKLRDSFPLKLIAQWNSINPNTTYSYRNFFNTS-FD  171

Query  361   D--GDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANL  534
             D   D+    +    +++ V A K MD +++   ++DC +SGSTAVI ++Q  DLV+AN+
Sbjct  172   DFQHDSVAPTNIATLRQSFVRACKTMDSELRDQNQIDCSSSGSTAVILLKQGHDLVIANV  231

Query  535   GDSRAVLGRKTDNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNE  711
             GDSRAVL  +  NG + A+QLTTDLKP +P EAERIR C GRV ALK EP I RVWLPN 
Sbjct  232   GDSRAVLATQDRNGSLTAVQLTTDLKPDLPREAERIRICKGRVFALKSEPWISRVWLPNV  291

Query  712   DTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVC  891
             ++PGLAMSRAFGDF LK  GIIS P+ SYH L+  D F+VLATDGVWDVLSN EV+S V 
Sbjct  292   NSPGLAMSRAFGDFCLKDFGIISVPDFSYHRLTHRDQFVVLATDGVWDVLSNQEVVSIVA  351

Query  892   SAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             S        AA+ +V+AAV AWK + P+S+ DDC+ +CLFL
Sbjct  352   STPR---SSAARILVDAAVQAWKAKLPSSKVDDCSVVCLFL  389



>ref|XP_009371152.1| PREDICTED: probable protein phosphatase 2C 33 [Pyrus x bretschneideri]
 ref|XP_009371153.1| PREDICTED: probable protein phosphatase 2C 33 [Pyrus x bretschneideri]
Length=407

 Score =   275 bits (702),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/308 (49%), Positives = 199/308 (65%), Gaps = 10/308 (3%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG     S FS  G KG+NQDA I ++ +G     FCG+FDGHG  GH V+K VR+ LP 
Sbjct  74    NGSSDFTSLFSKQGKKGVNQDAMIAWENFGSADTTFCGVFDGHGPFGHVVAKKVRDALPL  133

Query  295   LFLKQ------AKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVE  456
                 Q      A   P   +       +  D      F+  K++ + AFK+MDK++K   
Sbjct  134   RLTSQWVLNGNASNGPADDSSEAVAYHEGKDEERCDLFMTLKDSFLKAFKVMDKELKLHP  193

Query  457   KLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAE  633
             ++DC  SG+TAV  ++Q +DLV+AN+GDSRAVLG R  D  + A+QLT DLKP++P EAE
Sbjct  194   RIDCYCSGTTAVTLVKQGQDLVIANVGDSRAVLGTRDKDGSLVAVQLTVDLKPNLPREAE  253

Query  634   RIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSP  813
             RIR C GRV AL+ EP I RVWLPN ++PGLAM+RAFGDF LK  G+IS P++SY  L+ 
Sbjct  254   RIRLCKGRVFALQNEPEIARVWLPNCNSPGLAMARAFGDFCLKDFGLISVPDLSYRRLTE  313

Query  814   NDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDC  993
              D F+VLATDG+WDVLSN+EV+  V  A       AA+A+VE+A  AW+ ++P ++ DDC
Sbjct  314   KDEFVVLATDGIWDVLSNEEVVDIVALAPR---PSAARALVESATRAWRIKYPYAKVDDC  370

Query  994   TAICLFLQ  1017
               +CLFL 
Sbjct  371   AVVCLFLN  378



>ref|XP_008337529.1| PREDICTED: probable protein phosphatase 2C 33 [Malus domestica]
 ref|XP_008337531.1| PREDICTED: probable protein phosphatase 2C 33 [Malus domestica]
Length=407

 Score =   274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 198/308 (64%), Gaps = 10/308 (3%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG     S FS  G KG+NQDA I ++ +G     FCG+FDGHG  GH V+K VR+ LP 
Sbjct  74    NGSSDFTSLFSKQGKKGVNQDAMIAWENFGSADTTFCGVFDGHGPFGHMVAKKVRDALPL  133

Query  295   LFLKQ------AKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVE  456
                 Q      A   P   +       +  D      F+  K++ + AFK+MDK++K   
Sbjct  134   RLTSQWVLNGNATNGPADDSSEAAACHEGKDEERCDFFMTLKDSFLKAFKVMDKELKLHP  193

Query  457   KLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAE  633
             ++DC  SG+TAV  ++Q +DLV+AN+GDSRAVLG R  D  + A+QLT DLKP++P EAE
Sbjct  194   RIDCYCSGTTAVTLVKQGQDLVIANVGDSRAVLGTRDKDGSLVAVQLTVDLKPNLPREAE  253

Query  634   RIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSP  813
             RIR C GRV AL+ EP I RVWLPN ++PGLAM+RAFGDF LK  G+IS P++SY  L+ 
Sbjct  254   RIRLCKGRVFALQNEPEIARVWLPNCNSPGLAMARAFGDFCLKDFGLISVPDISYRRLTE  313

Query  814   NDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDC  993
              D F+VLATDG+WDVL+N+EV+  V  A       AA+ +VE+A  AW+ ++P ++ DDC
Sbjct  314   KDEFVVLATDGIWDVLTNEEVVDIVALAPR---PSAARTLVESATRAWRLKYPYAKVDDC  370

Query  994   TAICLFLQ  1017
               +CLFL 
Sbjct  371   AVVCLFLN  378



>ref|XP_009776219.1| PREDICTED: probable protein phosphatase 2C 52 [Nicotiana sylvestris]
Length=472

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 206/316 (65%), Gaps = 22/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMAEDVTFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRAKLN---------TNKLD------DGDTTENKSFLKWKEACVSAFKL  429
               LK + FL    +K N           KLD      DG+  E+K    W+EA + ++K 
Sbjct  120   --LKLSSFLQSFDSKRNGATANCCNGNPKLDVVDPDKDGEM-EDKVDNLWREAFLKSYKA  176

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK+++    LDC  SGST+V  ++Q  +L +  +GDSRA+L  K +N  + A+QLT DL
Sbjct  177   MDKELRSHPNLDCFCSGSTSVTLVKQGSNLFMGYIGDSRAILASKDNNDSMIAVQLTVDL  236

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP +QRVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  237   KPDLPKEAERIKRCKGRVFALQDEPEVQRVWLPFDDAPGLAMARAFGDFCLKEYGVISVP  296

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+H L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  297   EFSHHILTERDKFIVLASDGVWDVLSNEEVVEIVSSAPTRA--SAARILVDSAAREWKTK  354

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  355   YPTSKMDDCAVVCLFL  370



>ref|XP_009629131.1| PREDICTED: probable protein phosphatase 2C 33 [Nicotiana tomentosiformis]
Length=486

 Score =   276 bits (707),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 162/361 (45%), Positives = 224/361 (62%), Gaps = 38/361 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E ++H        NG   +AS FS  G+KG NQDA I+++ +G  +   FCG+FDG
Sbjct  39    DYHKEELLHRIPGRMFLNGSSEVASLFSQQGNKGTNQDAMIVWENFGSRTDTVFCGVFDG  98

Query  241   HGKNGHYVSKLVRNHLP--------------------------SLFLKQAKFLPKIRAKL  342
             HG  GH V+K VR+ LP                          SL+ + A  + +  +++
Sbjct  99    HGPYGHMVAKRVRDALPLKLSTHWEVNIKSEDVLREISLNRGSSLYPEDASLISE-ESRV  157

Query  343   NTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLV  522
             + +  D    TE   F   KE+ + A+K+MD++++    +DC  SG+TAV  ++Q +DLV
Sbjct  158   SIDVEDTEKHTE--VFQTLKESFLKAYKVMDRELRSYTNIDCLCSGTTAVTLVKQGKDLV  215

Query  523   VANLGDSRAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVW  699
             + N+GDSRAVL  R  D+ + A+QLT DLKP++P EAERIRKC GRV +L +EP + RVW
Sbjct  216   IGNIGDSRAVLCTRGDDDSLTAVQLTVDLKPNLPAEAERIRKCKGRVFSLHDEPDVARVW  275

Query  700   LPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVM  879
             +PN ++PGLAM+RAFGDF LK  G+IS PE+SY  LS  D F++LATDG+WDVLSNDEV+
Sbjct  276   MPNSNSPGLAMARAFGDFCLKDFGVISVPEISYRRLSEKDEFIILATDGIWDVLSNDEVV  335

Query  880   STVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK*S-LFFFVGILK*  1056
               V SA      +AA+++VE AV AWK  +P S+ DDC  +CLFL   S  F  V I K 
Sbjct  336   KIVASASSR--SLAARSLVEVAVRAWKTTYPTSKVDDCAVVCLFLDSNSNNFSTVSITKD  393

Query  1057  N  1059
             N
Sbjct  394   N  394



>ref|XP_010673906.1| PREDICTED: probable protein phosphatase 2C 33 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010673907.1| PREDICTED: probable protein phosphatase 2C 33 [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 212/327 (65%), Gaps = 30/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS ++  G KG NQDA ++++ +   +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  58    NGATEVASLYTQQGRKGTNQDAMVVWENFCSRNDTIFCGVFDGHGPYGHLVAKRVRDSLP  117

Query  292   -------------------------SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSFLK  396
                                      S+  ++A F+        +  L++ D  E + F  
Sbjct  118   QKLNAQWEVNTKSEEVLREISLNCSSVNSEEASFISADEESRVSVDLEETDK-EPEIFEI  176

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              KE+ + AF++MD++++    +DC  SG+TAV  I+Q +DLV+ N+GDSRAVLG R TDN
Sbjct  177   LKESFLKAFRIMDRELRVHAGVDCFCSGTTAVTLIKQGQDLVIGNVGDSRAVLGTRDTDN  236

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP++P EAERI+KC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  237   TLVAVQLTVDLKPNLPAEAERIKKCRGRVFALQDEPDVARVWLPNNDSPGLAMARAFGDF  296

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK +G+I+ P++SY  L+  D F+VLATDG+WDVLSN +V++ V +A       AA+AV
Sbjct  297   CLKDYGLIAVPDISYRRLTEMDEFIVLATDGIWDVLSNKDVVNIVAAAPTRS--TAARAV  354

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             VE AV AWK ++P S+ DDC  +CLFL
Sbjct  355   VETAVRAWKMKYPTSKIDDCAVVCLFL  381



>ref|XP_009766558.1| PREDICTED: probable protein phosphatase 2C 33 [Nicotiana sylvestris]
Length=532

 Score =   278 bits (710),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 213/327 (65%), Gaps = 29/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG +GH V+K VR+ LP
Sbjct  102   NGSSDVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPHGHMVAKRVRDSLP  161

Query  292   -------SLFLKQAKFLPKIR----AKLNTNKLD------------DGDTTENKS--FLK  396
                     + +K    L +I     A LN+                D +  E +   F  
Sbjct  162   LKLSAHWEVNVKSEDVLKEISLNAGASLNSEDASLISADEESRVSIDVEEAEKQPEVFQT  221

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG  576
              KE+ + A+K+MD++++    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVLG +  +G
Sbjct  222   LKESFLKAYKVMDRELRSYTNIDCFCSGTTAVTFVKQGQDLVIGNVGDSRAVLGTRDKSG  281

Query  577   -VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP++P EAERIRKC GRV AL++EP + RVWLP+ D+PGLAM+RAFGDF
Sbjct  282   SLTAVQLTVDLKPNLPAEAERIRKCRGRVFALRDEPEVSRVWLPHSDSPGLAMARAFGDF  341

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS PE+SY  L+  D F+VLATDG+WDVLSNDEV+  + SA       AA+++
Sbjct  342   CLKDFGLISVPEISYRRLTGKDEFIVLATDGIWDVLSNDEVVKIIASASSR--SSAARSL  399

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             VEAAV AW+ ++P S+ DDC  +CLFL
Sbjct  400   VEAAVRAWRTKYPTSKVDDCAVVCLFL  426



>ref|XP_010928896.1| PREDICTED: probable protein phosphatase 2C 66 [Elaeis guineensis]
Length=548

 Score =   278 bits (711),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 210/332 (63%), Gaps = 28/332 (8%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDES-GDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +A  FS  G KG NQDA ++++ +   S   FCG+FDGHG  GH V+K VR+ LP
Sbjct  94    NGATEVACLFSQQGKKGFNQDAMLVWENFASRSDTTFCGVFDGHGPFGHLVAKKVRDSLP  153

Query  292   SLFLK-------------QAKFLPKIRAKLNTNKL-------DDGDTTENKS----FLKW  399
                               Q  FL        T  +       D  D  EN++    +L  
Sbjct  154   LKLCAEWIGNVSGHDGPCQNGFLTGSANSEGTTSVIIDDECADPLDVDENENLPEMYLTL  213

Query  400   KEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK-TDNG  576
             K++ + A +LMDK++K  + +DC  SG+TAV  ++Q +DLVV N+GDSRA+LGR+  DN 
Sbjct  214   KQSLLKASRLMDKELKVQQTIDCFCSGTTAVTIVKQGQDLVVGNVGDSRAILGRRDEDNN  273

Query  577   VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFM  756
             + A+QLT DLKP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF 
Sbjct  274   LVAVQLTIDLKPNLPREASRIQQCKGRVFALQDEPEVARVWLPNSDSPGLAMARAFGDFC  333

Query  757   LKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavv  936
             LK +G+IS P+VSYH+L   D F+VLATDGVWDVLSN EV+  V SA       AA+AVV
Sbjct  334   LKDYGLISIPDVSYHHLIEKDEFIVLATDGVWDVLSNKEVVDIVASAPTR--TTAARAVV  391

Query  937   eaavdaWKRRFPNSRRDDCTAICLFLQK*SLF  1032
             + AV AW+ +FP S+ DDC  +CLFL    LF
Sbjct  392   DCAVRAWRLKFPTSKIDDCAVVCLFLDPQLLF  423



>emb|CDP13625.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   277 bits (709),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 210/327 (64%), Gaps = 28/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS ++  G KG NQDA I+++ +  ++G  FCG+FDGHG  GH V++ VR+ LP
Sbjct  75    NGASSVASLYTQQGKKGTNQDAMIVWENFCSKTGTIFCGVFDGHGPYGHMVARKVRDCLP  134

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDGDTT-----------------ENKSFLKWKE-----  405
              L  K+ +      A   + K+++GD+T                 +N++  K+ E     
Sbjct  135   LLLRKEWESTTASTADQGSGKIENGDSTGSTRFDEILDDECCELPDNEATEKFPEIHQLL  194

Query  406   --ACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNG  576
               + + AF+LMDK++K    +DC  SG+TAV  + Q +DLV+ N+GDSRAVL  R  DN 
Sbjct  195   RKSFLKAFRLMDKELKLHPTVDCFCSGTTAVTLVMQGQDLVLGNVGDSRAVLATRDNDNS  254

Query  577   VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFM  756
             + A+QLT DLKP++P EA RI+K  GRV AL++EP + RVWLPN D+PGLAM+RAFGDF 
Sbjct  255   LMAVQLTVDLKPNLPREAARIQKYKGRVFALQDEPEVARVWLPNSDSPGLAMARAFGDFC  314

Query  757   LKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavv  936
             LK  G+IS P+V YH ++  D F+VLATDGVWDVLSN E +  V SA  +    AA+AVV
Sbjct  315   LKDFGLISVPDVYYHQITEKDEFVVLATDGVWDVLSNKEAVDVVASAPSHA--TAARAVV  372

Query  937   eaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             + A  AW+ ++P S+ DDC   CLFL+
Sbjct  373   DCATRAWRLKYPTSKNDDCAVACLFLE  399



>ref|XP_002992818.1| hypothetical protein SELMODRAFT_187001 [Selaginella moellendorffii]
 gb|EFJ06108.1| hypothetical protein SELMODRAFT_187001 [Selaginella moellendorffii]
Length=463

 Score =   275 bits (704),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/316 (46%), Positives = 208/316 (66%), Gaps = 28/316 (9%)
 Frame = +1

Query  133   ASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQ  309
             A  F+  G KG+NQDA I+++ +   +   FCG+FDGHG  GH V++ VR+ LPS     
Sbjct  55    ACLFTQQGRKGVNQDAMIVWESFCSRKDTTFCGVFDGHGPYGHLVARRVRDSLPS-----  109

Query  310   AKFLPKIRAKLNTNKLDDG------------------DTTENKSFLKWKEACVSAFKLMD  435
              K L   +    +  L DG                  +  E + F  WKE  + ++K+MD
Sbjct  110   -KLLAYWQEATESKNLSDGGESEKAEEQVLPGSDSGEEAQEPEMFKVWKETHLKSYKVMD  168

Query  436   KQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKP  612
             K ++    +DC  SG+TAV  I+Q ++LV+ N+GDSRAV+G R  DN ++A+QLT DLKP
Sbjct  169   KDLRVHPIIDCFCSGTTAVTLIKQGDELVLGNVGDSRAVMGSRADDNSIRAVQLTVDLKP  228

Query  613   SVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEV  792
             ++P EAERIR+C GRV AL +EP + RVWLP++++PGLAM+RAFGDF LK  G+I+ PEV
Sbjct  229   NLPEEAERIRQCKGRVFALHDEPEVARVWLPHDNSPGLAMARAFGDFCLKDFGVIAVPEV  288

Query  793   SYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFP  972
             SY+ ++  D F+VLATDGVWDVLSN+EV+  V +A    +  +A+++VE+AV AW+ ++P
Sbjct  289   SYYRITERDQFVVLATDGVWDVLSNEEVVKIVATAPT--KTTSARSLVESAVRAWRLKYP  346

Query  973   NSRRDDCTAICLFLQK  1020
              S+ DDC  +CL+L K
Sbjct  347   TSKMDDCAVVCLYLNK  362



>ref|XP_008341905.1| PREDICTED: probable protein phosphatase 2C 52 [Malus domestica]
 ref|XP_008341906.1| PREDICTED: probable protein phosphatase 2C 52 [Malus domestica]
Length=466

 Score =   275 bits (704),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 148/309 (48%), Positives = 201/309 (65%), Gaps = 11/309 (4%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA ++++ +  +   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSQTSCIFTQQGRKGINQDAMLVWEDFMSDDAIFCGVFDGHGPHGHLVARKVRDALPM  120

Query  295   ---LFLKQAKFLPKIRAKLNTNKLDDGDTT-----ENKSFLKWKEACVSAFKLMDKQIKQ  450
                 FL   +   K   K N  K D GDT      E K  L W++A + ++K MDK+++ 
Sbjct  121   KLLSFLYSYQGSSKTCFKGNLKKSDCGDTEKDGLDEEKLNLSWRDAFLKSYKAMDKELRS  180

Query  451   VEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCE  627
                LDC  SGSTAV  ++Q  +L +  +GDSRA+LG R + + + AIQLT DLKP +P E
Sbjct  181   HPNLDCFCSGSTAVTLVKQGSNLFMGYIGDSRAILGSRDSSDSMVAIQLTVDLKPDLPRE  240

Query  628   AERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNL  807
             AERI++C GRV AL +EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+  L
Sbjct  241   AERIKRCKGRVFALHDEPEVSRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSHRIL  300

Query  808   SPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRD  987
             +  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ VV++A   WK ++P S+ D
Sbjct  301   TDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRA--SAARTVVDSAAREWKLKYPTSKMD  358

Query  988   DCTAICLFL  1014
             DC  +CLFL
Sbjct  359   DCAVVCLFL  367



>ref|XP_002987553.1| hypothetical protein SELMODRAFT_183192 [Selaginella moellendorffii]
 gb|EFJ11389.1| hypothetical protein SELMODRAFT_183192 [Selaginella moellendorffii]
Length=464

 Score =   275 bits (704),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/316 (46%), Positives = 208/316 (66%), Gaps = 28/316 (9%)
 Frame = +1

Query  133   ASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQ  309
             A  F+  G KG+NQDA I+++ +   +   FCG+FDGHG  GH V++ VR+ LPS     
Sbjct  55    ACLFTQQGRKGVNQDAMIVWESFCSRKDTTFCGVFDGHGPYGHLVARRVRDSLPS-----  109

Query  310   AKFLPKIRAKLNTNKLDDG------------------DTTENKSFLKWKEACVSAFKLMD  435
              K L   +    +  L DG                  +  E + F  WKE  + ++K+MD
Sbjct  110   -KLLAYWQEATESKNLSDGGESEKAEEQVLPGSDSGEEAQEPEMFKVWKETHLKSYKVMD  168

Query  436   KQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKP  612
             K ++    +DC  SG+TAV  I+Q ++LV+ N+GDSRAV+G R  DN ++A+QLT DLKP
Sbjct  169   KDLRVHPIIDCFCSGTTAVTLIKQGDELVLGNVGDSRAVMGSRADDNSIRAVQLTVDLKP  228

Query  613   SVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEV  792
             ++P EAERIR+C GRV AL +EP + RVWLP++++PGLAM+RAFGDF LK  G+I+ PEV
Sbjct  229   NLPEEAERIRQCKGRVFALHDEPEVARVWLPHDNSPGLAMARAFGDFCLKDFGVIAVPEV  288

Query  793   SYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFP  972
             SY+ ++  D F+VLATDGVWDVLSN+EV+  V +A    +  +A+++VE+AV AW+ ++P
Sbjct  289   SYYRITERDQFVVLATDGVWDVLSNEEVVKIVATAPT--KTTSARSLVESAVRAWRLKYP  346

Query  973   NSRRDDCTAICLFLQK  1020
              S+ DDC  +CL+L K
Sbjct  347   TSKMDDCAVVCLYLNK  362



>gb|ABR16508.1| unknown [Picea sitchensis]
Length=526

 Score =   277 bits (708),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 210/330 (64%), Gaps = 30/330 (9%)
 Frame = +1

Query  103   FGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVR  279
             FG  NG   +A  F+  G KG NQDA ++++ +G      FCG+FDGHG  GH V+K VR
Sbjct  60    FG--NGASNVACMFTQQGRKGTNQDAMLVWEDFGSRKDTVFCGVFDGHGPFGHLVAKKVR  117

Query  280   NHLPSLFLKQ----------AKFLPKIRAKLNTNK-----LDD-----GDTTENKS----  387
             + LPS    Q           K        +N+ +     +DD      D  E +     
Sbjct  118   DSLPSKLSNQWEAEMKDDDSIKEANSTVGSMNSEESLSVTMDDEWRESADMEEREKCPEI  177

Query  388   FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RK  564
             FL  KE+ + AFK+MDK+++    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVLG R 
Sbjct  178   FLTLKESFLKAFKVMDKELRLHPTIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRV  237

Query  565   TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAF  744
              DN + A+QLT DLKP++P EAERIR+C GRV AL +EP + RVWLP+ D+PGLAM+RAF
Sbjct  238   QDNSLSAVQLTVDLKPNLPREAERIRQCKGRVFALHDEPEVSRVWLPHNDSPGLAMARAF  297

Query  745   GDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaa  924
             GDF LK  G+I+ P+VSY  L+  D F+VLA+DGVWDVLSN EV+  V SA    +  AA
Sbjct  298   GDFCLKDFGLIAVPDVSYRRLTERDEFIVLASDGVWDVLSNKEVVDIVASA--PSQTTAA  355

Query  925   kavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +A+VE AV AW+ ++P S+ DDC  +CLFL
Sbjct  356   RALVEYAVRAWRLKYPTSKVDDCAVVCLFL  385



>emb|CDY53743.1| BnaAnng12710D [Brassica napus]
Length=468

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 212/325 (65%), Gaps = 29/325 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +A  F+  G KG NQDA ++++ +G  +   FCG+FDGHG  GH V+K VR++LP
Sbjct  61    NGSSDVACIFTQQGKKGPNQDAMVVWESFGSRTDTVFCGVFDGHGPFGHMVAKRVRDNLP  120

Query  292   SLFLKQAKF----------LPKIRAKLNTNKLDDG------------DTTENKSFLKWKE  405
                LK + +          +  +    N N  D              ++TE++ F   KE
Sbjct  121   ---LKLSAYWEAKVPVEGSIKTVNNSANNNSEDAASFVSTEEEPRPEESTESELFQTLKE  177

Query  406   ACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVK  582
             A + AFK+MD+++K    +DC  SG+TAV  I+Q E LVV N+GDSRAV+G R  +NG+ 
Sbjct  178   AFLKAFKVMDRELKFHGSVDCFCSGTTAVTLIKQGEYLVVGNVGDSRAVMGTRDGENGLV  237

Query  583   AIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLK  762
             A+QLT DLKP++P E ERI+KC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK
Sbjct  238   AVQLTVDLKPNLPAEEERIKKCRGRVFALRDEPDVCRVWLPNCDSPGLAMARAFGDFCLK  297

Query  763   YHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavvea  942
               G+IS PEVS+  L+  D F+VLATDGVWDVLSN+EV+  V SA       AA+A+VE 
Sbjct  298   DFGLISVPEVSFRRLTEQDEFIVLATDGVWDVLSNEEVVKIVASAPSR--SSAARALVET  355

Query  943   avdaWKRRFPNSRRDDCTAICLFLQ  1017
             AV AW+ ++P S+ DDC A+CL+L 
Sbjct  356   AVRAWRHKYPTSKVDDCAAVCLYLN  380



>ref|XP_003574715.1| PREDICTED: probable protein phosphatase 2C 66 [Brachypodium distachyon]
Length=525

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/324 (47%), Positives = 203/324 (63%), Gaps = 26/324 (8%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG   +A   +  G KG NQDA ++++ +      FCG+FDGHG  GH+V+K VR+ LP 
Sbjct  74    NGASAVACLHTQQGRKGTNQDAMVVWENFNSSDSVFCGVFDGHGPYGHFVAKKVRDSLPV  133

Query  295   LFLKQAK----------FLPKIRAKLNTNKLD-------------DGDTTENKSFLKWKE  405
               L Q K              I A LN+ +               DG     + F+  K+
Sbjct  134   KLLTQWKTSGNGGTSPQLNGSISASLNSEETASAIDDEWGESVDVDGSDMLPEMFVPLKQ  193

Query  406   ACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVK  582
             + + AFKLMDK++K    +DC  SGSTAV  ++Q  DLVV NLGDSRA++  R   N + 
Sbjct  194   SYLKAFKLMDKELKLHPTIDCFCSGSTAVTLVKQGWDLVVGNLGDSRAIMATRDASNHLT  253

Query  583   AIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLK  762
             A+QLT DLKP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK
Sbjct  254   AVQLTVDLKPNLPKEAARIQQCRGRVFALQDEPEVSRVWLPNNDSPGLAMARAFGDFCLK  313

Query  763   YHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavvea  942
              +G+IS PE+SY  L+  D F++LATDGVWDVLSN E +  V +A       AA+A+V+ 
Sbjct  314   DYGLISVPEISYRRLTEKDEFIILATDGVWDVLSNKEAVDVVAAAPSR--ATAARALVDC  371

Query  943   avdaWKRRFPNSRRDDCTAICLFL  1014
             AV +W+ +FP S+ DDC A+CLFL
Sbjct  372   AVRSWRLKFPTSKSDDCAAVCLFL  395



>ref|XP_009619304.1| PREDICTED: probable protein phosphatase 2C 52 [Nicotiana tomentosiformis]
 ref|XP_009619305.1| PREDICTED: probable protein phosphatase 2C 52 [Nicotiana tomentosiformis]
Length=472

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 204/315 (65%), Gaps = 20/315 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMAEDVTFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRAKLNTN---------KLDDGDT-----TENKSFLKWKEACVSAFKLM  432
               LK + FL    +K N +         KLD  D       E+K    W+EA + ++K M
Sbjct  120   --LKLSSFLQSFDSKRNGSTANCCNGNPKLDVVDPDKDEGMEDKVDNLWREAFLKSYKAM  177

Query  433   DKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLK  609
             DK+++    LDC  SGSTA+  ++Q  +L +  +GDSRA+L  K +N  + A+QLT DLK
Sbjct  178   DKELRSHPNLDCFCSGSTAITLVKQGANLFMGYIGDSRAILASKDNNDSMIAVQLTVDLK  237

Query  610   PSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPE  789
             P +P EAERI++C GRV AL++EP +QRVWLP +D PGLAM+RAFGDF LK +G+IS PE
Sbjct  238   PDLPKEAERIKRCKGRVFALQDEPEVQRVWLPFDDAPGLAMARAFGDFCLKEYGVISVPE  297

Query  790   VSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRF  969
              S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK ++
Sbjct  298   FSHRTLTERDKFIVLASDGVWDVLSNEEVVEIVSSAPTRA--SAARILVDSAAREWKTKY  355

Query  970   PNSRRDDCTAICLFL  1014
             P S+ DDC  +CLFL
Sbjct  356   PTSKMDDCAVVCLFL  370



>ref|XP_004296680.1| PREDICTED: probable protein phosphatase 2C 33-like [Fragaria 
vesca subsp. vesca]
Length=424

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 205/310 (66%), Gaps = 23/310 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGD-ESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS FS  G KG+NQDA I ++ +G  E   FCG+FDGHG +GH V+K VR+ LP
Sbjct  96    NGFSDVASLFSKQGKKGVNQDAMIAWENFGSKEDTIFCGVFDGHGPSGHMVAKKVRDSLP  155

Query  292   SLFLKQAKFLPKIRAKLNTNKLDD---GDTTENKS-----FLKWKEACVSAFKLMDKQIK  447
                        K+ ++   N  D    G + ENK      F   K++ + AFK+MDK++K
Sbjct  156   L----------KVSSQWVLNTTDANRAGASEENKDSHGEFFATLKDSFLKAFKVMDKELK  205

Query  448   QVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTDLKPSVPC  624
                ++DC  SG+TAV  ++Q +DLV+AN+GDSRAVLG + + G + A+QLT DLKP++P 
Sbjct  206   LHPRIDCYCSGTTAVTMVKQGQDLVIANIGDSRAVLGTRDEEGSLVAVQLTVDLKPNLPR  265

Query  625   EAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHN  804
             EAERI    GRV AL  EP + RVWLPN ++PGLAM+RAFGDF LK +G+IS P++SY  
Sbjct  266   EAERITLRKGRVFALHNEPDVSRVWLPNSNSPGLAMARAFGDFCLKDYGLISVPDISYRR  325

Query  805   LSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRR  984
             L+  D F+VLATDG+WDVLSN EV+  V ++       AA+A+VE A  AWK ++P ++ 
Sbjct  326   LTDKDEFVVLATDGIWDVLSNKEVVEIVAASPR---PSAARALVELANRAWKFKYPYAKT  382

Query  985   DDCTAICLFL  1014
             DDC  +CLFL
Sbjct  383   DDCAVVCLFL  392



>ref|XP_010556832.1| PREDICTED: probable protein phosphatase 2C 52 [Tarenaya hassleriana]
Length=476

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/309 (48%), Positives = 201/309 (65%), Gaps = 24/309 (8%)
 Frame = +1

Query  142   FSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFL  321
             F+  G KGINQDA I+++ +  E   FCG+FDGHG  GH V++ VR+ LP   +K   FL
Sbjct  70    FTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPYGHLVARKVRDALP---VKLMSFL  126

Query  322   PKIRAKLNTNKLD-----------------DGDTTENKSFLKWKEACVSAFKLMDKQIKQ  450
               +++K NT++                   DG ++E+K    W+EA + +FK MDK+++ 
Sbjct  127   HSLQSKQNTSRGSRFGRSSSKSDAPEAEKVDG-SSEDKLSCLWREAFLKSFKAMDKELRS  185

Query  451   VEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSVPCE  627
                LDC  SGSTAV  ++Q   L + N+GDSRA+LG K  N  + AIQLT DLKP +P E
Sbjct  186   HPNLDCFCSGSTAVTIVKQGSSLFMGNIGDSRAILGSKDSNDSMVAIQLTVDLKPDLPKE  245

Query  628   AERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNL  807
             AERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+  L
Sbjct  246   AERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSHRVL  305

Query  808   SPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRD  987
             +  D F+VLA+DGVWDVLSN+EV+  V  A       AA+ +V+AA   WK ++P S+ D
Sbjct  306   TDRDQFIVLASDGVWDVLSNEEVVEIV--ATSPSRASAARILVDAAAREWKLKYPTSKMD  363

Query  988   DCTAICLFL  1014
             DC  +CLFL
Sbjct  364   DCAVVCLFL  372



>ref|XP_006345821.1| PREDICTED: probable protein phosphatase 2C 33-like [Solanum tuberosum]
Length=470

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 215/347 (62%), Gaps = 40/347 (12%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGD-ESGDFCGIFDG  240
             D+ +E ++H        NG   +AS FS  G KG NQDA I+++ +G  E   FCG+FDG
Sbjct  39    DFHKEELLHRVPGRMFLNGSSEVASLFSQQGKKGTNQDAMIVWENFGSREDTVFCGVFDG  98

Query  241   HGKNGHYVSKLVRNHLP--------------------------SLFLKQAKFLPKIRAKL  342
             HG  GH V+K VR+ LP                          SL+ + A  +    ++L
Sbjct  99    HGPFGHMVAKRVRDALPLKLSTHWEVNIKSEDVLREISLNTGSSLYPEDAVLISAEESRL  158

Query  343   NTNKLDDGDTTEN--KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDED  516
             +     D + TE   + F   KE+ + A+K+MD++++    +DC  SG+T+V  ++Q E+
Sbjct  159   SI----DVEETEKHLEVFQTLKESFLKAYKVMDRELRSYTNIDCFCSGTTSVTLVKQGEN  214

Query  517   LVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQR  693
             LV+ N+GDSRAVLG R  D+ + A+QLT DLKP +P E ERIRKC GRV +L++EP + R
Sbjct  215   LVIGNVGDSRAVLGTRGEDDSLTAVQLTVDLKPDLPAEFERIRKCKGRVFSLQDEPDVAR  274

Query  694   VWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDE  873
             VW+PN ++PGLAM+RAFGDF LK  G+IS PE+SY  LS  D F+VLATDG+WDVLSNDE
Sbjct  275   VWMPNSNSPGLAMARAFGDFCLKDFGVISVPEISYRRLSEKDEFIVLATDGIWDVLSNDE  334

Query  874   VMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             V++ V          AA+++VE AV AWK  +P S+ DDC  +CLFL
Sbjct  335   VVNIV--DSASSRSSAARSLVEEAVRAWKITYPTSKVDDCAVVCLFL  379



>ref|XP_006350422.1| PREDICTED: probable protein phosphatase 2C 33-like [Solanum tuberosum]
Length=604

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 211/327 (65%), Gaps = 29/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG +GH V+K VR+ LP
Sbjct  175   NGSSEAASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPHGHMVAKRVRDSLP  234

Query  292   SLF-------LKQAKFLPKIRAKLNTN-----------------KLDDGDTTENKS-FLK  396
             S         LK    L +I      +                  +D  +T ++   F  
Sbjct  235   SKLSAHWEVNLKSEDVLKEISLNAGASLYPEDASLISAADESRVSIDVEETGKHPEIFQT  294

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              KE+ + A+K+MD+++K    +DC  SG+TAV  I+Q +DLV+ N+GDSRA+LG R  D 
Sbjct  295   LKESFLKAYKVMDRELKSYTNIDCFCSGTTAVTLIKQGQDLVIGNVGDSRAILGTRDKDG  354

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP++P EAERIRKC GRV +L++EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  355   SLTAVQLTVDLKPNLPAEAERIRKCRGRVFSLRDEPEVARVWLPNSDSPGLAMARAFGDF  414

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS PE+SY  L+  D F+VLATDG+WDVL+NDEV+  V SA  +    AA+++
Sbjct  415   CLKDFGLISVPEISYRRLTGKDEFIVLATDGIWDVLTNDEVVKIVASASSH--SSAARSL  472

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  473   VESAVRAWRTKYPTSKVDDCAVVCLFL  499



>ref|XP_006357501.1| PREDICTED: probable protein phosphatase 2C 52-like [Solanum tuberosum]
Length=472

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 203/316 (64%), Gaps = 22/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA ++++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSKTSCIFTQQGRKGINQDAMVVWEDFMAEDVTFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRAKLN---------TNKLD------DGDTTENKSFLKWKEACVSAFKL  429
               LK A FL    +K N           KLD      DG   +   +L W+EA + ++K 
Sbjct  120   --LKLASFLQSFDSKHNGSTANCCSVNKKLDVVDPDKDGGMEDKVDYL-WREAFLKSYKA  176

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK+++    LDC  SGSTA+  ++Q  +L +  +GDSRA++  K  N  + A+QLT DL
Sbjct  177   MDKELRSHPNLDCFCSGSTAITLVKQGSNLFMGYIGDSRAIMASKDSNDSMVAVQLTVDL  236

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP +QRVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  237   KPDLPKEAERIKRCKGRVFALQDEPEVQRVWLPFDDAPGLAMARAFGDFCLKEYGVISVP  296

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  297   EFSHRILTDRDKFIVLASDGVWDVLSNEEVVEIVSSAPTRA--SAARILVDSAAREWKTK  354

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  355   YPTSKMDDCAVVCLFL  370



>ref|XP_004239696.1| PREDICTED: probable protein phosphatase 2C 33 [Solanum lycopersicum]
Length=470

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 210/330 (64%), Gaps = 36/330 (11%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGD-ESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS FS  G KG NQDA I+++ +G  E   FCG+FDGHG  GH V+K VR+ LP
Sbjct  56    NGSSEVASLFSQQGKKGTNQDAMIVWENFGSREDTVFCGVFDGHGPFGHMVAKRVRDALP  115

Query  292   --------------------------SLFLKQAKFLPKIRAKLNTNKLDDGDTTEN--KS  387
                                       SL+ + A  +    ++L+     D + T+N  + 
Sbjct  116   LKLSTHWEVNIKSEDVLREISLNTGSSLYPEDAVLISAEESRLSI----DVEETKNHLEV  171

Query  388   FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RK  564
             F   KE+ + A+K+MD++++    +DC  SG+TAV  ++Q E LV+ N+GDSRAVLG R 
Sbjct  172   FQTLKESFLKAYKVMDRELRSYTNIDCFCSGTTAVTLVKQGEHLVIGNVGDSRAVLGTRG  231

Query  565   TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAF  744
              D+ + A+QLT DLKP +P E ERIRKC GRV +L++EP + RVW+PN ++PGLAM+RAF
Sbjct  232   EDDSLTAVQLTVDLKPDLPAEFERIRKCKGRVFSLQDEPDVARVWMPNSNSPGLAMARAF  291

Query  745   GDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaa  924
             GDF LK  G+IS PE+SY  LS  D F++LATDG+WDVLSNDEV++ V SA       AA
Sbjct  292   GDFCLKDFGVISVPEISYRRLSEKDEFIILATDGIWDVLSNDEVVNIVDSASSR--SSAA  349

Query  925   kavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +A+VE AV AWK  +P S+ DDC  +CLFL
Sbjct  350   RALVEEAVQAWKITYPTSKVDDCAVVCLFL  379



>ref|XP_011039750.1| PREDICTED: probable protein phosphatase 2C 52 [Populus euphratica]
Length=474

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 201/316 (64%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  60    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDATFCGVFDGHGPHGHLVARKVRDALP-  118

Query  295   LFLKQAKFLPKIRAKLN---------------TNKLDDGDTTENKSFLKWKEACVSAFKL  429
               +K   FL   +++ N                  LD   + E+K    W+EA + ++K 
Sbjct  119   --VKLQSFLNSCQSRQNGSDQACFKGNLMKSDVGDLDKDGSVEDKLNSLWREAFLKSYKA  176

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK++K    LDC  SGSTA+  ++Q  +L +  +GDSRA++G K  N  + A+QLT DL
Sbjct  177   MDKELKSHPNLDCFCSGSTAITIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAVQLTVDL  236

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  237   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  296

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  297   EFSHRTLTERDQFIVLASDGVWDVLSNEEVVEIVSSAPTRA--SAARILVDSAAREWKLK  354

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  355   YPTSKMDDCAVVCLFL  370



>ref|XP_008388813.1| PREDICTED: probable protein phosphatase 2C 33 [Malus domestica]
Length=500

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/344 (46%), Positives = 214/344 (62%), Gaps = 33/344 (10%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG    AS F+  G KG NQDA I+++ +   +   FCG+FDG
Sbjct  42    DYRREEQLHRIPGRMFLNGSSEAASLFTQQGKKGTNQDAMIVWENFCSRTDTVFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIR----AKLNTN------------  351
             HG  GH V+K VR+ LP        + +   + L  I       LN++            
Sbjct  102   HGPFGHMVAKRVRDSLPLKLSANWEVKITNDEVLKGISLNTAGSLNSDDTAFVSVDEDLR  161

Query  352   -KLDDGDTTENKSFLK-WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVV  525
               +D  +T +N   L+  +E+ + AFK+MD++++    +DC  SG+TAV  I+Q  DL +
Sbjct  162   PSVDVDETEKNPEILQALRESFLKAFKVMDRELRTTPSIDCFCSGTTAVTLIKQGRDLFI  221

Query  526   ANLGDSRAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWL  702
              N+GDSRAVL  R  D+ + AIQLT DLKPS+P EAERIRKC GRV AL++EP + RVWL
Sbjct  222   GNVGDSRAVLCTRDRDDTLSAIQLTVDLKPSLPAEAERIRKCRGRVFALQDEPEVARVWL  281

Query  703   PNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMS  882
             PN D+PGLAM+RAFGDF LK  G+IS P+VSY  L+  D F+VLATDG+WDVLSN EV+ 
Sbjct  282   PNNDSPGLAMARAFGDFCLKDFGLISVPDVSYRRLTEKDEFIVLATDGIWDVLSNKEVVD  341

Query  883   TVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
              + +A       AA+A+VE AV AW++++P S+ DDC  +CLFL
Sbjct  342   VIATA--PARPSAAQALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>gb|EYU39712.1| hypothetical protein MIMGU_mgv1a008325mg [Erythranthe guttata]
Length=377

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 148/331 (45%), Positives = 210/331 (63%), Gaps = 35/331 (11%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA ++++ +G  +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  4     NGSSDVASLFTQQGKKGTNQDAMVVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDSLP  63

Query  292   SLFL--------KQAKFLPKIRAKLNTNK--------------------LDDGDTTENKS  387
              + +        K  + L ++   LNT +                    +D  +  + + 
Sbjct  64    LMLIANWEVNNIKSGEILREV--SLNTTESLSTEEASSCLSANEEVMSSIDSEEALKQQG  121

Query  388   -FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-R  561
              F   K++ ++AFK+MD++++    +DC  SG+TAV  ++Q + LV+ N+GDSRAVL  R
Sbjct  122   VFQALKKSFLNAFKVMDRELRMYTNIDCFYSGTTAVTFVKQGQHLVIGNVGDSRAVLATR  181

Query  562   KTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRA  741
               +N + A+QLT DLKP++P E ERIRKC GRV AL++EP + RVWLPN ++PGLAM+RA
Sbjct  182   DENNKLTAVQLTVDLKPNLPAEEERIRKCKGRVFALQDEPEVARVWLPNNNSPGLAMARA  241

Query  742   FGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeema  921
             FGDF LK  G+IS PE+SY +++  D F+VLATDG+WDVLSN EV+  V S        A
Sbjct  242   FGDFCLKDFGLISVPEISYRHITNKDEFVVLATDGIWDVLSNKEVVKIVSSC--PSRSQA  299

Query  922   akavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             A+AVVE AV AW+ ++P S+ DDC  +CLFL
Sbjct  300   ARAVVETAVRAWRSKYPTSKVDDCAVVCLFL  330



>ref|XP_009118526.1| PREDICTED: probable protein phosphatase 2C 33 [Brassica rapa]
Length=467

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 211/325 (65%), Gaps = 29/325 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +A  F+  G KG NQDA ++++ +G  +   FCG+FDGHG  GH V+K VR++LP
Sbjct  61    NGSSEVACIFTQQGKKGPNQDAMVVWESFGSRTDTVFCGVFDGHGPFGHMVAKRVRDNLP  120

Query  292   SLFLKQAKF----------LPKIRAKLNTNKLDDG------------DTTENKSFLKWKE  405
                LK + +          +  +    N N  D              ++TE++ F   KE
Sbjct  121   ---LKLSAYWEAKVPVEGSIKTVNNSANNNSEDAASFVSTEEEPRPEESTESELFQTLKE  177

Query  406   ACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVK  582
             A + AFK+MD+++K    +DC  SG+TAV  I+Q E LVV N+GDSRAV+G R   NG+ 
Sbjct  178   AFLKAFKVMDRELKFHGSVDCFCSGTTAVTLIKQGEYLVVGNVGDSRAVMGTRDGKNGLV  237

Query  583   AIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLK  762
             A+QLT DLKP++P E ERI+KC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK
Sbjct  238   AVQLTVDLKPNLPAEEERIKKCRGRVFALRDEPDVCRVWLPNCDSPGLAMARAFGDFCLK  297

Query  763   YHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavvea  942
               G+IS PEVS+  L+  D F+VLATDG+WDVLSN+EV+  V SA       AA+A+VE 
Sbjct  298   DFGLISVPEVSFRRLTEKDEFIVLATDGIWDVLSNEEVVKIVASAPSR--SSAARALVET  355

Query  943   avdaWKRRFPNSRRDDCTAICLFLQ  1017
             AV AW+ ++P S+ DDC A+CL+L 
Sbjct  356   AVRAWRHKYPTSKVDDCAAVCLYLN  380



>ref|XP_008782938.1| PREDICTED: probable protein phosphatase 2C 66 isoform X2 [Phoenix 
dactylifera]
Length=547

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 209/326 (64%), Gaps = 28/326 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +A  F+  G KG NQDA ++++ +   S   FCG+FDGHG  GH V++ VR+ LP
Sbjct  93    NGATEVACLFTQQGKKGFNQDAMLVWENFASRSDTIFCGVFDGHGPFGHLVARKVRDSLP  152

Query  292   SLFL-------------KQAKFLP-------KIRAKLNTNKLDDGDTTENKS----FLKW  399
                               Q  FLP            ++    +  D  EN+     +L  
Sbjct  153   LKLCAEWIGNVSGHNSPSQNGFLPGSANFEESTSVIIDDEWAEPVDADENEKLPEMYLTL  212

Query  400   KEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK-TDNG  576
             K++ + A +LMDK++K   ++DC  SG+TAV  ++Q +DLVV N+GDSRA++GR+  DN 
Sbjct  213   KQSLLKASRLMDKELKVQPRIDCFCSGTTAVTIVKQGQDLVVGNVGDSRAIMGRRDEDNN  272

Query  577   VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFM  756
             + A+QLT DLKP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF 
Sbjct  273   LVAVQLTIDLKPNLPKEASRIQQCKGRVFALQDEPEVARVWLPNSDSPGLAMARAFGDFC  332

Query  757   LKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavv  936
             LK +G+IS P+VSYH+L+  D F+VLATDGVWDVLSN EV+  V SA       AA+AVV
Sbjct  333   LKDYGLISIPDVSYHHLTEKDEFIVLATDGVWDVLSNKEVVDIVASAPTR--TTAARAVV  390

Query  937   eaavdaWKRRFPNSRRDDCTAICLFL  1014
             + AV AW+ +FP S+ DDC  +CLFL
Sbjct  391   DCAVRAWRLKFPTSKIDDCAVVCLFL  416



>ref|XP_009783863.1| PREDICTED: probable protein phosphatase 2C 33 [Nicotiana sylvestris]
Length=487

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 157/345 (46%), Positives = 218/345 (63%), Gaps = 37/345 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E ++H        NG   +AS FS  G+KG NQDA I+++ +G  +   FCG+FDG
Sbjct  39    DYHKEELLHRIPGRMFLNGSSEVASLFSQQGNKGTNQDAMIVWENFGSRTDTVFCGVFDG  98

Query  241   HGKNGHYVSKLVRNHLP--------------------------SLFLKQAKFLPKIRAKL  342
             HG  GH V+KLVR+ LP                          SL+ + A  + +  +++
Sbjct  99    HGPYGHMVAKLVRDALPLKLSTHWEVNIKSEDVLREISLNRGSSLYPEDASLISE-ESRV  157

Query  343   NTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLV  522
             + +  D    TE   F   K + + A+K++D++++    +DC  SG+TAV  ++Q +DLV
Sbjct  158   SIDVEDTEKHTE--VFQTLKGSFLKAYKVVDRELRSYTNIDCLCSGTTAVTLVKQGKDLV  215

Query  523   VANLGDSRAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVW  699
             + N+GDSRAVL  R  D+ + A+QLT DLKP++P EAERIRKC GRV +L +EP + RVW
Sbjct  216   IGNIGDSRAVLCMRGDDDSLTAVQLTVDLKPNLPAEAERIRKCKGRVFSLHDEPDVARVW  275

Query  700   LPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVM  879
             +PN D+PGLAM+RAFGDF LK  G+IS PE+SY  LS  D F+VLATDG+WDVLSNDEV+
Sbjct  276   MPNSDSPGLAMARAFGDFCLKDFGVISVPEISYRCLSEKDEFIVLATDGIWDVLSNDEVV  335

Query  880   STVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
               V SA      +AA+++VE AV AWK  +P S+ DDC  +CLFL
Sbjct  336   RIVASASSR--SLAARSLVEVAVRAWKTTYPTSKVDDCAVVCLFL  378



>ref|XP_004304122.1| PREDICTED: probable protein phosphatase 2C 52-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 206/316 (65%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  60    NGKSKTSCVFTQQGRKGINQDAMIVWEDFMSEDAIFCGVFDGHGPHGHLVARKVRDALP-  118

Query  295   LFLKQAKFLPKIRAKL----------NTNKLDDGDTT-----ENKSFLKWKEACVSAFKL  429
               LK   FL    ++           N  KLDDG+T      E K  L+W+EA + ++K 
Sbjct  119   --LKLLSFLNSSPSRSNVSSKTCFGGNVKKLDDGETEKGASPEEKLNLEWREAFMKSYKS  176

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK-TDNGVKAIQLTTDL  606
             MDK+++    +DC  SGSTAV  ++Q  +L +  +GDSRA+LG K + + + AIQLT DL
Sbjct  177   MDKELRSHPNVDCFCSGSTAVTLVKQGSNLFMGYIGDSRAILGSKDSSDSMIAIQLTVDL  236

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  237   KPDLPREAERIKRCKGRVFALQDEPEVSRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  296

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E ++  L+  D F+VLA+DGVWDVLSN+EV+  V SA       A++ VV+AA   WK +
Sbjct  297   EFAHRILTERDQFIVLASDGVWDVLSNEEVVEIVSSAPSR--SAASRFVVDAAAREWKLK  354

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  355   YPTSKMDDCAVVCLFL  370



>ref|XP_008777864.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Phoenix 
dactylifera]
Length=498

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 210/330 (64%), Gaps = 35/330 (11%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V++ VR+ LP
Sbjct  58    NGASSVASLFTQQGKKGTNQDAMIVWENFGSRADTVFCGVFDGHGPYGHMVARKVRDSLP  117

Query  292   SLFLKQAKFLP--------------KIRAKLNTNK-----LDDG-----DTTENKS----  387
                LK +  L                    +N+ +     LD+G     D  E       
Sbjct  118   ---LKLSTHLEVNVGSDDCREGSIISHSGSMNSEETSSICLDEGSGVSTDIEEKDKHPEI  174

Query  388   FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKT  567
             F+  KE+ V AFK+MDK++K    ++C  SG+TAV  ++Q EDLV+ N+GDSRAVLG + 
Sbjct  175   FMTLKESFVKAFKVMDKELKLHPNINCFCSGTTAVTMVKQGEDLVIGNVGDSRAVLGTRD  234

Query  568   DNG-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAF  744
              N  + A+QLT DLKP++P EAERIRKC GRV AL++EP + RVWLPN ++PGLAM+RAF
Sbjct  235   KNDCLIAVQLTVDLKPNLPREAERIRKCKGRVFALQDEPGVARVWLPNSNSPGLAMARAF  294

Query  745   GDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaa  924
             GDF LK  G+IS PEVSY  ++  D F+VLATDGVWDVLSN EV+  V S        AA
Sbjct  295   GDFCLKDFGLISVPEVSYRRVTERDEFIVLATDGVWDVLSNKEVVDIVAST--PARSSAA  352

Query  925   kavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +++VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  353   RSLVESAVRAWRLKYPTSKIDDCAVVCLFL  382



>ref|XP_011095667.1| PREDICTED: probable protein phosphatase 2C 6 [Sesamum indicum]
Length=518

 Score =   275 bits (704),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 158/362 (44%), Positives = 220/362 (61%), Gaps = 27/362 (7%)
 Frame = +1

Query  7     LKIIISWEMGICISKASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAI  186
             LK   S +    ISK S  +   +     +      NG   IA  ++  G KG NQDA I
Sbjct  27    LKKGTSGDFATFISKLSGAVVAEEQALRQIPGRLFANGASRIACLYTQQGKKGTNQDAMI  86

Query  187   LYQGYG---DESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKF-LPKIRAKLNTN-  351
             +++ +    D S  FCG+FDGHG  GH V++ VR+ LP L   Q +  L   +   N N 
Sbjct  87    VWENFSAGSDASATFCGVFDGHGPYGHMVARKVRDALPILLRSQLETKLENDQNHANKNG  146

Query  352   ------KLDD-----------GDTTEN--KSFLKWKEACVSAFKLMDKQIKQVEKLDCCT  474
                   + DD            + T+   + ++  K++ + AFKLMDK++K    +DC  
Sbjct  147   NFEGMRRFDDFMDEDGCESMEAEDTDKVPEMYVPLKKSILKAFKLMDKELKLHPTIDCFC  206

Query  475   SGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCN  651
             SG+TAV  I+Q +DL++ N+GDSRAVL  R  DN + A+QLT DLKP++P EA RI+KC 
Sbjct  207   SGTTAVALIKQGQDLIIGNVGDSRAVLATRDKDNALVAVQLTVDLKPNLPREAARIQKCK  266

Query  652   GRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLV  831
             GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK  G+IS P+V +H+++  D F++
Sbjct  267   GRVFALQDEPEVARVWLPNSDSPGLAMARAFGDFCLKDFGLISIPDVYHHHITERDQFVI  326

Query  832   LATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLF  1011
             LATDGVWDVLSN E +  V SA   G   AA+A+V+ A  AW+ ++P S+ DDC  +CLF
Sbjct  327   LATDGVWDVLSNKEAVDIVASA--PGRGTAARALVDCATRAWRLKYPTSKNDDCAVVCLF  384

Query  1012  LQ  1017
             L+
Sbjct  385   LE  386



>ref|XP_009147325.1| PREDICTED: probable protein phosphatase 2C 33 [Brassica rapa]
Length=458

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 213/318 (67%), Gaps = 19/318 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    A  F+  G KG NQDA ++++ +G  +   FCG+FDGHG  GH V+K VR++LP
Sbjct  59    NGASEAACIFTQQGKKGPNQDAMVVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDNLP  118

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDG-------------DTTENKS--FLKWKEACVSAFK  426
                    + +  I +  N N  +D              ++ E++S  F   K+A + AFK
Sbjct  119   LKLSAYWEAIVPINSASNINNSEDASFVSAEEEPSANNNSEESQSDLFQTLKDAFLKAFK  178

Query  427   LMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTD  603
             +MD+++K  + +DC  SG+TAV  I+Q E LVV N+GDSRAV+G R  +N + A+QLT D
Sbjct  179   VMDRELKFHKSVDCFCSGTTAVTLIKQGEYLVVGNVGDSRAVMGTRNGENALVAVQLTVD  238

Query  604   LKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIIST  783
             LKP++P EAERI+KC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK  G+IS 
Sbjct  239   LKPNLPAEAERIKKCRGRVFALRDEPEVCRVWLPNCDSPGLAMARAFGDFCLKDFGLISV  298

Query  784   PEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKR  963
             P+VS+  L+  D F+VLA+DG+WDVLSN+EV++ V SA       AA+A+VE+AV AW+ 
Sbjct  299   PDVSFRRLTEQDEFIVLASDGIWDVLSNEEVVAIVASAPSR--SSAARALVESAVRAWRY  356

Query  964   RFPNSRRDDCTAICLFLQ  1017
             ++P S+ DDC A+CL+L 
Sbjct  357   KYPTSKVDDCAAVCLYLH  374



>ref|XP_003539901.1| PREDICTED: probable protein phosphatase 2C 52-like isoform X1 
[Glycine max]
 ref|XP_006592417.1| PREDICTED: probable protein phosphatase 2C 52-like isoform X2 
[Glycine max]
Length=471

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 202/312 (65%), Gaps = 14/312 (4%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLP-  291
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRSSCIFTQQGRKGINQDAMIVWEDFMSEDTIFCGVFDGHGPHGHLVARKVRDALPT  120

Query  292   ----SLFLKQAKFLPKIRAKLNTN-KLDDGDT-----TENKSFLKWKEACVSAFKLMDKQ  441
                 SL   ++K     +     N K D GD+      E+K    W+EA + A+K MDK+
Sbjct  121   KLVSSLHSNESKRNGSGKTCFKGNVKPDSGDSEKDCSAEDKLNSTWREAFMKAYKAMDKE  180

Query  442   IKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSV  618
             ++    LDC  SGSTAV  ++Q  +L +  +GDSRA++G K  N  + AIQLT DLKP +
Sbjct  181   LRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAIMGSKDSNDSIVAIQLTVDLKPDL  240

Query  619   PCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSY  798
             P EAERI+KC GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+
Sbjct  241   PREAERIKKCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSH  300

Query  799   HNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNS  978
               L+  D F++LA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK ++P S
Sbjct  301   RQLTDRDQFIILASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVDSAAREWKLKYPTS  358

Query  979   RRDDCTAICLFL  1014
             + DDC  +CLFL
Sbjct  359   KMDDCAVVCLFL  370



>gb|KDO54036.1| hypothetical protein CISIN_1g011218mg [Citrus sinensis]
Length=456

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 218/346 (63%), Gaps = 37/346 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   IAS F+  G KG NQDA I+++ +   +   FCG+FDG
Sbjct  42    DYRREEPLHRIPGRLFLNGSSEIASLFTQQGKKGTNQDAMIVWENFASRADTIFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIRAKLNT----NKLD---------  360
             HG  GH V+K VR+ LP        + +   + L +I   +NT    N  D         
Sbjct  102   HGPYGHMVAKRVRDSLPLKLSSHWEVNITSEEVLREI--SINTAGSINSEDTSFVSADEE  159

Query  361   ---DGDTTENKSFLKW----KEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
                  D  E + F ++    KE+ + AFK+MD++++    +DC  SG+TAV  I+Q + L
Sbjct  160   PRASADLEETEKFPEFFQTLKESFLKAFKVMDRELRMHATIDCFCSGTTAVTLIKQGQHL  219

Query  520   VVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRV  696
             V+ N+GDSRAVLG R  D+ + A+QLT DLKP++P EAERIRKC GRV AL +EP + RV
Sbjct  220   VIGNVGDSRAVLGTRDKDDSLVAMQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARV  279

Query  697   WLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEV  876
             WLPN D+PGLAM+RAFGDF LK  G+IS P++SY  L+  D F+VLATDG+WDVLSN+EV
Sbjct  280   WLPNYDSPGLAMARAFGDFCLKDFGLISVPDISYRRLTDKDEFIVLATDGIWDVLSNEEV  339

Query  877   MSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +  V SA       AA+++VE+AV AW+R++P S+ DDC  +CLFL
Sbjct  340   VEIVASAPAR--SSAARSLVESAVRAWRRKYPTSKVDDCAVVCLFL  383



>ref|XP_004170792.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 33-like [Cucumis sativus]
Length=400

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 207/318 (65%), Gaps = 21/318 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGD-ESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KGINQDA I+++ +G  E   FCG+FDGHG  GH V+K VR+ LP
Sbjct  65    NGTTDHASLFTRQGKKGINQDAMIVWENFGSKEDTIFCGVFDGHGPFGHMVAKXVRDSLP  124

Query  292   -----SLFLKQAKFLPKIRAKLNTNKLDDGDT-----------TENKSFLKWKEACVSAF  423
                   L L   +   + R +++   L   D+           +    ++  KE+ + AF
Sbjct  125   LKLNAQLELDATRKEGQARCQVSPPTLVQKDSGTSHCDPDHRGSYGNIYITLKESFLKAF  184

Query  424   KLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTT  600
             K+MDK++K    +DC TSG+T+V  ++Q   L++ N+GDSRAVLG R   N + A+QLT 
Sbjct  185   KVMDKELKLHPYIDCYTSGTTSVALVKQGRHLIIGNVGDSRAVLGTRDKSNSLAAVQLTV  244

Query  601   DLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIIS  780
             DLKP+ P EAERIR C GR+ AL+ EP I RVWLPN D+PGLAM+RAFGDF LK  G+I+
Sbjct  245   DLKPNHPREAERIRLCKGRIFALQNEPEIFRVWLPNNDSPGLAMARAFGDFCLKDFGVIA  304

Query  781   TPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWK  960
              P+VSY +L+  D F+VLATDGVWDVLSN+EV++ V S+ +     AA+ +V++A  AW+
Sbjct  305   VPDVSYRHLTEKDEFVVLATDGVWDVLSNEEVVAIVASSPK---SSAARVLVDSATRAWR  361

Query  961   RRFPNSRRDDCTAICLFL  1014
              ++P ++ DDC  +CL+L
Sbjct  362   LKYPTAKVDDCAVVCLYL  379



>ref|XP_009415101.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415102.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 204/334 (61%), Gaps = 46/334 (14%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS FS  G KGINQDA I+++ +G  S   FCG+FDGHG NGH V+K VR+ LP
Sbjct  55    NGASSAASLFSRQGKKGINQDAMIVWENFGCRSDTVFCGVFDGHGPNGHMVAKKVRDILP  114

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDG----------DTTENKS------------------  387
                        K+RA+   N  DD           D+ E  S                  
Sbjct  115   L----------KLRARWEVNIGDDECKENNLSKSMDSEETSSVCLNEEFRASIGFKDLIK  164

Query  388   ----FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVL  555
                     ++  + AF+ +DK+++    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVL
Sbjct  165   RSEIIATLRDPFLKAFRKVDKELRLHPDIDCFYSGTTAVTLVKQGQDLVIGNVGDSRAVL  224

Query  556   G-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAM  732
             G R  +N + A+QLT DLKP++P EAERIR+C GRV AL++EP + R+WLPN ++PGLAM
Sbjct  225   GTRDQNNTLVAVQLTVDLKPNLPREAERIRRCRGRVFALRDEPEVARLWLPNANSPGLAM  284

Query  733   SRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGe  912
             +RAFGDF LK  G+IS PE+SY  ++  D F+VLATDGVWDVLSN EV+  V  A     
Sbjct  285   ARAFGDFCLKDFGLISVPEISYRRITEKDEFIVLATDGVWDVLSNKEVVDIVAMASTRS-  343

Query  913   emaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
               AA+ VVE+A  AW+ R+P SR DDC  +CLFL
Sbjct  344   -SAARYVVESAGRAWRLRYPTSRVDDCAVVCLFL  376



>gb|KDO63278.1| hypothetical protein CISIN_1g045692mg [Citrus sinensis]
Length=424

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 208/321 (65%), Gaps = 18/321 (6%)
 Frame = +1

Query  82    GQENVVHFGDCNGVEVI-------ASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFD  237
             G+++ V  GD NG  V         S F+  G KGINQDA  +++ + GD+   FCG+FD
Sbjct  33    GEDDFVRVGD-NGASVRLQGSSKNISMFTQQGRKGINQDAMTVWENFTGDKDTVFCGVFD  91

Query  238   GHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEAC-V  414
             GHG  GH +++ VR++LPS      K L     K N     +G  +    F +  EA  V
Sbjct  92    GHGPAGHKIARHVRDNLPSKLSTAIKLL-----KRNHEDYSNGSKSSQNPFFRALEASLV  146

Query  415   SAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTD-NGVKAIQ  591
              A++ +D ++     +D  +SG+TAV  I++ E L++ANLGDSRAVL  + D N +  +Q
Sbjct  147   KAYEELDDELGLASAVDSYSSGATAVNIIKKGEHLIIANLGDSRAVLCTRDDRNQLVPVQ  206

Query  592   LTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHG  771
             LTTDLKP +  EAERIR C GRV A+ EEP + RVW+P+ED PGLAM+RAFGDF LK +G
Sbjct  207   LTTDLKPEIASEAERIRNCKGRVFAMDEEPDVYRVWMPDEDCPGLAMARAFGDFCLKDYG  266

Query  772   IISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavd  951
             +IS PE+SY  L+  D F+VLATDGVWDVL+N EV+ TV  A +  +EMAAK +V  AV 
Sbjct  267   LISIPEISYRKLTREDQFVVLATDGVWDVLTNSEVIRTVACASK--KEMAAKMLVSRAVR  324

Query  952   aWKRRFPNSRRDDCTAICLFL  1014
             AW+ ++P S+ DDC AICLFL
Sbjct  325   AWRTKYPGSKIDDCAAICLFL  345



>ref|XP_011045478.1| PREDICTED: probable protein phosphatase 2C 52 [Populus euphratica]
Length=473

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 204/316 (65%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  60    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARKVRDALP-  118

Query  295   LFLKQAKFLPKIRAKLN----------TNKLDDGD-----TTENKSFLKWKEACVSAFKL  429
               +K   FL   +++ N          + K D GD     + E+K    W+EA + ++K 
Sbjct  119   --VKLQSFLNSCQSRQNEPGQTCFMGNSKKSDVGDLDKDGSVEDKLNSLWREAFLKSYKA  176

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK++K    LDC  SGSTA+  ++Q  +L +  +GDSRA++G K  N  + A+QLT DL
Sbjct  177   MDKELKSHPNLDCFCSGSTAITIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAVQLTVDL  236

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  237   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  296

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  297   EFSHRTLTDKDQFIVLASDGVWDVLSNEEVVEIVSSAPTRA--SAARILVDSAAREWKLK  354

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  355   YPTSKMDDCAVVCLFL  370



>ref|XP_004140875.1| PREDICTED: probable protein phosphatase 2C 33-like [Cucumis sativus]
Length=400

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 207/318 (65%), Gaps = 21/318 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGD-ESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KGINQDA I+++ +G  E   FCG+FDGHG  GH V+K VR+ LP
Sbjct  65    NGTTDHASLFTRQGKKGINQDAMIVWENFGSKEDTIFCGVFDGHGPFGHMVAKKVRDSLP  124

Query  292   -----SLFLKQAKFLPKIRAKLNTNKLDDGDT-----------TENKSFLKWKEACVSAF  423
                   L L   +   + R +++   L   D+           +    ++  KE+ + AF
Sbjct  125   LKLNAQLELDATRKEGQARCQVSPPTLVQKDSGTSHCDPDHRGSYGNIYITLKESFLKAF  184

Query  424   KLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTT  600
             K+MDK++K    +DC TSG+T+V  ++Q   L++ N+GDSRAVLG R   N + A+QLT 
Sbjct  185   KVMDKELKLHPYIDCYTSGTTSVALVKQGRHLIIGNVGDSRAVLGTRDKSNSLAAVQLTV  244

Query  601   DLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIIS  780
             DLKP+ P EAERIR C GR+ AL+ EP I RVWLPN D+PGLAM+RAFGDF LK  G+I+
Sbjct  245   DLKPNHPREAERIRLCKGRIFALQNEPEIFRVWLPNNDSPGLAMARAFGDFCLKDFGVIA  304

Query  781   TPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWK  960
              P+VSY +L+  D F+VLATDGVWDVLSN+EV++ V S+ +     AA+ +V++A  AW+
Sbjct  305   VPDVSYRHLTEKDEFVVLATDGVWDVLSNEEVVAIVASSPK---SSAARVLVDSATRAWR  361

Query  961   RRFPNSRRDDCTAICLFL  1014
              ++P ++ DDC  +CL+L
Sbjct  362   LKYPTAKVDDCAVVCLYL  379



>ref|XP_003534509.1| PREDICTED: probable protein phosphatase 2C 33-like [Glycine max]
Length=489

 Score =   274 bits (700),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 211/327 (65%), Gaps = 29/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA ++++ +   E   FCG+FDGHG  GH V+K VR+ LP
Sbjct  58    NGSSQVASLFTQQGKKGTNQDAMVVWENFCSREDTIFCGVFDGHGPYGHMVAKRVRDSLP  117

Query  292   ---SLFLKQAKFLPKIRAKLNTNKLD--------------------DGDTTENKS--FLK  396
                +   +Q+    ++  +++ N                       D + TE     F  
Sbjct  118   LKLNAHWEQSASGEEVLKEISVNTAGSMNSEEAAFASADDESRVSVDAEETEKHPEIFQT  177

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              KE+ + AFK+MD+++K  + +DC  SG+TAV  ++Q  DL++ N+GDSRAVLG R+ DN
Sbjct  178   LKESFLKAFKVMDRELKMHQSIDCFCSGTTAVTLVKQGRDLIIGNVGDSRAVLGTREKDN  237

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + AIQLT DLKP++P E ERIRKC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  238   SLVAIQLTVDLKPNLPAEEERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDF  297

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS PEVSY  ++  D F+V+ATDG+WDVLSN EV+  V +A      +AA+A+
Sbjct  298   CLKDFGLISVPEVSYRRVTEKDEFVVMATDGIWDVLSNKEVVDIVAAAPRR--ALAARAL  355

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             VE+AV +W+ ++P S+ DDC  +CLFL
Sbjct  356   VESAVRSWRYKYPTSKVDDCAVVCLFL  382



>ref|XP_004492843.1| PREDICTED: probable protein phosphatase 2C 33-like [Cicer arietinum]
Length=506

 Score =   274 bits (701),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 209/329 (64%), Gaps = 33/329 (10%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KG NQDA ++++ +   E   FCG+FDGHG  GH V+K VR+ LP
Sbjct  65    NGSSQFASLFTQQGKKGTNQDAMVVWENFCSREDTIFCGVFDGHGPYGHMVAKKVRDSLP  124

Query  292   -------SLFLKQAKFLPKIRAKLNT----NKLD--------------DGDTTEN--KSF  390
                     L +   + L +I   +NT    N  D              D + TE   + F
Sbjct  125   LKLNAHWELNVSGEEVLKEI--SINTAGSMNSEDTAFISADEESRVSFDAEETEKLPEIF  182

Query  391   LKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKT  567
                KE+ + AFK+MD+ +K  + +DC  SG+TAV  I+Q  DLV+ N+GDSRAVLG R  
Sbjct  183   QTLKESFLKAFKVMDRDLKTHQTIDCFCSGTTAVTLIKQGRDLVIGNVGDSRAVLGTRDK  242

Query  568   DNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFG  747
             DN + A+QLT DLKP++P EAERIRKC GRV +L++EP + RVWLPN D+PGLAM+RAFG
Sbjct  243   DNSLVAVQLTVDLKPNLPAEAERIRKCKGRVFSLQDEPEVARVWLPNNDSPGLAMARAFG  302

Query  748   DFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaak  927
             DF LK  G+IS PEVSY  L+  D F+VLATDG+WDVLSN EV+  +  +       AA+
Sbjct  303   DFCLKDFGLISVPEVSYRRLTGKDEFIVLATDGIWDVLSNKEVVDII--SAAPRRATAAR  360

Query  928   avveaavdaWKRRFPNSRRDDCTAICLFL  1014
             ++VE+AV AW+ ++P S+ DDC  ICLFL
Sbjct  361   SLVESAVRAWRYKYPTSKVDDCAVICLFL  389



>ref|XP_006371587.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ERP49384.1| phosphatase 2C family protein [Populus trichocarpa]
Length=474

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 202/316 (64%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  60    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARKVRDTLP-  118

Query  295   LFLKQAKFLPKIRAKLNTNK---------------LDDGDTTENKSFLKWKEACVSAFKL  429
               +K   FL   +++ N +                LD   + E+K    W+EA + ++K 
Sbjct  119   --VKLQSFLNSCQSRQNGSDQTCFKGNSMKSDVADLDKDGSIEDKLNSLWREAFLKSYKA  176

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK++K    LDC  SGSTA+  ++Q  +L +  +GDSRA++G K  N  + A+QLT DL
Sbjct  177   MDKELKSHPNLDCFCSGSTAITIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAVQLTVDL  236

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  237   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  296

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  297   EFSHRTLTERDQFIVLASDGVWDVLSNEEVVEIVSSAPTRA--SAARILVDSAAREWKLK  354

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  355   YPTSKMDDCAVVCLFL  370



>gb|KDO73929.1| hypothetical protein CISIN_1g011968mg [Citrus sinensis]
Length=474

 Score =   273 bits (698),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 209/348 (60%), Gaps = 22/348 (6%)
 Frame = +1

Query  34    GICISKASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDES  213
              I + K SS   DAD    ++      N     A  ++  G KGINQDA I+++ +    
Sbjct  34    AIFLKKKSSIDDDADQLLHHISGRMVNNAASKTACVYTQQGKKGINQDAMIVWENFSSSD  93

Query  214   GDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS--  387
               FCGIFDGHG  GH V+K VR+ LP +   Q K      +  N N     + T + S  
Sbjct  94    TVFCGIFDGHGPYGHMVAKKVRDSLPVILCSQWKASNDQTSFENANGSTHSEETASLSMD  153

Query  388   -----------------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDED  516
                              +L  K++ + +FKLMDK++K    +DC  SG+TAV  ++Q  D
Sbjct  154   EEGFETLDTEGDKLPEIYLPLKKSMLKSFKLMDKELKLHPAIDCFCSGTTAVTLVKQGPD  213

Query  517   LVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQR  693
             +V+ N+GDSRAVL  R+ DN + A+QLT DLKP +P EA RI++C GRV AL++EP + R
Sbjct  214   IVIGNVGDSRAVLATREKDNSLVAVQLTVDLKPDLPREAARIQQCKGRVFALQDEPEVAR  273

Query  694   VWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDE  873
             VWLPN D+PGLAM+RAFGDF LK  G+IS P++ Y  L+  D F++LATDGVWDV+SN E
Sbjct  274   VWLPNNDSPGLAMARAFGDFCLKDFGLISVPDIYYRRLTEKDEFIILATDGVWDVISNKE  333

Query  874   VMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              +  V SA       AA+A+V+ AV +WK ++P S+ DDC  +CLFL+
Sbjct  334   AVEIVASAPSQA--TAARALVDWAVRSWKLKYPTSKNDDCAVVCLFLE  379



>gb|KHN41141.1| Hypothetical protein glysoja_017185 [Glycine soja]
Length=451

 Score =   273 bits (697),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 202/312 (65%), Gaps = 14/312 (4%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLP-  291
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  41    NGKSRGSCIFTQQGRKGINQDAMIVWEDFMSEDTIFCGVFDGHGPHGHLVARKVRDALPI  100

Query  292   ----SLFLKQAKFLPKIRAKLNTN-KLDDGDT-----TENKSFLKWKEACVSAFKLMDKQ  441
                 SL   ++K     +     N K D G++      E+K    W+EA + A+K MDK+
Sbjct  101   KLISSLHSNESKRNGSGKTCFKGNVKPDSGESEKDCSAEDKLNSTWREAFMKAYKAMDKE  160

Query  442   IKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSV  618
             ++    LDC  SGSTAV  ++Q  +L +  +GDSRA++G K  N  + AIQLT DLKP +
Sbjct  161   LRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAIQLTVDLKPDL  220

Query  619   PCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSY  798
             P EAERI+KC GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+
Sbjct  221   PREAERIKKCRGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSH  280

Query  799   HNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNS  978
               L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK ++P S
Sbjct  281   RQLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVDSAAREWKHKYPTS  338

Query  979   RRDDCTAICLFL  1014
             + DDC  +CLFL
Sbjct  339   KMDDCAVVCLFL  350



>ref|XP_009766317.1| PREDICTED: probable protein phosphatase 2C 52 [Nicotiana sylvestris]
Length=464

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 198/307 (64%), Gaps = 12/307 (4%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KG+NQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRTSCIFTQQGRKGVNQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRAKLNTNKL------DDGDTTENKSFLKWKEACVSAFKLMDKQIKQVE  456
               LK    L    +  + N        D    T +K   +WK+A + ++K MDK+++   
Sbjct  120   --LKLKSLLQSFESNRSENPQVETVDPDKDQVTSDKVVTQWKDAFLQSYKAMDKELRSQP  177

Query  457   KLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSVPCEAE  633
              LDC  SGSTAV  I+Q  +L +  +GDSRA+L  K +N  + A+QLT DLKP +P EAE
Sbjct  178   NLDCFCSGSTAVTLIKQGSNLYMGYIGDSRAILASKDENDSMVAVQLTVDLKPDLPREAE  237

Query  634   RIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSP  813
             RI++C GRV AL++EP + RVWLP ++ PGLAM+RAFGDF +K +G+IS PE S+  L+ 
Sbjct  238   RIKQCKGRVFALQDEPEVHRVWLPYDNAPGLAMARAFGDFCVKEYGVISMPEFSHRVLTE  297

Query  814   NDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDC  993
              D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK ++P S+ DDC
Sbjct  298   RDQFIVLASDGVWDVLSNEEVVDIVSSAPTRS--SAARILVDSAAREWKTKYPTSKMDDC  355

Query  994   TAICLFL  1014
               +CLFL
Sbjct  356   AVVCLFL  362



>ref|XP_010907919.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=486

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 210/328 (64%), Gaps = 29/328 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V++ VR+ LP
Sbjct  58    NGASSVASLFTQQGKKGTNQDAMIVWENFGSRADTVFCGVFDGHGPYGHMVARSVRDSLP  117

Query  292   -------------------SLFLKQAKFLPKIRAKLNTNK-----LDDGDTTENKS-FLK  396
                                S+         +  + +  +K      D G+  ++   F+ 
Sbjct  118   LKLSSHLEVNVGSDDHRECSIISHSGSMNSEETSSICLDKEPRVFTDIGEKDKHPDIFMT  177

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              KE+ + AFK+MDK++K   K+DC  SG+TAV  ++Q EDLV+ N+GDSRAVLG R  ++
Sbjct  178   LKESFLKAFKVMDKELKLHPKIDCFCSGTTAVTVVKQGEDLVIGNVGDSRAVLGTRDKND  237

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP++P EAERIRKC GRV AL++EP + RVWLPN ++PGLAM+RAFGDF
Sbjct  238   CLIAVQLTVDLKPNLPREAERIRKCRGRVFALQDEPEVARVWLPNSNSPGLAMARAFGDF  297

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS PEVSY  ++  D F+VLATDGVWDVLSN EV+  V  A       AA+ +
Sbjct  298   CLKDFGLISVPEVSYWRITERDEFIVLATDGVWDVLSNKEVVDIVACA--PARSSAARFL  355

Query  934   veaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             VE+AV AW+ ++P S+ DDC  +CLFL+
Sbjct  356   VESAVQAWRLKYPTSKIDDCAVVCLFLK  383



>ref|XP_008445704.1| PREDICTED: probable protein phosphatase 2C 33 [Cucumis melo]
Length=399

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 205/317 (65%), Gaps = 20/317 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYG-DESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KGINQDA I+++ +G  E   FCG+FDGHG  GH V+K VR+ LP
Sbjct  65    NGTTDHASLFTRQGKKGINQDAMIVWENFGTKEDTIFCGVFDGHGPFGHMVAKKVRDSLP  124

Query  292   SLFLKQAKFLPKIRAKLNTNK--------LDDGDTTEN-------KSFLKWKEACVSAFK  426
                  Q +     +   N  +        ++ G  T +         ++  KE+ + AFK
Sbjct  125   LKLNAQLELDATRKEGQNDARCQVSPPTLVNKGSGTSHCDPDHRGNIYVMLKESFLKAFK  184

Query  427   LMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTD  603
             +MDK++K    +DC TSG+T+V  ++Q  DL++ N+GDSRAVLG R   N + A+QLT D
Sbjct  185   VMDKELKLHPYIDCYTSGTTSVALVKQGRDLIIGNVGDSRAVLGTRDKSNSLVAVQLTVD  244

Query  604   LKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIIST  783
             LKP+ P EAERIR C GR+ AL+ EP I RVWLPN D+PGLAM+RAFGDF LK  G+I+ 
Sbjct  245   LKPNHPREAERIRLCKGRIFALQNEPEIFRVWLPNNDSPGLAMARAFGDFCLKDFGVIAV  304

Query  784   PEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKR  963
             P+VSY +L+  D F+VLATDGVWDVLSN+EV++ V S+       AA+ +V++A  AW+ 
Sbjct  305   PDVSYRHLTEKDEFVVLATDGVWDVLSNEEVVAVVASSPR---SSAARVLVDSATRAWRL  361

Query  964   RFPNSRRDDCTAICLFL  1014
             ++P ++ DDC  +CL+L
Sbjct  362   KYPTAKVDDCAVVCLYL  378



>dbj|BAJ88611.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/303 (48%), Positives = 192/303 (63%), Gaps = 19/303 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYG-DESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             +G    AS F+  G KGINQDA +++ G+G +E G  CG+FDGHG +GH V++ VR+ LP
Sbjct  48    DGRSRTASVFTQQGRKGINQDAMLIWDGFGGEEDGVLCGVFDGHGPHGHLVARRVRDSLP  107

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCC  471
                +  A+  PK              T  +     W++A   A+K MDK ++    LD  
Sbjct  108   LRLMSAARASPK--------------TGLDMPATAWRKAFTRAYKAMDKDLRSHPSLDSF  153

Query  472   TSGSTAVIAIRQDEDLVVANLGDSRAVLGRK--TDNGVKAIQLTTDLKPSVPCEAERIRK  645
              SGSTAV  ++   DL +AN+GDSRAVLG +     G+ A+QLT DLKP VP EAERI+K
Sbjct  154   CSGSTAVTVLKLGSDLYMANIGDSRAVLGSRDAAAGGMAAVQLTVDLKPDVPSEAERIKK  213

Query  646   CNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHF  825
             C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE  +  L+  D F
Sbjct  214   CRGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVISVPEFFHWPLTDKDQF  273

Query  826   LVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAIC  1005
             ++LA+DGVWDVLSN E +  V S+       AA+ +VEAA   WK ++P SR DDC  +C
Sbjct  274   VILASDGVWDVLSNQEAVDIVSSSPSR--SKAARTLVEAANREWKTKYPTSRTDDCAVVC  331

Query  1006  LFL  1014
             L+L
Sbjct  332   LYL  334



>ref|XP_003552448.1| PREDICTED: probable protein phosphatase 2C 33-like [Glycine max]
Length=487

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 211/327 (65%), Gaps = 29/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA ++++ +   +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  58    NGSSQVASLFTQQGKKGTNQDAMVVWENFCSRQDTIFCGVFDGHGPYGHMVAKRVRDSLP  117

Query  292   ---SLFLKQAKFLPKIRAKLNTNKLD--------------------DGDTTENKS--FLK  396
                ++  +Q+    ++  +++ N                       D + TE     F  
Sbjct  118   LKLNVHWEQSASGEEVLKEISVNTAGSMNSEEAAFASADDESRVSVDAEETEKHPEIFQT  177

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              K++ + AFK+MD+++K  + +DC  SG+TAV  ++Q  DL++ N+GDSRAVLG R+ DN
Sbjct  178   LKDSFLKAFKVMDRELKTHQSIDCFCSGTTAVTLVKQGHDLIIGNVGDSRAVLGTREKDN  237

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + AIQLT DLKP++P E ERIRKC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  238   SLVAIQLTVDLKPNLPAEEERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDF  297

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS PEVSY  L+  D F+VLATDG+WDVLSN EV+  V +A       AA+A+
Sbjct  298   CLKDFGLISVPEVSYRRLTEKDEFVVLATDGIWDVLSNKEVVDIVAAAPRR--ASAARAL  355

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             VE+AV +W+ ++P S+ DDC  +CLFL
Sbjct  356   VESAVRSWRYKYPTSKVDDCAVVCLFL  382



>ref|XP_007149875.1| hypothetical protein PHAVU_005G106100g [Phaseolus vulgaris]
 gb|ESW21869.1| hypothetical protein PHAVU_005G106100g [Phaseolus vulgaris]
Length=474

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 203/315 (64%), Gaps = 20/315 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR  LP 
Sbjct  61    NGKSRSSCIFTQQGRKGINQDAMIVWEDFISEDVTFCGVFDGHGPHGHLVARKVREALP-  119

Query  295   LFLKQAKFLPKIRAKLN---------TNKLDDGD-----TTENKSFLKWKEACVSAFKLM  432
               LK   FL    +  N         + K ++G+     T E+K    W+EA + A+K M
Sbjct  120   --LKLLSFLHSSESGQNGSGKTCFRGSMKPENGESEKDVTAEDKLSSMWREAFMKAYKAM  177

Query  433   DKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNGVK-AIQLTTDLK  609
             DK+++    LDC  SGSTAV  ++Q  +L + N+GDSRA++G K  N V  AIQLT DLK
Sbjct  178   DKELRSHPNLDCFCSGSTAVTVVKQGSNLFMGNIGDSRAIMGSKDSNDVMVAIQLTIDLK  237

Query  610   PSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPE  789
             P +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P+
Sbjct  238   PDLPREAERIKRCKGRVFALQDEPEVHRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPD  297

Query  790   VSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRF  969
              S+  L+  D F+VLA+DG+WDVLSN+EV+  V SA       AA+ +V++A   WK ++
Sbjct  298   FSHRLLTDKDQFIVLASDGIWDVLSNEEVVGIVSSAPTR--SSAARLLVDSAAREWKLKY  355

Query  970   PNSRRDDCTAICLFL  1014
             P S+ DDC  +CLFL
Sbjct  356   PTSKVDDCAVVCLFL  370



>ref|XP_011077163.1| PREDICTED: probable protein phosphatase 2C 33 [Sesamum indicum]
 ref|XP_011077165.1| PREDICTED: probable protein phosphatase 2C 33 [Sesamum indicum]
Length=494

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/329 (47%), Positives = 207/329 (63%), Gaps = 33/329 (10%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   IAS ++  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  55    NGCSEIASLYTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHLVAKRVRDSLP  114

Query  292   -------SLFLKQAKFLPKIRAKLNTN-------------------KLDDGDTTENKS-F  390
                     + +K  + L ++   LNT                     +D  +T +    F
Sbjct  115   LKLSAHWEVNIKSDEVLREV--SLNTTGGLYSEDTSLLSADDEARASVDAEETGKQPDVF  172

Query  391   LKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKT  567
                KE+ + AFK MD++++    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVL  R  
Sbjct  173   QTLKESFLKAFKAMDRELRMYANIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLATRDE  232

Query  568   DNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFG  747
             +N + A+QLT DLKP++P EAERIRKC GRV AL +EP + RVWLPN D+PGLAM+RAFG
Sbjct  233   NNLLTAVQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARVWLPNNDSPGLAMARAFG  292

Query  748   DFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaak  927
             DF LK  G+IS PE+SY  ++  D F+VLATDG+WDVLSN EV+  V S        AA+
Sbjct  293   DFCLKEFGLISVPEISYRCITDKDEFIVLATDGIWDVLSNKEVVEVVGSC--RARSNAAR  350

Query  928   avveaavdaWKRRFPNSRRDDCTAICLFL  1014
              +VE+AV AWK ++P S+ DDC  +CLFL
Sbjct  351   TLVESAVRAWKTKYPTSKVDDCAVVCLFL  379



>gb|EMT27153.1| Putative protein phosphatase 2C 64 [Aegilops tauschii]
Length=431

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/303 (48%), Positives = 192/303 (63%), Gaps = 19/303 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYG-DESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             +G    AS F+  G KGINQDA +++ G+G +E G  CG+FDGHG +GH V++ VR+ LP
Sbjct  48    DGRSRTASVFTQQGRKGINQDAMLIWDGFGGEEDGVLCGVFDGHGPHGHLVARRVRDSLP  107

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCC  471
                +  A+  PK              T  +     W++A   A+K MDK ++    LD  
Sbjct  108   LRLMSAARASPK--------------TGLDMPAAAWRKAFARAYKAMDKDLRSHPALDSF  153

Query  472   TSGSTAVIAIRQDEDLVVANLGDSRAVLGRK--TDNGVKAIQLTTDLKPSVPCEAERIRK  645
              SGSTAV  ++   DL +AN+GDSRAVLG +     G+ A+QLT DLKP VP EAERI+K
Sbjct  154   CSGSTAVTVLKLGSDLYMANIGDSRAVLGSRDAAAGGMAAVQLTVDLKPDVPSEAERIKK  213

Query  646   CNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHF  825
             C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE  +  L+  D F
Sbjct  214   CRGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVISVPEFFHWPLTDKDQF  273

Query  826   LVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAIC  1005
             ++LA+DGVWDVLSN E +  V S+       AA+ +VEAA   WK ++P SR DDC  +C
Sbjct  274   VILASDGVWDVLSNQEAVDIVSSSPSR--SKAARTLVEAANREWKTKYPTSRTDDCAVVC  331

Query  1006  LFL  1014
             L+L
Sbjct  332   LYL  334



>gb|KDO73930.1| hypothetical protein CISIN_1g011968mg [Citrus sinensis]
Length=466

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 209/348 (60%), Gaps = 22/348 (6%)
 Frame = +1

Query  34    GICISKASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDES  213
              I + K SS   DAD    ++      N     A  ++  G KGINQDA I+++ +    
Sbjct  34    AIFLKKKSSIDDDADQLLHHISGRMVNNAASKTACVYTQQGKKGINQDAMIVWENFSSSD  93

Query  214   GDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS--  387
               FCGIFDGHG  GH V+K VR+ LP +   Q K      +  N N     + T + S  
Sbjct  94    TVFCGIFDGHGPYGHMVAKKVRDSLPVILCSQWKASNDQTSFENANGSTHSEETASLSMD  153

Query  388   -----------------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDED  516
                              +L  K++ + +FKLMDK++K    +DC  SG+TAV  ++Q  D
Sbjct  154   EEGFETLDTEGDKLPEIYLPLKKSMLKSFKLMDKELKLHPAIDCFCSGTTAVTLVKQGPD  213

Query  517   LVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQR  693
             +V+ N+GDSRAVL  R+ DN + A+QLT DLKP +P EA RI++C GRV AL++EP + R
Sbjct  214   IVIGNVGDSRAVLATREKDNSLVAVQLTVDLKPDLPREAARIQQCKGRVFALQDEPEVAR  273

Query  694   VWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDE  873
             VWLPN D+PGLAM+RAFGDF LK  G+IS P++ Y  L+  D F++LATDGVWDV+SN E
Sbjct  274   VWLPNNDSPGLAMARAFGDFCLKDFGLISVPDIYYRRLTEKDEFIILATDGVWDVISNKE  333

Query  874   VMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              +  V SA       AA+A+V+ AV +WK ++P S+ DDC  +CLFL+
Sbjct  334   AVEIVASAPSQA--TAARALVDWAVRSWKLKYPTSKNDDCAVVCLFLE  379



>emb|CBI39869.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 206/334 (62%), Gaps = 41/334 (12%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA ++++ +   S   FCG+FDGHG  GH V+K VR+ LP
Sbjct  4     NGASTVASLFTQQGKKGTNQDAMLVWENFSSRSDTIFCGVFDGHGPYGHMVAKKVRDCLP  63

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDG-----------------------------DTTEN-  381
              +   Q       +A  N++K  DG                             D  E  
Sbjct  64    LILHTQ------WQANSNSDKKSDGKNGNAPEKTNLEETASLNMDDEYYESLEVDDNEKV  117

Query  382   -KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG  558
              + +L  KE+ + AFKLMDK++K    +DC  SG+TAV  ++Q  +LV+ N+GDSRAVL 
Sbjct  118   PEMYLPLKESFLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQGPNLVIGNIGDSRAVLA  177

Query  559   -RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMS  735
              R  +N + A+QLT DLKP++P EA RI +C GRV AL++EP + RVWLPN D+PGLAM+
Sbjct  178   TRDVENSLTAVQLTIDLKPNLPREAARIHQCKGRVFALQDEPEVARVWLPNSDSPGLAMA  237

Query  736   RAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGee  915
             RAFGDF LK  G+IS P++ Y +L+  D F++LATDGVWDVLSN E +  V SA   G  
Sbjct  238   RAFGDFCLKDFGLISVPDIYYRHLTERDEFIILATDGVWDVLSNKEAVDIVASA--PGHT  295

Query  916   maakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              AA+A+V+ AV AW+ ++P S+ DDC  +CLFL+
Sbjct  296   TAARALVDCAVRAWRLKYPTSKNDDCAVVCLFLE  329



>ref|XP_003527445.1| PREDICTED: probable protein phosphatase 2C 52-like isoform X1 
[Glycine max]
 ref|XP_006582329.1| PREDICTED: probable protein phosphatase 2C 52-like isoform X2 
[Glycine max]
 ref|XP_006582330.1| PREDICTED: probable protein phosphatase 2C 52-like isoform X3 
[Glycine max]
Length=471

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 202/312 (65%), Gaps = 14/312 (4%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLP-  291
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRGSCIFTQQGRKGINQDAMIVWEDFMSEDTIFCGVFDGHGPHGHLVARKVRDALPI  120

Query  292   ----SLFLKQAKFLPKIRAKLNTN-KLDDGDT-----TENKSFLKWKEACVSAFKLMDKQ  441
                 SL   ++K     +     N K D G++      E+K    W+EA + A+K MDK+
Sbjct  121   KLISSLHSNESKRNGSGKTCFKGNVKPDSGESEKDCSAEDKLNSTWREAFMKAYKAMDKE  180

Query  442   IKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSV  618
             ++    LDC  SGSTAV  ++Q  +L +  +GDSRA++G K  N  + AIQLT DLKP +
Sbjct  181   LRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAIQLTVDLKPDL  240

Query  619   PCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSY  798
             P EAERI+KC GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+
Sbjct  241   PREAERIKKCRGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSH  300

Query  799   HNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNS  978
               L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK ++P S
Sbjct  301   RQLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVDSAAREWKHKYPTS  358

Query  979   RRDDCTAICLFL  1014
             + DDC  +CLFL
Sbjct  359   KMDDCAVVCLFL  370



>ref|XP_006480437.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X1 
[Citrus sinensis]
 ref|XP_006480438.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X2 
[Citrus sinensis]
Length=491

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 218/346 (63%), Gaps = 37/346 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   IAS F+  G KG NQDA I+++ +   +   FCG+FDG
Sbjct  42    DYRREEPLHRIPGRLFLNGSSEIASLFTQQGKKGTNQDAMIVWENFASRADTIFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIRAKLNT----NKLD---------  360
             HG  GH V+K VR+ LP        + +   + L +I   +NT    N  D         
Sbjct  102   HGPYGHMVAKRVRDSLPLKLSSHWEVNITSEEVLREI--SINTAGSINSEDTSFVSADEE  159

Query  361   ---DGDTTENKSFLKW----KEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
                  D  E + F ++    KE+ + AFK+MD++++    +DC  SG+TAV  I+Q + L
Sbjct  160   PRASADLEETEKFPEFFQTLKESFLKAFKVMDRELRMHATIDCFCSGTTAVTLIKQGQHL  219

Query  520   VVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRV  696
             V+ N+GDSRAVLG R  D+ + A+QLT DLKP++P EAERIRKC GRV AL +EP + RV
Sbjct  220   VIGNVGDSRAVLGTRDKDDSLVAMQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARV  279

Query  697   WLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEV  876
             WLPN D+PGLAM+RAFGDF LK  G+IS P++SY  L+  D F+VLATDG+WDVLSN+EV
Sbjct  280   WLPNYDSPGLAMARAFGDFCLKDFGLISVPDISYRRLTDKDEFIVLATDGIWDVLSNEEV  339

Query  877   MSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +  V SA       AA+++VE+AV AW+R++P S+ DDC  +CLFL
Sbjct  340   VEIVASAPAR--SSAARSLVESAVRAWRRKYPTSKVDDCAVVCLFL  383



>gb|KHN31949.1| Hypothetical protein glysoja_025783 [Glycine soja]
Length=471

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 201/312 (64%), Gaps = 14/312 (4%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLP-  291
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRSSCIFTQQGRKGINQDAMIVWEDFMSEDTIFCGVFDGHGPHGHLVARKVRDALPI  120

Query  292   ----SLFLKQAKFLPKIRAKLNTN-KLDDGDT-----TENKSFLKWKEACVSAFKLMDKQ  441
                 SL   ++K     +     N K D GD+      E+K    W+EA + A+K MDK+
Sbjct  121   KLISSLHSNESKRNGSGKTCFKGNVKPDSGDSEKDCSAEDKLNSTWREAFMKAYKAMDKE  180

Query  442   IKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSV  618
             ++    LDC  SGSTAV  ++Q  +L +  +GDSRA++G K  N  + AIQLT DLKP +
Sbjct  181   LRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAIMGSKDSNDSIVAIQLTVDLKPDL  240

Query  619   PCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSY  798
             P EAERI+KC GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+
Sbjct  241   PREAERIKKCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSH  300

Query  799   HNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNS  978
               L+  D F++LA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK ++P S
Sbjct  301   RQLTDRDQFIILASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVDSAAREWKLKYPTS  358

Query  979   RRDDCTAICLFL  1014
             + DDC   CLFL
Sbjct  359   KMDDCAVACLFL  370



>gb|KDO54033.1| hypothetical protein CISIN_1g011218mg [Citrus sinensis]
 gb|KDO54034.1| hypothetical protein CISIN_1g011218mg [Citrus sinensis]
Length=491

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 218/346 (63%), Gaps = 37/346 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG   IAS F+  G KG NQDA I+++ +   +   FCG+FDG
Sbjct  42    DYRREEPLHRIPGRLFLNGSSEIASLFTQQGKKGTNQDAMIVWENFASRADTIFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIRAKLNT----NKLD---------  360
             HG  GH V+K VR+ LP        + +   + L +I   +NT    N  D         
Sbjct  102   HGPYGHMVAKRVRDSLPLKLSSHWEVNITSEEVLREI--SINTAGSINSEDTSFVSADEE  159

Query  361   ---DGDTTENKSFLKW----KEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
                  D  E + F ++    KE+ + AFK+MD++++    +DC  SG+TAV  I+Q + L
Sbjct  160   PRASADLEETEKFPEFFQTLKESFLKAFKVMDRELRMHATIDCFCSGTTAVTLIKQGQHL  219

Query  520   VVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRV  696
             V+ N+GDSRAVLG R  D+ + A+QLT DLKP++P EAERIRKC GRV AL +EP + RV
Sbjct  220   VIGNVGDSRAVLGTRDKDDSLVAMQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARV  279

Query  697   WLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEV  876
             WLPN D+PGLAM+RAFGDF LK  G+IS P++SY  L+  D F+VLATDG+WDVLSN+EV
Sbjct  280   WLPNYDSPGLAMARAFGDFCLKDFGLISVPDISYRRLTDKDEFIVLATDGIWDVLSNEEV  339

Query  877   MSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +  V SA       AA+++VE+AV AW+R++P S+ DDC  +CLFL
Sbjct  340   VEIVASAPAR--SSAARSLVESAVRAWRRKYPTSKVDDCAVVCLFL  383



>ref|XP_002319366.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE95289.1| phosphatase 2C family protein [Populus trichocarpa]
Length=473

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/316 (46%), Positives = 203/316 (64%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  60    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARKVRDALP-  118

Query  295   LFLKQAKFLPKIRAKLN----------TNKLDDGD-----TTENKSFLKWKEACVSAFKL  429
               +K   FL   +++ N          + K D GD     + E+K    W+E  + ++K 
Sbjct  119   --VKLQSFLNSCQSRQNEPGQTCFTGNSKKSDVGDLDKDGSVEDKLNSLWRETFLKSYKA  176

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK++K    LDC  SGSTA+  ++Q  +L +  +GDSRA++G K  N  + A+QLT DL
Sbjct  177   MDKELKSHPNLDCFCSGSTAITIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAVQLTVDL  236

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  237   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  296

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  297   EFSHRTLTDKDQFIVLASDGVWDVLSNEEVVGIVSSAPTRA--SAARILVDSAAREWKLK  354

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  355   YPTSKMDDCAVVCLFL  370



>ref|XP_006452792.1| hypothetical protein CICLE_v10007997mg [Citrus clementina]
 gb|ESR66032.1| hypothetical protein CICLE_v10007997mg [Citrus clementina]
Length=523

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 209/348 (60%), Gaps = 22/348 (6%)
 Frame = +1

Query  34    GICISKASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDES  213
              I + K SS   DAD    ++      N     A  ++  G KGINQDA I+++ +    
Sbjct  34    AIFLKKKSSIDDDADQLLHHISGRMVNNAASKTACVYTQQGKKGINQDAMIVWENFSSSD  93

Query  214   GDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS--  387
               FCGIFDGHG  GH V+K VR+ LP +   Q K      +  N N     + T + S  
Sbjct  94    TVFCGIFDGHGPYGHMVAKKVRDSLPVILCSQWKASNDQTSFENANGSTHSEETASLSMD  153

Query  388   -----------------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDED  516
                              +L  K++ + +FKLMDK++K    +DC  SG+TAV  ++Q  D
Sbjct  154   EEGFETLDTEGDKLPEIYLPLKKSMLKSFKLMDKELKLHPAIDCFCSGTTAVTLVKQGPD  213

Query  517   LVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQR  693
             +V+ N+GDSRAVL  R+ DN + A+QLT DLKP +P EA RI++C GRV AL++EP + R
Sbjct  214   IVIGNVGDSRAVLATREKDNSLVAVQLTVDLKPDLPREAARIQQCKGRVFALQDEPEVAR  273

Query  694   VWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDE  873
             VWLPN D+PGLAM+RAFGDF LK  G+IS P++ Y  L+  D F++LATDGVWDV+SN E
Sbjct  274   VWLPNNDSPGLAMARAFGDFCLKDFGLISVPDIYYRRLTEKDEFIILATDGVWDVISNKE  333

Query  874   VMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              +  V SA       AA+A+V+ AV +WK ++P S+ DDC  +CLFL+
Sbjct  334   AVEIVASAPSQA--TAARALVDWAVRSWKLKYPTSKNDDCAVVCLFLE  379



>ref|XP_007139720.1| hypothetical protein PHAVU_008G053700g [Phaseolus vulgaris]
 gb|ESW11714.1| hypothetical protein PHAVU_008G053700g [Phaseolus vulgaris]
Length=490

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 208/327 (64%), Gaps = 29/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA ++++ +   +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  57    NGSTQVASLFTQQGKKGTNQDAMVVWENFCSRQDTIFCGVFDGHGPFGHMVAKRVRDVLP  116

Query  292   -------SLFLKQAKFLPKI----------------RAKLNTNKLDDGDTTEN--KSFLK  396
                     L +   + L +I                 A  ++    D + TE   K F  
Sbjct  117   LNLNTHWELNVSGEEILKEIGINPAGSMNIEEAASASADEDSRVSVDAEETEKHPKIFQT  176

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              KE+ + AFK+MD+++K  + +DC  SG+TAV  I+Q  DL+V N+GDSRAVLG R+ D+
Sbjct  177   LKESFLKAFKVMDRELKTHQSIDCFCSGTTAVTLIKQGHDLIVGNVGDSRAVLGTREKDD  236

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP++P E ERIR C GRV AL +EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  237   SLVAVQLTVDLKPNLPAEEERIRSCKGRVFALHDEPEVARVWLPNNDSPGLAMARAFGDF  296

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS PEVSY  L+  D F+VLATDG+WDVLSN EV+  V +       +AA+A+
Sbjct  297   CLKDFGLISVPEVSYRRLTEKDEFIVLATDGIWDVLSNKEVVDIVAATSRRS--LAARAL  354

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  355   VESAVRAWRYKYPTSKVDDCAVVCLFL  381



>ref|XP_009410548.1| PREDICTED: probable protein phosphatase 2C 73 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/340 (46%), Positives = 212/340 (62%), Gaps = 19/340 (6%)
 Frame = +1

Query  28    EMGICISKASSEIHDADYG-QENVVHFGD------CNGVEVIASAFSHPGSKGINQDAAI  186
             E+G   +  + E  DA Y  +E+ V  GD        G  ++AS F+  G KG+NQDA  
Sbjct  9     EVGRMPTSGAMERVDAFYAAEEDSVRVGDGGGRVRLKGSCMVASMFTQQGWKGVNQDAMT  68

Query  187   LYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDD  363
             L++G+ GD+   FCG+FDGHG  GH V+  VR+ LPS      K           +    
Sbjct  69    LWEGFAGDQGTIFCGVFDGHGPYGHRVACHVRDALPSRLQSGMKAFEGGAGDTGGDG---  125

Query  364   GDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDS  543
                  +  F  W    VSAF+ +DK++     +DC  SG+TAV  +++ + L++ANLGDS
Sbjct  126   -----DGWFASWNATIVSAFEELDKELSNHPWIDCICSGATAVTILKERDHLIIANLGDS  180

Query  544   RAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTP  720
             RAVL  R  D+ +  +QLT D KP++P EAERIR C GRV +L+EEP + R+WLP+ED+P
Sbjct  181   RAVLCTRDDDDQLVPVQLTVDQKPNLPSEAERIRSCRGRVFSLEEEPDVHRLWLPDEDSP  240

Query  721   GLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAY  900
             GLAM+RAFGD  LK  G+I+TP++S+  LS  D F+VLATDGVWDVLSN+EV+  V SA 
Sbjct  241   GLAMARAFGDLCLKDFGLIATPQISHRKLSDKDEFVVLATDGVWDVLSNEEVIKIVSSAN  300

Query  901   EYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             +     AAK VV+ AV AW+ + P S+ DDCT +C FLQ+
Sbjct  301   KRS--AAAKQVVDRAVRAWRTKHPTSKVDDCTVVCFFLQQ  338



>ref|XP_010069369.1| PREDICTED: probable protein phosphatase 2C 33 [Eucalyptus grandis]
 gb|KCW57692.1| hypothetical protein EUGRSUZ_H00454 [Eucalyptus grandis]
Length=406

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 205/326 (63%), Gaps = 29/326 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KGINQDA I+++ +G ++    CG+FDGHG  GH V+K VR+ LP
Sbjct  59    NGSSDAASLFTRQGKKGINQDAMIVWENFGSKTDTILCGVFDGHGPFGHMVAKKVRDSLP  118

Query  292   SLF-----LK------QAKFLPKIRAKLNTNKLDDGDTTENKSF-------------LKW  399
                     LK       + F       +N+ +       + K+F             L  
Sbjct  119   LKLNALWELKVGSPDGHSDFSSSAMGSMNSEETSIKTIEDLKTFPKLEFGENHSDTILTL  178

Query  400   KEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNG  576
             KE+ V AFK+MDK++K   ++DC  SG+TAV  ++Q  DL++ N+GDSRAVLG R  +N 
Sbjct  179   KESFVKAFKVMDKELKLHPQIDCYCSGTTAVTLVKQGHDLLIGNVGDSRAVLGTRDKNNS  238

Query  577   VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFM  756
             + A+QLT DLKP +P E ERIR C GRV ALK EP + RVWLPN D+PGLAM+RAFGDF 
Sbjct  239   LIAVQLTVDLKPDLPRELERIRLCRGRVFALKNEPEVARVWLPNCDSPGLAMARAFGDFC  298

Query  757   LKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavv  936
             LK  G+IS PE+SY  L+  D F+VLATDG+WDVLSN+EV+  V SA       AA+ +V
Sbjct  299   LKDFGLISIPEISYRRLTDRDEFVVLATDGIWDVLSNNEVVDIVASAPR---SSAARTLV  355

Query  937   eaavdaWKRRFPNSRRDDCTAICLFL  1014
             E+A+ AW+ ++P ++ DDC  +CLFL
Sbjct  356   ESAIRAWRFKYPYAKVDDCAVVCLFL  381



>ref|XP_008230255.1| PREDICTED: probable protein phosphatase 2C 52 [Prunus mume]
 ref|XP_008230257.1| PREDICTED: probable protein phosphatase 2C 52 [Prunus mume]
Length=471

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 206/316 (65%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA ++++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRASCIFTQQGRKGINQDAMVVWEDFMSEDAIFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRAKLNTN----------KLDDGDT-----TENKSFLKWKEACVSAFKL  429
               +K   FL   +++LN +          + D GD+      E K  + W+EA + ++K 
Sbjct  120   --VKLLSFLHSYQSRLNGSSKTCFKGNLKRSDGGDSEKDASAEEKLNVTWREAFLKSYKA  177

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK-TDNGVKAIQLTTDL  606
             MDK+++    LDC  SGSTAV  ++Q  +L +  +GDSRA+LG K + + + AIQLT DL
Sbjct  178   MDKELRSHPNLDCFCSGSTAVTLVKQGSNLFMGYIGDSRAILGSKDSSDSMVAIQLTVDL  237

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  238   KPDLPREAERIKRCKGRVFALQDEPEVSRVWLPFDDAPGLAMARAFGDFCLKDYGVISIP  297

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V S+       AA+ VV++A   WK +
Sbjct  298   EFSHRILTERDQFIVLASDGVWDVLSNEEVVEIVSSSPSR--ASAARIVVDSAAREWKLK  355

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  356   YPTSKMDDCAVVCLFL  371



>gb|KHG26837.1| putative phosphatase 2C 33 -like protein [Gossypium arboreum]
Length=487

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 158/348 (45%), Positives = 212/348 (61%), Gaps = 31/348 (9%)
 Frame = +1

Query  58    SEIHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FC  225
             S I   DY +E  +H       NG   +AS F+  G KG NQDA I+++ +G  +   FC
Sbjct  36    SRISSFDYWKEEPLHRTGQLFLNGSNDVASLFTQQGKKGTNQDAMIIWENFGSRTDTVFC  95

Query  226   GIFDGHGKNGHYVSKLVRNHLP------------------SLFLKQAKFLPKIRAKLNTN  351
             G+FDGHG  GH V+K VR+HLP                   + L  A  +    + L  +
Sbjct  96    GVFDGHGPYGHMVAKRVRDHLPLKLNAHWEVSKSGEDALREINLNTAGSMNSETSFLTAD  155

Query  352   KLD----DGDTTEN--KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDE  513
             +      D + TE   + F   KE+ + AFK+MD+ ++    +DC  SG+TAV  ++Q  
Sbjct  156   EESRASVDLEETEKFPEIFQTLKESFLKAFKVMDRDLRTHASIDCFCSGTTAVTLVKQGP  215

Query  514   DLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQ  690
              +V+ N+GDSRAVLG R  DN + A+QLT DLKP++P EAERIRK  GRV ALK+EP + 
Sbjct  216   HIVIGNVGDSRAVLGTRDKDNSLIAVQLTVDLKPNLPAEAERIRKYKGRVFALKDEPEVA  275

Query  691   RVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSND  870
             RVWLPN + PGLAM+RAFGDF LK  G+IS PE+SY ++S  D F+VLATDG+WDVLSN 
Sbjct  276   RVWLPNSNAPGLAMARAFGDFCLKDFGLISVPEISYWHVSEKDEFIVLATDGIWDVLSNK  335

Query  871   EVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             EV+  V S        AA+A+VE AV AW+ ++P S+ DDC  +CLF 
Sbjct  336   EVVDIVASC--RARTSAARALVETAVRAWRYKYPTSKVDDCAVVCLFF  381



>ref|XP_007215329.1| hypothetical protein PRUPE_ppa005246mg [Prunus persica]
 gb|EMJ16528.1| hypothetical protein PRUPE_ppa005246mg [Prunus persica]
Length=471

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 206/316 (65%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA ++++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRASCIFTQQGRKGINQDAMVVWEDFMSEDAIFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRAKLNTN----------KLDDGDT-----TENKSFLKWKEACVSAFKL  429
               +K   FL   +++LN +          + D GD+      E K  + W+EA + ++K 
Sbjct  120   --VKLLSFLHSYQSRLNGSSKTCFKGNLKRSDGGDSEKDASAEEKLNVTWREAFLKSYKA  177

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK-TDNGVKAIQLTTDL  606
             MDK+++    LDC  SGSTAV  ++Q  +L +  +GDSRA+LG K + + + AIQLT DL
Sbjct  178   MDKELRSHPNLDCFCSGSTAVTLVKQGSNLFMGYIGDSRAILGSKDSSDSMVAIQLTVDL  237

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  238   KPDLPREAERIKRCKGRVFALQDEPEVSRVWLPFDDAPGLAMARAFGDFCLKDYGVISIP  297

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V S+       AA+ VV++A   WK +
Sbjct  298   EFSHRILTERDQFIVLASDGVWDVLSNEEVVEIVSSSPSR--ASAARIVVDSAAREWKLK  355

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  356   YPTSKMDDCAVVCLFL  371



>ref|XP_004305101.1| PREDICTED: probable protein phosphatase 2C 73-like [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 199/307 (65%), Gaps = 15/307 (5%)
 Frame = +1

Query  136   SAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAK  315
             S ++  G KGINQDA  +++ + ++   +CG+FDGHG +GH +++ VR++LPS   +  K
Sbjct  56    SMYTQQGKKGINQDAMTVWEDFAEKDMYYCGVFDGHGPDGHKIARYVRDNLPSKLSQVVK  115

Query  316   F------------LPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEK  459
                          LP       +N       +++ S   W+ + V +FK MD+++     
Sbjct  116   IYQLNTGIFDNASLPSSFFNQESNTTPISKGSQDISLSSWEASFVKSFKDMDEELSLDST  175

Query  460   LDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAER  636
             +D   SGSTAV  ++Q + LV+ANLGDSRAVLG R  +N +  +QLT DLKP  P EAER
Sbjct  176   IDSFCSGSTAVNVVKQGDHLVIANLGDSRAVLGTRGENNQIVPVQLTVDLKPDTPSEAER  235

Query  637   IRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPN  816
             I+KCNGR+ A+ EEP + R+W+P+ED PGLAM+RAFGDF LK +G+IS PEV Y  ++ +
Sbjct  236   IKKCNGRIFAVDEEPEVYRIWMPDEDCPGLAMARAFGDFCLKDYGLISIPEVCYKTITSD  295

Query  817   DHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCT  996
             D F+VLATDGVWD LSN  V+  V SA +     AAK +V+ AV AWKR++P S+ DDC 
Sbjct  296   DEFVVLATDGVWDALSNANVVKIVASAKK--RSNAAKLLVKRAVRAWKRKYPESKIDDCA  353

Query  997   AICLFLQ  1017
              ICLFL+
Sbjct  354   VICLFLK  360



>ref|XP_007043535.1| Phosphatase 2C 52 isoform 1 [Theobroma cacao]
 ref|XP_007043536.1| Phosphatase 2C 52 isoform 1 [Theobroma cacao]
 gb|EOX99366.1| Phosphatase 2C 52 isoform 1 [Theobroma cacao]
 gb|EOX99367.1| Phosphatase 2C 52 isoform 1 [Theobroma cacao]
Length=473

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 203/313 (65%), Gaps = 15/313 (5%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLP-  291
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARKVRDALPL  120

Query  292   ----SLFLKQAKFLPKIRA--KLNTNKLDDGDT-----TENKSFLKWKEACVSAFKLMDK  438
                 S+   Q++     R   + N+ K D GD+      E++    WKEA + ++K MDK
Sbjct  121   KLLSSMHSYQSRQNGSGRTCFRGNSKKSDGGDSEKDGSAEDRLNSIWKEAFMKSYKAMDK  180

Query  439   QIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPS  615
             +++    LDC  SGSTAV  ++Q  +L +  +GDSRA++G K  N  + AIQLT DLKP 
Sbjct  181   ELRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAIQLTVDLKPD  240

Query  616   VPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVS  795
             +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE S
Sbjct  241   LPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFS  300

Query  796   YHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPN  975
             +  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA  +V++A   WK ++P 
Sbjct  301   HRILTERDQFIVLASDGVWDVLSNEEVVEIVSSAPT--RSSAAGILVDSAAREWKLKYPT  358

Query  976   SRRDDCTAICLFL  1014
             S+ DDC  +CLFL
Sbjct  359   SKMDDCAVVCLFL  371



>ref|XP_008806175.1| PREDICTED: probable protein phosphatase 2C 66 [Phoenix dactylifera]
Length=539

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/325 (45%), Positives = 211/325 (65%), Gaps = 26/325 (8%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +A  ++  G KG NQDA ++++ +   S   FCG+FDGHG  GH V++ VR+ LP
Sbjct  90    NGTSEVACLYTQQGKKGTNQDAMVVWENFSSRSDTIFCGVFDGHGPFGHMVARKVRDSLP  149

Query  292   SLFLKQAKF------LP----KIRAKLNTNKLD------------DGDTTENKSFLKWKE  405
                  + +        P     +   +N+ +              D D    ++++  K+
Sbjct  150   LKLCTEWRANVSGHDSPHQNGSLSGSMNSEETTSISIDDDWGESIDEDEKLPENYIPLKQ  209

Query  406   ACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVK  582
             + + AFKLMDK++K    +DC  SG+TAV  ++Q +DL++ N+GDSRA++G R  DN + 
Sbjct  210   SFLKAFKLMDKELKLHPVIDCFCSGTTAVTLVKQGQDLIIGNVGDSRAIMGTRDKDNNLV  269

Query  583   AIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLK  762
             A+QLT DLKP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK
Sbjct  270   AVQLTVDLKPNLPREAARIQQCRGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDFCLK  329

Query  763   YHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavvea  942
              +G+IS P++SYH+L+  D F+VLATDGVWDVLSN EV+  V SA  +    AA+A+V+ 
Sbjct  330   DYGLISVPDISYHHLTEKDEFIVLATDGVWDVLSNKEVVDIVASAPTHA--TAARALVDC  387

Query  943   avdaWKRRFPNSRRDDCTAICLFLQ  1017
             AV AW+ +FP S+ DDC  +CLFL+
Sbjct  388   AVRAWRLKFPTSKIDDCAVVCLFLE  412



>gb|EYU26137.1| hypothetical protein MIMGU_mgv1a005757mg [Erythranthe guttata]
Length=471

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 203/312 (65%), Gaps = 17/312 (5%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  +   FCGIFDGHG +GH V++ VR+ LP 
Sbjct  61    NGRSTSSCIFTQQGRKGINQDAMIVWEDFMTDDVTFCGIFDGHGPHGHLVARKVRDTLP-  119

Query  295   LFLKQAKFLPKIRAKLNTNKLD--DGDTTEN--KSFLK-------WKEACVSAFKLMDKQ  441
               LK + F+    +K N +  +  +GD   +     +K       W+EA + ++K MDK+
Sbjct  120   --LKLSSFMNSAESKKNRSNANCCNGDMKSDVVDPVVKDTSVDSLWREAFLKSYKSMDKE  177

Query  442   IKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSV  618
             ++    LDC  SGSTAV  ++Q  +L +  +GDSRA+LG K  N  + AIQLT DLKP +
Sbjct  178   LRSHPNLDCFCSGSTAVTLVKQGSNLFMGYIGDSRAILGSKDSNDSMVAIQLTVDLKPDL  237

Query  619   PCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSY  798
             P EAERI++C GRV AL++EP +QRVWLP +D PGLAM+RAFGDF LK +G+IS PE S+
Sbjct  238   PREAERIKRCKGRVFALQDEPEVQRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSH  297

Query  799   HNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNS  978
               L+  D F+VLA+DGVWDVLSN+EV+  V S        AA+ VVE+A   WK ++P S
Sbjct  298   RILTDRDKFVVLASDGVWDVLSNEEVVEIVSSVATRA--SAARTVVESAAREWKSKYPTS  355

Query  979   RRDDCTAICLFL  1014
             + DDC  +CLFL
Sbjct  356   KMDDCAVVCLFL  367



>emb|CDP04194.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 218/347 (63%), Gaps = 37/347 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E ++H        NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDG
Sbjct  41    DYKREEMLHRIPGRLFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDG  100

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIRAKLNTNKLDDGDTTEN------  381
             HG  GH V+K VR+ LP        + +K    L +I ++  T  ++  DT+ +      
Sbjct  101   HGPYGHMVAKRVRDCLPLKLSAHWEVNIKNDDVLREI-SQNRTVSMNSEDTSYSSVSVDE  159

Query  382   ---------------KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDED  516
                            + F   KE+ + AFK+MD+++K    +DC  SG+TAV  ++Q +D
Sbjct  160   EARVSIGVEDAEKHPEVFQTLKESFMKAFKVMDRELKMHTNIDCFCSGTTAVTLVKQGDD  219

Query  517   LVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQR  693
             LV+ N+GDSRA+L  R  ++ + A+QLT DLKPS+P EAERIRKC GRV AL++EP + R
Sbjct  220   LVIGNVGDSRAILASRDGNDSLIAVQLTVDLKPSLPAEAERIRKCKGRVFALQDEPDVAR  279

Query  694   VWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDE  873
             VWLPN D+PGLAM+RAFGDF LK  G+IS PE+SY  L+  D F+V+A+DG+WDVLSN E
Sbjct  280   VWLPNNDSPGLAMARAFGDFCLKDFGLISVPEISYRRLTEKDEFIVVASDGIWDVLSNKE  339

Query  874   VMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             V+  V S+       AA+ +VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  340   VVDIVASSPAR--SSAARRLVESAVRAWRSKYPTSKVDDCAVVCLFL  384



>gb|EYU39458.1| hypothetical protein MIMGU_mgv1a005481mg [Erythranthe guttata]
Length=482

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/342 (45%), Positives = 212/342 (62%), Gaps = 33/342 (10%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY  E  +H        NG    AS F+  G KG NQDA I+++ +G  +   FCG+FDG
Sbjct  40    DYRSEEQLHRTPGRMFLNGSSDTASLFTQQGRKGTNQDAMIVWENFGSRTDTVFCGVFDG  99

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIRAKLNTNKLDD------GDTTEN  381
             HG  GH V+K VR+ LP        + +K  + L  +    ++++  +       DT   
Sbjct  100   HGPYGHMVAKRVRDCLPLKLSSHWEVNIKNDEILRDVSLNTSSSRCSEDASFFSADTEVA  159

Query  382   KS--------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLG  537
             ++        F   KE+ + A+K+MD+++K    +DC  SG+TAV  ++Q +DL++ N+G
Sbjct  160   RASIDEQPEVFHTLKESFLKAYKVMDRELKMYANIDCFCSGTTAVTMVKQGQDLIIGNVG  219

Query  538   DSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNED  714
             DSRAVL  R  +N + A+QLT DLKP++P EAERIRKC GRV AL +EP + RVWLPN D
Sbjct  220   DSRAVLATRDENNLLTAVQLTVDLKPNLPGEAERIRKCKGRVFALHDEPEVARVWLPNND  279

Query  715   TPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTV--  888
             +PGLAM+RAFGDF LK  G+IS PEVSY  ++  D F+VLATDG+WDVLSN EV+  V  
Sbjct  280   SPGLAMARAFGDFCLKDFGLISVPEVSYRRITDKDEFIVLATDGIWDVLSNKEVVDIVES  339

Query  889   CSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             CS        AAK++VE AV  W+ ++P S+ DDC  +CLFL
Sbjct  340   CSTRS----SAAKSLVECAVRGWRSKYPTSKVDDCAVVCLFL  377



>ref|XP_003624186.1| Protein phosphatase 2c [Medicago truncatula]
 gb|ABR24134.1| protein phosphatase 2c [Medicago truncatula]
 gb|AES80404.1| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=502

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 208/329 (63%), Gaps = 29/329 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KG NQDA ++++ +   E   FCG+FDGHG  GH V+K VR+ LP
Sbjct  60    NGSSQFASLFTQQGKKGTNQDAMLVWENFCSREDTIFCGVFDGHGPYGHMVAKRVRDSLP  119

Query  292   -------SLFLKQAKFLPKI--RAKLNTNKLDDG------------DTTENKS----FLK  396
                     L +     L +I   A  + N  D              DT E +     F  
Sbjct  120   LKLNTQWELNVSGDDVLKEISVNAAASMNSEDATFASADEESRVSIDTEEMEKLPEIFHT  179

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              KE+ + AFK+MD+++K  + +DC  SG+TAV  ++Q  DL++ N+GDSRAVLG R+ DN
Sbjct  180   LKESFLKAFKVMDRELKMHQTIDCFCSGTTAVTLVKQGRDLIIGNIGDSRAVLGTREKDN  239

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP++P EAERIRKC GRV AL +EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  240   SLVAVQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVCRVWLPNSDSPGLAMARAFGDF  299

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS PEVSY  L+  D F+V+ATDG+WDVLSN EV+  + +A       AA+++
Sbjct  300   CLKDFGLISVPEVSYRRLTEKDEFVVMATDGIWDVLSNKEVVDIIAAAPRR--ATAARSL  357

Query  934   veaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             VE AV AW+ ++P S+ DDC  +CLFL K
Sbjct  358   VETAVRAWRYKYPTSKVDDCAVVCLFLDK  386



>ref|XP_006481121.1| PREDICTED: probable protein phosphatase 2C 65-like [Citrus sinensis]
Length=377

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/294 (50%), Positives = 197/294 (67%), Gaps = 10/294 (3%)
 Frame = +1

Query  142   FSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKF  318
             F+  G KGINQDA  +++ + GD+   FCG+FDGHG  GH +++ VR++LPS      K 
Sbjct  2     FTQQGRKGINQDAMTVWENFTGDKDTVFCGVFDGHGPAGHKIARHVRDNLPSKLSTAIKL  61

Query  319   LPKIRAKLNTNKLDDGDTTENKSFLKWKEAC-VSAFKLMDKQIKQVEKLDCCTSGSTAVI  495
             L     K N     +G  +    F +  EA  V A++ +D ++     +D  +SG+TAV 
Sbjct  62    L-----KRNHEDYSNGSKSSQNPFFRALEASLVKAYEELDDELGLASAVDSYSSGATAVN  116

Query  496   AIRQDEDLVVANLGDSRAVLGRKTD-NGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALK  672
              I++ E L++ANLGDSRAVL  + D N +  +QLTTDLKP +  EAERIR C GRV A+ 
Sbjct  117   IIKKGEHLIIANLGDSRAVLCTRDDRNQLVPVQLTTDLKPEIAGEAERIRNCKGRVFAMD  176

Query  673   EEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVW  852
             EEP + RVW+P+ED PGLAM+RAFGDF LK +G+IS PE+SY  L+  D F+VLATDGVW
Sbjct  177   EEPDVYRVWMPDEDCPGLAMARAFGDFCLKGYGLISIPEISYRKLTREDQFVVLATDGVW  236

Query  853   DVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             DVL+N EV+ TV  A +  +EMAAK +V  AV AW+ ++P S+ DDC AICLFL
Sbjct  237   DVLTNSEVIRTVACASK--KEMAAKMLVSRAVRAWRTKYPGSKIDDCAAICLFL  288



>ref|XP_010095801.1| putative protein phosphatase 2C 52 [Morus notabilis]
 gb|EXB62269.1| putative protein phosphatase 2C 52 [Morus notabilis]
Length=472

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 206/316 (65%), Gaps = 22/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ V++ LP 
Sbjct  61    NGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDAIFCGVFDGHGPHGHLVARRVKDTLP-  119

Query  295   LFLKQAKFLPKIRAKLN----------TNKLDDGDT-----TENKSFLKWKEACVSAFKL  429
               +K   FL   +++ N           NKLD GD+      E+K    W+EA + ++K 
Sbjct  120   --IKLMSFLHSQQSRENGSSKTCFRGNVNKLD-GDSEKDGSAEDKLNSSWREAFLKSYKA  176

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK-TDNGVKAIQLTTDL  606
             MDK+++    LDC  SGSTAV  ++Q  +L +  +GDSRA++G K + + + A+QLT DL
Sbjct  177   MDKELRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAIMGSKDSSDSMVAVQLTVDL  236

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  237   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  296

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V  A       AA+ +V++A   WK +
Sbjct  297   EFSHRILTEKDQFIVLASDGVWDVLSNEEVVEIVSLAPT--RFSAARILVDSAAREWKLK  354

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDCT +CLFL
Sbjct  355   YPTSKMDDCTVVCLFL  370



>ref|XP_009406352.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 210/326 (64%), Gaps = 28/326 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KGINQDA ++++ +GD S   FCG+FDGHG NGH V++ VR+ LP
Sbjct  8     NGATSAASLFTQRGRKGINQDAMLVWENFGDRSDTVFCGVFDGHGPNGHKVARKVRDILP  67

Query  292   -SLFLKQAKFLPKIRAKLN----TNKLDDGDTT------ENKSFLKWKE-----------  405
               L      ++     + N    T  ++  +T+      E+K+ + ++E           
Sbjct  68    LKLRASWEVYIGNDECRENNISSTRSMNSEETSSMNLNEESKASVGFEERVKHSETLTIL  127

Query  406   --ACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNG  576
               + + AF+++DK+++    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVLG R   N 
Sbjct  128   KDSFLKAFRIVDKELRLHPDIDCFYSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDQHNT  187

Query  577   VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFM  756
             + A+QLT DLKP++P EAERIR+C GRV AL+ EP + RVWLPN D+PGLAM+RA GDF 
Sbjct  188   LVAVQLTVDLKPNLPREAERIRRCRGRVFALRGEPEVARVWLPNIDSPGLAMARALGDFC  247

Query  757   LKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavv  936
             LK  G+IS PE+SY  ++  D F+VLATDGVWDVLSN EV+  V +        AA+ +V
Sbjct  248   LKNFGLISVPEISYRRITEKDEFIVLATDGVWDVLSNREVVKIVSTV--SARSSAARILV  305

Query  937   eaavdaWKRRFPNSRRDDCTAICLFL  1014
             E+AV AWK ++P S+ DDC  +CLFL
Sbjct  306   ESAVRAWKLKYPTSKIDDCAVVCLFL  331



>ref|XP_004952485.1| PREDICTED: probable protein phosphatase 2C 14-like [Setaria italica]
Length=524

 Score =   273 bits (697),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 203/323 (63%), Gaps = 25/323 (8%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS ++  G KG+NQDA I ++ Y   E   FCG+FDGHG  GH V+K VR+ LP
Sbjct  131   NGACAVASLYTLQGKKGVNQDAMIFWENYCSREDTIFCGVFDGHGPYGHLVAKRVRDLLP  190

Query  292   -----SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS----------------FLKWKEA  408
                   L ++  +       K N N++   +    +                 F   + +
Sbjct  191   VKLGADLAMEDGRETSTSNIKSNANEVGSPEHVNRRVTVMSSEAEQNGEYPEIFPALRAS  250

Query  409   CVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKA  585
              + AF +MD+ +K  + +DC  SG+TAV  I+Q  +L++ NLGDSRAVLG R  +N + A
Sbjct  251   FLKAFHVMDRDLKLHKNIDCFFSGTTAVAVIKQGRNLIIGNLGDSRAVLGTRDENNQLVA  310

Query  586   IQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKY  765
             IQLT DLKP++P EA+RI++  GR+ AL EEP + RVWLP  ++PGLAM+RAFGDF LK 
Sbjct  311   IQLTVDLKPNIPSEAQRIKQRRGRIFALPEEPEVARVWLPKYNSPGLAMARAFGDFCLKD  370

Query  766   HGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaa  945
             HG+IS P+VSYH+++  D F+VLATDGVWDVLSNDEV+S V  A       AA+ +VE+A
Sbjct  371   HGVISMPDVSYHHITEKDEFVVLATDGVWDVLSNDEVVSIVSRATSRA--SAARFLVESA  428

Query  946   vdaWKRRFPNSRRDDCTAICLFL  1014
               AW+ RFP S+ DDC  +CLFL
Sbjct  429   HRAWRTRFPTSKIDDCAVVCLFL  451



>gb|KCW84581.1| hypothetical protein EUGRSUZ_B01420 [Eucalyptus grandis]
Length=427

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 212/326 (65%), Gaps = 30/326 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  4     NGSSEVASLFTLQGKKGTNQDAMIVWENFGSRTDTIFCGVFDGHGPFGHLVAKRVRDSLP  63

Query  292   -------SLFLKQAKFLPKIRAKLNT-NKLDDGDTT------ENKSFLK----------W  399
                     + L     L +I   +NT   +  G+T       E ++F +           
Sbjct  64    LKVSAHWKVNLNSEDLLREI--SINTMGGMSPGETAFVSAGEEPRAFAELEEIEKQVQML  121

Query  400   KEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNG  576
             KE+ + AFK+MD++++  +K+DC  SG+TAV  I+Q   +V+ N+GDSRAVLG R  D  
Sbjct  122   KESFLKAFKVMDRELRMQKKIDCFCSGTTAVALIKQGHRVVIGNVGDSRAVLGTRDKDGS  181

Query  577   VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFM  756
             + A+QLT DLKP++P EAERIR+C GRV ALK+EP + RVWLPN ++PGLAM+RAFGDF 
Sbjct  182   LIAVQLTVDLKPNIPAEAERIRRCRGRVFALKDEPEVARVWLPNNNSPGLAMARAFGDFC  241

Query  757   LKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavv  936
             LK  G+IS P++S  +LS  D F+VLATDG+WDVLSN EV+  V SA       A++A+V
Sbjct  242   LKNFGLISVPDLSCLSLSEKDEFIVLATDGIWDVLSNKEVVEIVASASAR--SSASRALV  299

Query  937   eaavdaWKRRFPNSRRDDCTAICLFL  1014
             E AV AW+ ++P S+ DDC A+CLFL
Sbjct  300   ERAVRAWRHKYPTSKVDDCAAVCLFL  325



>gb|KDP24167.1| hypothetical protein JCGZ_25824 [Jatropha curcas]
Length=471

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 205/316 (65%), Gaps = 21/316 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRTSCIFTQQGRKGINQDAMIVWEDFLSEDVIFCGVFDGHGPHGHLVARKVRDALP-  119

Query  295   LFLKQAKFLPKIRA----------KLNTNKLDDGDT-----TENKSFLKWKEACVSAFKL  429
               +K   FL   +A          K N+ K D GD+      E+K    W+EA + ++K+
Sbjct  120   --VKLLSFLHSNQARQNGSGQTCFKGNSKKSDVGDSEKDGSAEDKLNSVWREAFLKSYKV  177

Query  430   MDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDL  606
             MDK+++    LDC  SGSTA+  ++Q  +L +  +GDSRA++G K  N  + A+QLT DL
Sbjct  178   MDKELRSHPNLDCFCSGSTAITIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAVQLTVDL  237

Query  607   KPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTP  786
             KP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS P
Sbjct  238   KPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIP  297

Query  787   EVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRR  966
             E S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK +
Sbjct  298   EFSHRLLTDKDQFIVLASDGVWDVLSNEEVVEIVSSAPT--RSSAARILVDSAAREWKLK  355

Query  967   FPNSRRDDCTAICLFL  1014
             +P S+ DDC  +CLFL
Sbjct  356   YPTSKMDDCAVVCLFL  371



>emb|CDY53741.1| BnaAnng12690D [Brassica napus]
Length=467

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 207/320 (65%), Gaps = 22/320 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +A  F+  G KG NQDA ++++ +G  +   FCG+FDGHG  GH V+K VR++LP
Sbjct  61    NGSSEVACIFTQQGKKGPNQDAMVVWESFGSRTDTVFCGVFDGHGPFGHMVAKRVRDNLP  120

Query  292   SLFLKQAKFLPKIRAKL------------------NTNKLDDGDTTENKSFLKWKEACVS  417
                    +    + A L                  +T +    + TE++ F   KEA + 
Sbjct  121   LKLSAYWEAKVPVEASLKTANNSANNNSEDAASFVSTEEEPRPENTESELFQTLKEAFLK  180

Query  418   AFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQL  594
             AF +MD+++K    +DC  SG+TAV  I+Q E LVV N+GDSRAV+G R   NG+ A+QL
Sbjct  181   AFNVMDRELKFHGSVDCFCSGTTAVTLIKQGEYLVVGNVGDSRAVMGTRDGKNGLVAVQL  240

Query  595   TTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGI  774
             T DLKP++P E ERI+KC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK  G+
Sbjct  241   TVDLKPNLPAEEERIKKCRGRVFALRDEPDVCRVWLPNCDSPGLAMARAFGDFCLKDFGL  300

Query  775   ISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavda  954
             IS PEVS+  L+  D F+VLATDGVWDVLSN+EV+  V SA       AA+A+VE AV A
Sbjct  301   ISVPEVSFRRLTEQDEFIVLATDGVWDVLSNEEVVKIVASAPSR--SSAARALVETAVRA  358

Query  955   WKRRFPNSRRDDCTAICLFL  1014
             W+ ++P S+ DDC A+CL+L
Sbjct  359   WRHKYPTSKVDDCAAVCLYL  378



>ref|XP_004237585.1| PREDICTED: probable protein phosphatase 2C 33 [Solanum lycopersicum]
Length=645

 Score =   276 bits (705),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 208/327 (64%), Gaps = 29/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KG NQDA ++++ +   +   FCG+FDGHG +GH V+K VR+ LP
Sbjct  223   NGSSEAASLFTQQGKKGTNQDAMVVWENFASRTDTVFCGVFDGHGPHGHMVAKRVRDSLP  282

Query  292   S-------LFLKQAKFLPKIRAKLNTN----------KLDDG----DTTEN----KSFLK  396
             S       + LK    L +I      +            DD     D  E     + F  
Sbjct  283   SKLSAHWEVSLKSEDVLKEISLNAGASLYPEDASLISAADDSRVSIDVEETGKHPEIFQT  342

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              KE+ + A+K+MD+++K    +DC  SG+TAV  I+Q +DLV+ N+GDSRA+LG R  D 
Sbjct  343   LKESFLKAYKVMDRELKSYTNIDCFCSGTTAVTLIKQGQDLVIGNVGDSRAILGTRDKDG  402

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP++P EAERIRKC GRV +L +EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  403   SLTAVQLTVDLKPNLPAEAERIRKCRGRVFSLHDEPEVARVWLPNSDSPGLAMARAFGDF  462

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS PE+SY  L+  D F+VLATDG+WDVL+NDEV+  V SA       AA+++
Sbjct  463   CLKDFGLISVPEISYRRLTGKDEFIVLATDGIWDVLTNDEVVKIVASASS--RSSAARSL  520

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  521   VESAVRAWRTKYPTSKVDDCAVVCLFL  547



>dbj|BAJ88000.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   268 bits (686),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 199/316 (63%), Gaps = 24/316 (8%)
 Frame = +1

Query  136   SAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLPSLFLKQA  312
             S ++  G KG+NQDA ++ + +G + G  FCG+FDGHG  GH VSK+VR+ LP       
Sbjct  1     SLYTMQGKKGVNQDAMVVVENFGSKDGTIFCGVFDGHGPQGHLVSKMVRDLLPVKLSANI  60

Query  313   KFLPKIRAKLN--TNKLDDGDTTEN------------------KSFLKWKEACVSAFKLM  432
                      +N  TN   +GDT +                   + F   + + + AF +M
Sbjct  61    GRDEYKELSINNVTNGTAEGDTVKTVVEDTDAALEAVENGGYPEIFTALRTSFLRAFYVM  120

Query  433   DKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTD-NGVKAIQLTTDLK  609
             D+ +K  + +DC  SGSTAV  I+Q +DL++ NLGDSRA+L  K + N + A+QLT DLK
Sbjct  121   DRDLKSHKNIDCLFSGSTAVTLIKQGQDLIIGNLGDSRAILATKDEGNHLVALQLTVDLK  180

Query  610   PSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPE  789
             PS+P EA RIR+  GRV +L  EP + RVWLP  ++PGLAM+RAFGDF LK +G+IS P+
Sbjct  181   PSIPSEAARIRERKGRVFSLPNEPDVTRVWLPKYNSPGLAMARAFGDFCLKNYGVISVPD  240

Query  790   VSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRF  969
             VSYH+++  D F+VLATDGVWDVLSND+V+  V  +    E  AA+ +V+ A   W+ RF
Sbjct  241   VSYHHITEKDEFIVLATDGVWDVLSNDDVVKIVSESTS--EASAARLLVQTAHRTWRTRF  298

Query  970   PNSRRDDCTAICLFLQ  1017
             P ++ DDC A+CLFL+
Sbjct  299   PTAKVDDCAAVCLFLK  314



>gb|AAV73837.1| protein phosphatase 2c [Medicago sativa]
Length=502

 Score =   272 bits (695),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 207/332 (62%), Gaps = 35/332 (11%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGY-GDESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KG NQDA ++++ +   E   FCG+FDGHG  GH V+K VR+ LP
Sbjct  60    NGSSEFASLFTQQGKKGTNQDAMVVWENFCSREDTIFCGVFDGHGPYGHMVAKRVRDSLP  119

Query  292   --------------------------SLFLKQAKFLPKIRAKLNTNKLDDGDTTEN--KS  387
                                       S+ L+ A F     A   +    D +  E   + 
Sbjct  120   LKLNTQWELNVSGDDVLKEISINAAGSMILEDATFAS---ADEESRVSIDAEEMEKLPEI  176

Query  388   FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RK  564
             F   KE+ + AFK+MD+++K  + +DC  SG+TAV  ++Q  DL++ N+GDSRAVLG R+
Sbjct  177   FHTLKESFLKAFKVMDRELKMHQTIDCFCSGTTAVTLVKQGRDLIIGNVGDSRAVLGTRE  236

Query  565   TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAF  744
              D+ + A+QLT DLKP++P EAERIRKC GRV AL +EP + RVWLPN D+PGLAM+RAF
Sbjct  237   KDDSLVAVQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVCRVWLPNSDSPGLAMARAF  296

Query  745   GDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaa  924
             GDF LK  G+IS PEVSY  L+  D F+V+ATDG+WDVLSN EV+  + +A       AA
Sbjct  297   GDFCLKDFGLISVPEVSYRRLTEKDEFVVMATDGIWDVLSNKEVVDIIAAAPRR--ATAA  354

Query  925   kavveaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             +++VE AV AW+ ++P S+ DDC  +CLFL K
Sbjct  355   RSLVETAVRAWRYKYPTSKVDDCAVVCLFLDK  386



>ref|XP_008218455.1| PREDICTED: probable protein phosphatase 2C 33 [Prunus mume]
Length=506

 Score =   272 bits (695),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 158/353 (45%), Positives = 219/353 (62%), Gaps = 33/353 (9%)
 Frame = +1

Query  49    KASSEIHDADYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESG  216
             K  S     DY +E  +H        NG   +AS F+  G KG NQDA I+++ +G  + 
Sbjct  33    KMGSRNSSFDYRREEPLHRIPGRMFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTD  92

Query  217   D-FCGIFDGHGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIR----AKLNTN---  351
               FCG+FDGHG  GH V+K VR+ LP        + +   + L +I       LN++   
Sbjct  93    TVFCGVFDGHGPFGHMVAKRVRDSLPLKLSANWEVTITSEEVLKEISLNNSGSLNSDGTP  152

Query  352   ----------KLDDGDTTENKS-FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIA  498
                        +D  +T ++   F   KE+ + AFK+MD++++    +DC  SG+TAV  
Sbjct  153   FVYVDEDFRASIDIEETDKHPEIFQTLKESFLKAFKIMDRELRTQPSIDCFCSGTTAVTL  212

Query  499   IRQDEDLVVANLGDSRAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKE  675
             ++Q  DL++ N+GDSRAVL  R  D+ + AIQLT DLKP++P EAERIRKC GRV AL++
Sbjct  213   VKQGRDLIIGNVGDSRAVLCTRDKDDTLIAIQLTVDLKPNLPAEAERIRKCRGRVFALQD  272

Query  676   EPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWD  855
             EP + RVWLPN D+PGLAM+RAFGDF LK  G+IS P++S+  L+  D F+VLATDG+WD
Sbjct  273   EPEVSRVWLPNNDSPGLAMARAFGDFCLKDFGLISVPDISFRRLTEKDEFIVLATDGIWD  332

Query  856   VLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             VLSN EV+  V SA       AA+A+VE AV AW++++P S+ DDC  +CLFL
Sbjct  333   VLSNKEVVDIVASAPAR--SSAARALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_009357075.1| PREDICTED: probable protein phosphatase 2C 52 [Pyrus x bretschneideri]
Length=471

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 153/348 (44%), Positives = 217/348 (62%), Gaps = 25/348 (7%)
 Frame = +1

Query  31    MGICISKASSE-IHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQG  198
             +G C  K + +   D  Y  +N+    +    NG    +  F+  G KGINQDA ++++ 
Sbjct  29    IGFCGQKRTKKTFSDHSYTLQNLHTLPNRIFTNGKSQTSCIFTQQGRKGINQDAMVVWED  88

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKL----------NT  348
             +  +   FCG+FDGHG +GH V++ VR+ LP   +K   FL   +++L          + 
Sbjct  89    FMSDDAIFCGVFDGHGPHGHLVARKVRDALP---VKLLSFLYSYQSRLKGSSKTCFKGSV  145

Query  349   NKLDDGDT-----TENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDE  513
              K D GDT      E K  L W++A + ++K MDK+++    LDC  SGSTAV  ++Q  
Sbjct  146   KKSDGGDTEKDGSAEEKLNLSWRDAFLKSYKSMDKELRSHPNLDCFCSGSTAVTLVKQGS  205

Query  514   DLVVANLGDSRAVLGRK-TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQ  690
             +L +  +GDSRA+LG K + + + AIQLT DLKP +P EAERI++C GRV AL++EP + 
Sbjct  206   NLFMGYIGDSRAILGSKDSSDSMVAIQLTVDLKPDLPREAERIKRCKGRVFALQDEPEVS  265

Query  691   RVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSND  870
             RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+  L+  D F+VLA+DGVWDVLSN+
Sbjct  266   RVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSHRILTDRDQFIVLASDGVWDVLSNE  325

Query  871   EVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             EV+  V SA       AA+ VV++A   WK ++P S+ DDC  +CLFL
Sbjct  326   EVVEIVSSAPS--RASAARTVVDSAAREWKLKYPTSKMDDCAVVCLFL  371



>ref|XP_008379553.1| PREDICTED: probable protein phosphatase 2C 52 [Malus domestica]
Length=471

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 153/348 (44%), Positives = 217/348 (62%), Gaps = 25/348 (7%)
 Frame = +1

Query  31    MGICISKASSE-IHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQG  198
             +G C  K + +   D  Y  +N+    +    NG    +  F+  G KGINQDA ++++ 
Sbjct  29    IGFCGQKRTKKTFSDHSYTLQNLHTLPNRIFTNGKSQTSCIFTQQGRKGINQDAMVVWED  88

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKL----------NT  348
             +  +   FCG+FDGHG +GH V++ VR+ LP   +K   FL   +++L          + 
Sbjct  89    FMSDDAIFCGVFDGHGPHGHLVARKVRDALP---VKLLSFLYSYQSRLKGSSTTCFKGSX  145

Query  349   NKLDDGDT-----TENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDE  513
              K D GDT      E K  L W++A + ++K MDK+++    LDC  SGSTAV  ++Q  
Sbjct  146   KKSDGGDTEKDGSAEEKLNLSWRDAFLKSYKSMDKELRSHPNLDCFCSGSTAVTLVKQGS  205

Query  514   DLVVANLGDSRAVLGRK-TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQ  690
             +L +  +GDSRA+LG K + + + AIQLT DLKP +P EAERI++C GRV AL++EP + 
Sbjct  206   NLFMGYIGDSRAILGSKDSSDSMVAIQLTVDLKPDLPREAERIKRCKGRVFALQDEPEVS  265

Query  691   RVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSND  870
             RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+  L+  D F+VLA+DGVWDVLSN+
Sbjct  266   RVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSHRILTDRDQFIVLASDGVWDVLSNE  325

Query  871   EVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             EV+  V SA       AA+ VV++A   WK ++P S+ DDC  +CLFL
Sbjct  326   EVVEIVSSAPS--RASAARTVVDSAAREWKLKYPTSKMDDCAVVCLFL  371



>ref|XP_007132652.1| hypothetical protein PHAVU_011G113300g [Phaseolus vulgaris]
 gb|ESW04646.1| hypothetical protein PHAVU_011G113300g [Phaseolus vulgaris]
Length=468

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 200/312 (64%), Gaps = 14/312 (4%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  61    NGKSRGSCIFTQQGRKGINQDAMIVWEDFMSEDMIFCGVFDGHGPHGHLVARKVRDALPV  120

Query  295   LFLK-----------QAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQ  441
               L              K   K   K ++ + +   +TE+K    W+EA + ++K MDK+
Sbjct  121   KLLSFLHSSESKRSGSGKTCFKGNVKPDSVEFEKDCSTEDKMNSMWREAFMKSYKAMDKE  180

Query  442   IKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSV  618
             ++    LDC  SGSTAV  ++Q  +L +  +GDSRA++G K  N  + AIQLT DLKP +
Sbjct  181   LRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAIQLTVDLKPDL  240

Query  619   PCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSY  798
             P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+
Sbjct  241   PREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVISIPEFSH  300

Query  799   HNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNS  978
               L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK ++P S
Sbjct  301   RQLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVDSAAREWKLKYPTS  358

Query  979   RRDDCTAICLFL  1014
             + DDC  +CLFL
Sbjct  359   KMDDCAVVCLFL  370



>ref|XP_003543347.1| PREDICTED: probable protein phosphatase 2C 52-like [Glycine max]
Length=475

 Score =   271 bits (692),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 198/312 (63%), Gaps = 14/312 (4%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA I+++ +  E   FCG+FDGHG +GH V++ VR  LP 
Sbjct  61    NGKSRSSCIFTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARKVREALPL  120

Query  295   LFLK-----------QAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQ  441
               L              K   +   K  + + + G + E++    W+EA + A+K MDK 
Sbjct  121   KLLSFLHSSESGRNGSGKACFRSNIKPESGESEKGLSAEDEENSMWREAFMKAYKAMDKV  180

Query  442   IKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSV  618
             ++    LDC  SGSTAV  ++Q  +L + N+GDSRA++G K  N  + AIQLT DLKP +
Sbjct  181   LRSHPNLDCFCSGSTAVTIVKQGSNLFMGNIGDSRAIMGSKDGNDSMVAIQLTIDLKPDL  240

Query  619   PCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSY  798
             P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE S+
Sbjct  241   PREAERIKQCKGRVFALQDEPEVHRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSH  300

Query  799   HNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNS  978
               L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK ++P S
Sbjct  301   RLLTDKDQFIVLASDGVWDVLSNEEVVRIVSSAPTR--SSAARTLVDSAAREWKLKYPTS  358

Query  979   RRDDCTAICLFL  1014
             + DDC  +CLFL
Sbjct  359   KMDDCAVVCLFL  370



>ref|XP_004159488.1| PREDICTED: probable protein phosphatase 2C 6-like [Cucumis sativus]
Length=523

 Score =   272 bits (695),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 207/324 (64%), Gaps = 25/324 (8%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   IA  ++  G KG+NQDA I+ + +  +    FCG+FDGHG  GH V+K VR+ LP
Sbjct  82    NGSSRIACLYTQQGKKGVNQDAMIVQENFSSKRDTVFCGVFDGHGPFGHMVAKKVRDTLP  141

Query  292   SLFLKQ-----AKFLPKIRAKLNTNKLD----DGDTTENKS------------FLKWKEA  408
              +   Q      +   K R   ++N  D    +GD    KS            FL  K +
Sbjct  142   LILCTQWTSKSNEDQSKTRHSRSSNSEDSVALEGDEDSYKSLEGEENEKFPKMFLPLKVS  201

Query  409   CVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGR-KTDNGVKA  585
              + +FKLMDK++K  +K+DC  SGSTAV  I+Q ++L++ N+GDSRAVL     DN +  
Sbjct  202   LLKSFKLMDKELKLHQKIDCFCSGSTAVTLIKQGQNLILGNVGDSRAVLATIDEDNSLIP  261

Query  586   IQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKY  765
             IQLT DLKP +P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK 
Sbjct  262   IQLTVDLKPDLPGEAARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDFCLKD  321

Query  766   HGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaa  945
              G+IS P+V Y +L+P D F++LATDGVWDVLSN E +  V SA     E AA+A+V+ A
Sbjct  322   FGLISVPDVYYRHLTPRDQFVILATDGVWDVLSNKEAIEIVASA--PSRETAARALVDCA  379

Query  946   vdaWKRRFPNSRRDDCTAICLFLQ  1017
             V AW+ ++P S+ DDC  +CLFL+
Sbjct  380   VRAWRLKYPTSKNDDCAVVCLFLE  403



>ref|XP_009390619.1| PREDICTED: probable protein phosphatase 2C 66 [Musa acuminata 
subsp. malaccensis]
Length=536

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 209/333 (63%), Gaps = 40/333 (12%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYG-DESGDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    A  ++  G KG NQDA I+++ +   +   FCG+FDGHG  GH VSK VR+ LP
Sbjct  82    NGTSEAACLYTQQGRKGTNQDAMIVWENFSLTKDTIFCGVFDGHGPYGHMVSKKVRDSLP  141

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDG--------------------------DTTENKS--  387
                    K   + RA LN+++  D                           D  EN+   
Sbjct  142   ------LKLSTQWRASLNSHESPDPNGSISGSMNSEETASMSIDDECGESLDVDENEKLP  195

Query  388   --FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-  558
               +L  K++ + +FK MDK++K    +DC  SG+TAV  ++Q +DLV+ N+GDSRA++G 
Sbjct  196   EMYLPLKQSFLKSFKSMDKELKFHPTIDCFCSGTTAVTVVKQGQDLVIGNIGDSRAIMGT  255

Query  559   RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSR  738
             R  +N + A+QLT DLKP++P EA RI++C GRV AL++EP + RVWLPN D+PGLAM+R
Sbjct  256   RDKENNLTAVQLTVDLKPNLPREAARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMAR  315

Query  739   AFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeem  918
             AFGDF LK +G+IS PE+SY +L+  D F+VLATDGVWDVLSN EV+  V SA       
Sbjct  316   AFGDFCLKDYGLISVPEISYRHLTEKDEFIVLATDGVWDVLSNKEVVDVVGSAPTRS--T  373

Query  919   aakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             AA+AVV+ AV AW+ +FP S+ DDC  +CLFL+
Sbjct  374   AARAVVDCAVRAWRLKFPTSKIDDCAVVCLFLK  406



>emb|CBI17615.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 204/329 (62%), Gaps = 34/329 (10%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  58    NGASDFASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDSLP  117

Query  292   -------------------------SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS--F  390
                                      S+  +   F   I A   +    D + TE +   F
Sbjct  118   LKLSAHWEVNINEDVLKEISLNTTGSMNSEDTAF---ISADEESRPSIDLEETEKQPEIF  174

Query  391   LKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKT  567
                KE+ + AFK+MD++++    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVLG R  
Sbjct  175   QALKESFLKAFKVMDRELRMHTNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDK  234

Query  568   DNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFG  747
             D  + AIQLT DLKP++P EAERIR+  GRV AL++EP + RVWLPN D+PGLAM+RAFG
Sbjct  235   DGYLVAIQLTVDLKPNLPGEAERIRRFKGRVFALQDEPEVARVWLPNNDSPGLAMARAFG  294

Query  748   DFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaak  927
             DF LK  G+IS PE+SY  LS  D F+VLATDGVWDVLSN EV+  V SA       AA+
Sbjct  295   DFCLKDFGLISVPEISYRRLSEKDEFVVLATDGVWDVLSNKEVVDIVASASSR--STAAR  352

Query  928   avveaavdaWKRRFPNSRRDDCTAICLFL  1014
              +VE AV AW+ ++P S+ DDC  +CLFL
Sbjct  353   TLVETAVRAWRLKYPTSKVDDCAVVCLFL  381



>ref|XP_009782883.1| PREDICTED: probable protein phosphatase 2C 65 [Nicotiana sylvestris]
Length=451

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 209/307 (68%), Gaps = 12/307 (4%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDF-CGIFDGHGKNGHYVSKLVRNHLP  291
             +G     S +S  G KGINQDA  +++ +G + G F CG+FDGHG +GH V++ VR+ LP
Sbjct  56    HGYSKFVSMYSQQGKKGINQDAMTVWENFGGQKGAFFCGVFDGHGPSGHKVARYVRDSLP  115

Query  292   SL---FLKQAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKL  462
             S     LK++  + +I +  N ++ D     +N  F   K A + +FK MD+++++   +
Sbjct  116   SKISSLLKESNNVSEITSTENGDESD-----QNPLFAATKAAFLKSFKEMDEELEKEPSI  170

Query  463   DCCTSGSTAVIAIRQDEDLVVANLGDSRAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERI  639
             +  +SG+TAV   +Q+E L++ NLGDSRA++  R   N + + QLT DLKP +P E ERI
Sbjct  171   ESYSSGTTAVTLFKQEEHLLIGNLGDSRAIICTRDEKNQLISEQLTVDLKPHIPSEYERI  230

Query  640   RKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPND  819
             + C GRV+A+++EP++ RVW+P+ED PGLAM+RAFGDF LK +G+IS PEV Y  L+  D
Sbjct  231   KSCKGRVMAMEQEPNVYRVWMPDEDCPGLAMARAFGDFCLKDYGLISVPEVYYRKLTERD  290

Query  820   HFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTA  999
              F+VLATDGVWDVLSNDEV+  V +A +    MAAK +VE AV AWK ++P ++ DDC  
Sbjct  291   EFVVLATDGVWDVLSNDEVIRIVATARK--RSMAAKLLVECAVRAWKYKYPRAKIDDCAV  348

Query  1000  ICLFLQK  1020
             +CLFL++
Sbjct  349   VCLFLKR  355



>ref|XP_006474744.1| PREDICTED: probable protein phosphatase 2C 66-like isoform X1 
[Citrus sinensis]
 ref|XP_006474745.1| PREDICTED: probable protein phosphatase 2C 66-like isoform X2 
[Citrus sinensis]
Length=503

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 209/348 (60%), Gaps = 22/348 (6%)
 Frame = +1

Query  34    GICISKASSEIHDADYGQENVVHFGDCNGVEVIASAFSHPGSKGINQDAAILYQGYGDES  213
              I + K SS   DAD    ++      N     A  ++  G KG NQDA I+++ +    
Sbjct  34    AIFLKKKSSIDDDADQLLHHISGRMVNNAASKTACVYTQQGKKGTNQDAMIVWENFSSSD  93

Query  214   GDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS--  387
               FCGIFDGHG  GH V+K VR+ LP +   Q K      +  N N     + T + S  
Sbjct  94    TVFCGIFDGHGPYGHMVAKKVRDSLPVILCSQWKASNDQTSFENANGSTHSEETASLSMD  153

Query  388   -----------------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDED  516
                              +L  K++ + +FKLMDK++K    +DC  SG+TAV  ++Q  D
Sbjct  154   EEGFETLDTEGDKLPEIYLPLKKSMLKSFKLMDKELKLHPAIDCFCSGTTAVTLVKQGPD  213

Query  517   LVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQR  693
             +V+ N+GDSRAVL  R+ DN + A+QLT DLKP +P EA RI++C GRV AL++EP + R
Sbjct  214   IVIGNVGDSRAVLATREKDNSLVAVQLTVDLKPDLPREAARIQQCKGRVFALQDEPEVAR  273

Query  694   VWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDE  873
             VWLPN D+PGLAM+RAFGDF LK  G+IS P++ Y  L+  D F++LATDGVWDV+SN E
Sbjct  274   VWLPNNDSPGLAMARAFGDFCLKDFGLISVPDIYYRRLTEKDEFVILATDGVWDVISNKE  333

Query  874   VMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              +  V SA    +  AA+A+V+ AV +WK ++P S+ DDC  +CLFL+
Sbjct  334   AVEIVASA--PSQTTAARALVDWAVRSWKLKYPTSKNDDCAVVCLFLE  379



>ref|XP_002325473.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ABK95223.1| unknown [Populus trichocarpa]
 gb|EEE99854.1| phosphatase 2C family protein [Populus trichocarpa]
Length=493

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 215/346 (62%), Gaps = 37/346 (11%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDE-SGDFCGIFDG  240
             DY +E  +H        NG   IAS F+  G KG NQDA I+++ +G      FCG+FDG
Sbjct  42    DYRREEPLHRIPGRLFLNGSSDIASLFTQQGKKGTNQDAMIVWENFGSRRDAVFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIRAKLNTN-KLDDGDTT------E  378
             HG  GH V+K VR+ LP        + +     L +I   LNT   ++  DT+      E
Sbjct  102   HGPYGHMVAKRVRDSLPLKLTAHWEVNVASEDVLREI--SLNTTGSMNSEDTSFISADDE  159

Query  379   NKS-------------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDL  519
             +++             F   KE+ + AFK+MD++++    +DC  SG+TAV  ++Q + L
Sbjct  160   SRASVDLEDAEKHPEIFQTLKESFLKAFKIMDRELRVHTNIDCFCSGTTAVTLVKQGQYL  219

Query  520   VVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRV  696
             V+ N+GDSRAVLG R  D+ + A+QLT DLKP++P EAERIRKC GRV AL++EP + RV
Sbjct  220   VLGNVGDSRAVLGTRDKDDSLVAVQLTVDLKPNLPVEAERIRKCRGRVFALQDEPEVSRV  279

Query  697   WLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEV  876
             WLPN D+PGLAM+RAFGDF LK  G+IS P++SY  L+  D F+VLATDG+WDVLSN EV
Sbjct  280   WLPNNDSPGLAMARAFGDFCLKDFGLISVPDISYRCLTEKDEFIVLATDGIWDVLSNKEV  339

Query  877   MSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +  V S        AAK +VE AV AW+ ++P S+ DDC  +CLFL
Sbjct  340   VDIVGSV--PSRSSAAKTLVELAVRAWRYKYPTSKIDDCAVVCLFL  383



>ref|XP_010268762.1| PREDICTED: probable protein phosphatase 2C 1 [Nelumbo nucifera]
Length=469

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 205/315 (65%), Gaps = 21/315 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA ++++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  60    NGNSRTSCIFTQQGRKGINQDAMVVWEDFMSEDAIFCGVFDGHGPHGHLVARKVRDDLP-  118

Query  295   LFLKQAKFLPKIRAK---LNTN------KLD-----DGDTTENKSFLKWKEACVSAFKLM  432
               LK   FL    ++   LN N      KL+     DG T +N   L W+EA + ++K M
Sbjct  119   --LKLLSFLQSQESRQNGLNNNCFGRKTKLEGDSEKDGSTEDNLGSL-WREAFLKSYKAM  175

Query  433   DKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRK-TDNGVKAIQLTTDLK  609
             DK+++    LDC  SGSTAV  ++Q  +L +  +GDSRA++G K + + + A+QLT DLK
Sbjct  176   DKELRSHPTLDCFCSGSTAVTIVKQGLNLFMGYIGDSRAIMGSKDSSDSMVAVQLTVDLK  235

Query  610   PSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPE  789
             P +P E ERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE
Sbjct  236   PDLPREEERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVISIPE  295

Query  790   VSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRF  969
              S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V++A   WK ++
Sbjct  296   FSHRILTERDQFIVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVDSASREWKLKY  353

Query  970   PNSRRDDCTAICLFL  1014
             P S+ DDC  +CLFL
Sbjct  354   PTSKMDDCAVVCLFL  368



>ref|XP_009413563.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=496

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 150/322 (47%), Positives = 210/322 (65%), Gaps = 24/322 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS FS  G KG NQDA I+++ +G  +   FCG+FDGHG +GH ++K VR+ LP
Sbjct  59    NGSSGVASLFSQQGRKGPNQDAMIVWENFGSRNDTVFCGVFDGHGPHGHMIAKRVRDVLP  118

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDGDTT-------ENKSFLKWKE-------------AC  411
                    +        +N +   + DT+       EN + + ++E               
Sbjct  119   LKLNSNWEGEDCRETTVNNSGSINSDTSSTVSLKEENHTSIDFEENDEHSHILRTLKDPF  178

Query  412   VSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAI  588
             + AF++MDK+++Q   +DC  SG+TAV  ++Q ++LV+ N+GDSRAVLG R  +N + A+
Sbjct  179   LKAFRIMDKELRQHSDIDCFYSGTTAVTLVKQGQELVIGNVGDSRAVLGTRDENNSLIAV  238

Query  589   QLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYH  768
             QLT DLKP++P EAERIR+C GRV AL++EP + RVWLPN DTPGLAM+RA GDF LK +
Sbjct  239   QLTVDLKPNLPREAERIRQCKGRVFALRDEPDVARVWLPNSDTPGLAMARALGDFCLKDY  298

Query  769   GIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaav  948
             G+IS PE+SY +++  D F+++ATDGVWDVLSN+EV+  V SA       AA  +VE+AV
Sbjct  299   GLISVPEISYWHITERDEFIIMATDGVWDVLSNEEVVDIVASAPAR--SSAAHLLVESAV  356

Query  949   daWKRRFPNSRRDDCTAICLFL  1014
              AW+ +FP SR DDC  +CLFL
Sbjct  357   KAWRFKFPTSRVDDCAVVCLFL  378



>ref|XP_007205041.1| hypothetical protein PRUPE_ppa004533mg [Prunus persica]
 gb|EMJ06240.1| hypothetical protein PRUPE_ppa004533mg [Prunus persica]
Length=504

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 158/353 (45%), Positives = 219/353 (62%), Gaps = 33/353 (9%)
 Frame = +1

Query  49    KASSEIHDADYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESG  216
             K  S     DY +E  +H        NG   +AS F+  G KG NQDA I+++ +G  + 
Sbjct  33    KMGSRNSSFDYRREEPLHRIPGRMFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTD  92

Query  217   D-FCGIFDGHGKNGHYVSKLVRNHLP-------SLFLKQAKFLPKIR----AKLNTN---  351
               FCG+FDGHG  GH V+K VR+ LP        + +   + L +I       LN++   
Sbjct  93    TVFCGVFDGHGPFGHMVAKRVRDSLPLKLSANWEVTITSEEVLKEISLNNSGSLNSDGTP  152

Query  352   ----------KLDDGDTTENKS-FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIA  498
                        +D  +T ++   F   KE+ + AFK+MD++++    +DC  SG+TAV  
Sbjct  153   FVYVDEDFRASIDIEETDKHPEIFQTLKESFLKAFKIMDRELRTQPSIDCFCSGTTAVTL  212

Query  499   IRQDEDLVVANLGDSRAVL-GRKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKE  675
             ++Q  DL++ N+GDSRAVL  R  D+ + AIQLT DLKP++P EAERIRKC GRV AL++
Sbjct  213   VKQGRDLIIGNVGDSRAVLCTRDKDDTLIAIQLTVDLKPNLPAEAERIRKCRGRVFALQD  272

Query  676   EPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWD  855
             EP + RVWLPN D+PGLAM+RAFGDF LK  G+IS P++S+  L+  D F+VLATDG+WD
Sbjct  273   EPEVSRVWLPNNDSPGLAMARAFGDFCLKDFGLISVPDISFWRLTEKDEFIVLATDGIWD  332

Query  856   VLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             VLSN EV+  V SA       AA+A+VE AV AW++++P S+ DDC  +CLFL
Sbjct  333   VLSNKEVVDIVASAPAR--SSAARALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_003562890.1| PREDICTED: probable protein phosphatase 2C 64 [Brachypodium distachyon]
Length=428

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 192/303 (63%), Gaps = 19/303 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDES-GDFCGIFDGHGKNGHYVSKLVRNHLP  291
             +G    AS F+  G KGINQDA +++ G+G E  G  CG+FDGHG +GH V++ VR+ LP
Sbjct  46    DGRSRTASVFTQQGRKGINQDAMLIWDGFGGEDDGVLCGVFDGHGPHGHLVARRVRDSLP  105

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCC  471
                +  A+   K     N   + D           W++A   AFK MDK ++    LD  
Sbjct  106   LRLMSAARASAK-----NGQDMTDA---------AWRKAFARAFKAMDKDLRSHPSLDSF  151

Query  472   TSGSTAVIAIRQDEDLVVANLGDSRAVLGRK--TDNGVKAIQLTTDLKPSVPCEAERIRK  645
              SGSTAV  ++   DL +AN+GDSRAVLG +     G+ A+QLT DLKP VP EAERI+K
Sbjct  152   CSGSTAVTVLKLGSDLYMANIGDSRAVLGSRDAIAGGMVAVQLTVDLKPDVPSEAERIKK  211

Query  646   CNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHF  825
             C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE  + +L+  D F
Sbjct  212   CKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVISVPEFFHWSLTEKDQF  271

Query  826   LVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAIC  1005
             ++LA+DGVWDVLSN + +  V S+       AAK +VEAA   WK ++P SR DDC  IC
Sbjct  272   VILASDGVWDVLSNQQAVDIVSSSPSR--SKAAKTLVEAATREWKTKYPTSRTDDCAVIC  329

Query  1006  LFL  1014
             L+L
Sbjct  330   LYL  332



>ref|XP_004975270.1| PREDICTED: probable protein phosphatase 2C 14-like [Setaria italica]
Length=518

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 201/301 (67%), Gaps = 12/301 (4%)
 Frame = +1

Query  142   FSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKF  318
             ++  G KG+NQDA ++++ +G +    FCG+FDGHG NGH V+K VR+ LP         
Sbjct  142   YTMQGKKGVNQDAMVVWENFGSKHDTVFCGVFDGHGPNGHLVAKRVRDLLPVKLSANLGR  201

Query  319   LPKIRAKLNTNKLDDGDTT-ENKS-------FLKWKEACVSAFKLMDKQIKQVEKLDCCT  474
                       ++++D D + EN+        F   + + + AF +MD+ +K    +DC  
Sbjct  202   NGTTTGGTTPHRVEDTDASLENEENGEHPEFFPALRASFLRAFYVMDRDLKLHRNIDCAF  261

Query  475   SGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCN  651
             SG+TAV   +Q ++L++ NLGDSRAVLG R  DN + A+QLT DLKPS+P EAERI++  
Sbjct  262   SGTTAVTVFKQGQNLIICNLGDSRAVLGTRDEDNQLVAVQLTVDLKPSIPSEAERIKQRR  321

Query  652   GRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLV  831
             GRV +L +EP++ RVWLP  ++PGLAM+R+FGDF LK +GIIS P+VSYH ++  D F+V
Sbjct  322   GRVFSLPDEPNVARVWLPTFNSPGLAMARSFGDFCLKNYGIISMPDVSYHCITEKDEFVV  381

Query  832   LATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLF  1011
             LATDGVWDVLSNDEV+S + +A       AA+ +VE+A  AW+ R+P S+ DDC A+CLF
Sbjct  382   LATDGVWDVLSNDEVVSIISNA--PSRVSAARFLVESAQRAWRTRYPTSKTDDCAAVCLF  439

Query  1012  L  1014
             L
Sbjct  440   L  440



>ref|XP_010908969.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=494

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 214/328 (65%), Gaps = 31/328 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG+NQDA I+++ +G  +   FCG+FDGHG  GH V++ VR+ LP
Sbjct  62    NGASSVASLFTQKGKKGLNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVARRVRDSLP  121

Query  292   ------------SLFLKQAKFLPKIRAKLNTNK-----LDD--GDTTENKS-------FL  393
                         S   +++  +    A +N+ +     LD+  G +T+ +        F 
Sbjct  122   LKLSALWEVNVGSDDCRESTIISH-SASMNSEETSSICLDEEPGVSTDIEEKDKHPEIFT  180

Query  394   KWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN  573
               KE+ + AFK+MDK++K    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVLG +  N
Sbjct  181   TLKESFLKAFKVMDKELKLHTNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDQN  240

Query  574   G-VKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGD  750
               + A+QLT DLKP++P EAERIRKC GRV AL+ EP + RVWLPN D+PGLAM+RAFGD
Sbjct  241   DCLIAVQLTVDLKPNLPREAERIRKCRGRVFALQSEPEVARVWLPNNDSPGLAMARAFGD  300

Query  751   FMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaaka  930
             F LK  G+IS PE+SY  ++  D F+VLATDGVWDVLSN EV+  V SA       AA++
Sbjct  301   FCLKDFGLISVPEISYLRITKKDEFIVLATDGVWDVLSNKEVVDIVSSAPAR--SSAARS  358

Query  931   vveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +VE+AV AW+ ++P S+ DDC  +CLFL
Sbjct  359   LVESAVQAWRLKYPTSKIDDCAVVCLFL  386



>ref|XP_002277393.1| PREDICTED: probable protein phosphatase 2C 33 [Vitis vinifera]
Length=486

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 204/329 (62%), Gaps = 34/329 (10%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  58    NGASDFASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDSLP  117

Query  292   -------------------------SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS--F  390
                                      S+  +   F   I A   +    D + TE +   F
Sbjct  118   LKLSAHWEVNINEDVLKEISLNTTGSMNSEDTAF---ISADEESRPSIDLEETEKQPEIF  174

Query  391   LKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKT  567
                KE+ + AFK+MD++++    +DC  SG+TAV  ++Q +DLV+ N+GDSRAVLG R  
Sbjct  175   QALKESFLKAFKVMDRELRMHTNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDK  234

Query  568   DNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFG  747
             D  + AIQLT DLKP++P EAERIR+  GRV AL++EP + RVWLPN D+PGLAM+RAFG
Sbjct  235   DGYLVAIQLTVDLKPNLPGEAERIRRFKGRVFALQDEPEVARVWLPNNDSPGLAMARAFG  294

Query  748   DFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaak  927
             DF LK  G+IS PE+SY  LS  D F+VLATDGVWDVLSN EV+  V SA       AA+
Sbjct  295   DFCLKDFGLISVPEISYRRLSEKDEFVVLATDGVWDVLSNKEVVDIVASASSR--STAAR  352

Query  928   avveaavdaWKRRFPNSRRDDCTAICLFL  1014
              +VE AV AW+ ++P S+ DDC  +CLFL
Sbjct  353   TLVETAVRAWRLKYPTSKVDDCAVVCLFL  381



>ref|XP_008441722.1| PREDICTED: probable protein phosphatase 2C 33 [Cucumis melo]
 ref|XP_008441723.1| PREDICTED: probable protein phosphatase 2C 33 [Cucumis melo]
Length=485

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 203/329 (62%), Gaps = 30/329 (9%)
 Frame = +1

Query  112   CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHL  288
              NG   +AS F+  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V+K VR+ L
Sbjct  55    TNGFTDMASLFTQQGKKGTNQDAMIVWENFGSRTDTIFCGVFDGHGPYGHMVAKKVRDSL  114

Query  289   P--------------------------SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSF  390
             P                          S+   +A        +   +   DG   + + F
Sbjct  115   PLRLSAHWEVNLTTDDVHREISLNNTGSMNSDEATSFVSADEEFRASIDVDGTEKQPEIF  174

Query  391   LKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKT  567
                KE+ + AF++MD +++  + +D   SG+TAV  ++Q +DLV+ N+GDSRAVLG R  
Sbjct  175   HTLKESFLKAFRVMDWELRMHQTIDSFCSGTTAVTIVKQGQDLVIGNVGDSRAVLGMRDK  234

Query  568   DNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFG  747
              + +  IQLT DLKP++P EAERIRKC GRV AL++EP + RVWLPN ++PGLAM+RAFG
Sbjct  235   GDSLVPIQLTVDLKPNLPAEAERIRKCRGRVFALQDEPDVARVWLPNSNSPGLAMARAFG  294

Query  748   DFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaak  927
             DF LK  G+IS PE+SY  L+  D F+VLATDG+WDVLSN EV+  V SA +     AA+
Sbjct  295   DFCLKDFGLISVPEISYRRLTEKDEFIVLATDGIWDVLSNKEVVDIVASAPKR--TTAAR  352

Query  928   avveaavdaWKRRFPNSRRDDCTAICLFL  1014
              +VE AV AWK ++P S+ DDC  +CLFL
Sbjct  353   TLVETAVKAWKHKYPTSKIDDCAVVCLFL  381



>ref|XP_010644704.1| PREDICTED: probable protein phosphatase 2C 6 [Vitis vinifera]
Length=511

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 206/334 (62%), Gaps = 41/334 (12%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +AS F+  G KG NQDA ++++ +   S   FCG+FDGHG  GH V+K VR+ LP
Sbjct  60    NGASTVASLFTQQGKKGTNQDAMLVWENFSSRSDTIFCGVFDGHGPYGHMVAKKVRDCLP  119

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDG-----------------------------DTTEN-  381
              +   Q       +A  N++K  DG                             D  E  
Sbjct  120   LILHTQ------WQANSNSDKKSDGKNGNAPEKTNLEETASLNMDDEYYESLEVDDNEKV  173

Query  382   -KSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG  558
              + +L  KE+ + AFKLMDK++K    +DC  SG+TAV  ++Q  +LV+ N+GDSRAVL 
Sbjct  174   PEMYLPLKESFLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQGPNLVIGNIGDSRAVLA  233

Query  559   -RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMS  735
              R  +N + A+QLT DLKP++P EA RI +C GRV AL++EP + RVWLPN D+PGLAM+
Sbjct  234   TRDVENSLTAVQLTIDLKPNLPREAARIHQCKGRVFALQDEPEVARVWLPNSDSPGLAMA  293

Query  736   RAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGee  915
             RAFGDF LK  G+IS P++ Y +L+  D F++LATDGVWDVLSN E +  V SA   G  
Sbjct  294   RAFGDFCLKDFGLISVPDIYYRHLTERDEFIILATDGVWDVLSNKEAVDIVASA--PGHT  351

Query  916   maakavveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
              AA+A+V+ AV AW+ ++P S+ DDC  +CLFL+
Sbjct  352   TAARALVDCAVRAWRLKYPTSKNDDCAVVCLFLE  385



>emb|CDY51389.1| BnaC08g46260D [Brassica napus]
Length=423

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/295 (48%), Positives = 198/295 (67%), Gaps = 9/295 (3%)
 Frame = +1

Query  142   FSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFL  321
             F+  G KG+NQD+ I++Q +  +   FCG+FDGHG NGH VS+ VR  LP   L    F+
Sbjct  61    FTQQGRKGVNQDSMIVWQDFMSKDMTFCGVFDGHGPNGHLVSRKVRESLPVRLLS---FM  117

Query  322   PKIRAKLN--TNKLDDGDTTE-NKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAV  492
               I++K N  T+K D  + +E +K  L W+EA + +F  MDK+++    ++C  SGSTAV
Sbjct  118   HSIQSKQNGSTSKSDSQEASEEDKLKLLWEEAFLKSFNAMDKELRSHPNVECFCSGSTAV  177

Query  493   IAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLKPSVPCEAERIRKCNGRVIAL  669
               I+Q   L + N+GDSRA+LG K  N  + A+QLT DLKP +P E ERI++C GRV AL
Sbjct  178   TVIKQGSHLFMGNIGDSRAILGSKDSNDSMVAVQLTVDLKPDLPREEERIKQCKGRVFAL  237

Query  670   KEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGV  849
             ++EP + RVWLP ++ PGLAM+RAFGDF +K +G+IS P+ S+  L+  D F+VLA+DGV
Sbjct  238   EDEPEVPRVWLPFDNAPGLAMARAFGDFCVKDYGVISIPDFSHRLLTDRDQFIVLASDGV  297

Query  850   WDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             WDVLSN+EV+  V  A       AA+ VV++A   WK ++P S+ DDC  +CLFL
Sbjct  298   WDVLSNEEVVEVV--ASASSRASAARLVVDSASREWKLKYPTSKMDDCAVVCLFL  350



>ref|XP_004506557.1| PREDICTED: probable protein phosphatase 2C 52-like [Cicer arietinum]
Length=471

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 201/315 (64%), Gaps = 20/315 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA ++++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  62    NGKSRGSCIFTQQGRKGINQDAMVVWEDFMSEDTVFCGVFDGHGPHGHLVARKVRDTLP-  120

Query  295   LFLKQAKFLPKIRAKLNTN---------KLDDGDT-----TENKSFLKWKEACVSAFKLM  432
               +K   FL    +K N +         K D GD+      E+K    W+EA +  +K M
Sbjct  121   --VKLLSFLHSSESKQNRSGKACFKQNIKRDGGDSEKDCSAEDKLNSTWREAFMKTYKAM  178

Query  433   DKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLK  609
             DK+++    +DC  SGSTAV  ++Q  +L +  +GDSRA++G K  N  + A+QLT DLK
Sbjct  179   DKELRSHPNVDCFCSGSTAVTIVKQGLNLFMGYIGDSRAIMGSKDSNDAMVAVQLTVDLK  238

Query  610   PSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPE  789
             P +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE
Sbjct  239   PDLPREAERIKQCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPE  298

Query  790   VSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRF  969
              S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ VV +A   WK ++
Sbjct  299   FSHRLLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARIVVNSAAREWKLKY  356

Query  970   PNSRRDDCTAICLFL  1014
             P S+ DDC  +CLFL
Sbjct  357   PTSKMDDCAVVCLFL  371



>ref|XP_010278294.1| PREDICTED: probable protein phosphatase 2C 52 [Nelumbo nucifera]
Length=474

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/317 (46%), Positives = 202/317 (64%), Gaps = 23/317 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA ++++ +  E   FCG+FDGHG +GH V++ VR+ LP 
Sbjct  62    NGNSRTSCIFTQQGRKGINQDAMVVWEDFMSEDAIFCGVFDGHGPHGHLVARKVRDTLP-  120

Query  295   LFLKQAKFLPKIRAKLN----------------TNKLDDGDTTENKSFLKWKEACVSAFK  426
               LK   FL    ++ N                  + +  D TE+   L W+EA + ++K
Sbjct  121   --LKLLSFLQSQESRQNGLGNNCFSRKAKPDSMDKESEKDDPTEDLGSL-WREAFLKSYK  177

Query  427   LMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDNG-VKAIQLTTD  603
              MDK+++    LDC  SGSTAV  ++Q  +L +  +GDSRA+LG +  NG + A+QLT D
Sbjct  178   SMDKELRSHPTLDCFCSGSTAVTIVKQGLNLFMGYIGDSRAILGSRDSNGSMVAVQLTVD  237

Query  604   LKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIIST  783
             LKP +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS 
Sbjct  238   LKPDLPKEAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVISI  297

Query  784   PEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKR  963
             PE S+  L+  D F+VLA+DGVWDVLSN+EV+  + SA       AA+ +VE+A   WK 
Sbjct  298   PEFSHRILTERDQFIVLASDGVWDVLSNEEVVEIISSAPTRS--SAARILVESAAREWKL  355

Query  964   RFPNSRRDDCTAICLFL  1014
             ++P S+ DDC  +CLFL
Sbjct  356   KYPTSKMDDCAVVCLFL  372



>ref|NP_001060016.1| Os07g0566200 [Oryza sativa Japonica Group]
 sp|Q8H4S6.2|P2C64_ORYSJ RecName: Full=Probable protein phosphatase 2C 64; Short=OsPP2C64 
[Oryza sativa Japonica Group]
 dbj|BAC79670.1| putative protein phosphatase 2C [Oryza sativa Japonica Group]
 dbj|BAF21930.1| Os07g0566200 [Oryza sativa Japonica Group]
 gb|EAZ40328.1| hypothetical protein OsJ_24776 [Oryza sativa Japonica Group]
Length=427

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/303 (47%), Positives = 194/303 (64%), Gaps = 22/303 (7%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDES-GDFCGIFDGHGKNGHYVSKLVRNHLP  291
             +G    A+ ++  G KGINQDA +++ G+G E  G  CG+FDGHG +GH V++ VR+ LP
Sbjct  48    DGRSRTATVYTQQGRKGINQDAMLVWDGFGGEDDGVLCGVFDGHGPHGHVVARRVRDSLP  107

Query  292   SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSFLKWKEACVSAFKLMDKQIKQVEKLDCC  471
                +  A+                 D+  +     W++A   A+K MDK ++    LDC 
Sbjct  108   LRLMSAAR-----------------DSGADMPAAAWRKAFARAYKAMDKDLRSHPSLDCF  150

Query  472   TSGSTAVIAIRQDEDLVVANLGDSRAVLGRK--TDNGVKAIQLTTDLKPSVPCEAERIRK  645
              SGSTAV  ++   DL +AN+GDSRAVLG +  T  G+ A+QLT DLKP VP EAERI+K
Sbjct  151   CSGSTAVTVLKLGSDLYMANIGDSRAVLGSREATGGGMVAVQLTVDLKPDVPSEAERIKK  210

Query  646   CNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHF  825
             C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE  + +L+  D F
Sbjct  211   CRGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVISVPEFFHWSLTEKDQF  270

Query  826   LVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAIC  1005
             ++LA+DGVWDVLSN E +  V ++       AAK++VEAA   WK ++P S+ DDC  +C
Sbjct  271   VILASDGVWDVLSNQEAVDIVSASPSR--SKAAKSLVEAATREWKTKYPTSKIDDCAVVC  328

Query  1006  LFL  1014
             L+L
Sbjct  329   LYL  331



>ref|XP_009379076.1| PREDICTED: probable protein phosphatase 2C 6 [Pyrus x bretschneideri]
Length=542

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 208/329 (63%), Gaps = 29/329 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDES-GDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   +A  ++  G KG NQDA ++++ +   S   FCG+FDGHG  GH V+K VR+ LP
Sbjct  68    NGGSKVACLYTQQGKKGTNQDAMLVWENFATRSDTTFCGVFDGHGPFGHVVAKKVRDSLP  127

Query  292   SLFLKQAKF-----LPKIRAKLNTN-----------KLDDG-----DTTENKS----FLK  396
              +   Q K      L  +    N N            +DD      +  EN+     +L 
Sbjct  128   LILCTQWKADSNSDLSNLNKAENANGSSNLEEPASPSIDDEWCESLEVRENEKLPDMYLP  187

Query  397   WKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              K++ + AFKLMDK++K    +DC  SG+TAV  I+Q ++LV+ N+GDSRAVL  R  DN
Sbjct  188   LKKSFLKAFKLMDKELKLHPTIDCFCSGTTAVTLIKQGQNLVIGNVGDSRAVLATRDQDN  247

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP +P E+ RI++C GRV AL++EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  248   SLIAVQLTVDLKPDLPAESARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDF  307

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS P+V Y +L+  D F++LATDGVWDVLSN E +  V SA   G   AA+A+
Sbjct  308   CLKDFGLISVPDVFYRHLTERDEFIILATDGVWDVLSNKEAVEIVASA--PGHTTAARAL  365

Query  934   veaavdaWKRRFPNSRRDDCTAICLFLQK  1020
             V+ AV AW+ ++P S+ DDC  +CLFL+K
Sbjct  366   VDCAVRAWRLKYPTSKNDDCAVVCLFLEK  394



>emb|CDY51537.1| BnaA05g33370D [Brassica napus]
Length=533

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 211/318 (66%), Gaps = 19/318 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG    A  F+  G KG NQDA ++++ +G  +   FCG+FDGHG  GH V+K VR++LP
Sbjct  150   NGASEAACIFTQQGKKGPNQDAMVVWESFGSRTDTVFCGVFDGHGPYGHMVAKRVRDNLP  209

Query  292   SLFLKQAKFLPKIRAKLNTNKLDD-------------GDTTENKS--FLKWKEACVSAFK  426
                    +    I +  N N  +D              ++ E++S  F   K+A + AFK
Sbjct  210   LKLSAYWEAKVPINSASNINNSEDVSFVSAEEEPSANNNSEESQSDLFQTLKDAFLKAFK  269

Query  427   LMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTD  603
             +MD+++K  + +DC  SG+TAV  I+Q E LVV N+GDSRAV+G R  +N + A+QLT D
Sbjct  270   VMDRELKFHKSVDCFCSGTTAVTLIKQGEYLVVGNVGDSRAVMGTRNGENALVAVQLTVD  329

Query  604   LKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIIST  783
             LKP++P EAERI+KC GRV AL++EP + RVWLPN D+PGLAM+RAFGDF LK  G+IS 
Sbjct  330   LKPNLPAEAERIKKCRGRVFALRDEPEVCRVWLPNCDSPGLAMARAFGDFCLKDFGLISV  389

Query  784   PEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKR  963
             P+VS+  L+  D F+VLA+DG+WDVLSN+EV++ V  A       AA+A+VE+AV AW+ 
Sbjct  390   PDVSFRRLTEQDEFIVLASDGIWDVLSNEEVVAIV--ASAPSRSSAARALVESAVRAWRY  447

Query  964   RFPNSRRDDCTAICLFLQ  1017
             ++P S+ DDC A+CL+L 
Sbjct  448   KYPTSKVDDCAAVCLYLH  465



>ref|XP_002319268.2| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE95191.2| phosphatase 2C family protein [Populus trichocarpa]
Length=482

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 209/329 (64%), Gaps = 31/329 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDES-GDFCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   IAS F+  G KG NQDA I+++ +G  +   FCG+FDGHG  GH V+K VR+ LP
Sbjct  59    NGSSDIASLFTQQGKKGTNQDAMIVWENFGSRTDAVFCGVFDGHGPYGHMVAKRVRDSLP  118

Query  292   --------------------------SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKSFL  393
                                       S+  +   F+        +  L+D +    ++F 
Sbjct  119   LKLTAYWEMNATSEAVLKEISLNTTGSMNSEDTSFISADEEPRASVDLEDAE-KHPENFQ  177

Query  394   KWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTD  570
               KE+ + AFK+MD++++    +DC  SG+TAV  ++Q + LV+ N+GDSRAVLG R  D
Sbjct  178   TLKESFLKAFKVMDRELRVHANIDCFCSGTTAVTLVKQGQYLVLGNVGDSRAVLGTRDKD  237

Query  571   NGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGD  750
             + + A+QLT DLKP++P EAERIRKC GRV AL++EP + RVWLPN D+PGLAM+RAFGD
Sbjct  238   DSLVAVQLTVDLKPNLPAEAERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGD  297

Query  751   FMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaaka  930
             F LK  G+IS P++SY +L+  D F+VLATDG+WDVLSN EV+  V S        AA+A
Sbjct  298   FCLKDFGLISVPDISYRHLTEKDEFIVLATDGIWDVLSNKEVVDIVASVSSR--SSAARA  355

Query  931   vveaavdaWKRRFPNSRRDDCTAICLFLQ  1017
             +VE+AV AW+ ++P S+ DDC  +CLFL+
Sbjct  356   LVESAVRAWRYKYPTSKIDDCAVVCLFLE  384



>ref|XP_010500496.1| PREDICTED: probable protein phosphatase 2C 33 [Camelina sativa]
Length=495

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 216/356 (61%), Gaps = 45/356 (13%)
 Frame = +1

Query  76    DYGQENVVHFGD----CNGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDG  240
             DY +E  +H        NG    A  F+  G KG NQDA ++++ +G  +   FCG+FDG
Sbjct  42    DYRREEPLHRVPGRMFLNGSSEAACIFTQQGKKGPNQDAMVVWENFGSRTDTVFCGVFDG  101

Query  241   HGKNGHYVSKLVRNHLP---SLFLKQAKFLPKIRAKLNTNKLDDGDTTENKS--------  387
             HG  GH V+K VR++LP   S + +    +  +   + T+ +++     N          
Sbjct  102   HGPYGHMVAKRVRDNLPLKLSTYWEAKVPVEGVLKAITTDTVNNATNINNSEDTAAAAAA  161

Query  388   --------------------------FLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTA  489
                                       F   KE+ + AFK+MD+++K    +DC  SG+TA
Sbjct  162   SVSAEEEPRTSAKMEEEENMESHPELFQTLKESFLKAFKVMDRELKFHGSVDCFCSGTTA  221

Query  490   VIAIRQDEDLVVANLGDSRAVLG-RKTDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIA  666
             V  I+Q + LVV N+GDSRAV+G R +DN + ++QLT DLKP++P EAERIRKC GRV A
Sbjct  222   VTLIKQGQYLVVGNIGDSRAVMGTRDSDNALHSVQLTVDLKPNLPAEAERIRKCRGRVFA  281

Query  667   LKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDG  846
             L++EP + RVWLPN D+PGLAM+RAFGDF LK  G+IS P+VS+  L+  D F+VLATDG
Sbjct  282   LRDEPEVCRVWLPNCDSPGLAMARAFGDFCLKDFGLISVPDVSFRRLTEKDEFIVLATDG  341

Query  847   VWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             +WDVLSND+V+  V SA       AA+A+VE+AV AW+ ++P S+ DDC A+CL+L
Sbjct  342   IWDVLSNDDVVGIVASA--PSRSTAARAIVESAVRAWRYKYPTSKVDDCAAVCLYL  395



>ref|XP_003605716.1| hypothetical protein MTR_4g037470 [Medicago truncatula]
 gb|AES87913.1| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=470

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/315 (46%), Positives = 200/315 (63%), Gaps = 20/315 (6%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGDFCGIFDGHGKNGHYVSKLVRNHLPS  294
             NG    +  F+  G KGINQDA ++++ +  E   FCG+FDGHG  GH V++ VR+ LP 
Sbjct  61    NGKSRGSCIFTQQGRKGINQDAMVVWEDFMSEDTIFCGVFDGHGPQGHLVARKVRDTLP-  119

Query  295   LFLKQAKFLPKIRAKLNTN---------KLDDGDT-----TENKSFLKWKEACVSAFKLM  432
               +K   F   + +K N +           D G++      E+K    W+EA + A+K M
Sbjct  120   --VKLLSFWHSLESKQNRSDKTCFKRNITPDCGESEKDCSAEDKLNSTWREAFIKAYKTM  177

Query  433   DKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLGRKTDN-GVKAIQLTTDLK  609
             DK+++    LDC  SGST+V  ++Q  +L +  +GDSRA++G K  N  + AIQLT DLK
Sbjct  178   DKELRSYPNLDCFCSGSTSVTVVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAIQLTVDLK  237

Query  610   PSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPE  789
             P +P EAERI++C GRV AL++EP + RVWLP +D PGLAM+RAFGDF LK +G+IS PE
Sbjct  238   PDLPREAERIKQCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPE  297

Query  790   VSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakavveaavdaWKRRF  969
              S+  L+  D F+VLA+DGVWDVLSN+EV+  V SA       AA+ +V +A   WK ++
Sbjct  298   FSHRLLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRS--SAARILVNSAAREWKLKY  355

Query  970   PNSRRDDCTAICLFL  1014
             P S+ DDC  +CLFL
Sbjct  356   PTSKMDDCAVVCLFL  370



>ref|XP_002529215.1| protein phosphatase-2c, putative [Ricinus communis]
 gb|EEF33171.1| protein phosphatase-2c, putative [Ricinus communis]
Length=504

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 204/327 (62%), Gaps = 31/327 (9%)
 Frame = +1

Query  115   NGVEVIASAFSHPGSKGINQDAAILYQGYGDESGD-FCGIFDGHGKNGHYVSKLVRNHLP  291
             NG   IA  ++  G KG NQDA ++++ +   S   FCG+FDGHG  GH V+K VR+ LP
Sbjct  56    NGSSKIACLYTQQGKKGTNQDAMLVWESFSSRSDTVFCGVFDGHGPYGHMVAKKVRDSLP  115

Query  292   SLFLKQAK--------FLPKIR-------------AKLNTNKLDDGDTTENKSFLKW---  399
              +   Q K         LPK               A ++    D  +  +N+ F +    
Sbjct  116   LVLCTQWKDGSNDENSSLPKTENTPESTNSEETASASVDDESHDFLEVEQNEKFPEMYQP  175

Query  400   -KEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDEDLVVANLGDSRAVLG-RKTDN  573
              K++ + AFK+MDK++K    +DC  SGSTAV  I+QD  L++ NLGDSRAVL  R  DN
Sbjct  176   LKKSIMKAFKMMDKELKLHPTIDCFCSGSTAVTLIKQD--LIIGNLGDSRAVLATRNEDN  233

Query  574   GVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQRVWLPNEDTPGLAMSRAFGDF  753
              + A+QLT DLKP +P E+ RI +C GRV ALK+EP + RVWLPN D+PGLAM+RAFGDF
Sbjct  234   SLHAVQLTIDLKPDLPRESARIHQCKGRVFALKDEPEVARVWLPNNDSPGLAMARAFGDF  293

Query  754   MLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSNDEVMSTVCSAYEYGeemaakav  933
              LK  G+IS P+V YH+L   D F++LATDGVWDVLSN E +  V SA   G   AA+A+
Sbjct  294   CLKDFGLISVPDVYYHHLIKGDEFIILATDGVWDVLSNKEAVDIVASA--PGRATAARAL  351

Query  934   veaavdaWKRRFPNSRRDDCTAICLFL  1014
             V+ AV AW+ ++P S+ DDC  +CLFL
Sbjct  352   VDCAVRAWRLKYPTSKNDDCAVVCLFL  378



>ref|XP_008348116.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 52 [Malus domestica]
Length=471

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 216/348 (62%), Gaps = 25/348 (7%)
 Frame = +1

Query  31    MGICISKASSE-IHDADYGQENVVHFGD---CNGVEVIASAFSHPGSKGINQDAAILYQG  198
             +G C  K + +   D  Y  +N+    +    NG    +  F+  G KGINQDA ++++ 
Sbjct  29    IGFCGQKRTKKTFSDHSYTLQNLHTLPNRIFTNGKSQTSCIFTQQGRKGINQDAMVVWED  88

Query  199   YGDESGDFCGIFDGHGKNGHYVSKLVRNHLPSLFLKQAKFLPKIRAKL----------NT  348
             +  +   FCG+FDGHG +GH V++ VR+ LP   +K   FL   +++L          + 
Sbjct  89    FMSDDAIFCGVFDGHGPHGHLVARKVRDALP---VKLLSFLYSYQSRLKGSSTTCFKGSX  145

Query  349   NKLDDGDT-----TENKSFLKWKEACVSAFKLMDKQIKQVEKLDCCTSGSTAVIAIRQDE  513
              K D GDT      E K  L W++A + ++K MDK+++    LDC  SGSTAV  ++Q  
Sbjct  146   KKSDGGDTEKDGSAEEKLNLSWRDAFLKSYKSMDKELRSHPNLDCFCSGSTAVTLVKQGS  205

Query  514   DLVVANLGDSRAVLGRK-TDNGVKAIQLTTDLKPSVPCEAERIRKCNGRVIALKEEPHIQ  690
             +L +  +GDSRA+LG K + + + AIQLT DLKP +P EAERI++C GRV AL++EP + 
Sbjct  206   NLFMGYIGDSRAILGSKDSSDSMVAIQLTVDLKPDLPREAERIKRCKGRVFALQDEPEVS  265

Query  691   RVWLPNEDTPGLAMSRAFGDFMLKYHGIISTPEVSYHNLSPNDHFLVLATDGVWDVLSND  870
             RVWLP +D PGLAM+RAFGDF LK +G+IS P  S+  L+  D F+VLA+DGVWDVLSN+
Sbjct  266   RVWLPFDDAPGLAMARAFGDFCLKEYGVISIPXFSHRILTDRDQFIVLASDGVWDVLSNE  325

Query  871   EVMSTVCSAYEYGeemaakavveaavdaWKRRFPNSRRDDCTAICLFL  1014
             EV+  V SA       AA+ VV++A   WK ++P S+ DDC  +CLFL
Sbjct  326   EVVEIVSSAPS--RASAARTVVDSAAREWKLKYPTSKMDDCAVVCLFL  371



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3061147228170