BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18809_g1_i1 len=1559 path=[1537:0-678 3752:679-694 2232:695-859
2397:860-1014 2552:1015-1113 2651:1114-1558]

Length=1559
                                                                      Score     E

ref|XP_006600362.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    454   2e-153   
ref|XP_009622776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    438   2e-147   
emb|CDO98837.1|  unnamed protein product                                436   1e-146   
ref|XP_006342825.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    428   2e-143   
ref|XP_003550367.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    427   3e-143   
ref|XP_004252913.1|  PREDICTED: bifunctional epoxide hydrolase 2        426   1e-142   
ref|XP_009622179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    421   6e-141   
ref|XP_004229259.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    421   9e-141   
ref|XP_007154300.1|  hypothetical protein PHAVU_003G106900g             421   1e-140   
ref|XP_011091000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    420   2e-140   
ref|XP_009757465.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    420   3e-140   
ref|XP_009757467.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    420   4e-140   
gb|EYU43974.1|  hypothetical protein MIMGU_mgv1a009814mg                420   4e-140   
ref|XP_009622181.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    419   5e-140   
ref|XP_007222764.1|  hypothetical protein PRUPE_ppa008756mg             417   3e-139   
ref|XP_006489040.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    418   7e-139   
ref|XP_006419515.1|  hypothetical protein CICLE_v10005186mg             417   1e-138   
emb|CAZ86692.1|  epoxide hydrolase 1                                    414   3e-138   
ref|XP_008223222.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    413   9e-138   
ref|XP_009788447.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    413   9e-138   
gb|KDO71745.1|  hypothetical protein CISIN_1g017221mg                   409   1e-135   
ref|XP_006349824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    407   1e-135   
ref|XP_006342824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    407   2e-135   
ref|XP_009352305.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    407   2e-135   
ref|XP_007222693.1|  hypothetical protein PRUPE_ppa008676mg             405   1e-134   
ref|XP_004296863.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    404   3e-134   
ref|XP_007035641.1|  Alpha/beta-Hydrolases superfamily protein          407   4e-134   
ref|XP_011090999.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    403   5e-134   
ref|NP_001274907.1|  epoxide hydrolase                                  402   2e-133   
gb|EYU43973.1|  hypothetical protein MIMGU_mgv1a010247mg                402   3e-133   
ref|NP_001275417.1|  epoxide hydrolase                                  401   5e-133   
ref|XP_004290776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    400   7e-133   
ref|NP_001274962.1|  epoxide hydrolase                                  400   8e-133   
gb|EYU21013.1|  hypothetical protein MIMGU_mgv1a010239mg                400   9e-133   
ref|XP_007221833.1|  hypothetical protein PRUPE_ppa020197mg             399   2e-132   
pdb|2CJP|A  Chain A, Structure Of Potato (Solanum Tuberosum) Epox...    399   3e-132   
emb|CDO98838.1|  unnamed protein product                                398   5e-132   
pdb|3CXU|A  Chain A, Structure Of A Y149f Mutant Of Epoxide Hydro...    398   9e-132   
ref|XP_010105137.1|  Epoxide hydrolase 2                                397   2e-131   
emb|CDP10752.1|  unnamed protein product                                397   2e-131   
ref|XP_004239806.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    396   3e-131   
ref|XP_009350800.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    395   2e-130   
ref|XP_004229258.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    394   2e-130   
ref|NP_001275381.1|  epoxide hydrolase                                  393   7e-130   
ref|XP_004239808.1|  PREDICTED: bifunctional epoxide hydrolase 2        393   9e-130   
ref|XP_010024724.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    392   1e-129   
gb|KDP27825.1|  hypothetical protein JCGZ_18905                         391   3e-129   
ref|XP_010024723.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    391   4e-129   
gb|KHG21329.1|  Epoxide hydrolase 2                                     392   1e-128   
ref|XP_003554527.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    390   1e-128   
ref|XP_002516953.1|  epoxide hydrolase, putative                        390   1e-128   Ricinus communis
emb|CAJ19276.1|  putative epoxide hydrolase                             388   7e-128   Solanum commersonii
ref|XP_004239805.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    387   2e-127   
ref|XP_010911257.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    387   2e-127   
ref|XP_009598630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    386   4e-127   
ref|XP_009771842.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    385   6e-127   
ref|XP_007163124.1|  hypothetical protein PHAVU_001G208300g             385   8e-127   
ref|XP_006355815.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    385   8e-127   
ref|XP_008341331.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    385   1e-126   
gb|EYU46741.1|  hypothetical protein MIMGU_mgv1a009984mg                384   2e-126   
ref|XP_009775927.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    384   2e-126   
ref|XP_008340789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    384   2e-126   
ref|XP_009136735.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    385   5e-126   
ref|XP_008784772.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    383   7e-126   
ref|XP_004240550.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   8e-126   
ref|XP_008784771.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    383   1e-125   
ref|XP_010921626.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   1e-125   
emb|CDX90550.1|  BnaA03g42310D                                          382   1e-125   
ref|XP_002271210.1|  PREDICTED: bifunctional epoxide hydrolase 2        381   2e-125   Vitis vinifera
ref|XP_008371325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    381   3e-125   
ref|XP_004494384.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    380   5e-125   
ref|XP_008784770.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   7e-125   
ref|XP_009620847.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    380   9e-125   
ref|XP_010434902.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    382   1e-124   
ref|XP_008361962.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    379   2e-124   
ref|XP_010269590.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    379   3e-124   
ref|XP_009411662.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    378   5e-124   
gb|KFK41013.1|  hypothetical protein AALP_AA2G073900                    376   4e-123   
ref|XP_003632381.1|  PREDICTED: bifunctional epoxide hydrolase 2        375   4e-123   
ref|XP_010105136.1|  Epoxide hydrolase 2                                375   2e-122   
ref|XP_008355493.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    372   7e-122   
gb|AAA81893.1|  epoxide hydrolase                                       369   6e-121   Solanum tuberosum [potatoes]
ref|XP_008789846.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    370   8e-121   
ref|XP_011006451.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    369   2e-120   
ref|XP_008784769.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    369   2e-120   
emb|CDP17111.1|  unnamed protein product                                368   4e-120   
ref|NP_567228.1|  putative epoxide hydrolase                            367   7e-120   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69728.1|  epoxide hydrolase                                       367   8e-120   
ref|XP_008775993.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    366   1e-119   
ref|XP_010914485.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    367   1e-119   
ref|XP_007015353.1|  Alpha/beta-Hydrolases superfamily protein          366   2e-119   
ref|XP_010038230.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    366   3e-119   
ref|XP_004298141.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    366   3e-119   
ref|XP_009335707.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    365   4e-119   
gb|KDP27828.1|  hypothetical protein JCGZ_18908                         365   4e-119   
ref|XP_002270853.1|  PREDICTED: bifunctional epoxide hydrolase 2        365   5e-119   Vitis vinifera
ref|XP_011079631.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    364   1e-118   
gb|KEH24395.1|  epoxide hydrolase                                       363   2e-118   
ref|XP_009775353.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    363   3e-118   
ref|XP_006288215.1|  hypothetical protein CARUB_v10001452mg             363   4e-118   
ref|XP_009629123.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    363   4e-118   
ref|NP_001055069.1|  Os05g0273800                                       362   9e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010038235.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    361   2e-117   
ref|XP_011041992.1|  PREDICTED: bifunctional epoxide hydrolase 2        361   2e-117   
ref|XP_009386486.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    360   2e-117   
ref|XP_004230258.1|  PREDICTED: bifunctional epoxide hydrolase 2        359   6e-117   
ref|XP_010039296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    359   1e-116   
ref|XP_009391487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    358   1e-116   
gb|KHG07158.1|  Epoxide hydrolase 2                                     358   2e-116   
ref|XP_006283220.1|  hypothetical protein CARUB_v10004250mg             372   2e-116   
ref|XP_002320333.2|  epoxide hydrolase family protein                   358   2e-116   Populus trichocarpa [western balsam poplar]
ref|XP_009111296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    358   3e-116   
ref|XP_007015342.1|  Alpha/beta-Hydrolases superfamily protein          358   3e-116   
gb|KDP27824.1|  hypothetical protein JCGZ_18904                         358   4e-116   
gb|KDP28184.1|  hypothetical protein JCGZ_13955                         357   5e-116   
emb|CDY65636.1|  BnaAnng20810D                                          357   6e-116   
ref|XP_006414412.1|  hypothetical protein EUTSA_v10025488mg             359   7e-116   
ref|XP_009629075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    357   9e-116   
ref|XP_010043042.1|  PREDICTED: bifunctional epoxide hydrolase 2        357   9e-116   
ref|XP_009414133.1|  PREDICTED: bifunctional epoxide hydrolase 2        358   1e-115   
ref|XP_008386679.1|  PREDICTED: bifunctional epoxide hydrolase 2        356   2e-115   
emb|CDY50394.1|  BnaCnng19260D                                          356   2e-115   
ref|XP_008775992.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    355   2e-115   
ref|XP_010649574.1|  PREDICTED: bifunctional epoxide hydrolase 2        355   3e-115   
emb|CDP17110.1|  unnamed protein product                                355   6e-115   
ref|XP_006344695.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    354   9e-115   
ref|XP_004290809.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    354   1e-114   
gb|EYU46742.1|  hypothetical protein MIMGU_mgv1a010264mg                354   1e-114   
gb|ACE82566.1|  epoxide hydrolase                                       353   2e-114   Nicotiana benthamiana
ref|XP_002874922.1|  hypothetical protein ARALYDRAFT_490337             353   2e-114   
ref|XP_006444386.1|  hypothetical protein CICLE_v10023691mg             353   2e-114   
ref|XP_010693593.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    355   2e-114   
gb|EMT04118.1|  hypothetical protein F775_13984                         353   3e-114   
gb|KEH32298.1|  epoxide hydrolase                                       354   3e-114   
ref|XP_010038234.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    353   3e-114   
ref|XP_006444387.1|  hypothetical protein CICLE_v10021228mg             352   3e-114   
ref|XP_009788536.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    352   4e-114   
ref|XP_006480000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    352   8e-114   
ref|XP_010088294.1|  Epoxide hydrolase 2                                351   1e-113   
emb|CDP17206.1|  unnamed protein product                                350   2e-113   
ref|XP_008235117.1|  PREDICTED: bifunctional epoxide hydrolase 2        350   3e-113   
ref|XP_010429523.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    350   3e-113   
gb|ACE82565.1|  epoxide hydrolase                                       350   3e-113   Nicotiana benthamiana
ref|XP_006396441.1|  hypothetical protein EUTSA_v10028814mg             350   4e-113   
ref|XP_006414587.1|  hypothetical protein EUTSA_v10025505mg             352   4e-113   
ref|XP_010914488.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    349   9e-113   
ref|XP_010094462.1|  Epoxide hydrolase 2                                349   9e-113   
ref|XP_009393200.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    348   1e-112   
ref|XP_010556730.1|  PREDICTED: bifunctional epoxide hydrolase 2        348   1e-112   
ref|XP_004965308.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    350   1e-112   
ref|XP_010422608.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    349   1e-112   
ref|XP_004152242.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    348   1e-112   
emb|CDY05187.1|  BnaC05g46160D                                          349   2e-112   
ref|XP_010104146.1|  Epoxide hydrolase 2                                348   2e-112   
ref|XP_002283462.1|  PREDICTED: bifunctional epoxide hydrolase 2        348   2e-112   Vitis vinifera
ref|XP_006419517.1|  hypothetical protein CICLE_v10005451mg             347   3e-112   
gb|KCW50060.1|  hypothetical protein EUGRSUZ_K03501                     348   3e-112   
ref|XP_006414415.1|  hypothetical protein EUTSA_v10025689mg             348   4e-112   
ref|XP_011092097.1|  PREDICTED: bifunctional epoxide hydrolase 2        347   4e-112   
ref|XP_002523108.1|  epoxide hydrolase, putative                        347   6e-112   Ricinus communis
ref|XP_010039619.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    347   6e-112   
ref|XP_010039627.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    347   7e-112   
ref|XP_002884518.1|  hypothetical protein ARALYDRAFT_317420             347   9e-112   
ref|XP_008454322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    346   1e-111   
gb|KGN66047.1|  hypothetical protein Csa_1G569240                       346   1e-111   
emb|CDX90553.1|  BnaA03g42280D                                          346   1e-111   
ref|XP_002443185.1|  hypothetical protein SORBIDRAFT_08g014640          348   2e-111   Sorghum bicolor [broomcorn]
ref|XP_010088295.1|  Epoxide hydrolase 2                                345   2e-111   
ref|XP_011023717.1|  PREDICTED: bifunctional epoxide hydrolase 2        345   3e-111   
ref|XP_009136732.1|  PREDICTED: bifunctional epoxide hydrolase 2        345   3e-111   
ref|XP_006419522.1|  hypothetical protein CICLE_v10005425mg             345   4e-111   
ref|XP_010456047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    345   4e-111   
ref|XP_009111297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    345   4e-111   
ref|XP_006489041.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    345   4e-111   
ref|XP_009393199.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    345   5e-111   
emb|CDY65635.1|  BnaAnng20800D                                          344   8e-111   
ref|XP_009147218.1|  PREDICTED: bifunctional epoxide hydrolase 2        344   9e-111   
dbj|BAK07144.1|  predicted protein                                      345   1e-110   
ref|XP_003563920.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    345   1e-110   
emb|CDY09727.1|  BnaC07g33340D                                          343   2e-110   
ref|XP_007050977.1|  Alpha/beta-Hydrolases superfamily protein          343   2e-110   
ref|XP_004152245.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    342   3e-110   
ref|XP_010038231.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    342   4e-110   
ref|NP_001148885.1|  epoxide hydrolase 2                                342   5e-110   Zea mays [maize]
gb|KFK41012.1|  hypothetical protein AALP_AA2G073800                    342   6e-110   
tpg|DAA53983.1|  TPA: epoxide hydrolase 2                               342   1e-109   
ref|XP_008807392.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    341   1e-109   
ref|XP_010449872.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    343   1e-109   
ref|NP_187211.1|  alpha/beta-Hydrolases superfamily protein             342   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006378063.1|  hypothetical protein POPTR_0010s01420g             340   1e-109   
ref|XP_008454325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    341   2e-109   
emb|CDY27752.1|  BnaA05g31610D                                          341   2e-109   
gb|ACU19478.1|  unknown                                                 340   2e-109   Glycine max [soybeans]
ref|XP_006604802.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    340   3e-109   
ref|XP_006433457.1|  hypothetical protein CICLE_v10001881mg             340   3e-109   
ref|XP_002318980.2|  epoxide hydrolase family protein                   340   3e-109   Populus trichocarpa [western balsam poplar]
ref|XP_006414584.1|  hypothetical protein EUTSA_v10025778mg             340   3e-109   
ref|XP_003554633.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    340   4e-109   
ref|XP_010449873.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    340   4e-109   
ref|NP_001240943.1|  uncharacterized protein LOC100803974               339   5e-109   
gb|EMT09897.1|  hypothetical protein F775_52362                         340   8e-109   
ref|XP_010914487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    338   9e-109   
ref|XP_002455386.1|  hypothetical protein SORBIDRAFT_03g009830          339   9e-109   Sorghum bicolor [broomcorn]
gb|KHG24497.1|  Epoxide hydrolase 2                                     338   1e-108   
ref|XP_007147002.1|  hypothetical protein PHAVU_006G088500g             338   1e-108   
gb|KEH24510.1|  epoxide hydrolase                                       338   2e-108   
gb|KFK37968.1|  hypothetical protein AALP_AA3G053200                    338   2e-108   
gb|AAO27849.1|AF482450_1  soluble epoxide hydrolase                     338   2e-108   Euphorbia lagascae
gb|KFK30821.1|  hypothetical protein AALP_AA6G030400                    338   2e-108   
ref|XP_004967831.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    338   2e-108   
ref|XP_004247402.1|  PREDICTED: bifunctional epoxide hydrolase 2        338   2e-108   
ref|XP_010486015.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    338   2e-108   
gb|EMT14639.1|  hypothetical protein F775_19531                         339   3e-108   
ref|XP_006359858.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    337   3e-108   
gb|KDP28185.1|  hypothetical protein JCGZ_13956                         337   3e-108   
ref|XP_007147004.1|  hypothetical protein PHAVU_006G088600g             337   3e-108   
ref|XP_011079630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    336   8e-108   
ref|XP_004981166.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    337   9e-108   
ref|XP_010464087.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    337   9e-108   
gb|AFZ93648.1|  epoxide hydrolase                                       336   1e-107   
ref|XP_002523107.1|  epoxide hydrolase, putative                        336   1e-107   Ricinus communis
ref|XP_007147001.1|  hypothetical protein PHAVU_006G088400g             336   1e-107   
ref|XP_010693594.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    337   1e-107   
ref|XP_002463580.1|  hypothetical protein SORBIDRAFT_01g002410          335   2e-107   Sorghum bicolor [broomcorn]
ref|XP_010440228.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    335   2e-107   
ref|XP_010524544.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    337   3e-107   
ref|XP_002302724.1|  epoxide hydrolase family protein                   335   3e-107   Populus trichocarpa [western balsam poplar]
gb|ADP68585.1|  epoxide hydrolase A                                     334   4e-107   
gb|KDP28186.1|  hypothetical protein JCGZ_13957                         334   7e-107   
gb|KHN43314.1|  Epoxide hydrolase 2                                     333   9e-107   
ref|XP_003566463.1|  PREDICTED: bifunctional epoxide hydrolase 2        333   9e-107   
ref|XP_006299381.1|  hypothetical protein CARUB_v10015540mg             334   9e-107   
gb|EPS62395.1|  hypothetical protein M569_12392                         332   3e-106   
ref|XP_010684348.1|  PREDICTED: bifunctional epoxide hydrolase 2        332   3e-106   
ref|XP_008454330.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    332   6e-106   
emb|CAA55294.1|  epoxide hydrolase                                      332   6e-106   Glycine max [soybeans]
ref|XP_010548981.1|  PREDICTED: bifunctional epoxide hydrolase 2        332   7e-106   
ref|NP_001238563.1|  epoxide hydrolase                                  332   7e-106   
ref|XP_002868171.1|  hypothetical protein ARALYDRAFT_329917             338   8e-106   
ref|XP_010434903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    332   9e-106   
ref|XP_002306333.2|  hypothetical protein POPTR_0005s08280g             332   9e-106   Populus trichocarpa [western balsam poplar]
gb|AES82458.2|  epoxide hydrolase                                       331   1e-105   
ref|XP_006472971.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    339   1e-105   
gb|EYU42194.1|  hypothetical protein MIMGU_mgv1a010473mg                330   1e-105   
gb|KHG22415.1|  Epoxide hydrolase 2                                     330   1e-105   
ref|XP_011015179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    330   1e-105   
ref|XP_002512456.1|  epoxide hydrolase, putative                        330   2e-105   Ricinus communis
ref|XP_007031041.1|  Alpha/beta-Hydrolases superfamily protein          330   2e-105   
gb|AAM28292.1|  epoxide hydrolase                                       330   3e-105   Ananas comosus
ref|XP_007200440.1|  hypothetical protein PRUPE_ppa008875mg             329   5e-105   
ref|XP_010039280.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    329   5e-105   
gb|KHG16220.1|  Epoxide hydrolase 2                                     328   1e-104   
ref|XP_011039566.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    329   1e-104   
gb|ACU19450.1|  unknown                                                 328   1e-104   Glycine max [soybeans]
ref|XP_008450607.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    328   2e-104   
ref|XP_010544298.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    328   2e-104   
gb|AFK41660.1|  unknown                                                 327   2e-104   
gb|KEH24503.1|  epoxide hydrolase                                       327   2e-104   
gb|ACJ85188.1|  unknown                                                 327   3e-104   Medicago truncatula
gb|EPS67066.1|  pectinesterase                                          345   3e-104   
ref|NP_001150215.1|  epoxide hydrolase 2                                327   4e-104   Zea mays [maize]
ref|XP_003626244.1|  Epoxide hydrolase                                  327   4e-104   
ref|XP_004152244.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    327   4e-104   
ref|XP_003626241.1|  Epoxide hydrolase                                  327   5e-104   
gb|ACF83934.1|  unknown                                                 327   5e-104   Zea mays [maize]
ref|XP_011021885.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    327   6e-104   
ref|XP_004494576.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    326   7e-104   
gb|AFK45529.1|  unknown                                                 326   8e-104   
gb|KHN20253.1|  Epoxide hydrolase 2                                     326   1e-103   
ref|XP_007147005.1|  hypothetical protein PHAVU_006G088700g             325   1e-103   
ref|XP_004508197.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    326   2e-103   
ref|XP_006299523.1|  hypothetical protein CARUB_v10015695mg             325   2e-103   
ref|NP_193331.6|  alpha/beta-Hydrolases superfamily protein             327   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004156834.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    325   2e-103   
gb|EYU42746.1|  hypothetical protein MIMGU_mgv1a010198mg                325   2e-103   
ref|XP_004494577.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    326   3e-103   
ref|XP_002314368.1|  hypothetical protein POPTR_0010s01430g             325   3e-103   Populus trichocarpa [western balsam poplar]
ref|NP_001051780.1|  Os03g0829100                                       325   3e-103   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99775.1|  predicted protein                                      325   3e-103   
gb|AES82420.2|  epoxide hydrolase                                       324   4e-103   
ref|XP_002314371.1|  hypothetical protein POPTR_0010s01440g             324   4e-103   
gb|AFK39155.1|  unknown                                                 324   5e-103   
ref|XP_003556522.1|  PREDICTED: bifunctional epoxide hydrolase 2 ...    324   5e-103   
ref|XP_010674075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    324   5e-103   
gb|EAZ11286.1|  hypothetical protein OsJ_01142                          325   9e-103   
ref|XP_003626243.1|  Epoxide hydrolase                                  323   1e-102   
ref|XP_010102979.1|  Epoxide hydrolase 2                                323   1e-102   
gb|KHN03961.1|  Epoxide hydrolase 2                                     323   1e-102   
ref|XP_006397371.1|  hypothetical protein EUTSA_v10022504mg             323   2e-102   
ref|XP_010038233.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    323   2e-102   
ref|XP_010546737.1|  PREDICTED: bifunctional epoxide hydrolase 2        322   2e-102   
ref|XP_003554635.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    322   4e-102   
ref|NP_001276233.1|  bifunctional epoxide hydrolase 2-like              321   7e-102   
ref|NP_001132040.1|  uncharacterized protein LOC100193450               323   7e-102   
ref|XP_010440227.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    322   7e-102   
gb|ACJ84799.1|  unknown                                                 321   7e-102   
gb|ACU23321.1|  unknown                                                 321   7e-102   
ref|XP_004152361.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    320   1e-101   
gb|AFW56302.1|  hypothetical protein ZEAMMB73_530848                    323   1e-101   
emb|CBI39538.3|  unnamed protein product                                319   2e-101   
ref|XP_008246047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    318   2e-101   
ref|XP_010649601.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    320   3e-101   
ref|XP_004494951.1|  PREDICTED: uncharacterized protein LOC101500941    330   4e-101   
ref|XP_007144960.1|  hypothetical protein PHAVU_007G198000g             319   4e-101   
ref|XP_008438903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    320   5e-101   
ref|XP_003626240.1|  Epoxide hydrolase                                  332   6e-101   
gb|AFK34299.1|  unknown                                                 318   6e-101   
gb|AFK46740.1|  unknown                                                 318   1e-100   
ref|XP_003626245.1|  Epoxide hydrolase                                  318   1e-100   
ref|XP_002880830.1|  predicted protein                                  318   2e-100   
gb|EPS69185.1|  hypothetical protein M569_05583                         317   3e-100   
gb|KDP23458.1|  hypothetical protein JCGZ_23291                         317   3e-100   
gb|ACJ84958.1|  unknown                                                 317   4e-100   
dbj|BAK06387.1|  predicted protein                                      317   4e-100   
gb|KHN02949.1|  Epoxide hydrolase 2                                     313   8e-100   
ref|XP_003626202.1|  Epoxide hydrolase                                  327   1e-99    
emb|CDM82646.1|  unnamed protein product                                315   2e-99    
gb|AFK39700.1|  unknown                                                 314   4e-99    
ref|NP_180242.1|  soluble epoxide hydrolase                             313   6e-99    
emb|CDY09722.1|  BnaC07g33390D                                          313   8e-99    
ref|XP_006650836.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    313   1e-98    
ref|XP_010229424.1|  PREDICTED: uncharacterized protein LOC100841009    326   1e-98    
ref|XP_004134492.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    313   1e-98    
ref|XP_006296031.1|  hypothetical protein CARUB_v10025176mg             312   2e-98    
ref|XP_010417820.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    312   2e-98    
gb|AES82460.2|  epoxide hydrolase                                       320   5e-98    
ref|XP_003626242.1|  Epoxide hydrolase                                  320   6e-98    
gb|KFK32480.1|  hypothetical protein AALP_AA6G247900                    310   8e-98    
ref|NP_180243.1|  alpha/beta-hydrolases superfamily protein             310   1e-97    
ref|NP_001042622.1|  Os01g0255100                                       308   8e-97    
ref|XP_010473058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    307   2e-96    
gb|ABR16314.1|  unknown                                                 305   7e-96    
gb|EAY92419.1|  hypothetical protein OsI_14153                          306   9e-96    
ref|XP_010544295.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    304   3e-95    
ref|XP_008454327.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    303   6e-95    
ref|XP_003604118.1|  Epoxide hydrolase                                  302   1e-94    
gb|ABK21215.1|  unknown                                                 301   4e-94    
ref|XP_008223225.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    297   3e-93    
ref|XP_011010961.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    298   5e-93    
emb|CAB46034.1|  putative epoxide hydrolase                             305   8e-93    
ref|XP_011010960.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    297   9e-93    
gb|KHG02721.1|  Epoxide hydrolase 2                                     291   6e-91    
ref|XP_010429482.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    293   8e-91    
ref|XP_009598691.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    290   1e-90    
ref|XP_002459617.1|  hypothetical protein SORBIDRAFT_02g007580          291   2e-90    
gb|KHG02720.1|  Epoxide hydrolase 2                                     305   2e-90    
ref|XP_004981168.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    291   4e-90    
emb|CDJ26688.1|  unnamed protein product                                291   5e-90    
gb|KDO87161.1|  hypothetical protein CISIN_1g048209mg                   290   1e-89    
gb|ACN28644.1|  unknown                                                 288   2e-89    
ref|XP_010557474.1|  PREDICTED: bifunctional epoxide hydrolase 2        288   2e-89    
dbj|BAJ90007.1|  predicted protein                                      288   4e-89    
ref|XP_006838631.1|  hypothetical protein AMTR_s00002p00235860          286   2e-88    
ref|XP_006654297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    283   3e-88    
dbj|BAJ91671.1|  predicted protein                                      286   3e-88    
dbj|BAJ89155.1|  predicted protein                                      285   1e-87    
ref|XP_008680999.1|  PREDICTED: uncharacterized protein LOC100191...    284   2e-87    
ref|XP_002979677.1|  hypothetical protein SELMODRAFT_111571             283   5e-87    
gb|ACG46051.1|  epoxide hydrolase 2                                     283   5e-87    
ref|XP_002967234.1|  hypothetical protein SELMODRAFT_87385              282   8e-87    
ref|XP_002960490.1|  hypothetical protein SELMODRAFT_266570             281   3e-86    
ref|NP_001151201.1|  epoxide hydrolase 2                                281   3e-86    
emb|CDJ26419.1|  unnamed protein product                                280   5e-86    
ref|XP_006838629.1|  hypothetical protein AMTR_s00002p00235200          280   5e-86    
ref|XP_006419521.1|  hypothetical protein CICLE_v10005425mg             276   8e-86    
ref|XP_004981167.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    279   1e-85    
ref|XP_006650837.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    279   2e-85    
gb|EMT01002.1|  hypothetical protein F775_32452                         278   5e-85    
ref|XP_008644360.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    278   7e-85    
ref|XP_002985384.1|  hypothetical protein SELMODRAFT_181715             276   1e-84    
gb|KDO38861.1|  hypothetical protein CISIN_1g026419mg                   272   5e-84    
ref|XP_002275186.1|  PREDICTED: bifunctional epoxide hydrolase 2        275   5e-84    
ref|XP_008775994.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    271   1e-83    
ref|XP_002310826.2|  epoxide hydrolase family protein                   273   3e-83    
ref|XP_006408053.1|  hypothetical protein EUTSA_v100212090mg            271   3e-83    
emb|CAN77654.1|  hypothetical protein VITISV_032325                     273   3e-83    
gb|EAY92418.1|  hypothetical protein OsI_14152                          272   9e-83    
ref|XP_003577254.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    271   1e-82    
gb|KDP37443.1|  hypothetical protein JCGZ_08284                         271   1e-82    
ref|XP_004152243.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    270   3e-82    
ref|XP_010100621.1|  Epoxide hydrolase 2                                268   3e-82    
ref|XP_009140747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    270   5e-82    
ref|XP_010042740.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   7e-82    
ref|XP_011025873.1|  PREDICTED: bifunctional epoxide hydrolase 2        269   1e-81    
gb|KCW50054.1|  hypothetical protein EUGRSUZ_K03494                     266   1e-81    
gb|KDO87174.1|  hypothetical protein CISIN_1g021158mg                   266   1e-81    
emb|CDY48181.1|  BnaA04g15450D                                          268   1e-81    
ref|XP_010107837.1|  Epoxide hydrolase 2                                268   2e-81    
emb|CAD30841.1|  soluble epoxide hydrolase                              266   1e-80    
emb|CDY57860.1|  BnaC08g47760D                                          266   1e-80    
gb|KEH24396.1|  epoxide hydrolase                                       261   7e-80    
ref|XP_010275537.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    264   7e-80    
dbj|BAK08144.1|  predicted protein                                      264   7e-80    
ref|XP_008338037.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    264   9e-80    
gb|AFK36273.1|  unknown                                                 263   2e-79    
ref|XP_006489255.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    260   3e-79    
dbj|BAJ98388.1|  predicted protein                                      262   4e-79    
ref|XP_010275536.1|  PREDICTED: bifunctional epoxide hydrolase 2        262   5e-79    
gb|AFK43935.1|  unknown                                                 261   1e-78    
ref|XP_006479996.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   2e-78    
ref|NP_001051781.1|  Os03g0829200                                       261   2e-78    
gb|KCW84773.1|  hypothetical protein EUGRSUZ_B015792                    257   2e-78    
emb|CAD31713.1|  epoxide hydrolase                                      257   6e-78    
ref|XP_002521508.1|  epoxide hydrolase, putative                        259   7e-78    
gb|KCW50160.1|  hypothetical protein EUGRSUZ_K03595                     256   8e-78    
ref|XP_009346065.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   1e-77    
ref|XP_010321810.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    254   1e-77    
ref|XP_009346066.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   1e-77    
ref|XP_008354646.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   2e-77    
ref|XP_007156093.1|  hypothetical protein PHAVU_003G257900g             258   2e-77    
ref|XP_011100955.1|  PREDICTED: bifunctional epoxide hydrolase 2        258   2e-77    
ref|XP_010028623.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   2e-77    
gb|AGV54241.1|  epoxide hydrolase 2-like protein                        257   6e-77    
gb|EAY73347.1|  hypothetical protein OsI_01224                          257   6e-77    
ref|XP_001753609.1|  predicted protein                                  256   8e-77    
gb|AFK43554.1|  unknown                                                 256   8e-77    
ref|XP_002451255.1|  hypothetical protein SORBIDRAFT_05g026560          256   1e-76    
ref|XP_008354647.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    256   1e-76    
ref|XP_003557340.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    255   2e-76    
ref|XP_008337725.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    255   3e-76    
ref|XP_011015180.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    251   6e-76    
ref|XP_002880829.1|  predicted protein                                  253   8e-76    
ref|XP_003520282.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    254   9e-76    
gb|AFK46496.1|  unknown                                                 253   1e-75    
ref|XP_007046807.1|  Alpha/beta-Hydrolases superfamily protein is...    253   2e-75    
gb|KEH20402.1|  epoxide hydrolase                                       252   2e-75    
emb|CDP01962.1|  unnamed protein product                                250   2e-74    
ref|XP_010921625.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    246   2e-74    
ref|XP_004509321.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    249   3e-74    
ref|XP_007147003.1|  hypothetical protein PHAVU_006G088600g             246   4e-74    
ref|XP_004963322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    249   5e-74    
ref|XP_010649095.1|  PREDICTED: bifunctional epoxide hydrolase 2        248   6e-74    
ref|XP_010033445.1|  PREDICTED: bifunctional epoxide hydrolase 2        249   6e-74    
ref|XP_006433456.1|  hypothetical protein CICLE_v10001881mg             246   7e-74    
ref|XP_010679802.1|  PREDICTED: bifunctional epoxide hydrolase 2        248   1e-73    
ref|XP_004287856.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    248   2e-73    
ref|NP_001147768.1|  LOC100281378                                       247   4e-73    
ref|XP_002443655.1|  hypothetical protein SORBIDRAFT_08g022970          246   5e-73    
emb|CBI22970.3|  unnamed protein product                                242   6e-73    
ref|WP_033667766.1|  epoxide hydrolase                                  245   9e-73    
ref|WP_033665135.1|  epoxide hydrolase                                  245   1e-72    
ref|XP_006444395.1|  hypothetical protein CICLE_v10024303mg             243   2e-72    
ref|XP_003579088.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    244   3e-72    
ref|NP_001240134.1|  uncharacterized protein LOC100809053               243   1e-71    
ref|XP_006296069.1|  hypothetical protein CARUB_v10025219mg             241   1e-71    
gb|KHN27037.1|  Epoxide hydrolase 2                                     242   2e-71    
gb|KEH24504.1|  epoxide hydrolase                                       239   2e-71    
ref|XP_008454323.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    239   5e-71    
ref|XP_010254688.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    240   7e-71    
ref|XP_010254690.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    241   9e-71    
ref|WP_027528024.1|  epoxide hydrolase                                  240   1e-70    
ref|XP_009350799.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    234   1e-70    
ref|NP_190669.1|  alpha/beta-Hydrolases superfamily protein             240   1e-70    
ref|XP_010426641.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    240   1e-70    
ref|XP_004963323.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    239   2e-70    
ref|XP_008662613.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    239   2e-70    
gb|KHG08034.1|  Epoxide hydrolase 2                                     239   2e-70    
gb|KHN00509.1|  Epoxide hydrolase 2                                     238   4e-70    
ref|WP_026400729.1|  epoxide hydrolase                                  237   1e-69    
ref|NP_001067364.1|  Os12g0636400                                       237   1e-69    
ref|XP_010515481.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    237   1e-69    
ref|WP_035692775.1|  epoxide hydrolase                                  236   3e-69    
gb|KEH24512.1|  epoxide hydrolase                                       233   3e-69    
ref|XP_010547454.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    236   4e-69    
ref|XP_006664242.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    236   4e-69    
ref|WP_018656912.1|  hypothetical protein                               236   4e-69    
ref|NP_001152729.1|  LOC100286370                                       236   4e-69    
ref|XP_002877783.1|  hypothetical protein ARALYDRAFT_485452             235   9e-69    
ref|XP_006487348.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    235   1e-68    
ref|XP_006403966.1|  hypothetical protein EUTSA_v10010546mg             235   1e-68    
ref|XP_004287855.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    235   1e-68    
ref|XP_006419519.1|  hypothetical protein CICLE_v10006037mg             229   1e-68    
gb|KDO38863.1|  hypothetical protein CISIN_1g044507mg                   229   1e-68    
ref|XP_006291410.1|  hypothetical protein CARUB_v10017549mg             235   2e-68    
gb|KDO49467.1|  hypothetical protein CISIN_1g020621mg                   234   2e-68    
ref|XP_006423389.1|  hypothetical protein CICLE_v10028838mg             234   3e-68    
gb|EMS45147.1|  Epoxide hydrolase 2                                     229   4e-68    
ref|XP_009136579.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    233   6e-68    
ref|XP_010503777.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    233   6e-68    
ref|XP_006419516.1|  hypothetical protein CICLE_v10006950mg             229   1e-67    
ref|XP_006838632.1|  hypothetical protein AMTR_s00002p00236030          232   1e-67    
ref|WP_030747352.1|  epoxide hydrolase                                  232   1e-67    
pir||D71425  probable ATsEH - Arabidopsis thaliana                      227   2e-67 
ref|XP_008353224.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    226   2e-67    
ref|WP_012852003.1|  epoxide hydrolase                                  231   2e-67    
ref|XP_008340934.1|  PREDICTED: bifunctional epoxide hydrolase 2        226   5e-67    
dbj|BAK01028.1|  predicted protein                                      230   6e-67    
ref|XP_007202253.1|  hypothetical protein PRUPE_ppa008854mg             230   8e-67    
ref|XP_008241748.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    229   1e-66    
ref|WP_038677555.1|  epoxide hydrolase                                  229   3e-66    
emb|CAN65686.1|  hypothetical protein VITISV_022460                     223   3e-66    
ref|WP_018641625.1|  epoxide hydrolase                                  227   2e-65    
ref|WP_008968056.1|  epoxide hydrolase                                  226   2e-65    
ref|NP_001078398.1|  alpha/beta-Hydrolases superfamily protein          221   2e-65    
emb|CDY26530.1|  BnaC01g23690D                                          226   2e-65    
emb|CDY33304.1|  BnaA01g19710D                                          226   3e-65    
gb|ETX06952.1|  epoxide hydrolase                                       226   3e-65    
ref|NP_849393.1|  alpha/beta-Hydrolases superfamily protein             220   4e-65    
ref|NP_001154238.1|  alpha/beta-Hydrolases superfamily protein          224   7e-65    
gb|KDO38860.1|  hypothetical protein CISIN_1g043205mg                   221   8e-65    



>ref|XP_006600362.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Glycine 
max]
 ref|XP_006600363.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Glycine 
max]
Length=354

 Score =   454 bits (1169),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 237/379 (63%), Positives = 284/379 (75%), Gaps = 30/379 (8%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +++VNGI+MH+A+ G+GP++LF+HGFP+ WY+WRHQ+  LAS GYR VAPDLR
Sbjct  1     MEGIEHQTLNVNGINMHIAEKGEGPLILFIHGFPDLWYSWRHQITALASLGYRCVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P + P+ +TSLHVVGDLV LL  +  DEEKVFVVGHDWGAM AW+L LYRP+
Sbjct  61    GYGDTD-VPAN-PTAYTSLHVVGDLVGLLDAIVGDEEKVFVVGHDWGAMTAWSLSLYRPE  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +++ALVN+SV FTPRNPK KPL+TLRAVYG+DYYICRFQ +          H + R  E 
Sbjct  119   RIRALVNLSVVFTPRNPKRKPLDTLRAVYGNDYYICRFQVSK---------HGLSRSDEK  169

Query  762   ACSASSCCQCRFDIW--HWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                 S     R   W   WL C    +        QE GEIE EFA +GT +VL+ FLTY
Sbjct  170   KMLFS-----RGKPWFAKWLCCSSALL--------QEPGEIEAEFAQIGTARVLKEFLTY  216

Query  936   YNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
              NP PLYLPK GK F   TD    LPSWLS+ + DYY SK++KTGFTGG+NYYR LDL+W
Sbjct  217   RNPGPLYLPK-GKAFAHPTDSPIALPSWLSEEECDYYASKYDKTGFTGGLNYYRNLDLNW  275

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+A+WTGA+V VPVKFIVGDLD+TYNAPGAKEYIHKGG KRDVPLLE+VVVLEG GHF+
Sbjct  276   ELTASWTGAQVKVPVKFIVGDLDLTYNAPGAKEYIHKGGFKRDVPLLEDVVVLEGAGHFL  335

Query  1287  HEEKPHEINTHILNFLHNF  1343
             H+E+P EI+ HI +F   F
Sbjct  336   HQERPDEISNHIYDFFKKF  354



>ref|XP_009622776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=323

 Score =   438 bits (1126),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 225/372 (60%), Positives = 265/372 (71%), Gaps = 56/372 (15%)
 Frame = +3

Query  234   EHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYGD  413
             EH  V VNGI+MHV + GQGPV+LF+HGFPE WY+WRHQ+ F+A  GYRAVAPDLRG+GD
Sbjct  6     EHKIVPVNGINMHVVEAGQGPVILFIHGFPELWYSWRHQISFVAKHGYRAVAPDLRGFGD  65

Query  414   TTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVKA  593
             TTG    DPSKFTSL VVGDLV LL+ +A  EEKVFVVGHDWGA++AWALCL+RPDKVKA
Sbjct  66    TTGVLKHDPSKFTSLQVVGDLVELLNTIAPKEEKVFVVGHDWGAIIAWALCLFRPDKVKA  125

Query  594   LVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACSA  773
             LVN+SV F+PRNPK KPLETLRAVYG+DYY+ RFQ+     +I  +   IG +       
Sbjct  126   LVNLSVAFSPRNPKRKPLETLRAVYGEDYYVVRFQE---PGEIEAEFAKIGTK-------  175

Query  774   SSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSPL  953
                                                          KVL+ FL+Y NP PL
Sbjct  176   ---------------------------------------------KVLENFLSYRNPGPL  190

Query  954   YLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTGA  1133
             YLP K KLF+ S   LPSWL + +VDY  SK+EK GFTGG+NYYRA+DL+WEL+AAWTGA
Sbjct  191   YLP-KSKLFDDSPVILPSWLPEKEVDYVASKYEKAGFTGGVNYYRAIDLNWELTAAWTGA  249

Query  1134  KVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEIN  1313
             KV VPVKFIVGDLD+TYNAPG K+Y+HKGG+K+DVPLLEEVV+LE VGHF+ +EKP EIN
Sbjct  250   KVKVPVKFIVGDLDLTYNAPGVKDYVHKGGMKKDVPLLEEVVILENVGHFLQQEKPDEIN  309

Query  1314  THILNFLHNFSS  1349
              HI +F H FSS
Sbjct  310   KHIYDFFHGFSS  321



>emb|CDO98837.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   436 bits (1121),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/381 (59%), Positives = 271/381 (71%), Gaps = 59/381 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V VNGI+MHVA+ GQGPVVLFLHGFPECWYTWRHQM F+AS G+RAVAPDLR
Sbjct  1     MEKIEHKNVEVNGINMHVAEIGQGPVVLFLHGFPECWYTWRHQMSFMASHGHRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+G TTGAP DDPSKFT+LHVVGD++ LL +VA DE+KVF+VGHDWGA+MAWALCLYRPD
Sbjct  61    GFGGTTGAPIDDPSKFTTLHVVGDIIELLKIVAPDEDKVFLVGHDWGAVMAWALCLYRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKAL NMSV F PRNPK KP+ETLRAV G DYY+CRFQ+     +I ++   +G +   
Sbjct  121   KVKALFNMSVSFGPRNPKRKPIETLRAVCGPDYYVCRFQE---PGEIEEEFAKVGTK---  174

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                              +VL+ FL+Y  
Sbjct  175   -------------------------------------------------RVLENFLSYRA  185

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+LP KG LF  S D    LPSWLS+ DV YY +++ ++GFTG +NYYRALD++WEL
Sbjct  186   PGPLFLP-KGILFGDSPDAPTTLPSWLSEEDVAYYVNQYAQSGFTGALNYYRALDINWEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VPVKF+VGDLD+TYNAPG K+Y+HKGGLK+DVP L++VVV++ VGHF+HE
Sbjct  245   TAPWTGAQVKVPVKFVVGDLDLTYNAPGTKDYLHKGGLKKDVPFLDQVVVMKEVGHFLHE  304

Query  1293  EKPHEINTHILNFLHNFSS*I  1355
             EKP EIN +I  F+   SS I
Sbjct  305   EKPDEINKYIHQFIQKVSSPI  325



>ref|XP_006342825.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=334

 Score =   428 bits (1100),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 222/379 (59%), Positives = 268/379 (71%), Gaps = 59/379 (16%)
 Frame = +3

Query  222   MEG-IEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             MEG +EH +V+VNGI+MH  + G+GP+VLF+HGFPECWY+WRHQM F+A QGYRAVAPDL
Sbjct  1     MEGQVEHKTVAVNGINMHFVEIGEGPIVLFIHGFPECWYSWRHQMSFMAKQGYRAVAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDTTGAP DDPSKFT+L +VGDLV LL+ +A  EEKVFVVGHDWGA+++WALCLYRP
Sbjct  61    RGYGDTTGAPNDDPSKFTTLDIVGDLVELLNNIAPQEEKVFVVGHDWGAVVSWALCLYRP  120

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             DKVKA V +SV F PRNP  KPLETLR VYGDDYY+ RFQ+  V   I  +   +G    
Sbjct  121   DKVKAFVCLSVAFNPRNPVKKPLETLRKVYGDDYYVVRFQEPGV---IEGEFEELG----  173

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                    K +  +FL                          TY 
Sbjct  174   ----------------------IKNVVKKFL--------------------------TYR  185

Query  939   NPSPLYLPKKGKLFE--GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
              P PLYL KKGK FE   STD+LP WLS  D+D+Y +K+++ GFTG +NYYR++D +WE+
Sbjct  186   TPGPLYL-KKGKPFEDASSTDELPGWLSDEDIDFYANKYKQIGFTGALNYYRSIDRNWEV  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAWTGAK+ VPVKFIVGDLDITYNAPGAK+Y+HKGG K+ VPLLE+VVVL+GVGHFIH+
Sbjct  245   TAAWTGAKIQVPVKFIVGDLDITYNAPGAKDYLHKGGFKKLVPLLEDVVVLQGVGHFIHQ  304

Query  1293  EKPHEINTHILNFLHNFSS  1349
             EKP EIN HI N++   SS
Sbjct  305   EKPKEINEHIYNYISKISS  323



>ref|XP_003550367.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Glycine 
max]
Length=319

 Score =   427 bits (1098),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 223/377 (59%), Positives = 269/377 (71%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +++VNGI+MH+A+ G+GP++LF+HGFP+ WY+WRHQ+  LAS GYR VAPDLR
Sbjct  1     MEGIEHQTLNVNGINMHIAEKGEGPLILFIHGFPDLWYSWRHQITALASLGYRCVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P + P+ +TSLHVVGDLV LL  +  DEEKVFVVGHDWGAM AW+L LYRP+
Sbjct  61    GYGDTD-VPAN-PTAYTSLHVVGDLVGLLDAIVGDEEKVFVVGHDWGAMTAWSLSLYRPE  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +++ALVN+SV FTPRNPK KPL+TLRAVYG+DYYICRFQ+                    
Sbjct  119   RIRALVNLSVVFTPRNPKRKPLDTLRAVYGNDYYICRFQEP-------------------  159

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    EI+  F              A +GT +VL+ FLTY N
Sbjct  160   ----------------------GEIEAEF--------------AQIGTARVLKEFLTYRN  183

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PLYLP KGK F   TD    LPSWLS+ + DYY SK++KTGFTGG+NYYR LDL+WEL
Sbjct  184   PGPLYLP-KGKAFAHPTDSPIALPSWLSEEECDYYASKYDKTGFTGGLNYYRNLDLNWEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A+WTGA+V VPVKFIVGDLD+TYNAPGAKEYIHKGG KRDVPLLE+VVVLEG GHF+H+
Sbjct  243   TASWTGAQVKVPVKFIVGDLDLTYNAPGAKEYIHKGGFKRDVPLLEDVVVLEGAGHFLHQ  302

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EI+ HI +F   F
Sbjct  303   ERPDEISNHIYDFFKKF  319



>ref|XP_004252913.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=323

 Score =   426 bits (1094),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 219/373 (59%), Positives = 264/373 (71%), Gaps = 56/373 (15%)
 Frame = +3

Query  231   IEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYG  410
              +H  V VNGI+MHV + G GP VLF+HGFPE WY+WRHQ+ F+A  GYRA+APDLRGYG
Sbjct  6     FDHKIVEVNGINMHVVEKGHGPFVLFIHGFPELWYSWRHQIIFMAKHGYRAMAPDLRGYG  65

Query  411   DTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVK  590
             DTTG P DDPSKF+SL VVGDLV LL+ + ++E+KVFVVGHDWGA +AW LCL RPDKVK
Sbjct  66    DTTGVPKDDPSKFSSLRVVGDLVELLNTIVSEEDKVFVVGHDWGAKIAWELCLLRPDKVK  125

Query  591   ALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACS  770
             ALVNMSV F+PRNPK KP+E+L+A+YGDDYY+ RFQ+  V   +  +   IG +      
Sbjct  126   ALVNMSVPFSPRNPKRKPIESLKAIYGDDYYVVRFQEPGV---MEAEFAKIGTKK-----  177

Query  771   ASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSP  950
                                                      VLG       FLTY NP P
Sbjct  178   -----------------------------------------VLGK------FLTYRNPGP  190

Query  951   LYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTG  1130
             LY+P KGK F+ S   LPSWLS+ +VDY+ SK+E+TGFTGG NYYRALDL+WEL+AAW+G
Sbjct  191   LYMP-KGKPFDDSPVILPSWLSQKEVDYFASKYEQTGFTGGFNYYRALDLNWELTAAWSG  249

Query  1131  AKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEI  1310
             AKV VPVKFIVGDLD+TYNAPGAK+YI+KGG+K+DVPLLE+VV+LE VGHF+ +EKP EI
Sbjct  250   AKVKVPVKFIVGDLDLTYNAPGAKDYINKGGMKKDVPLLEKVVILENVGHFLQQEKPDEI  309

Query  1311  NTHILNFLHNFSS  1349
             N HI +F   FSS
Sbjct  310   NKHIHDFFKGFSS  322



>ref|XP_009622179.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=325

 Score =   421 bits (1083),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 215/376 (57%), Positives = 266/376 (71%), Gaps = 56/376 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ I+H  + VNGI+MH+A+ GQGP+VLFLHGFPE WY+WR+QM F+A  GYRAVAPDLR
Sbjct  4     MKEIQHKLLRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRYQMPFMAGHGYRAVAPDLR  63

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDTTGA  DD +KFT+LHVVGD+V LL++++ D+EKVFVVGHDWGAM+AWALCLYRPD
Sbjct  64    GFGDTTGALNDDFTKFTTLHVVGDIVELLNIISPDQEKVFVVGHDWGAMIAWALCLYRPD  123

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVNMSV FTP+NP  +P+  LRA YGD+YYI RFQ+     +I ++   IG ++  
Sbjct  124   KVKALVNMSVPFTPQNPIIRPIARLRATYGDEYYIIRFQE---PGEIEEEFAQIGTKT--  178

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LT  N
Sbjct  179   --------------------------------------------------VLEKLLTNRN  188

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P PL +P KGK F+ S   LP WL++ +VDYY +K+E+TGFTGG+NYYRALDL+WEL+A 
Sbjct  189   PEPLKVP-KGKPFDKSPVKLPPWLTEKEVDYYATKYEQTGFTGGLNYYRALDLNWELTAP  247

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             WTGAK+ VPVKFIVGDLDITYNA G K+YIHKGGLK+DVPLLE+VV+L+GV HF+ +EKP
Sbjct  248   WTGAKIKVPVKFIVGDLDITYNAAGVKDYIHKGGLKKDVPLLEDVVILKGVAHFLQQEKP  307

Query  1302  HEINTHILNFLHNFSS  1349
              E+N HI  FL  FSS
Sbjct  308   DEVNKHIHAFLQGFSS  323



>ref|XP_004229259.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=335

 Score =   421 bits (1083),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 216/379 (57%), Positives = 268/379 (71%), Gaps = 60/379 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             + +EH +V+VNGI+MH  + GQGP+VLF+HGFPECWY+WRHQM F+A QGYRAVAPDLRG
Sbjct  3     DQVEHKTVAVNGINMHFVEIGQGPLVLFIHGFPECWYSWRHQMSFMAKQGYRAVAPDLRG  62

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDTTGAP DDP+KFT+L +VGDLV LL+ +A  EEKVFVVGHDWGA+++WALCLYRPDK
Sbjct  63    YGDTTGAPNDDPNKFTTLDIVGDLVELLNNIAPQEEKVFVVGHDWGAVVSWALCLYRPDK  122

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKA V +SV F PRNP +KPL+TLR VYGDDYY+ RFQ+  V   I  +   +G      
Sbjct  123   VKAFVCLSVAFNPRNPLNKPLDTLRKVYGDDYYVVRFQEAGV---IEGEFEELG------  173

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                                  K +  +FL                          TY  P
Sbjct  174   --------------------IKNVLKKFL--------------------------TYRTP  187

Query  945   SPLYLPKKGKLFEGST----DDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
              PLYL KKGK FE ++    D+LP+WLS  D+D+Y +K+++ GFTG +NYYR++D +WE+
Sbjct  188   GPLYL-KKGKPFEDTSSTNDDELPAWLSHEDIDFYANKYKQIGFTGALNYYRSIDRNWEV  246

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAWTGAK+ VPVKFIVGDLDITYNAPGAK+Y+HKGG K+ VPLLE+VVVL+GVGHFIH+
Sbjct  247   TAAWTGAKIQVPVKFIVGDLDITYNAPGAKDYLHKGGFKKLVPLLEDVVVLQGVGHFIHQ  306

Query  1293  EKPHEINTHILNFLHNFSS  1349
             EKP EIN HI N++   SS
Sbjct  307   EKPKEINEHIYNYITKISS  325



>ref|XP_007154300.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
 gb|ESW26294.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
Length=319

 Score =   421 bits (1081),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 218/377 (58%), Positives = 266/377 (71%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEG+ H +V+VNGI+MH+A+ G+GP +LF+HGFP+ W++WRHQM  LAS GYR VAPDLR
Sbjct  1     MEGVRHRTVNVNGINMHIAEMGEGPSILFIHGFPDLWFSWRHQMKALASLGYRCVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT    +  P+ +TSLHVVGD+V LL  +A D EKVFVVGHDWGAM AW L L+RPD
Sbjct  61    GYGDTDVPAS--PTAYTSLHVVGDIVGLLDEIAGDNEKVFVVGHDWGAMTAWVLSLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +++ALVN+SV FTPRNPK KPL+TL+AVYG+DYYI                         
Sbjct  119   RIRALVNLSVAFTPRNPKRKPLDTLKAVYGNDYYI-------------------------  153

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G IE EF  +GT++VL+ FLTY N
Sbjct  154   ---------CRF---------------------QEPGNIEAEFEQIGTERVLKEFLTYRN  183

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P+YL  +GK F    D    LPSWLS+ +  YY SK+EKTGFTGG+NYYR LDL+WEL
Sbjct  184   PAPIYL-HEGKGFGHPIDSPLKLPSWLSEEECHYYASKYEKTGFTGGLNYYRNLDLNWEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGAKV VPVKFIVGDLD+TYNAPGAK+YIHKGGLKRDVPLLE+VVV++G GHF+H+
Sbjct  243   TAPWTGAKVKVPVKFIVGDLDLTYNAPGAKDYIHKGGLKRDVPLLEDVVVIQGAGHFLHQ  302

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEIN HI +F+  F
Sbjct  303   ERPHEINQHIYDFVKKF  319



>ref|XP_011091000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=327

 Score =   420 bits (1080),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 217/377 (58%), Positives = 263/377 (70%), Gaps = 57/377 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M G+EH ++S+NGISMHVA+ G GP++LFLHGFP+CWYTWRHQ+ F A+ GYRA+APDLR
Sbjct  1     MVGVEHKTLSLNGISMHVAEMGHGPIILFLHGFPQCWYTWRHQITFFATHGYRALAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVA-ADEEKVFVVGHDWGAMMAWALCLYRP  578
             GY DTTG P  DP+KFT+LHVVGD+VAL+  +A  +++KV VVGHDWGA++AWALCLYRP
Sbjct  61    GYADTTGVPPSDPAKFTTLHVVGDIVALIDALAPPNDQKVLVVGHDWGALVAWALCLYRP  120

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             DKVKALVNMSV FT RNP  KPLE LRAVYGDDYYICRFQ+      I  +   IG ++ 
Sbjct  121   DKVKALVNMSVVFTRRNPSRKPLEMLRAVYGDDYYICRFQEPGA---IEHEFAQIGTKT-  176

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                        L+   +++  G                      
Sbjct  177   --------------------------VLKHFLTYRTPG----------------------  188

Query  939   NPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
                PL +P KGK F  +   LP WLS+ DVDYYTSK+  TGFT  +NYYRALD++WEL+A
Sbjct  189   ---PLNIP-KGKPFPDTPISLPPWLSEEDVDYYTSKYNLTGFTAALNYYRALDINWELTA  244

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
             AWTGA++ VPVKFIVGD+D+TYNAPG KEYIHKGG KRDVPLL+EVVV+EGVGHFIHEEK
Sbjct  245   AWTGAQITVPVKFIVGDVDLTYNAPGCKEYIHKGGFKRDVPLLKEVVVMEGVGHFIHEEK  304

Query  1299  PHEINTHILNFLHNFSS  1349
             P ++N HI +F   FSS
Sbjct  305   PDDVNAHIHSFFKQFSS  321



>ref|XP_009757465.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=331

 Score =   420 bits (1079),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 216/377 (57%), Positives = 265/377 (70%), Gaps = 57/377 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEG+EH +VSVNGI+MH A+ GQGP+VLF+HGFPE WY++RHQM F+A+ GYRAVAPDLR
Sbjct  1     MEGVEHKTVSVNGINMHYAEIGQGPLVLFIHGFPELWYSFRHQMSFMANHGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTG P DDPS FT+L +VGDLV LL+ +A  EEKVFV+GHDWGA+++WALCLYRPD
Sbjct  61    GYGDTTGVPKDDPSNFTTLSIVGDLVELLNSIAPQEEKVFVIGHDWGAVVSWALCLYRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVK    +SV F PRNP  KPL+TLRAVYGDDYY+ RFQ+  V                 
Sbjct  121   KVKGFFCLSVAFNPRNPIKKPLDTLRAVYGDDYYVVRFQEAGV-----------------  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                              +  +++E+ ++                      VL+ F TY  
Sbjct  164   -----------------IEAEFEEMGVK---------------------NVLKKFFTYRE  185

Query  942   PSPLYLPKKGKLF-EGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P+PLYL KKGK F +    +LP WLS+ ++D+Y  KFE+TGFTG +N+YRA+  +WEL+A
Sbjct  186   PAPLYL-KKGKPFGDNPQVELPCWLSEEELDFYAIKFEQTGFTGPLNFYRAIHRNWELTA  244

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
             AWTGAK+ VPVKFIVGDLD+TYNAPG K+Y+HKGG K+ VPLLEEVVVLEGVGHFIHEEK
Sbjct  245   AWTGAKIQVPVKFIVGDLDLTYNAPGTKDYLHKGGFKKQVPLLEEVVVLEGVGHFIHEEK  304

Query  1299  PHEINTHILNFLHNFSS  1349
             P EIN HI NF+   SS
Sbjct  305   PKEINDHIYNFIRKISS  321



>ref|XP_009757467.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=340

 Score =   420 bits (1079),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 213/376 (57%), Positives = 264/376 (70%), Gaps = 56/376 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             +E I+H ++ VNG++MH+A+ GQGP+VLFLHGFPE WY+WRHQM F+A+ GYRAVA DLR
Sbjct  4     VEEIQHKTLRVNGLNMHIAEMGQGPIVLFLHGFPELWYSWRHQMPFVAAHGYRAVALDLR  63

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDTTGAP DD +KFT+LHVVGD+V LL+++A D+EKVFVVGHDWGAM+AWALC YRPD
Sbjct  64    GFGDTTGAPEDDFTKFTTLHVVGDIVELLNIIAPDQEKVFVVGHDWGAMIAWALCFYRPD  123

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KV ALVNM+V F PRNP  +P+  LRA YGD+YYI RFQ+     +I ++   IG ++  
Sbjct  124   KVNALVNMTVPFAPRNPIIRPIARLRATYGDEYYIIRFQE---PGEIEEEFAKIGTKT--  178

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LT  N
Sbjct  179   --------------------------------------------------VLEKLLTNRN  188

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P PL LP KGK F+ S   LP WL++ DVDYY SK+++TGFTGG+NYYRALDL+WEL+A 
Sbjct  189   PEPLMLP-KGKPFDESPVKLPPWLTEKDVDYYASKYQQTGFTGGLNYYRALDLNWELTAP  247

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             WTGAKV VPVKFIVGDLDITY+A G K+YIHKGG K+DVPLLE+VV+ +GV HF+ +EKP
Sbjct  248   WTGAKVKVPVKFIVGDLDITYSAAGVKDYIHKGGFKKDVPLLEDVVIFKGVAHFLPQEKP  307

Query  1302  HEINTHILNFLHNFSS  1349
              E+N  IL+FL  FSS
Sbjct  308   DEVNKQILDFLQGFSS  323



>gb|EYU43974.1| hypothetical protein MIMGU_mgv1a009814mg [Erythranthe guttata]
Length=331

 Score =   420 bits (1079),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 215/380 (57%), Positives = 266/380 (70%), Gaps = 60/380 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH S+S+NG++MHVA+ G+GP++LFLHGFPECWYTWRHQM F AS+GYRAVAPDLR
Sbjct  1     MEEIEHRSLSINGLTMHVAEAGRGPIILFLHGFPECWYTWRHQMVFFASRGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEE----KVFVVGHDWGAMMAWALCL  569
             G+ DTTGAP  DPSKFT+LHV GDLVAL+  VAA       KVFVVGHDWGA+MAWALCL
Sbjct  61    GFADTTGAPASDPSKFTTLHVAGDLVALIDAVAAAPADDGGKVFVVGHDWGAVMAWALCL  120

Query  570   YRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGR  749
             YRPDKVKALVN+SV F+ RNP  KP+ETLR+VYG++YYICRFQ+     +I ++   IG 
Sbjct  121   YRPDKVKALVNLSVPFSRRNPNRKPIETLRSVYGNEYYICRFQE---PGKIEQEFSQIGT  177

Query  750   RSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFL  929
             ++                                                    VL+ FL
Sbjct  178   KN----------------------------------------------------VLKNFL  185

Query  930   TYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             TY NP PL+LP K K F  +   LP WLS  DV+YY SK++ TGFTG +NYYRALD++WE
Sbjct  186   TYRNPGPLHLP-KSKAFSDTETSLPPWLSDEDVNYYASKYDATGFTGALNYYRALDINWE  244

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+ AW+  ++ V VKF+VGDLD+TYN+PG KEYIH GG K+DVPLL+EVVV++ V HFIH
Sbjct  245   LTGAWSRGEIKVAVKFMVGDLDLTYNSPGTKEYIHNGGFKKDVPLLKEVVVMKDVAHFIH  304

Query  1290  EEKPHEINTHILNFLHNFSS  1349
             +EKP E+N +IL+F +N+SS
Sbjct  305   QEKPDEVNANILSFFNNYSS  324



>ref|XP_009622181.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=333

 Score =   419 bits (1078),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 218/379 (58%), Positives = 265/379 (70%), Gaps = 59/379 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEG+EH +VSVNGI+MH A+ G+GP+VL +HGFPECWY+WRHQM F+A+ GYRAVAPDLR
Sbjct  1     MEGVEHKTVSVNGINMHYAEIGKGPLVLLIHGFPECWYSWRHQMSFMANHGYRAVAPDLR  60

Query  402   GYGDT-TGAPT-DDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             GYGDT TG P  DDPS FT+L +VGDLV LL+ +A  EEKVFVVGHDWGA+++WALCLYR
Sbjct  61    GYGDTATGVPNKDDPSNFTTLSIVGDLVELLNSIAPQEEKVFVVGHDWGAVVSWALCLYR  120

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PDKVK    +SV F PRNP  KPLETLRAVYGDDYY+ RFQ+  V               
Sbjct  121   PDKVKGFFCLSVAFNPRNPMKKPLETLRAVYGDDYYVVRFQEAGV---------------  165

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                                +  +++EI                     G K VL+ F TY
Sbjct  166   -------------------IEAEFEEI---------------------GVKNVLKKFFTY  185

Query  936   YNPSPLYLPKKGKLF-EGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               P+PLY  KKGK F +    +LP WLS+ ++D+Y +K+E+TGFTG +N+YRA+D +WEL
Sbjct  186   REPAPLYF-KKGKSFGDNPQVELPCWLSEEELDFYATKYEQTGFTGALNFYRAIDRNWEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             + AWTGAK+ VPVKFIVG+LD+TYNAPG K+Y+HKGG K+ VPLLEEVVVLEGVGHFIHE
Sbjct  245   TGAWTGAKIQVPVKFIVGELDLTYNAPGTKDYLHKGGFKKQVPLLEEVVVLEGVGHFIHE  304

Query  1293  EKPHEINTHILNFLHNFSS  1349
             EKP EIN HI NF+   SS
Sbjct  305   EKPKEINDHIYNFIRKISS  323



>ref|XP_007222764.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
 gb|EMJ23963.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
Length=320

 Score =   417 bits (1071),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 221/377 (59%), Positives = 268/377 (71%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+GIEH +V VNGI+MH+A+ GQGP++LF+HGFPE WY+WRHQ+  LAS GYRAVAPDLR
Sbjct  1     MDGIEHRTVQVNGINMHIAEKGQGPLILFIHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP D P+ +T LHVVGDL+ALL  +A D +KVFVVGHDWGA +AW LCL+RPD
Sbjct  61    GFGDTD-AP-DSPTSYTCLHVVGDLIALLDTIAPDHDKVFVVGHDWGAFIAWYLCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP+ K LE+L+AVYGDDYY+                         
Sbjct  119   RVKALVNMSVAFRPRNPQRKNLESLKAVYGDDYYM-------------------------  153

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G IE EFA +GT +V++ FLTY N
Sbjct  154   ---------CRF---------------------QEPGVIEAEFAKIGTARVMKEFLTYRN  183

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+LPK  K+F  S D    LPSWLS+++V+YY SKFEKTGFTGGINYYR LDL+WEL
Sbjct  184   PGPLFLPKD-KMFGHSLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLDLNWEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAWTGA+V VPVKFIVGD D+TYN+ G K++IHKGG K+ VPLLEEVVV+EGV HFI++
Sbjct  243   TAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQ  302

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EIN HI +F+  F
Sbjct  303   ERPDEINKHIHDFIAKF  319



>ref|XP_006489040.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=375

 Score =   418 bits (1074),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 222/376 (59%), Positives = 263/376 (70%), Gaps = 61/376 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             E I+H  V+VNGI+MHVA+ GQGP++LF+HGFP  WY+WRHQ+  LAS GYRAVAPDLRG
Sbjct  58    EDIQHKVVNVNGINMHVAEKGQGPLILFIHGFPLLWYSWRHQIAALASLGYRAVAPDLRG  117

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT  AP +  S +T LH+VGD++ALL  VAAD+EKVFVVGHDWGA++AW LCL+RPD+
Sbjct  118   YGDTD-APAEV-SSYTCLHLVGDVIALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDR  175

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALVN+SV F PRNP  KPL+  +AVYGDDYYI                          
Sbjct  176   VKALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYI--------------------------  209

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                     CRF                     QE GEIE EFA +GT+ VL+ FLTY NP
Sbjct  210   --------CRF---------------------QEPGEIEAEFAQMGTETVLKEFLTYRNP  240

Query  945   SPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL+LPK GK F    D   DLPSWLS+ DV YY SK+EK GFTGGINYYR ++L+WEL 
Sbjct  241   GPLFLPK-GKGFGHPPDARIDLPSWLSEEDVKYYASKYEKAGFTGGINYYRNIELNWELL  299

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA++ VPVKFIVGDLD+TYNAPG K+YI+KGG K+ VPLLEEV+V+EGVGHFI+EE
Sbjct  300   APWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGHFINEE  359

Query  1296  KPHEINTHILNFLHNF  1343
             KP E+N HI NF   F
Sbjct  360   KPDEVNKHIYNFFQKF  375



>ref|XP_006419515.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
 gb|ESR32755.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
Length=375

 Score =   417 bits (1073),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 222/376 (59%), Positives = 262/376 (70%), Gaps = 61/376 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             E I+H  V+VNGI+MHVA+ GQGP++LF HGFP  WY+WRHQ+  LAS GYRAVAPDLRG
Sbjct  58    EDIQHKVVNVNGINMHVAEKGQGPLILFFHGFPLLWYSWRHQIAALASLGYRAVAPDLRG  117

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT  AP +  S +T LH+VGD++ALL  VAAD+EKVFVVGHDWGA++AW LCL+RPD+
Sbjct  118   YGDTD-APAEV-SSYTCLHLVGDVIALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDR  175

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALVN+SV F PRNP  KPL+  +AVYGDDYYI                          
Sbjct  176   VKALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYI--------------------------  209

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                     CRF                     QE GEIE EFA +GT+ VL+ FLTY NP
Sbjct  210   --------CRF---------------------QEPGEIEAEFAQMGTETVLKEFLTYRNP  240

Query  945   SPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL+LPK GK F    D   DLPSWLS+ DV YY SK+EK GFTGGINYYR ++L+WEL 
Sbjct  241   GPLFLPK-GKGFGHPPDARIDLPSWLSEEDVKYYASKYEKAGFTGGINYYRNIELNWELL  299

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA++ VPVKFIVGDLD+TYNAPG K+YI+KGG K+ VPLLEEV+V+EGVGHFI+EE
Sbjct  300   APWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGHFINEE  359

Query  1296  KPHEINTHILNFLHNF  1343
             KP E+N HI NF   F
Sbjct  360   KPDEVNKHIYNFFQKF  375



>emb|CAZ86692.1| epoxide hydrolase 1 [Prunus persica]
Length=323

 Score =   414 bits (1065),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 221/377 (59%), Positives = 267/377 (71%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +V VNGI+MH+A+ GQG ++LF+HGFPE WY+WRHQ+  LAS GYRAVAPDLR
Sbjct  4     MEGIEHRTVQVNGINMHIAEKGQGLLILFIHGFPELWYSWRHQITALASLGYRAVAPDLR  63

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP D P+ +T LHVVGDL+ALL  +A D +KVFVVGHDWGA +AW LCL+RPD
Sbjct  64    GFGDTD-AP-DSPTSYTCLHVVGDLIALLDTIAPDHDKVFVVGHDWGAFIAWYLCLFRPD  121

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP+ K LE+L+AVYGDDYY+                         
Sbjct  122   RVKALVNMSVAFRPRNPQRKNLESLKAVYGDDYYM-------------------------  156

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G IE EFA +GT +V++ FLTY N
Sbjct  157   ---------CRF---------------------QEPGVIEAEFAKIGTARVMKEFLTYRN  186

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+LPK  K+F  S D    LPSWLS+++V+YY SKFEKTGFTGGINYYR LDL+WEL
Sbjct  187   PGPLFLPKD-KMFGHSLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLDLNWEL  245

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAWTGA+V VPVKFIVGD D+TYN+ G K++IHKGG K+ VPLLEEVVV+EGV HFI++
Sbjct  246   TAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQ  305

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EIN HI +F+  F
Sbjct  306   ERPDEINKHIHDFIAKF  322



>ref|XP_008223222.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Prunus mume]
Length=323

 Score =   413 bits (1062),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 220/378 (58%), Positives = 267/378 (71%), Gaps = 63/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEG+EH +V VNGI+MH+A+ GQGP++LFLHGFPE WY+WRHQ+  LAS GYRAVAPDLR
Sbjct  4     MEGVEHRTVQVNGINMHIAEKGQGPLILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  63

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP D P+ +T LHV+GDLVALL  +A D++KVFVVGHDWGA++AW LCL+RPD
Sbjct  64    GFGDTD-AP-DSPTSYTCLHVIGDLVALLDAIAPDQDKVFVVGHDWGALIAWYLCLFRPD  121

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP+ K LE+L+AVYGDDYYI                         
Sbjct  122   RVKALVNMSVVFPPRNPRRKTLESLKAVYGDDYYI-------------------------  156

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G IE EFA +GT +V++ FLTY N
Sbjct  157   ---------CRF---------------------QEPGVIEAEFAKIGTARVMKEFLTYRN  186

Query  942   PSPLYLPKKGKLFEGSTDD----LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             P PL+LPK   +  G   D    LPSWLS+++V+YY SKFEKTGFTGGINYYR L+L+WE
Sbjct  187   PGPLFLPKD--IMFGHPPDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLNLNWE  244

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L AAWTGA+V VPVKFIVGD D+TYN+ G K++IHKGG K+ VPLLEEVVV+EGV HFI+
Sbjct  245   LIAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKCVPLLEEVVVMEGVAHFIN  304

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E+P EIN HI +F+  F
Sbjct  305   QERPDEINKHIHDFIAKF  322



>ref|XP_009788447.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=323

 Score =   413 bits (1062),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 218/372 (59%), Positives = 259/372 (70%), Gaps = 56/372 (15%)
 Frame = +3

Query  234   EHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYGD  413
             EH +V VNGI+MHV + GQGPV+LF+HGFPE WY+WRHQ+ F +  GYRAVAPDLRG+GD
Sbjct  6     EHKTVVVNGINMHVVEAGQGPVILFIHGFPELWYSWRHQISFASKHGYRAVAPDLRGFGD  65

Query  414   TTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVKA  593
             TT    DDPSKFTSL VVGDLV LL+ +A  EEKVFVVGHDWGA++AWALCL+RPDKVKA
Sbjct  66    TTEVSKDDPSKFTSLQVVGDLVELLNTIAPKEEKVFVVGHDWGAIIAWALCLFRPDKVKA  125

Query  594   LVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACSA  773
             LVN+SV F+ RNPK KPLETL AVYG+DYYI RFQ+     +I  +   IG         
Sbjct  126   LVNLSVAFSLRNPKRKPLETLCAVYGEDYYIVRFQE---PGEIEAEFAKIGT--------  174

Query  774   SSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSPL  953
                               K++  +FL                          +Y NP PL
Sbjct  175   ------------------KKVLEKFL--------------------------SYRNPGPL  190

Query  954   YLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTGA  1133
             YLP KGK F+ +   LPSWL + DVDY  SK+EK+GFTGG+NYYRA+DL+WEL+AAWTG 
Sbjct  191   YLP-KGKPFDDNPVILPSWLPEKDVDYIASKYEKSGFTGGVNYYRAIDLNWELTAAWTGG  249

Query  1134  KVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEIN  1313
             KV VPVKFIVGDLD+TYNAPG K+Y+HKG +K+DVPLLEEVV+LE VGHF+ +EKP  IN
Sbjct  250   KVKVPVKFIVGDLDLTYNAPGVKDYVHKGRMKKDVPLLEEVVILENVGHFLQQEKPDVIN  309

Query  1314  THILNFLHNFSS  1349
              HI  F H FSS
Sbjct  310   KHIHEFFHGFSS  321



>gb|KDO71745.1| hypothetical protein CISIN_1g017221mg [Citrus sinensis]
Length=375

 Score =   409 bits (1052),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 218/376 (58%), Positives = 261/376 (69%), Gaps = 61/376 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             E I+H  V+VNGI+MHVA+ GQGP++LF+HGFP  WY+WRHQ+  LAS GYRAVAPDLRG
Sbjct  58    EDIQHKVVNVNGINMHVAEKGQGPLILFIHGFPLLWYSWRHQITALASLGYRAVAPDLRG  117

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT  AP + PS +T LH+VGD++ALL  VAAD+EKVFVVGHDWGA++AW LCL+RPD+
Sbjct  118   YGDTD-APAEVPS-YTCLHLVGDVIALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPDR  175

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALVN+SV F PRNP  KPL+  +AVYGDDYYICRFQ+                     
Sbjct  176   VKALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPG-------------------  216

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                                   EI+  F              A +GT+ VL+ FLTY NP
Sbjct  217   ----------------------EIEAEF--------------AQMGTETVLKEFLTYRNP  240

Query  945   SPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL+LP KGK F    D    LPSWLS+ DV YY SK+EK GFTGGINYYR ++L+WEL 
Sbjct  241   GPLFLP-KGKGFGHPPDAQIALPSWLSEEDVKYYASKYEKAGFTGGINYYRNIELNWELL  299

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA++ VPVKFIVGDLD+TYNAPG K+YI+KGG K+ VPLLEEV+V+EGVGHFI+EE
Sbjct  300   APWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGHFINEE  359

Query  1296  KPHEINTHILNFLHNF  1343
             KP E+N HI NF   F
Sbjct  360   KPDEVNKHIYNFFQKF  375



>ref|XP_006349824.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Solanum 
tuberosum]
Length=323

 Score =   407 bits (1047),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 217/371 (58%), Positives = 254/371 (68%), Gaps = 56/371 (15%)
 Frame = +3

Query  234   EHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYGD  413
             +H  V VNGI+MHV + GQGP VLF+HGFPE WY+WRHQ+ F+A  GYRAVAPDLRGYGD
Sbjct  7     DHKIVEVNGINMHVVEKGQGPFVLFIHGFPELWYSWRHQIIFMAKHGYRAVAPDLRGYGD  66

Query  414   TTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVKA  593
             TTG P DDPSKF+SL VVGDLV LL+ +  +E+KVFVVGHDWGA++AW LCL RPDKVKA
Sbjct  67    TTGVPKDDPSKFSSLRVVGDLVELLNTIVPEEDKVFVVGHDWGALIAWNLCLLRPDKVKA  126

Query  594   LVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACSA  773
             LVNMSV F+PR                                N K  PI   S  A   
Sbjct  127   LVNMSVPFSPR--------------------------------NPKRKPI--ESLKAIYG  152

Query  774   SSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSPL  953
                   RF                     QE G +E EFA  GTKKVL+ +LTY NP PL
Sbjct  153   DDYYIVRF---------------------QEPGVMEAEFAKTGTKKVLENYLTYRNPGPL  191

Query  954   YLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTGA  1133
             YLPK GK F+ S   LPSWLS+ +VDY+ SK+E+TGFTGG NYYRALDL+WEL+AAW+GA
Sbjct  192   YLPK-GKPFDDSPVILPSWLSQKEVDYFASKYEQTGFTGGFNYYRALDLNWELTAAWSGA  250

Query  1134  KVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEIN  1313
             KV VPVKFIVGDLD+TYN PGAK+YI+KGG+K+DVPLLE+VV+LE VGHF+ +EKP EIN
Sbjct  251   KVKVPVKFIVGDLDLTYNTPGAKDYINKGGMKKDVPLLEKVVILENVGHFLQQEKPDEIN  310

Query  1314  THILNFLHNFS  1346
              HI +F   FS
Sbjct  311   KHIHDFFKGFS  321



>ref|XP_006342824.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=325

 Score =   407 bits (1047),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/376 (56%), Positives = 263/376 (70%), Gaps = 57/376 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME +EH ++ VNGI+MH+A+ GQGP+VLFLHGFPE WY+WRHQM F+A+ GYR VAPDLR
Sbjct  1     MEKVEHKTMRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRHQMPFMAAHGYRVVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDTTGAP  D +KFT+LHVVGDLV LL+++A D +KVF+VGHDWGAM+AW +CLYRPD
Sbjct  61    GFGDTTGAPKGDFTKFTTLHVVGDLVELLNIIAPD-QKVFLVGHDWGAMIAWDMCLYRPD  119

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             K+KALVNMSV F PRNP  +P+  LRA+YGD+YYI RFQ+     +I ++   IG ++  
Sbjct  120   KIKALVNMSVPFFPRNPIIRPIVALRAIYGDEYYIIRFQE---PGEIEEEFAQIGTKT--  174

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LT  +
Sbjct  175   --------------------------------------------------VLEKMLTIRD  184

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P PL LP KGK F+ S   LP WL++ DVDYY +K+E TGFTGG+NYYRALDL+WEL+A 
Sbjct  185   PEPLKLP-KGKPFDDSPVILPPWLTETDVDYYATKYEHTGFTGGLNYYRALDLNWELTAP  243

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             WTGAK+ VPVKFIVGDLD+TYN+ G K YI+KGGLK++VPLLE+VV+L+GV HF+ +EKP
Sbjct  244   WTGAKIEVPVKFIVGDLDLTYNSAGVKFYINKGGLKKNVPLLEDVVILKGVAHFLQQEKP  303

Query  1302  HEINTHILNFLHNFSS  1349
              E+N HI  F  +FSS
Sbjct  304   DEVNEHIHVFFQSFSS  319



>ref|XP_009352305.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 213/376 (57%), Positives = 266/376 (71%), Gaps = 61/376 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             EGIEH +V VNGI+MHVA+ G GP++LF+HGFP+ WY+WRHQ+  L++ GYR VAPDLRG
Sbjct  4     EGIEHRTVQVNGINMHVAEKGHGPLILFIHGFPDLWYSWRHQILALSALGYRTVAPDLRG  63

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT  AP   PS +T LHVVGDLVALL  +A D+E+VFVV HDWG+++AW LCL+RPD+
Sbjct  64    YGDTD-APAS-PSSYTCLHVVGDLVALLDTIAPDQEQVFVVAHDWGSIIAWYLCLFRPDR  121

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             +KALV++SV F+PRNP+ K +++L+AVYGDDYYI                          
Sbjct  122   LKALVSLSVAFSPRNPQRKIIKSLQAVYGDDYYI--------------------------  155

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                     CRF                     QE G IE EFA +GT ++L+ FLTY NP
Sbjct  156   --------CRF---------------------QEPGVIEAEFAQMGTTRILKEFLTYRNP  186

Query  945   SPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL+LPK GK F   TD    LPSWLS+++V+YY +KFEKTGFTGGINYYR LDL+WEL+
Sbjct  187   GPLFLPK-GKGFGRPTDAPIVLPSWLSEDEVNYYATKFEKTGFTGGINYYRNLDLNWELT  245

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
              AWTGA+V VPVKFIVGD D+ YN+PGAK++IHKGG K+  PLLE+VVV+EGV HF+ +E
Sbjct  246   TAWTGAQVKVPVKFIVGDQDLVYNSPGAKDFIHKGGFKKYAPLLEQVVVMEGVAHFLQQE  305

Query  1296  KPHEINTHILNFLHNF  1343
             KP EINTHI +F+ NF
Sbjct  306   KPDEINTHIHDFIKNF  321



>ref|XP_007222693.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
 gb|EMJ23892.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
Length=323

 Score =   405 bits (1042),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 216/377 (57%), Positives = 264/377 (70%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+GIEH +V VNGI+MH+A+ GQGP++LF+HGFPE WY+WRHQ+  LAS GYRAVAPDLR
Sbjct  4     MDGIEHRTVQVNGINMHIAEKGQGPLILFIHGFPELWYSWRHQITALASLGYRAVAPDLR  63

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP D P+ +T LHV+GDLVALL  +A D++KVFVVGHDWGA +AW LCL+RPD
Sbjct  64    GFGDTD-AP-DSPTSYTCLHVIGDLVALLDAIAPDQDKVFVVGHDWGAFIAWYLCLFRPD  121

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP+ K LE+L+AVYGDDYYICRFQ+  V   I  +   IG     
Sbjct  122   RVKALVNMSVAFLPRNPQRKSLESLKAVYGDDYYICRFQEPGV---IEAEFAKIG-----  173

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                            T +V++ FLTY N
Sbjct  174   -----------------------------------------------TARVMKEFLTYRN  186

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               PL+LPK  K+F    D    LPSWLS+++V+YY SKFEKTGFTGGINYYR LDL+WEL
Sbjct  187   SGPLFLPKD-KMFGHPLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLDLNWEL  245

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAWTGA+V VPVKFIVGD D+TYN+ G K++IHKGG K+ VPLLEEVVV+EGV HFI++
Sbjct  246   TAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQ  305

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EIN HI +F+  F
Sbjct  306   ERPDEINKHIHDFIAKF  322



>ref|XP_004296863.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   404 bits (1038),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 219/377 (58%), Positives = 263/377 (70%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +V VNGI+MHVA+ GQGPV+LF+HGFPE WY WRHQ+  LA+ GYRAVAPDLR
Sbjct  1     MEGIEHRTVKVNGINMHVAEKGQGPVILFIHGFPELWYCWRHQIQALAAVGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP D  S +T LHVVGDLVALL  VAAD+EKVFVVGHDWGA++AW LCL+RPD
Sbjct  61    GYGDTD-APADQ-SSYTCLHVVGDLVALLDAVAADQEKVFVVGHDWGALIAWYLCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F+PRNP+ K  E LRAVYGDDYY+CRFQ+                    
Sbjct  119   RVKALVNLSVAFSPRNPQRKTTEMLRAVYGDDYYMCRFQEPG------------------  160

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    EI+  F              A +GT +V++ FLTY +
Sbjct  161   -----------------------EIEAEF--------------AQIGTARVMKEFLTYRH  183

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+LP KGK F    D    LPSWLS++DV+YY S FEK GFTGGINYYR  D +WEL
Sbjct  184   PGPLFLP-KGKGFRHPPDAPIPLPSWLSEDDVNYYVSFFEKKGFTGGINYYRNFDRNWEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA++ VPVKFIVGD D+ YN+ GAK++IHKGG K+ VPLLEEVVV+EGVGHFI+E
Sbjct  243   TAPWTGARIKVPVKFIVGDQDLVYNSLGAKDFIHKGGFKKYVPLLEEVVVMEGVGHFINE  302

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P+EI+ HI +F+  F
Sbjct  303   ERPNEISEHIHDFIKKF  319



>ref|XP_007035641.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY06567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=396

 Score =   407 bits (1045),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 258/371 (70%), Gaps = 63/371 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+VNGI+MHVA+ G+GPV+LFLHGFPE WY+WRHQ+   AS GY+AVAPDL 
Sbjct  74    MEEIEHRIVNVNGINMHVAEKGKGPVILFLHGFPELWYSWRHQITAFASLGYQAVAPDLC  133

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP D  S +T L+VVGDLVALL VVA +++KVFVVGHDWGA++AW LCL RPD
Sbjct  134   GYGDTD-AP-DAASSYTVLNVVGDLVALLDVVAPEQDKVFVVGHDWGALIAWWLCLVRPD  191

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F+PRNPK KPLE+LRA YGDDYYI                         
Sbjct  192   RVKALVNMSVVFSPRNPKRKPLESLRAFYGDDYYI-------------------------  226

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q  GEIE EFA LG ++VL+ FLTY N
Sbjct  227   ---------CRF---------------------QAPGEIEAEFAELGFERVLKGFLTYRN  256

Query  942   PSPLYLPKKGKLFEGSTDDL----PSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             P PL LPK GK F G  D      P+WLS+ DV YY S++EK GFTGG+NYYR +DL+WE
Sbjct  257   PGPLLLPK-GKYF-GQPDTPISLPPNWLSEEDVKYYISQYEKKGFTGGLNYYRNIDLNWE  314

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG++V VPVKFIVGD D+TYNAPG K+YI KGGLKRDVP LE+VVV+EGV HF+H
Sbjct  315   LTAPWTGSQVKVPVKFIVGDQDLTYNAPGTKDYIQKGGLKRDVPFLEQVVVMEGVAHFLH  374

Query  1290  EEKPHEINTHI  1322
             EEKP EIN H+
Sbjct  375   EEKPDEINKHM  385



>ref|XP_011090999.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   403 bits (1036),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 208/374 (56%), Positives = 253/374 (68%), Gaps = 57/374 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  + VNGI MHVA+ G+GP+VLF+HGFPE WY+WRHQM FLA+ GYRAVAPD+R
Sbjct  1     MENIEHKIIPVNGIKMHVAELGKGPLVLFVHGFPELWYSWRHQMVFLAAHGYRAVAPDMR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYG+TTGAP DDPSKFT LH+VGDL+ LL  +A  EEKVFVVGHDWGA++AW LCLYRPD
Sbjct  61    GYGETTGAPLDDPSKFTVLHLVGDLILLLDAIAPGEEKVFVVGHDWGALVAWHLCLYRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F PRNP+  P+E  R +YGDD+YI                         
Sbjct  121   RVKALVNLSVAFYPRNPEVNPVEMFRGLYGDDHYI-------------------------  155

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G+IE EFA +G K+V++    +  
Sbjct  156   ---------CRF---------------------QEPGDIEAEFANIGVKEVVKNIFAFRT  185

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P Y PK GK F  S +  P WL++ D+DYY S FE+TGFTGG+NYYRA  L+WEL+A 
Sbjct  186   PGPFYFPK-GKGFGYSLERAP-WLTEEDLDYYVSTFEQTGFTGGVNYYRAFGLNWELNAP  243

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             W+GA+V VP KFIVG+ DITY+ PG K++IHKGG K+ VPLL+EVVVLEG  HFI++E+P
Sbjct  244   WSGAQVKVPAKFIVGEFDITYHVPGTKDHIHKGGFKKFVPLLQEVVVLEGAAHFINQERP  303

Query  1302  HEINTHILNFLHNF  1343
              EIN HI  FL  F
Sbjct  304   DEINEHIYAFLKQF  317



>ref|NP_001274907.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81891.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 207/377 (55%), Positives = 257/377 (68%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+VNG++MH+A+ GQGP +LFLHGFPE WY+WRHQM +LA +GYRAVAP LR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFLHGFPELWYSWRHQMVYLAERGYRAVAPVLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +DPSKF+ L +VGD+VALL  +A +EEKVFVV HDWGA++AW LCL+RPD
Sbjct  61    GYGDTTGAPLNDPSKFSILQLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN SV F PRNPK   +E L+AVYG+D+YI RFQ   V  +I  +  PIG +S  
Sbjct  121   KVKALVNSSVHFLPRNPKMNTVEGLKAVYGEDHYISRFQ---VPGEIEAEFAPIGAKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LT+ +
Sbjct  176   --------------------------------------------------VLKKILTFRD  185

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P Y P KGK  E   D    L SWLS+ ++DYY +KFE+TGFTGG+NYYRAL ++WEL
Sbjct  186   PAPFYFP-KGKGLEALPDAPVALSSWLSEEELDYYANKFEQTGFTGGVNYYRALSINWEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VP KFIVG+ D+ Y+ PGAKEYIH GG K+DVPLLEEVVVLEG  HF+++
Sbjct  245   TAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVNQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI +F+  F
Sbjct  305   ERPHEISKHIYDFIQKF  321



>gb|EYU43973.1| hypothetical protein MIMGU_mgv1a010247mg [Erythranthe guttata]
Length=318

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/375 (55%), Positives = 259/375 (69%), Gaps = 58/375 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H ++ VNGISMHVA+ G+GP+VLFLHGFPE WY+WRHQM F+A++GYRAVAPD+R
Sbjct  1     MEEIQHRTIPVNGISMHVAELGEGPLVLFLHGFPELWYSWRHQMVFVAARGYRAVAPDMR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAAD-EEKVFVVGHDWGAMMAWALCLYRP  578
             GYGDTTGAP DDPSKFT LH+VGDL++LL  V+ D  +KVFVVGHDWGA +AW LC+YRP
Sbjct  61    GYGDTTGAPLDDPSKFTLLHLVGDLISLLDAVSPDGADKVFVVGHDWGAFVAWHLCMYRP  120

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D+VKALVN+SV F PR+P+  P++ +R++YG+D+YI                        
Sbjct  121   DRVKALVNLSVAFIPRDPEMNPVQKMRSLYGEDHYI------------------------  156

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                       CRF                     QE G+IE EF  +G K+VL+  L + 
Sbjct  157   ----------CRF---------------------QEPGDIEAEFEKIGVKEVLKNILAFR  185

Query  939   NPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             NP+PLY PK GK F  S D  P WL++ ++DYY +KFEKTGFTGGINYYRA  L WEL+A
Sbjct  186   NPAPLYFPK-GKGFTYSADRAP-WLTEEELDYYVTKFEKTGFTGGINYYRAFGLSWELNA  243

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              W GA+V VP KFIVG+LD+ Y+ PG K++IHKGG K+ VPLL+E+VVLEG  HF+++E+
Sbjct  244   PWAGAQVNVPTKFIVGELDLVYHTPGTKDFIHKGGFKKFVPLLQEIVVLEGAAHFVNQER  303

Query  1299  PHEINTHILNFLHNF  1343
               EIN HI  FL  F
Sbjct  304   ADEINEHIYAFLQQF  318



>ref|NP_001275417.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81892.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   401 bits (1030),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 258/377 (68%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+VNG++MH+A+ G+GP +LF+HGFPE WY+WRHQM +LA +GYRAVAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +DPSKF+ LH+VGD+VALL  +A +EEKVFVV HDWGA++AW LCL+RPD
Sbjct  61    GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV F+ RNPK   +E L+A+YG+D+YI RFQ   V  +I  +  PIG +S  
Sbjct  121   KVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQ---VPGEIEAEFAPIGAKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LTY +
Sbjct  176   --------------------------------------------------VLKKILTYRD  185

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P Y P KGK  E   D    L SWLS+ ++DYY +KFE+TGFTG +NYYRAL ++WEL
Sbjct  186   PAPFYFP-KGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VP KFIVG+ D+ Y+ PGAKEYIH GG K+DVPLLEEVVVLEG  HF+ +
Sbjct  245   TAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI +F+  F
Sbjct  305   ERPHEISKHIYDFIQKF  321



>ref|XP_004290776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   400 bits (1029),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 216/379 (57%), Positives = 260/379 (69%), Gaps = 62/379 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH ++ VNGI+MHVA+ GQGPV+LFLHGFPE WY WRHQM  LAS GYRAVAPDLR
Sbjct  1     MEGIEHKTIKVNGINMHVAEKGQGPVILFLHGFPELWYCWRHQMHALASLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP +  S +T LHVVGDL+ALL  VAAD+EKVFVVGHDWGA++AW LCL+RPD
Sbjct  61    GFGDTD-APAE-ASSYTCLHVVGDLIALLDAVAADQEKVFVVGHDWGAVIAWHLCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV FTPRNP+ KP+  L+AVYG DYY+                         
Sbjct  119   RVKALVNLSVAFTPRNPQFKPVPALKAVYGGDYYM-------------------------  153

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G+IE E A LG  +V++ FL+  N
Sbjct  154   ---------CRF---------------------QEEGDIEDELASLGCDRVMKEFLSNRN  183

Query  942   PSPLYLPKKGKLFEGSTDD----LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             P PL LPK GK F  ++ D    LPSWLS++D+ YY S FEK GFTG +NY+R LD +WE
Sbjct  184   PGPLMLPK-GKGFGNASPDAPVTLPSWLSEDDIHYYASNFEKKGFTGALNYFRNLDRNWE  242

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG+K++VPVKFIVGD D+ YN+ GAK+YIHKGG K+ VPLLEEVVV+EGV HFI+
Sbjct  243   LTAPWTGSKILVPVKFIVGDQDLVYNSMGAKDYIHKGGFKKYVPLLEEVVVMEGVAHFIN  302

Query  1290  EEKPHEINTHILNFLHNFS  1346
             EE+P EIN HI +F   F 
Sbjct  303   EERPEEINQHIYDFFKKFD  321



>ref|NP_001274962.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81889.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   400 bits (1029),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 207/377 (55%), Positives = 256/377 (68%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+VNG++MH+A+ GQGP +LFLHGFPE WY+WRHQM +LA  GYRAVAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFLHGFPELWYSWRHQMVYLAECGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGA  +DPSKF+ LH+VGD+VALL  +A +EEKVFVV HDWGA++AW LCL+RPD
Sbjct  61    GYGDTTGASLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV F PRNPK   +E L+A+YG+D+YI RFQ   V  +I  +  PIG +S  
Sbjct  121   KVKALVNLSVHFLPRNPKMNTVEWLKAIYGEDHYISRFQ---VPGEIEAEFAPIGAKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               +L+  LTY +
Sbjct  176   --------------------------------------------------ILKKILTYRD  185

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P Y P KGK  E   D    L SWLS+ ++DYY +KFE+TGFTGG+NYYRAL + WEL
Sbjct  186   PAPFYFP-KGKGLEALPDAPVALSSWLSEEELDYYANKFEQTGFTGGVNYYRALPISWEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VP KFIVG+ D+ Y+ PGAKEYIH GG K DVPLLEEVVVLEG  HF+++
Sbjct  245   TAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKEDVPLLEEVVVLEGSAHFVNQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI +F+  F
Sbjct  305   ERPHEISKHIYDFIQKF  321



>gb|EYU21013.1| hypothetical protein MIMGU_mgv1a010239mg [Erythranthe guttata]
Length=318

 Score =   400 bits (1028),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 204/375 (54%), Positives = 259/375 (69%), Gaps = 58/375 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H ++ VNGISMHVA+ G+GP+VLFLHGFPE WY+WRHQM F+A++GYRAVAPD+R
Sbjct  1     MEEIQHRTIPVNGISMHVAELGEGPLVLFLHGFPELWYSWRHQMVFVAARGYRAVAPDMR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAAD-EEKVFVVGHDWGAMMAWALCLYRP  578
             GYGDTTGAP DDPSKFT LH+VGDL++LL  V+ +  +KVFVVGHDWGA +AW LC+YRP
Sbjct  61    GYGDTTGAPLDDPSKFTLLHLVGDLISLLDAVSPNGADKVFVVGHDWGAFVAWHLCMYRP  120

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D+VKALVN+SV F PR+P+  P++ +R++YG+D+YI                        
Sbjct  121   DRVKALVNLSVAFIPRDPEMNPVQKMRSLYGEDHYI------------------------  156

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                       CRF                     QE G+IE EF  +G K+VL+  L + 
Sbjct  157   ----------CRF---------------------QEPGDIEAEFEKIGVKEVLKNILAFR  185

Query  939   NPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             NP+PLY PK GK F  S D  P WL++ ++DYY +KFEKTGFTGGINYYRA  L WEL+A
Sbjct  186   NPAPLYFPK-GKGFTYSADRAP-WLTEEELDYYVTKFEKTGFTGGINYYRAFGLSWELNA  243

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              W GA+V VP KFIVG+LD+ Y+ PG K++IHKGG K+ VPLL+E+VVLEG  HF+++E+
Sbjct  244   PWAGAQVNVPTKFIVGELDLVYHTPGTKDFIHKGGFKKFVPLLQEIVVLEGAAHFVNQER  303

Query  1299  PHEINTHILNFLHNF  1343
               EIN HI  FL  F
Sbjct  304   ADEINQHIYAFLQQF  318



>ref|XP_007221833.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
 gb|EMJ23032.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
Length=320

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 212/377 (56%), Positives = 264/377 (70%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +V VNGI+MH+A+ GQGP++LF+HGFPE WY+W HQ+  LAS GYRAVAPDLR
Sbjct  1     MEGIEHRTVQVNGINMHIAEKGQGPLILFVHGFPELWYSWSHQITALASFGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP D P+ +T LHVVGDL+ALL  +A D++KVFVVGHDWGA +AW LCL+RPD
Sbjct  61    GFGDTD-AP-DSPTSYTCLHVVGDLIALLDAIAPDQDKVFVVGHDWGAYLAWFLCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F PRNP+ K +E+++AVYGDDYY+                         
Sbjct  119   RVKALVNLSVAFMPRNPQRKFIESVKAVYGDDYYM-------------------------  153

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G +E EFA LGT +V++ FLTY N
Sbjct  154   ---------CRF---------------------QEPGVMEAEFAKLGTARVMKEFLTYRN  183

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+LPK  K+F  + D    LPSWLS+++V+YY SKFEKTGFTG +NYYR LDL+WEL
Sbjct  184   PGPLFLPKD-KMFGHAPDAPIVLPSWLSEDEVNYYASKFEKTGFTGALNYYRNLDLNWEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAWT  +V VPVKFIVGD D+ YN+  AK++IHKGG K+ VPLLEEVVV+EGV HFI++
Sbjct  243   TAAWTEVQVKVPVKFIVGDQDLVYNSLHAKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQ  302

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EIN HI +F+  F
Sbjct  303   ERPDEINKHIHDFIAKF  319



>pdb|2CJP|A Chain A, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
 pdb|2CJP|B Chain B, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
Length=328

 Score =   399 bits (1026),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 204/377 (54%), Positives = 258/377 (68%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ IEH  V+VNG++MH+A+ G+GP +LF+HGFPE WY+WRHQM +LA +GYRAVAPDLR
Sbjct  8     MKKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  67

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +DPSKF+ LH+VGD+VALL  +A +EEKVFVV HDWGA++AW LCL+RPD
Sbjct  68    GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  127

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV F+ RNPK   +E L+A+YG+D+YI RFQ   V  +I  +  PIG +S  
Sbjct  128   KVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQ---VPGEIEAEFAPIGAKS--  182

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LTY +
Sbjct  183   --------------------------------------------------VLKKILTYRD  192

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P Y P KGK  E   D    L SWLS+ ++DYY +KFE+TGFTG +NYYRAL ++WEL
Sbjct  193   PAPFYFP-KGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWEL  251

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VP KFIVG+ D+ Y+ PGAKEYIH GG K+DVPLLEEVVVLEG  HF+ +
Sbjct  252   TAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQ  311

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI +F+  F
Sbjct  312   ERPHEISKHIYDFIQKF  328



>emb|CDO98838.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   398 bits (1023),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 214/377 (57%), Positives = 261/377 (69%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ IEH +V+VNG+S+H+A+ GQGP+VLF+HGFPE WY+WRHQ+ FLA+ GYRAVAPDLR
Sbjct  1     MDKIEHKNVNVNGLSIHIAELGQGPLVLFIHGFPELWYSWRHQILFLAAHGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +D S+FT LHVVGDLVALL  +A DEEKVFVVGHDWGAM+AW LC++RPD
Sbjct  61    GYGDTTGAPVNDSSEFTCLHVVGDLVALLHAIAPDEEKVFVVGHDWGAMVAWYLCMFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVNMSV F PRNP +KP+E LRA  GDDYYICRFQ+      I  +L  +G     
Sbjct  121   KVKALVNMSVAFIPRNPLAKPVEMLRAYGGDDYYICRFQE---PGDIEAELAQMG-----  172

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                CK       FL                  KK+L     Y  
Sbjct  173   -------------------CK------DFL------------------KKML----AYRT  185

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+ P KGK F  S D    LPSWL++ DVDYY SKF+KTGFTGG+NYYRA++L WEL
Sbjct  186   PGPLFWP-KGKGFGDSPDGPVVLPSWLTEEDVDYYASKFDKTGFTGGLNYYRAVNLHWEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGAK+ VP KF+VG+LD+TY   G ++YIHKGG K DVPLLE+VVV++   HFI++
Sbjct  245   TAPWTGAKIKVPTKFVVGELDLTYYMRGVQDYIHKGGFKNDVPLLEDVVVVKDAAHFINQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EIN HI +F+  +
Sbjct  305   ERPDEINKHIYDFIQRY  321



>pdb|3CXU|A Chain A, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
 pdb|3CXU|B Chain B, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
Length=328

 Score =   398 bits (1023),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 203/377 (54%), Positives = 258/377 (68%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ IEH  V+VNG++MH+A+ G+GP +LF+HGFPE WY+WRHQM +LA +GYRAVAPDLR
Sbjct  8     MKKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  67

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +DPSKF+ LH+VGD+VALL  +A +EEKVFVV HDWGA++AW LCL+RPD
Sbjct  68    GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPD  127

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV F+ RNPK   +E L+A++G+D+YI RFQ   V  +I  +  PIG +S  
Sbjct  128   KVKALVNLSVHFSKRNPKMNVVEGLKAIFGEDHYISRFQ---VPGEIEAEFAPIGAKS--  182

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LTY +
Sbjct  183   --------------------------------------------------VLKKILTYRD  192

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P Y P KGK  E   D    L SWLS+ ++DYY +KFE+TGFTG +NYYRAL ++WEL
Sbjct  193   PAPFYFP-KGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWEL  251

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VP KFIVG+ D+ Y+ PGAKEYIH GG K+DVPLLEEVVVLEG  HF+ +
Sbjct  252   TAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQ  311

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI +F+  F
Sbjct  312   ERPHEISKHIYDFIQKF  328



>ref|XP_010105137.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03945.1| Epoxide hydrolase 2 [Morus notabilis]
Length=319

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 258/377 (68%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+GIEH +V VNGI MHVA+ G GPV+LF+HGFPE WY+WRHQ+  L+S G+RAVAPDLR
Sbjct  1     MDGIEHRTVEVNGIHMHVAEKGDGPVILFIHGFPELWYSWRHQIAALSSLGFRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+  A  + P+ +T L +VGDL+ALL  +AAD++KVFVVGHDWGA++AW LCL+RPD
Sbjct  61    GYGDS--AAPESPAVYTCLDIVGDLIALLDAIAADQDKVFVVGHDWGALIAWYLCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F PRNP+ +P+ ++RAV GD+YYICRFQ+     +I  +L  IG     
Sbjct  119   RVKALVNLSVAFNPRNPRRRPIHSMRAVCGDNYYICRFQE---FGEIEAELEKIG-----  170

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                              +VL+ FLTY +
Sbjct  171   -----------------------------------------------IDRVLREFLTYRH  183

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+LP KGK FE   D    LP WLS+ D+ YY SKFEKTGFTGGINYYR +D +WEL
Sbjct  184   PGPLFLP-KGKGFERPVDVPISLPDWLSEEDLKYYVSKFEKTGFTGGINYYRNIDRNWEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
              A WTG  + VPVKFIVGDLD+TYN+ GAK+Y+HKGG KRDVP L+EVV++EGVGHFI++
Sbjct  243   VAPWTGTPIKVPVKFIVGDLDLTYNSFGAKDYVHKGGFKRDVPFLQEVVIMEGVGHFINQ  302

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EIN HI +F + F
Sbjct  303   ERPQEINHHIYDFFNKF  319



>emb|CDP10752.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   397 bits (1019),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 260/378 (69%), Gaps = 60/378 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ IEH +VSVNGI+MH+A+ G+GP+VLFLHGFPE WY+WRHQ+ FLAS GYRAVAPDLR
Sbjct  1     MDKIEHKNVSVNGINMHIAELGEGPLVLFLHGFPELWYSWRHQILFLASHGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +D SKF+SLH+VGDL+AL   +A D+EKVFVVGHDWGA +AW LC++RPD
Sbjct  61    GYGDTTGAPVNDSSKFSSLHIVGDLIALTQAIAPDQEKVFVVGHDWGAFIAWHLCMFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KV+ALVN+SV F PRNP    +E+LR+ YG+DYY+CRFQ+                    
Sbjct  121   KVRALVNLSVAFIPRNPSCSLVESLRSAYGNDYYMCRFQEPG------------------  162

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    EI+  F              A +G K  ++  LTY  
Sbjct  163   -----------------------EIEAEF--------------AQIGVKNFIKKMLTYRT  185

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRAL-DLDWE  1109
             P PL+ P +GK F  S D    LPSWL+  DVDY+ SKFEKTGFTGG+NYYRAL ++ WE
Sbjct  186   PGPLFFP-QGKGFGDSPDTPVVLPSWLTDEDVDYFVSKFEKTGFTGGVNYYRALNNVTWE  244

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTGA+V VP KF++G+LD+TY+ PG +EYIHKGG KRDVPLLEEVVV++   HFI+
Sbjct  245   LTAPWTGAQVKVPAKFVIGELDLTYHMPGVQEYIHKGGFKRDVPLLEEVVVVKDAAHFIN  304

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E+P E++ HI +F+  F
Sbjct  305   QERPDEVSKHIHDFIKQF  322



>ref|XP_004239806.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   396 bits (1018),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 204/377 (54%), Positives = 255/377 (68%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ IEH  V+VNG++MH+A+ GQGP +LF+HGFPE WY+WRHQM +LA +GYRAVAPDLR
Sbjct  1     MDKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +DPSKF+  H+VGD+VALL  ++ +EEKVFVV HDWGA++AW LCL+RPD
Sbjct  61    GYGDTTGAPLNDPSKFSIFHLVGDVVALLEAISPNEEKVFVVAHDWGALIAWHLCLFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN SV F PRNP    +E L+AVYG+D+YI RFQ   V   I  +  PIG +S  
Sbjct  121   KVKALVNSSVHFFPRNPNMNTVEGLKAVYGEDHYISRFQ---VPGDIEAEFAPIGAKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LT+ +
Sbjct  176   --------------------------------------------------VLKKILTFRD  185

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
              +P Y P KGK  E   D    L SWLS+ ++DYY +KFEKTGFTGG+NYYRAL ++WEL
Sbjct  186   TAPFYFP-KGKGLEALPDAPVALSSWLSEEELDYYANKFEKTGFTGGVNYYRALPINWEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA++ VP KFIVG+ D+ Y+ PGAKEYIH GG K DVPLLEEVVVLEG  HF+++
Sbjct  245   TAPWTGAQLKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKNDVPLLEEVVVLEGAAHFVNQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI +F+ NF
Sbjct  305   ERPHEISKHIYDFIQNF  321



>ref|XP_009350800.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   395 bits (1014),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 208/376 (55%), Positives = 259/376 (69%), Gaps = 61/376 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             +GIEH +V VNGI+MHVA+ G GP++LFLHGFPE WY+WRHQ+  L++ GYRAVAPDLRG
Sbjct  4     QGIEHRTVQVNGINMHVAEKGNGPLILFLHGFPELWYSWRHQILALSALGYRAVAPDLRG  63

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT    +  PS +T LH+VGDLVALL  +A D+EKVFVV HDWGA++AW LCL+RPD+
Sbjct  64    YGDTDAPAS--PSSYTCLHMVGDLVALLDAIAPDQEKVFVVAHDWGALIAWYLCLFRPDR  121

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALV++SV F PRNP+ K +E+  A YGDDYY+                          
Sbjct  122   VKALVSLSVQFMPRNPRRKVIESFHAAYGDDYYM--------------------------  155

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                     CRF                     QE G IE EFA +GT +V++ FLTY NP
Sbjct  156   --------CRF---------------------QEPGVIEAEFAQMGTTRVIKEFLTYRNP  186

Query  945   SPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL+LPK GK F   TD    LPSWLS++DV+YYT+KF+KTGFTG +NYYR LD++WEL+
Sbjct  187   GPLFLPK-GKAFGHPTDTPIVLPSWLSEDDVNYYTAKFDKTGFTGPVNYYRNLDVNWELT  245

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA+V VPVKF+VGD D+ YN+ GA ++IHKGG K+ VPLLEEVVVLEGV HF+ +E
Sbjct  246   APWTGAQVKVPVKFVVGDQDLVYNSQGAPDFIHKGGFKKFVPLLEEVVVLEGVAHFLQQE  305

Query  1296  KPHEINTHILNFLHNF  1343
             KP EI+ HI +F+  F
Sbjct  306   KPDEISKHIHDFIKKF  321



>ref|XP_004229258.2| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=325

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 256/372 (69%), Gaps = 57/372 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME +EH ++ VNGI+MH+A+ GQGP+VLFLHGFPE WY+WRHQM F+A+ GY  VAPDLR
Sbjct  1     MEKVEHKTMRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRHQMLFMAAHGYHVVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDTTGAP  D +KFT+LHVVGDLV LL+++A D  KVF+VGHDWGAM+AWALCLYRPD
Sbjct  61    GFGDTTGAPKGDFTKFTTLHVVGDLVELLNIIAPD-RKVFLVGHDWGAMIAWALCLYRPD  119

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             K+ ALVNMSV + PRNP  +P+E LRA+YGD+YYI +FQ+     +I  +   IG ++  
Sbjct  120   KINALVNMSVPYFPRNPIIRPIEALRAIYGDEYYIIKFQE---PGKIEAEFAQIGTKT--  174

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LT  +
Sbjct  175   --------------------------------------------------VLEKILTMRD  184

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P PL +P KGK F+ S   LP WL++ DVDYY +K+E TGFTGG+NYYRA+DL+WEL+A 
Sbjct  185   PDPLKMP-KGKPFDDSPVILPPWLTEEDVDYYATKYEHTGFTGGLNYYRAIDLNWELTAP  243

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             WTGAK+ VPVKFIVGDLD+TYN  G K+YI+KGG K++VPLLE+VV+L+GV HF+ +E+P
Sbjct  244   WTGAKIEVPVKFIVGDLDLTYNLVGVKDYINKGGFKKNVPLLEDVVILKGVAHFLQQEEP  303

Query  1302  HEINTHILNFLH  1337
              E+N HI  F  
Sbjct  304   DEVNQHIHVFFQ  315



>ref|NP_001275381.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81890.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   393 bits (1009),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 255/377 (68%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+VNG++MH+A+ GQGP +LF+HGFPE WY+WRHQM +LA +GYRAVAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +DPSKF+  H+VGD+VALL  +A +E+KVFVV HDWGA++AW LCL+RPD
Sbjct  61    GYGDTTGAPINDPSKFSIFHLVGDVVALLEAIAPNEDKVFVVAHDWGALIAWHLCLFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV + PRN    P+E L+A+YG+DYYICRFQ   V  +I  +  PIG +S  
Sbjct  121   KVKALVNLSVHYHPRNSNMNPIEGLKALYGEDYYICRFQ---VPGEIEAEFAPIGAKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LTY +
Sbjct  176   --------------------------------------------------VLKKMLTYRD  185

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P Y P KGK  E   D    L +WLS+ ++DYY +KFE+TGFTG +NYYRAL ++ EL
Sbjct  186   PAPFYFP-KGKGLEAIADAPIVLSTWLSEEELDYYANKFEQTGFTGALNYYRALSINSEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VP KFIVG+ D+ Y+  GAKEYIH GG K+ VPLLEEVVVLEG  HF+++
Sbjct  245   TAPWTGAQVNVPTKFIVGEFDLAYHMRGAKEYIHNGGFKKYVPLLEEVVVLEGAAHFVNQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI +F+  F
Sbjct  305   ERPHEISKHIYDFIQKF  321



>ref|XP_004239808.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=321

 Score =   393 bits (1009),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 200/376 (53%), Positives = 252/376 (67%), Gaps = 57/376 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+VNG++MH+A+ GQG  +LF+HGFPE WY+WRHQM +LA +GYRAVAPDLR
Sbjct  1     MEKIEHKMVNVNGLNMHIAELGQGSTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +DPSKF+  H+VGDLVALL  +A +EEKVFVV HDWGA++AW LCL+RPD
Sbjct  61    GYGDTTGAPLNDPSKFSIFHLVGDLVALLEAIAPNEEKVFVVAHDWGAIIAWHLCLFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV F  RNPK   +E L+A+YG+D+YI RFQ   V  +I  +  PIG +S  
Sbjct  121   KVKALVNLSVHFPRRNPKMNTVEGLKAIYGEDHYISRFQ---VPGEIEAEFAPIGAKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LTY +
Sbjct  176   --------------------------------------------------VLKKILTYRD  185

Query  942   PSPLYLPKKGKL--FEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              +PLY PK   L     +   L SWLS+ ++DYY +K+E+TGFTG +NYYRA  ++WEL+
Sbjct  186   TAPLYFPKGSGLDALPDAPAALSSWLSEEELDYYANKYEQTGFTGAVNYYRAFPINWELT  245

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA+V VP KFIVG+ D+ Y+ PG KEYIH GG K+DVPLLEEVVVLEG  HF+++E
Sbjct  246   APWTGAQVKVPTKFIVGEFDLVYHIPGVKEYIHNGGFKKDVPLLEEVVVLEGAAHFVNQE  305

Query  1296  KPHEINTHILNFLHNF  1343
             +PHEIN HI +F+  F
Sbjct  306   RPHEINKHIYDFIQKF  321



>ref|XP_010024724.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61194.1| hypothetical protein EUGRSUZ_H03958 [Eucalyptus grandis]
Length=323

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 212/379 (56%), Positives = 254/379 (67%), Gaps = 63/379 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQ--GPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGIEH +V+VNGI+MHVA  G   GP VL LHGFPE WY+WRHQM  LA+ GYRAVAPD
Sbjct  3     MEGIEHRTVAVNGITMHVAIKGPSGGPTVLLLHGFPELWYSWRHQMAGLAALGYRAVAPD  62

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             LRG+GDT  AP    + +T L V GDL +LL  VA  EEKVFVVGHDWGA+ AW LCL+R
Sbjct  63    LRGFGDTD-APAS-AAGYTGLSVAGDLASLLDAVAKGEEKVFVVGHDWGAIAAWHLCLFR  120

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVN+SV FTPR+P  KPLE+LRA YG+DYYICRFQ+     ++  +   IG R 
Sbjct  121   PDRVKALVNLSVPFTPRHPARKPLESLRAAYGEDYYICRFQE---PGEMEAEFAQIGTR-  176

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                                                                +VL+ FLTY
Sbjct  177   ---------------------------------------------------RVLEEFLTY  185

Query  936   YNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
              NP PL+LP KGK F   TD    LPSWL++ DVDY+TSK+E TGFTGG NYYRALDL+W
Sbjct  186   RNPGPLFLP-KGKGFGHPTDTPIVLPSWLTEEDVDYFTSKYETTGFTGGFNYYRALDLNW  244

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+A WTGA++ VP KF+VGDLD+TYN+PG K++IHKGGLK+ VP LE+VVV+EGV HFI
Sbjct  245   ELTAPWTGAQIRVPAKFMVGDLDLTYNSPGTKDFIHKGGLKKYVPFLEDVVVMEGVAHFI  304

Query  1287  HEEKPHEINTHILNFLHNF  1343
             HEE+P E+  HI +F   F
Sbjct  305   HEERPQEVTQHIHDFFQMF  323



>gb|KDP27825.1| hypothetical protein JCGZ_18905 [Jatropha curcas]
Length=321

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 208/379 (55%), Positives = 253/379 (67%), Gaps = 63/379 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             M+ +EH  V VNGI++HVA+ G   GPV+LF+HGFPE WY+WR+Q+  LAS GYRA+APD
Sbjct  1     MDAVEHRFVHVNGINIHVAEAGPVNGPVILFIHGFPELWYSWRYQIVALASLGYRAIAPD  60

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             +RGYGDT  AP D P  +T LH+VGDL+ LL  VA  +EKVFVVGHDWGA +AW LCL+R
Sbjct  61    MRGYGDTD-APAD-PQSYTCLHIVGDLIGLLDAVAPQQEKVFVVGHDWGAYIAWYLCLFR  118

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVN+SV F PRNPK KP E +RAVYGDDYY+                       
Sbjct  119   PDRVKALVNLSVAFAPRNPKRKPTEGMRAVYGDDYYV-----------------------  155

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                        CR                      QE G+IE EFA LGT+K+++ FLTY
Sbjct  156   -----------CRI---------------------QEPGDIEAEFAELGTEKIMKEFLTY  183

Query  936   YNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
              NP PL LPK GK F   ++    LPSW S+ DV YY +KFEK GFTGG+NYYR +D +W
Sbjct  184   RNPGPLLLPK-GKAFSRPSETPLVLPSWFSEEDVQYYINKFEKKGFTGGLNYYRIVDRNW  242

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+A WTGA+V VPVKFIVGD D+TYN  G K++I KGG K+ VP LEEVV++EGVGHF+
Sbjct  243   ELTAPWTGAEVKVPVKFIVGDQDLTYNTFGTKDFIEKGGFKKAVPFLEEVVIMEGVGHFL  302

Query  1287  HEEKPHEINTHILNFLHNF  1343
             +EEKP EIN HI +F   F
Sbjct  303   NEEKPEEINKHIYDFFQKF  321



>ref|XP_010024723.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61193.1| hypothetical protein EUGRSUZ_H03957 [Eucalyptus grandis]
Length=323

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 211/379 (56%), Positives = 254/379 (67%), Gaps = 63/379 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             ++GIEH +V+VNGI+MHVA  G  + P VL LHGFPE WY+WRHQM  LA+ GYRAVAPD
Sbjct  3     LQGIEHRTVTVNGIAMHVAIKGSSRSPTVLLLHGFPELWYSWRHQMAGLAALGYRAVAPD  62

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             LRG+GDT    +   S +TSL VVGDLVALL  VA  EEKVFVVGHDWGA++AW L L+R
Sbjct  63    LRGFGDTDTPAS--ASAYTSLSVVGDLVALLDAVAKGEEKVFVVGHDWGAVVAWHLSLFR  120

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVN+SV FTPRNP  KPLE+LRA YG+DYYICRFQ+     ++  +   IG R 
Sbjct  121   PDRVKALVNLSVPFTPRNPAQKPLESLRAGYGEDYYICRFQE---PGEMEAEFAQIGTR-  176

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                                                                +VL+ FLT 
Sbjct  177   ---------------------------------------------------RVLEEFLTI  185

Query  936   YNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
              NP  L+LP KGK F    DD   LPSWL++ DVDYY SK+EKTGFTGG NYYRALDL+W
Sbjct  186   RNPDQLFLP-KGKAFGYPMDDLIILPSWLTEEDVDYYASKYEKTGFTGGFNYYRALDLNW  244

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+A WTGA++ VP KFIVGDLD+TY +PGAK+YIH+GGLK+ VP LE+VVV++GV HFI
Sbjct  245   ELTAPWTGAQIRVPAKFIVGDLDLTYTSPGAKDYIHRGGLKKYVPFLEDVVVMQGVAHFI  304

Query  1287  HEEKPHEINTHILNFLHNF  1343
             HEE+P E+  HI +F   F
Sbjct  305   HEERPQEVTHHIHDFFGKF  323



>gb|KHG21329.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=386

 Score =   392 bits (1008),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 207/377 (55%), Positives = 259/377 (69%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH  +  NGI+MHVA+ G+GPV+LFLHGFPE WYTWRHQ+   AS GYRA+APDLR
Sbjct  69    MEGIEHRVIKANGINMHVAEKGKGPVILFLHGFPELWYTWRHQITAFASLGYRALAPDLR  128

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+G+T  AP DD S +TSL VVGDL+ALL VVAAD+++VFVVGHDWGA++AW LC++RPD
Sbjct  129   GFGETE-AP-DDASTYTSLDVVGDLIALLDVVAADQDQVFVVGHDWGALIAWWLCMFRPD  186

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP  KPLE LRA+YGDDYYICRFQ+  V                 
Sbjct  187   RVKALVNMSVAFNPRNPNMKPLEGLRALYGDDYYICRFQEPGV-----------------  229

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                              +  +++E+                     G ++VL+ F TY +
Sbjct  230   -----------------IEAEFREM---------------------GYERVLKGFFTYRD  251

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL +P KGK F G  D    LPSW S+ D  YY S++EK GFTG +NYYR ++L+W+L
Sbjct  252   PCPLLIP-KGKYF-GQPDTPISLPSWFSEEDCKYYLSQYEKKGFTGALNYYRNINLNWQL  309

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTG+KV VPVKFIVGD D+TYN PG K+Y+HKGGLK++VPLLE+VVV+EGV HF+ E
Sbjct  310   TAPWTGSKVKVPVKFIVGDQDLTYNGPGIKDYLHKGGLKKNVPLLEQVVVMEGVAHFLQE  369

Query  1293  EKPHEINTHILNFLHNF  1343
             E P E+N HI +F + F
Sbjct  370   ENPDEVNKHIHDFFNKF  386



>ref|XP_003554527.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=317

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/377 (54%), Positives = 249/377 (66%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI+MHVA  G GPVVLFLHGFPE WYTWRHQ+  L++ GYRA+APDLR
Sbjct  1     MEKIEHKTVRTNGINMHVASIGSGPVVLFLHGFPELWYTWRHQLLSLSAVGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P  D S +++LH+V DLV LL  +    E+VF+VGHDWGA +AW  CL RPD
Sbjct  61    GYGDTDAPP--DASSYSALHIVADLVGLLDALGI--ERVFLVGHDWGASIAWHFCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP  KP+++LRA+ GDDYYI                         
Sbjct  117   RVKALVNMSVVFRPRNPNRKPIQSLRAIMGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E EFA  G  ++++ F+   +
Sbjct  152   ---------CRF---------------------QKPGEVEEEFARAGAARIIKTFIASRD  181

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P  +PK+   F GS D   DLPSWL++ DV+YY SKFE+ GFTGG+NYYRA+DL WEL
Sbjct  182   PRPPCVPKEIG-FGGSPDLRIDLPSWLTEEDVNYYASKFEQKGFTGGLNYYRAMDLTWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAWTG ++ VPVKFIVGDLDITYN PG KEYIH GG KRDVP L+E+VV+EGV HFI++
Sbjct  241   TAAWTGVQIKVPVKFIVGDLDITYNTPGVKEYIHNGGFKRDVPFLQELVVMEGVAHFINQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EI+ HI +F+  F
Sbjct  301   ERPQEISAHIYDFIKKF  317



>ref|XP_002516953.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF45567.1| epoxide hydrolase, putative [Ricinus communis]
Length=321

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 209/379 (55%), Positives = 251/379 (66%), Gaps = 63/379 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             M+ IEH  + VNGI+MHVA+ G   GPV+LF+HGFPE WY+WRHQ+  LAS GYRAVAPD
Sbjct  1     MDAIEHRVIKVNGINMHVAEMGPVNGPVILFIHGFPELWYSWRHQIVALASLGYRAVAPD  60

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             LRG+GDT   P  +   +T +H VGDL+ +L VVA  +EKVFVVGHDWGA MAW LCL+R
Sbjct  61    LRGFGDTDAPP--EQRSYTVMHSVGDLIGVLDVVAPLQEKVFVVGHDWGAYMAWFLCLFR  118

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVN+SV F+PRNP  K +E LRAVYGDDYY+                       
Sbjct  119   PDRVKALVNLSVSFSPRNPHKKIVEMLRAVYGDDYYM-----------------------  155

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                        CRF                     QE G+IE EFA LGT++V++ FLTY
Sbjct  156   -----------CRF---------------------QEVGDIEAEFAELGTERVIKEFLTY  183

Query  936   YNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
               P PL+LPK GK F  S ++   LPSWLS+ D  YY  KFE+ GFTGG+N YR LDL+W
Sbjct  184   RYPGPLFLPK-GKAFNRSPENPLVLPSWLSEEDAQYYVGKFEEKGFTGGLNLYRNLDLNW  242

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+A WTGAKV VP+KFIVGD D+TYN+ G K YI KGG KRDVP LEEVV++EGV HFI
Sbjct  243   ELTAPWTGAKVKVPIKFIVGDQDLTYNSLGNKAYIEKGGFKRDVPFLEEVVIMEGVAHFI  302

Query  1287  HEEKPHEINTHILNFLHNF  1343
             ++EK  EIN HI +F   F
Sbjct  303   NQEKAEEINKHIYDFFQKF  321



>emb|CAJ19276.1| putative epoxide hydrolase [Solanum commersonii]
Length=321

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 250/377 (66%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+VNG++MH+A+ GQGP +LF+HGFPE WY+WRHQM +LA +GYR VAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRTVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +DPSKF+  H+VGD+VALL  +A +E KVFVV HDWGA +AW LCL+RP+
Sbjct  61    GYGDTTGAPINDPSKFSIFHIVGDVVALLEAIAPNEGKVFVVAHDWGAFIAWHLCLFRPE  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV + P+N    P+E L+A+YG+DYYICRFQ   V   I  +  PIG +S  
Sbjct  121   KVKALVNLSVHYPPKNSNMNPIEGLKALYGEDYYICRFQ---VPGDIEAEFAPIGAKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LTY +
Sbjct  176   --------------------------------------------------VLKKMLTYRD  185

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P Y P KGK  E   D    L +WLS+ ++DYY SKFE+TGFTG +NYYRAL +  EL
Sbjct  186   PAPFYFP-KGKGLEAIADAPIALSTWLSEEELDYYASKFEQTGFTGALNYYRALSISSEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VP KFIVG+ D+ Y+  GAKEYIH GG K+ VPLLEEVVVLEG  HFI++
Sbjct  245   TAPWTGAEVKVPTKFIVGEFDLVYHMQGAKEYIHNGGFKKYVPLLEEVVVLEGAAHFINQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI +F+  F
Sbjct  305   ERPHEISKHIYDFIQKF  321



>ref|XP_004239805.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 251/377 (67%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+VNG++MH+A+ GQGP +LF+HGFPE WY+WRHQM +LA +GY AVAPDLR
Sbjct  1     MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYCAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +DPSKFT  H+VGDLVALL  +A +E+KVFVV HDWGA +AW LCL+RPD
Sbjct  61    GYGDTTGAPLNDPSKFTIFHLVGDLVALLEAIAPNEDKVFVVAHDWGAFIAWHLCLFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV + PRN    P+E L+A+YG+DYYICRFQ+      I  +  PIG +S  
Sbjct  121   KVKALVNLSVHYLPRNSNMNPVEGLKALYGEDYYICRFQE---EGDIEAEFAPIGAKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+  LTY +
Sbjct  176   --------------------------------------------------VLKKMLTYRD  185

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P   P KGK  E   D   DL +WLS+ ++DYY +KFE TGFTG +NYYRAL ++ EL
Sbjct  186   PAPFCFP-KGKGLEAIADAPSDLSTWLSEEELDYYANKFEHTGFTGALNYYRALSMNAEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VP KFIVG+ D+ Y+  GAKEYIH GG K+ VPLLEEVVVLEG  HF+++
Sbjct  245   TAPWTGAQVNVPTKFIVGEFDLVYHMRGAKEYIHNGGFKKYVPLLEEVVVLEGAAHFVNQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI +F+  F
Sbjct  305   ERPHEISKHIYDFIQKF  321



>ref|XP_010911257.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/377 (52%), Positives = 262/377 (69%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI H +V+VNGI+MH+A+ G+GP+VLF+HGFPE WY+WRHQM  LA++GYRAVAPDLR
Sbjct  1     MEGITHRTVAVNGINMHIAEKGEGPMVLFIHGFPELWYSWRHQMVALAARGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   + +T  H+VGDLVALL  +A D+  VF VGHDWGA++AW LC+ RPD
Sbjct  61    GYGDTDAPPST--TDYTIFHLVGDLVALLDALAQDQ--VFAVGHDWGAVVAWWLCMLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V+ALVNMSV F+PR+P  +P+++L+A++GDD+YICRFQ+                   G
Sbjct  117   RVRALVNMSVAFSPRHPARRPVDSLKALFGDDHYICRFQE------------------PG  158

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A  A                                     EFA + T  +L+ FLTY  
Sbjct  159   AAEA-------------------------------------EFARINTALLLKKFLTYRK  181

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+PL + K+ K F GS +    LPSWL++ DV+YYTSKFEK+GFTGG+NYYR L+L+WEL
Sbjct  182   PAPLLISKE-KGFGGSPNTEITLPSWLTEEDVNYYTSKFEKSGFTGGLNYYRCLNLNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTG ++ VPVKFIVGDLD+TY+ PG +++IHKGG KR+VP L++V+V++GVGHFI++
Sbjct  241   TAPWTGVQIKVPVKFIVGDLDLTYHTPGIQDHIHKGGFKREVPFLQDVIVMQGVGHFINQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHEI+ HI  F+  F
Sbjct  301   ERPHEISDHIYEFIRKF  317



>ref|XP_009598630.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=321

 Score =   386 bits (991),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/377 (52%), Positives = 256/377 (68%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V VNG+ MHVA+ GQGP++LF+HGFPE WY+WRHQ+ +LA +GYRAVAPDLR
Sbjct  1     MEKIEHKMVDVNGLQMHVAELGQGPIILFIHGFPELWYSWRHQIFYLAERGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +D +KF+  H+VGDL+AL+  +A +E+KVFVVGHDWGA++AW LCL+RPD
Sbjct  61    GYGDTTGAPINDHTKFSIFHLVGDLIALIEAIAPNEDKVFVVGHDWGAIIAWHLCLFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+S+ + P NP+   ++ LRA+YGDD+Y+ RFQ   V  +I  +  PIG +S  
Sbjct  121   KVKALVNLSIHYFPTNPQMNTVDGLRAIYGDDHYVWRFQ---VPGEIEAEFAPIGVKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+ FL + +
Sbjct  176   --------------------------------------------------VLKKFLRFRD  185

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
              +P Y P KGK  E   D   +L SWL++ D+DYY+SKFE+TGFTGG+NYYRA  ++WEL
Sbjct  186   SAPFYFP-KGKGVEAIPDAPIELSSWLTEEDLDYYSSKFEQTGFTGGVNYYRAFPINWEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VP KF+VG+LD+ Y+ PGAK+YIH G  K+DVPLLEEVVVLEG  HF+++
Sbjct  245   TAPWTGAQVKVPAKFMVGELDLVYHIPGAKDYIHNGEFKKDVPLLEEVVVLEGAAHFVNQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EIN HI +F+  F
Sbjct  305   ERPDEINKHIFDFIQKF  321



>ref|XP_009771842.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=318

 Score =   385 bits (990),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 257/378 (68%), Gaps = 64/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPV-VLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME I+H ++SVNGI+MH+A+ G+GP  +LFLHGFPE WYTWRHQ+  L+S+GYRA+APDL
Sbjct  1     MEKIQHKNLSVNGINMHIAEIGEGPTAILFLHGFPELWYTWRHQLISLSSRGYRAIAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT   P+  PS +T  H+VGDL+ALL  +  D+  VF+VGHDWGA++AW LCL RP
Sbjct  61    RGYGDTDAPPS--PSSYTVFHIVGDLIALLDTLGLDQ--VFLVGHDWGAIIAWYLCLLRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D++KALVNMSV F PR+PK KP+E++RAV GDDYYICRFQ                    
Sbjct  117   DRIKALVNMSVVFHPRHPKRKPIESMRAVLGDDYYICRFQ--------------------  156

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                  +Y +++  F              A + T +++  FL   
Sbjct  157   ---------------------EYGQVEEEF--------------ARVDTARLIAKFLISR  181

Query  939   NPSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             NP+PL + K+ K F GS+     LPSWLS+ D+DYY +KF + GFTGG+NYYRA+DL+WE
Sbjct  182   NPAPLRVSKE-KGFGGSSHTPIKLPSWLSEEDIDYYANKFSQKGFTGGLNYYRAMDLNWE  240

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG ++ VPVKFIVGDLD+TYN PG KEYIHKGG ++ VP L+EVV++EGVGHFI+
Sbjct  241   LTAPWTGMQIKVPVKFIVGDLDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVGHFIN  300

Query  1290  EEKPHEINTHILNFLHNF  1343
             EE+P EIN HI +F+  F
Sbjct  301   EERPEEINDHIYDFIQKF  318



>ref|XP_007163124.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
 gb|ESW35118.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
Length=317

 Score =   385 bits (988),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 202/379 (53%), Positives = 248/379 (65%), Gaps = 67/379 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +VS NGI+MHVA  G GPVVLFLHGFPE WYTWRHQ+  L+S GYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPELWYTWRHQLLSLSSVGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   S ++ LH+V DLV LL  +  D+  VF+VGHDWGA +AW  CL RP+
Sbjct  61    GYGDTDAPPS--ASSYSVLHIVADLVGLLDALGIDQ--VFLVGHDWGASIAWYFCLLRPE  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVNMSV F PRNPK KP+++LRA+ GDDYYI                         
Sbjct  117   RLKALVNMSVVFRPRNPKRKPIQSLRAMMGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E +FA  G  ++++ FL   +
Sbjct  152   ---------CRF---------------------QKPGEVEEDFARAGAARIIKKFLASRD  181

Query  942   PSPLYLPKKGKL--FEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
             P P   P+  K   F GS D    LPSWLS+ DV+YY SKFE+ GFTGG+NYYRA+DL W
Sbjct  182   PRP---PRASKEIGFGGSPDLHVALPSWLSEEDVNYYASKFEQKGFTGGLNYYRAMDLTW  238

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+AAWTG ++ VPVKFIVGDLDITYN PG KEYIH GG KRDVP L+E++V+EGV HFI
Sbjct  239   ELTAAWTGVQIKVPVKFIVGDLDITYNTPGVKEYIHNGGFKRDVPFLQELIVMEGVAHFI  298

Query  1287  HEEKPHEINTHILNFLHNF  1343
             +EE+P EI+ HI +F+  F
Sbjct  299   NEERPEEISAHIYDFIKKF  317



>ref|XP_006355815.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   385 bits (989),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 256/378 (68%), Gaps = 64/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGP-VVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME I+H ++SVNGI+MHVA+ G+GP  +LFLHGFPE WYTWRHQ+  L+S+GYRA+APDL
Sbjct  1     MENIQHKNLSVNGINMHVAEIGEGPSTILFLHGFPELWYTWRHQLISLSSKGYRAIAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT   P+  PS +T  H+VGDL+ALL  +  D+  VF+VGHDWGA++AW +CL RP
Sbjct  61    RGYGDTDSPPS--PSSYTVFHIVGDLIALLDALGLDQ--VFLVGHDWGAVIAWHVCLLRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D++KALVNMSV F PRNPK KP+E++RAV GDDYYICRFQ                    
Sbjct  117   DRIKALVNMSVVFHPRNPKRKPIESMRAVLGDDYYICRFQ--------------------  156

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                  +Y E +  F              A + T +++  FLT  
Sbjct  157   ---------------------EYGEAEEEF--------------ARVDTARLIAKFLTSR  181

Query  939   NPSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             NP+PL +PK+ K F GS      LPSWLS+ DV+YY +KF ++GFTGG+NYYRA+DL+WE
Sbjct  182   NPAPLRVPKE-KGFGGSPHTPITLPSWLSEEDVNYYANKFRQSGFTGGLNYYRAMDLNWE  240

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG ++ VPVKFI+GD+D+TYN PG KEYIHKGG ++ VP L+EVV++EGV HFI+
Sbjct  241   LTAPWTGVQIKVPVKFIIGDVDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVAHFIN  300

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E+P EIN HI +F   F
Sbjct  301   QERPEEINDHIYDFFQKF  318



>ref|XP_008341331.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 204/376 (54%), Positives = 258/376 (69%), Gaps = 61/376 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             +GIEH +V VNGI+MHVA+ G GP++LF+HGFPE WY+WRHQ+  L+  GYR VAPDLRG
Sbjct  4     QGIEHRTVQVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSDLGYRXVAPDLRG  63

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT  AP   PS +T LH+VGDLVALL  +A D+E+VFVV HDWGA++AW L L+RPD+
Sbjct  64    YGDTD-APAS-PSSYTCLHMVGDLVALLDAIAPDQEQVFVVAHDWGAVIAWYLXLFRPDR  121

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALV++SV F PRNP+ K +E+ +A YGDDYY+                          
Sbjct  122   VKALVSLSVQFIPRNPQRKFIESFQAAYGDDYYM--------------------------  155

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                     CRF                     QE G IE EFA +GT +V++ FLTY NP
Sbjct  156   --------CRF---------------------QEPGVIEAEFAQMGTTRVIKEFLTYRNP  186

Query  945   SPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL+LPK GK F    D    LPSWLS+++V+YY +KF+KTGFTGGINYYR LD++WEL+
Sbjct  187   XPLFLPK-GKGFGHPXDTPIVLPSWLSEDEVNYYAAKFDKTGFTGGINYYRNLDINWELT  245

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA+V VPVKF+VGD D+ YN+ GA+++IHKGG K+ VPLLEEV+VLEGV HF+ +E
Sbjct  246   APWTGAQVKVPVKFVVGDQDLVYNSLGAQDFIHKGGFKKFVPLLEEVIVLEGVAHFLQQE  305

Query  1296  KPHEINTHILNFLHNF  1343
             KP EI+ HI +F+  F
Sbjct  306   KPDEISKHIHBFIKKF  321



>gb|EYU46741.1| hypothetical protein MIMGU_mgv1a009984mg [Erythranthe guttata]
Length=325

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/379 (51%), Positives = 253/379 (67%), Gaps = 63/379 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ I+H ++  NGI++HVA+ G+GP VLFLHGFPE WY+WRHQM FL+S+GYRA+APDLR
Sbjct  1     MDKIQHKNIRSNGINIHVAEIGRGPAVLFLHGFPELWYSWRHQMLFLSSRGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+   S +T+ H++GDLV LL  +  D  +V++VGHDWGA+MAW LCL RPD
Sbjct  61    GYGDSDAPPS--ASSYTAFHIIGDLVGLLDALGLD--RVYLVGHDWGAVMAWYLCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN+SV F PRNPK KP+E++RA+ G+DYYI                         
Sbjct  117   RIKALVNLSVVFHPRNPKRKPVESMRAILGNDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GE E EFA + T ++++ FLT  N
Sbjct  152   ---------CRF---------------------QEPGEAESEFARVDTARLIKKFLTSRN  181

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+PL +PK+   F GS      +PSWLS+ DV YY SKF   GFTGG+NYYRA+DL+WEL
Sbjct  182   PAPLIVPKEVG-FGGSPHKPITMPSWLSEEDVQYYASKFSLKGFTGGLNYYRAMDLNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A W+  ++ VPVKFIVGDLD+TYN PG KEYIH GG KR VP L+E+V++EGV HFI++
Sbjct  241   TAPWSSVQIKVPVKFIVGDLDLTYNTPGVKEYIHGGGFKRQVPFLQELVIMEGVAHFINQ  300

Query  1293  EKPHEINTHILNFLHNFSS  1349
             EKP E + HI +F+H FSS
Sbjct  301   EKPEETSQHIYDFIHKFSS  319



>ref|XP_009775927.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009775928.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=321

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 197/377 (52%), Positives = 252/377 (67%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+VNG+ MHVA+ GQGP +LFLHGFPE WY+WRHQ+ +LA +GYRAVAPDLR
Sbjct  1     MEKIEHKMVAVNGLQMHVAELGQGPTILFLHGFPELWYSWRHQILYLAERGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDTTGAP +D +KF+  H+VGDL+AL+  +A +E+KVFVVGHDWGA++AW L L+RPD
Sbjct  61    GYGDTTGAPINDHTKFSIFHLVGDLIALIEAIAPNEDKVFVVGHDWGALIAWHLSLFRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             K+KALVN+SV + PRNP+   ++ LRA+YGDD+Y+ RFQ   V  +I  +  PIG +S  
Sbjct  121   KLKALVNLSVHYFPRNPQMNTVDGLRAIYGDDHYVWRFQ---VPGEIEAEFSPIGAKS--  175

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                               VL+ FL +  
Sbjct  176   --------------------------------------------------VLKKFLRFRG  185

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               P+Y P KGK  E   D   +L SWL++ D+DYY SKFE+TGFTGG+NYYRA  + WE 
Sbjct  186   SEPIYFP-KGKGVEAIPDAPIELSSWLTEEDLDYYASKFEQTGFTGGVNYYRAFPISWEF  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGAKV VP KFIVG+LD+ Y+ PGAK+YIH G  K+DVPLLEEVVVLEG  HF+++
Sbjct  245   TAPWTGAKVKVPAKFIVGELDLVYHIPGAKDYIHNGEFKKDVPLLEEVVVLEGAAHFVNQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EI+ HI +F+  F
Sbjct  305   ERPDEISKHIFDFIQKF  321



>ref|XP_008340789.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 207/376 (55%), Positives = 257/376 (68%), Gaps = 61/376 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             +GIEH +V VNGI+MHVA+ G GP++LF+HGFPE WY+WRHQ+  L++ GYRAVAPDLRG
Sbjct  4     QGIEHRTVPVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSALGYRAVAPDLRG  63

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT  AP   PS +  LHVVGDLVALL  +A D+E+VFVV HDWGA +AW LCL RPD+
Sbjct  64    YGDTD-APAS-PSSYNCLHVVGDLVALLDAIAPDQEQVFVVAHDWGAXIAWYLCLXRPDR  121

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALV++SV F PRNP+ K +E+L+A YGDDYYI                          
Sbjct  122   VKALVSLSVQFMPRNPQRKVIESLQAAYGDDYYI--------------------------  155

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                     CRF                     QE G IE EFA +GT +V++ FLTY NP
Sbjct  156   --------CRF---------------------QEPGVIEAEFAQMGTTRVIKEFLTYRNP  186

Query  945   SPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL+LPK GK F   T+    LPSWLS+++V+YY +KF+KTGFTGGINYYR  D++WEL+
Sbjct  187   GPLFLPK-GKGFGHPTBTPIVLPSWLSEDEVNYYXAKFDKTGFTGGINYYRNXDINWELT  245

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA+V VPVKF+VGD D+ YN+ GA ++I KGG K+ VPLLEEVVVLEGV HF+ +E
Sbjct  246   APWTGAQVKVPVKFVVGDQDLVYNSXGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFLQQE  305

Query  1296  KPHEINTHILNFLHNF  1343
             KP EI+ HI +F+  F
Sbjct  306   KPDEISKHIHDFIXXF  321



>ref|XP_009136735.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=362

 Score =   385 bits (988),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 205/387 (53%), Positives = 254/387 (66%), Gaps = 74/387 (19%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQ-----TGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             ++G+EH ++ VNGI+MHVA+     +G  P++LF+HGFPE WYTWRHQM  L+S GYR +
Sbjct  36    LDGVEHKTLKVNGINMHVAELPGSGSGGEPIILFIHGFPELWYTWRHQMTALSSLGYRTI  95

Query  387   APDLRGYGDTTGAPTDDPSK---FTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAW  557
             APDLRGYGDT     D P K   +T  ++VGDLVAL+  V   +E VFVVGHDWGAM+AW
Sbjct  96    APDLRGYGDT-----DAPEKMEDYTYFNIVGDLVALIDAVTGGDEAVFVVGHDWGAMIAW  150

Query  558   ALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLH  737
              LC+YRP+KVKALVNMSV F+PR+P   P+ TLR  +GDDYYICRFQK            
Sbjct  151   QLCMYRPEKVKALVNMSVLFSPRSPDRVPIPTLRRFFGDDYYICRFQKP-----------  199

Query  738   PIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVL  917
                                            EI+L F                LGT+KVL
Sbjct  200   ------------------------------GEIELEF--------------KKLGTEKVL  215

Query  918   QCFLTYYNPSPLYLPKKGKLFE-----GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINY  1082
             + FLTY  P PLYLP KGKLF+     G++  LP WL++ D+DYY +K++  GFTG INY
Sbjct  216   KEFLTYKTPGPLYLP-KGKLFKSSENGGASSALPPWLTQEDLDYYVTKYDNKGFTGPINY  274

Query  1083  YRALDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvv  1262
             YR +D +WEL+A WTGAK+ VPVKFIVGD D+TYN+PGAKEYI+ GG K+DVPLL+E VV
Sbjct  275   YRNIDRNWELTAPWTGAKIRVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETVV  334

Query  1263  leGVGHFIHEEKPHEINTHILNFLHNF  1343
             L+GVGHF+HEE P EIN HI +F   F
Sbjct  335   LKGVGHFLHEESPEEINQHIHSFFQKF  361



>ref|XP_008784772.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Phoenix 
dactylifera]
Length=322

 Score =   383 bits (983),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 200/371 (54%), Positives = 253/371 (68%), Gaps = 59/371 (16%)
 Frame = +3

Query  231   IEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYG  410
             I H +V+VNGI+MHVA+ G+GPVVL +HGFPE WYTWRHQ+  LA++G+RAVAPDLRG+G
Sbjct  11    ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  70

Query  411   DTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVK  590
             DT   P    S ++  H+VGDLVAL+  +  D+  VFVVGHDWGAM+AW+LC++RP+KV+
Sbjct  71    DTDAPP--GVSSYSMFHLVGDLVALIDSLGQDQ--VFVVGHDWGAMVAWSLCMFRPEKVR  126

Query  591   ALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACS  770
             A+VN+SV FTPRNP  K +E LR++YGDD+Y+CRFQ+                   GA  
Sbjct  127   AVVNLSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQE------------------PGAAE  168

Query  771   ASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSP  950
             A                                     EFA LGT  VL+ F TY++P P
Sbjct  169   A-------------------------------------EFARLGTALVLEKFYTYHSPDP  191

Query  951   LYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTG  1130
             L++PK+G     +   LPSWLSK+D+ YY SKFEKTGFTGG+NYYR LDL+WEL+A WTG
Sbjct  192   LFIPKEGWGSPDTEIPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAPWTG  251

Query  1131  AKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEI  1310
             A + VP KFIVGD+D+TY+ PG ++YIHK G K  VPLLEEVVV++GVGHFI+EEKPHEI
Sbjct  252   AHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINEEKPHEI  311

Query  1311  NTHILNFLHNF  1343
               HI NF+  F
Sbjct  312   TVHIYNFIKKF  322



>ref|XP_004240550.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=318

 Score =   382 bits (982),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 256/378 (68%), Gaps = 64/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGP-VVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME I+H +++VNGI+MH+A+ G+GP  +LFLHGFPE WY+WRHQ+  L+S+GYRA+APDL
Sbjct  1     MENIQHKNLTVNGINMHIAEIGEGPSTILFLHGFPELWYSWRHQLISLSSKGYRAIAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT   P+  PS +T  H+VGDL+ALL  +  D+  VF+VGHDWGA++AW +CL RP
Sbjct  61    RGYGDTDSPPS--PSSYTVFHIVGDLIALLDALGLDQ--VFLVGHDWGAVIAWHVCLLRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D++KALVNMSV F PRNPK KP+E++RAV GDDYYICRFQ                    
Sbjct  117   DRIKALVNMSVVFHPRNPKRKPIESMRAVLGDDYYICRFQ--------------------  156

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                  +Y E +  F              A + T +++  FLT  
Sbjct  157   ---------------------EYGEAEEEF--------------ARVDTARLIAKFLTSR  181

Query  939   NPSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             NP+PL +PK+ K F GS      LPSWLS+ DV+YY +KF ++GFTGG+NYYRA+DL+WE
Sbjct  182   NPAPLRVPKE-KGFGGSPHTPITLPSWLSEEDVNYYANKFRQSGFTGGLNYYRAMDLNWE  240

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG ++ VPVKFIVGD+D+TYN PG KEYIHKGG ++ VP L+EVV++EGV HFI+
Sbjct  241   LTAPWTGVQIKVPVKFIVGDVDLTYNTPGVKEYIHKGGFQKVVPFLQEVVIMEGVAHFIN  300

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E+P EIN HI +F   F
Sbjct  301   QERPEEINDHIYDFFQKF  318



>ref|XP_008784771.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Phoenix 
dactylifera]
Length=338

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 200/371 (54%), Positives = 253/371 (68%), Gaps = 59/371 (16%)
 Frame = +3

Query  231   IEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYG  410
             I H +V+VNGI+MHVA+ G+GPVVL +HGFPE WYTWRHQ+  LA++G+RAVAPDLRG+G
Sbjct  27    ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  86

Query  411   DTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVK  590
             DT   P    S ++  H+VGDLVAL+  +  D+  VFVVGHDWGAM+AW+LC++RP+KV+
Sbjct  87    DTDAPP--GVSSYSMFHLVGDLVALIDSLGQDQ--VFVVGHDWGAMVAWSLCMFRPEKVR  142

Query  591   ALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACS  770
             A+VN+SV FTPRNP  K +E LR++YGDD+Y+CRFQ+                   GA  
Sbjct  143   AVVNLSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQE------------------PGAAE  184

Query  771   ASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSP  950
             A                                     EFA LGT  VL+ F TY++P P
Sbjct  185   A-------------------------------------EFARLGTALVLEKFYTYHSPDP  207

Query  951   LYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTG  1130
             L++PK+G     +   LPSWLSK+D+ YY SKFEKTGFTGG+NYYR LDL+WEL+A WTG
Sbjct  208   LFIPKEGWGSPDTEIPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAPWTG  267

Query  1131  AKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEI  1310
             A + VP KFIVGD+D+TY+ PG ++YIHK G K  VPLLEEVVV++GVGHFI+EEKPHEI
Sbjct  268   AHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINEEKPHEI  327

Query  1311  NTHILNFLHNF  1343
               HI NF+  F
Sbjct  328   TVHIYNFIKKF  338



>ref|XP_010921626.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 200/378 (53%), Positives = 254/378 (67%), Gaps = 64/378 (17%)
 Frame = +3

Query  222   MEG-IEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             MEG I H  V+VNGI+MH+A+ G+GPVVL LHGFPE WY+WRHQ+  L++ GYRA+APDL
Sbjct  1     MEGEIHHRFVAVNGINMHIAEKGEGPVVLLLHGFPELWYSWRHQILALSAAGYRAIAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RG+GDT   P  + S +T  HVVGDLVAL+  +   +EKVFVVGHDWGAM+AW+LC++RP
Sbjct  61    RGFGDTDAPP--EASSYTMFHVVGDLVALIHTLG--QEKVFVVGHDWGAMVAWSLCMFRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             DKV+ALVN+SV F PR+P  KP+ETLRAVYGDDYYIC FQ+            P    +E
Sbjct  117   DKVRALVNLSVAFRPRSPDRKPVETLRAVYGDDYYICTFQE------------PGRTEAE  164

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
              AC                                           + T  V++ FLTY+
Sbjct  165   FAC-------------------------------------------IPTALVIKKFLTYH  181

Query  939   NPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             +PSP+ +PK+   F  S D    LPSWLS+ D++Y+ SKF+K+GFTGG+NYYRALDL+WE
Sbjct  182   DPSPVIVPKENG-FAASPDKEITLPSWLSEEDINYFASKFDKSGFTGGLNYYRALDLNWE  240

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG ++ VPVKFIVG+ D+ YN PG K+YIHKGG K+DVP LE+VVV+EG GHFI+
Sbjct  241   LTAPWTGMQIKVPVKFIVGNQDLMYNIPGVKDYIHKGGFKKDVPFLEDVVVIEGAGHFIN  300

Query  1290  EEKPHEINTHILNFLHNF  1343
             +EKP E   HI  F+  F
Sbjct  301   QEKPQETTDHIYEFIQKF  318



>emb|CDX90550.1| BnaA03g42310D [Brassica napus]
Length=330

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 203/384 (53%), Positives = 253/384 (66%), Gaps = 68/384 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQ-----TGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             ++G+EH ++ VNGI+MHVA+     +G  P++LF+HGFPE WYTWRHQM  L+S GYR +
Sbjct  4     LDGVEHKTLKVNGINMHVAELPGSGSGGEPIILFIHGFPELWYTWRHQMTALSSLGYRTI  63

Query  387   APDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             APDLRGYGDT  AP +    +   ++VGDLVAL+  V   +E VFVVGHDWGAM+AW LC
Sbjct  64    APDLRGYGDTN-AP-EKMEDYAYFNIVGDLVALIDAVTGGDEAVFVVGHDWGAMIAWQLC  121

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             +YRP+KVKALVNMSV F+PR+P   P+ TLR  +GDDYYICRFQK               
Sbjct  122   MYRPEKVKALVNMSVLFSPRSPDRVPIPTLRRFFGDDYYICRFQKPG-------------  168

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                                         EI+L F                LGT+KVL+ F
Sbjct  169   ----------------------------EIELEF--------------KKLGTEKVLKEF  186

Query  927   LTYYNPSPLYLPKKGKLFE-----GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
             LTY  P PLYLP KGKLF+     G++  LP WL++ D+DYY +K++  GFTG INYYR 
Sbjct  187   LTYKTPGPLYLP-KGKLFKSSENGGASSALPPWLTQEDLDYYVTKYDNKGFTGPINYYRN  245

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +D +WEL+A WTGAK+ VPVKFIVGD D+TYN+PGAKEYI+ GG K+DVPLL+E VVL+G
Sbjct  246   IDRNWELTAPWTGAKIRVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETVVLKG  305

Query  1272  VGHFIHEEKPHEINTHILNFLHNF  1343
             VGHF+HEE P EIN HI +F   F
Sbjct  306   VGHFLHEESPEEINQHIHSFFQKF  329



>ref|XP_002271210.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 203/376 (54%), Positives = 255/376 (68%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H +V  NGI++H+A+ GQGP++LFLHGFPE WY+WRHQ+  LAS GYRAVAPDLR
Sbjct  1     MEEIQHRTVEANGINIHIAEKGQGPIILFLHGFPELWYSWRHQIHALASLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP D  S +TSLHVVGD++ +L  + AD  +VFVVGHDWGA+MAW LCLYRPD
Sbjct  61    GFGDTD-APADGTS-YTSLHVVGDIIGVLDAIGAD--RVFVVGHDWGAVMAWYLCLYRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F+PRNP  KPLE+LRA  GDDYYICRFQ+  V                 
Sbjct  117   RVKALVNMSVPFSPRNPMRKPLESLRAQLGDDYYICRFQEPGV-----------------  159

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                              +  ++ EI                     G  +VL+ FLTY N
Sbjct  160   -----------------IETEFAEI---------------------GVDRVLKHFLTYRN  181

Query  942   PSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P+PL+LPK     +       LPSWLS+ +V YYT+K++KTGFTGG+NYYR+L+ +WEL+
Sbjct  182   PAPLFLPKGNAFGDDPATPIVLPSWLSEEEVHYYTTKYQKTGFTGGLNYYRSLNRNWELT  241

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A +TG +  VP KFIVGD D+TY+APG+K++IH GGLK+ VPLLE+V+V+EGVGHFIHEE
Sbjct  242   APFTGYQSKVPTKFIVGDHDMTYHAPGSKDFIHGGGLKKYVPLLEDVIVMEGVGHFIHEE  301

Query  1296  KPHEINTHILNFLHNF  1343
             K  EIN HI +F   F
Sbjct  302   KSDEINKHIYDFFQQF  317



>ref|XP_008371325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   381 bits (978),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 206/376 (55%), Positives = 256/376 (68%), Gaps = 61/376 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             +GIEH +V VNGI+MHVA+ G GP++LF+HGFPE WY+WRHQ+  L++ GYRAVAPDLRG
Sbjct  4     QGIEHRTVQVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILTLSALGYRAVAPDLRG  63

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT  AP   PS +  L++VGDLVALL  +A D+E+VFVV HDWGA +AW LCL RPD+
Sbjct  64    YGDTD-APAS-PSSYNCLYMVGDLVALLDAIAPDQEQVFVVAHDWGATIAWYLCLLRPDR  121

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALV +SV F PRNP+ K +E+L+A YGDDYYI                          
Sbjct  122   VKALVGLSVQFMPRNPQRKVIESLQAAYGDDYYI--------------------------  155

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                     CRF                     QE G IE EFA +GT +V++ FLTY NP
Sbjct  156   --------CRF---------------------QEPGVIEAEFAQMGTTRVIKEFLTYRNP  186

Query  945   SPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL+LPK GK F   TD    LPSWLS+++V+YY +KF+KTGFTGGINYYR  D++WEL+
Sbjct  187   GPLFLPK-GKGFGHPTDTPIVLPSWLSEDEVNYYVAKFDKTGFTGGINYYRNXDINWELT  245

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA+V VPVKF+VGD D+ YN+ GA ++I KGG K+ VPLLEEVVVLEGV HF+ +E
Sbjct  246   APWTGAQVKVPVKFVVGDQDLVYNSLGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFLQQE  305

Query  1296  KPHEINTHILNFLHNF  1343
             KP EI+ HI +F+  F
Sbjct  306   KPDEISKHIHDFIXXF  321



>ref|XP_004494384.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=317

 Score =   380 bits (977),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 198/377 (53%), Positives = 247/377 (66%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V+ NGI MH+A  G GPV+LFLHGFPE WY+WRHQ+  L+S GYRA+APDLR
Sbjct  1     MEKIEHTTVNTNGIKMHIASIGSGPVILFLHGFPELWYSWRHQLLSLSSLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P   PS +++LH+VGDLV LL  +  D  +VF+VGHDWGA MAW  CL +PD
Sbjct  61    GYGDTDAPPC--PSSYSALHIVGDLVGLLDGLGVD--RVFLVGHDWGAAMAWYFCLLKPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP  KP++T+RA+ GDDYYI                         
Sbjct  117   RVKALVNMSVVFRPRNPIRKPVQTMRALMGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE E EFA  G  ++++ FLT  +
Sbjct  152   ---------CRF---------------------QKPGEAEEEFARAGANRIIKSFLTLRD  181

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P  L +PK+   F GS +    LPSWLS+ DV+YY +K+E+ GFTGG+NYYRALDL WEL
Sbjct  182   PRALCVPKEIG-FGGSPNTPITLPSWLSEEDVNYYATKYEQKGFTGGLNYYRALDLTWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
              A WTG ++ VPVKFIVGDLD+TYN PG KEYIH GG +R+VP L+E+VV+EGV HFI++
Sbjct  241   MAPWTGEQIKVPVKFIVGDLDLTYNTPGVKEYIHNGGFRREVPYLQEMVVMEGVAHFINQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EIN HI +F+  F
Sbjct  301   ERPEEINAHIYDFIKKF  317



>ref|XP_008784770.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=359

 Score =   382 bits (980),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 200/371 (54%), Positives = 253/371 (68%), Gaps = 59/371 (16%)
 Frame = +3

Query  231   IEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYG  410
             I H +V+VNGI+MHVA+ G+GPVVL +HGFPE WYTWRHQ+  LA++G+RAVAPDLRG+G
Sbjct  48    ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  107

Query  411   DTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVK  590
             DT   P    S ++  H+VGDLVAL+  +  D+  VFVVGHDWGAM+AW+LC++RP+KV+
Sbjct  108   DTDAPP--GVSSYSMFHLVGDLVALIDSLGQDQ--VFVVGHDWGAMVAWSLCMFRPEKVR  163

Query  591   ALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACS  770
             A+VN+SV FTPRNP  K +E LR++YGDD+Y+CRFQ+                   GA  
Sbjct  164   AVVNLSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQE------------------PGAAE  205

Query  771   ASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSP  950
             A                                     EFA LGT  VL+ F TY++P P
Sbjct  206   A-------------------------------------EFARLGTALVLEKFYTYHSPDP  228

Query  951   LYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTG  1130
             L++PK+G     +   LPSWLSK+D+ YY SKFEKTGFTGG+NYYR LDL+WEL+A WTG
Sbjct  229   LFIPKEGWGSPDTEIPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAPWTG  288

Query  1131  AKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEI  1310
             A + VP KFIVGD+D+TY+ PG ++YIHK G K  VPLLEEVVV++GVGHFI+EEKPHEI
Sbjct  289   AHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINEEKPHEI  348

Query  1311  NTHILNFLHNF  1343
               HI NF+  F
Sbjct  349   TVHIYNFIKKF  359



>ref|XP_009620847.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   380 bits (975),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 255/378 (67%), Gaps = 64/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQG-PVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME I+H +++VNGI+MH+A+ G+G   +LFLHGFPE WYTWRHQ+  L+S+GYRA+APDL
Sbjct  1     MEKIQHKNLTVNGINMHIAEIGEGQSAILFLHGFPELWYTWRHQLLALSSKGYRAIAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT   P+  PS +T  H+VGDL+ALL  +  D+  VF+VGHDWGA++AW LCL RP
Sbjct  61    RGYGDTDAPPS--PSSYTVFHIVGDLIALLDTLRLDQ--VFLVGHDWGAIIAWHLCLLRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D++KALVNMSV F PR+PK KP+E++RAV GDDYYICRFQ                    
Sbjct  117   DRIKALVNMSVVFHPRHPKRKPIESMRAVLGDDYYICRFQ--------------------  156

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                  +Y +++  F              A + T +++  FL   
Sbjct  157   ---------------------EYGQVEEEF--------------ARVDTARLIAKFLISR  181

Query  939   NPSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             NP+PL + K+ K F GS+     LPSWLS+ D++YY +KF + GFTGG+NYYRA+DL+WE
Sbjct  182   NPAPLRVSKE-KGFGGSSHTPIKLPSWLSEEDINYYANKFSQKGFTGGLNYYRAMDLNWE  240

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG ++ VPVKFIVGDLD+TYN PG KEYIHKGG ++ VP L+EVV++EGVGHFI+
Sbjct  241   LTAPWTGQQIKVPVKFIVGDLDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVGHFIN  300

Query  1290  EEKPHEINTHILNFLHNF  1343
             EEKP EIN HI +F   F
Sbjct  301   EEKPEEINGHIYDFFQKF  318



>ref|XP_010434902.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=379

 Score =   382 bits (980),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 207/389 (53%), Positives = 254/389 (65%), Gaps = 76/389 (20%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQ---------TGQGPVVLFLHGFPECWYTWRHQMCFLASQG  374
             ++G+EH ++ +NGI+MHVA+         +G+ P++LF+HGFPE WYTWRHQM  L+S G
Sbjct  51    LDGVEHKTLKLNGINMHVAEKPASGSGTGSGKDPIILFIHGFPELWYTWRHQMVALSSLG  110

Query  375   YRAVAPDLRGYGDTTGAPTDDPSK---FTSLHVVGDLVALLSVVAADEEKVFVVGHDWGA  545
             YR +APDLRGYGDT     D P K   +T L+VVGDLVAL++ V   ++ VFVVGHDWGA
Sbjct  111   YRTIAPDLRGYGDT-----DAPEKVEDYTYLNVVGDLVALINAVTDGDKAVFVVGHDWGA  165

Query  546   MMAWALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQIN  725
             M+AW LC YRPDKVKALVNMSV F+PRN +  P+ TLR  +GDDYYI             
Sbjct  166   MLAWQLCQYRPDKVKALVNMSVLFSPRNSQRVPVTTLRHTFGDDYYI-------------  212

Query  726   KKLHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGT  905
                                  CRF                     Q+ GEIE EF  LGT
Sbjct  213   ---------------------CRF---------------------QKPGEIEAEFKKLGT  230

Query  906   KKVLQCFLTYYNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGI  1076
             +KVL+ FLTY  P PL+LPK GK FE   +D   LP WL++ D+DYY +K++K GFTG I
Sbjct  231   EKVLKEFLTYKTPGPLHLPK-GKCFERLENDACALPPWLTQEDLDYYVTKYDKKGFTGPI  289

Query  1077  NYYRALDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleev  1256
             NYYR +D +WEL+A WTGAK+ VPVKFIVG  D+TYN PGAKEYI+ GG KRDVPLL+E 
Sbjct  290   NYYRNIDRNWELTAPWTGAKIHVPVKFIVGGQDLTYNFPGAKEYINDGGFKRDVPLLDET  349

Query  1257  vvleGVGHFIHEEKPHEINTHILNFLHNF  1343
             VVL+G+GHF+HEE P  IN HI NF H F
Sbjct  350   VVLKGLGHFLHEEDPDVINQHIHNFFHKF  378



>ref|XP_008361962.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   379 bits (974),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 205/376 (55%), Positives = 255/376 (68%), Gaps = 61/376 (16%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             +GIEH +V VNGI+MHVA+ G GP++LF+HGFPE WY+WRHQ+  L++ GYRAVAPDLRG
Sbjct  4     QGIEHRTVPVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSALGYRAVAPDLRG  63

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT  AP   PS +  L  VGDLVALL  +A D+E+VFVV HDWGA +AW LCL RPD+
Sbjct  64    YGDTD-APAS-PSSYNCLXXVGDLVALLDAIAPDQEQVFVVAHDWGAXIAWYLCLXRPDR  121

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALV++SV F PRNP+ K +E+L+A YGDDYYI                          
Sbjct  122   VKALVSLSVQFMPRNPQRKVIESLQAAYGDDYYI--------------------------  155

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                     CRF                     QE G IE EFA +GT +V++ FLTY NP
Sbjct  156   --------CRF---------------------QEPGVIEAEFAQMGTTRVIKEFLTYRNP  186

Query  945   SPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL+LPK GK F   T+    LPSWLS+++V+YY +KF+KTGFTGGINYYR  D++WEL+
Sbjct  187   GPLFLPK-GKGFGHPTBTPIVLPSWLSEDEVNYYXAKFDKTGFTGGINYYRNXDINWELT  245

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA+V VPVKF+VGD D+ YN+ GA ++I KGG K+ VPLLEEVVVLEGV HF+ +E
Sbjct  246   APWTGAQVKVPVKFVVGDQDLVYNSLGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFLQQE  305

Query  1296  KPHEINTHILNFLHNF  1343
             KP EI+ HI +F+  F
Sbjct  306   KPDEISKHIHDFIRKF  321



>ref|XP_010269590.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nelumbo nucifera]
Length=318

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 196/377 (52%), Positives = 248/377 (66%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH  VSVNGI+MH+A+ G+GPVVLF+HGFPE WY+WRHQ+  LA++GYRAVAPDLR
Sbjct  1     MEGIEHRMVSVNGINMHIAEKGEGPVVLFIHGFPELWYSWRHQIVALAARGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   + ++  H+VGDL+ALL+++  D+  VFVVGHDWGA++AW LCL+RPD
Sbjct  61    GYGDTDAPPSI--TSYSVFHIVGDLIALLNILGQDQ--VFVVGHDWGAIIAWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F PRNP  K ++ LRA +GD+YYICRFQ+                    
Sbjct  117   RVKALVNLSVSFMPRNPAGKTVQRLRAAFGDNYYICRFQEP-------------------  157

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    EI+  F              A  G  K+++ FLTY  
Sbjct  158   ----------------------GEIEAEF--------------AQAGATKIMKYFLTYKK  181

Query  942   PSPLYLPK---KGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               PL LPK   +G       D+LP WL++ DV+YY +KFE+ GFTGG+NYYRALDL WE+
Sbjct  182   TGPLILPKGSIRGLHDAPQVDELPPWLTEEDVNYYATKFEQKGFTGGLNYYRALDLTWEI  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WT  +V VP KFIVGD D+TY  PGAKEYIH GG KRDVP L+EVVV+EGVGHFI +
Sbjct  242   TAPWTNVQVKVPAKFIVGDQDVTYTTPGAKEYIHGGGFKRDVPFLQEVVVMEGVGHFITQ  301

Query  1293  EKPHEINTHILNFLHNF  1343
             E+  EI+ HI +F+  F
Sbjct  302   ERADEISAHIHDFIQKF  318



>ref|XP_009411662.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   378 bits (970),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 195/377 (52%), Positives = 259/377 (69%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI H  + VNGI+MHVA+ G GPVVLF+HGFPE WY+WRHQ+  LA++GYRAVAPDLR
Sbjct  3     MEGISHRKLHVNGINMHVAEKGDGPVVLFVHGFPELWYSWRHQIASLAARGYRAVAPDLR  62

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+   S +T LH+VGDLVAL+  +  D+  VFVVGHDWGA +AW LC+ RPD
Sbjct  63    GYGDSDAPPS--ASAYTILHLVGDLVALIHALGQDQ--VFVVGHDWGAAVAWWLCMLRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV F+PRNP  + L++LRA++GDD+Y+CRFQ++                  G
Sbjct  119   KVKALVNLSVPFSPRNPHRRTLDSLRAIFGDDHYMCRFQEH------------------G  160

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A  A                                     EFA + T  +++ FLTY  
Sbjct  161   ATEA-------------------------------------EFAQIETSLLIKKFLTYRK  183

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P+ +PK+ K F+G+ +    LP+WLS+ D++Y+ SKFEK+GFTGG+NYYR LDL+WEL
Sbjct  184   PEPIIVPKE-KGFDGTLETPIALPTWLSEEDINYFASKFEKSGFTGGLNYYRCLDLNWEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA++ VPVKFIVGDLD+TY++PG ++YIHKGG K+ VP L++VVV+EGVGHFI++
Sbjct  243   TAPWTGAQIKVPVKFIVGDLDLTYHSPGVQDYIHKGGFKKLVPFLQDVVVMEGVGHFINQ  302

Query  1293  EKPHEINTHILNFLHNF  1343
             E+ H+I+ HI  F+  F
Sbjct  303   ERAHDISDHIYEFIKKF  319



>gb|KFK41013.1| hypothetical protein AALP_AA2G073900 [Arabis alpina]
Length=325

 Score =   376 bits (965),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 207/385 (54%), Positives = 252/385 (65%), Gaps = 72/385 (19%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQT-GQG----PVVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             M+GIEH ++ VNGI+MHVA+  G G    P++LF+HGFPE WYTWRHQM  L+S GYR +
Sbjct  1     MDGIEHKTLKVNGINMHVAEKPGSGSEGDPIILFIHGFPELWYTWRHQMVALSSLGYRTI  60

Query  387   APDLRGYGDTTGAPTDDPSK---FTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAW  557
             APDLRGYGDT     D P K   +T L+VVGDLVAL++ V + +EKVFVVGHDWGAM+AW
Sbjct  61    APDLRGYGDT-----DAPEKVEEYTYLNVVGDLVALINTVTSGDEKVFVVGHDWGAMIAW  115

Query  558   ALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLH  737
              LC+YRP+KVKALVNMSV FTPRNP   P+ TLR V+GDDYYICRFQK     +I  +  
Sbjct  116   QLCMYRPEKVKALVNMSVVFTPRNPDRVPVPTLRRVFGDDYYICRFQK---PGEIEAEFK  172

Query  738   PIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVL  917
              +G                                          ++  EF    T K L
Sbjct  173   KLGTE----------------------------------------KVLKEFLTYKTPKPL  192

Query  918   QCFLTYYNPSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYR  1088
                         ++P KG+LF+GS +    LP WL++ D+DYYT+K+EK GFTG INYYR
Sbjct  193   ------------FIP-KGELFKGSENAAAALPHWLTQEDLDYYTTKYEKRGFTGAINYYR  239

Query  1089  ALDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvle  1268
              LD  WEL+A WTGAK+ VPVKFIVGD D+TYN+PGAKEYIH GG K+DVPLL+E VVLE
Sbjct  240   NLDRSWELTAPWTGAKIAVPVKFIVGDQDLTYNSPGAKEYIHGGGFKKDVPLLDETVVLE  299

Query  1269  GVGHFIHEEKPHEINTHILNFLHNF  1343
             G+GHF+HEE P EIN HI +F   F
Sbjct  300   GLGHFLHEENPEEINQHIHSFFQKF  324



>ref|XP_003632381.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   375 bits (964),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/377 (51%), Positives = 244/377 (65%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H ++ VNGI+MHVA+ G+GP +LFLHGFPE WY+WRHQ+  L+S GYRA+APDLR
Sbjct  1     MEKIQHRNLRVNGINMHVAEIGEGPPILFLHGFPELWYSWRHQLLSLSSLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+  P+ +T+LH+VGDL+ALL  +   +  VF+VGHDWGA +AW  CL RPD
Sbjct  61    GYGDSDAPPS--PASYTALHIVGDLIALLDSLRLGQ--VFLVGHDWGAAIAWYFCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP  KP+E++R ++GDDYY+                         
Sbjct  117   RVKALVNMSVVFRPRNPTRKPIESMRVLFGDDYYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G  E EFA LGT+ V++ FL   N
Sbjct  152   ---------CRF---------------------QEPGLAENEFARLGTETVMKIFLGSRN  181

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P  +PK+   + G+      LP WLS+ D+DY+ SKF + GFTGG+NYYRALDL WE 
Sbjct  182   PRPPRMPKE-SWYSGALKTPTALPPWLSQEDIDYFASKFNQNGFTGGLNYYRALDLSWEA  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
              A WTG  + VPVKFIVGDLD TYN PG KEYIH GG KR+VP L+E+V++EGV HFI++
Sbjct  241   LAPWTGVPIKVPVKFIVGDLDTTYNTPGVKEYIHNGGFKREVPFLQELVIMEGVAHFINQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EIN HI +F+  F
Sbjct  301   ERPEEINAHIYDFIRRF  317



>ref|XP_010105136.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03944.1| Epoxide hydrolase 2 [Morus notabilis]
Length=347

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 200/364 (55%), Positives = 240/364 (66%), Gaps = 61/364 (17%)
 Frame = +3

Query  267   MHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYGDTTGAPTDDPSK  446
             MHVA+ G GPV+L +HGFPE WYTWRHQ+  LAS GYRA+APDLRGYGDT  AP D  +K
Sbjct  1     MHVAEKGNGPVILLVHGFPELWYTWRHQIMALASLGYRAIAPDLRGYGDTD-AP-DSAAK  58

Query  447   FTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVKALVNMSVCFTPR  626
             +T   VVGDL+ALL  VA +EEKVFVVGHDWGA+++W LCL+RPD+VKALVN+SV F PR
Sbjct  59    YTCFDVVGDLIALLDAVAGEEEKVFVVGHDWGALISWYLCLFRPDRVKALVNLSVAFNPR  118

Query  627   NPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACSASSCCQCRFDIW  806
             NP  KP ETLRA+YGDDYY+CRFQ+                                   
Sbjct  119   NPNRKPYETLRALYGDDYYVCRFQEPG---------------------------------  145

Query  807   HWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSPLYLPKKGKLFEG  986
                     EI+  F              A +G   V++ F TY +P PL++P KGK F  
Sbjct  146   --------EIEAEF--------------AEIGAATVIKEFYTYRSPKPLFMP-KGKCFGH  182

Query  987   STDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTGAKVMVPVKF  1157
               D    LPSW+S+ D+DYY SKFEKTGFTGGINYYR +D +WEL+A WTGAK+ VPVKF
Sbjct  183   PKDTPIALPSWVSEEDMDYYASKFEKTGFTGGINYYRNIDRNWELTAPWTGAKMQVPVKF  242

Query  1158  IVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEINTHILNFLH  1337
             IVGD D+ YN  G K+YIHKGG KRDVP L+EVVV+EGVGHF++EEK  E+  HI +F  
Sbjct  243   IVGDQDLVYNLYGTKDYIHKGGFKRDVPFLQEVVVMEGVGHFVNEEKADEVTQHIYDFFS  302

Query  1338  NFSS  1349
                S
Sbjct  303   KSQS  306



>ref|XP_008355493.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=316

 Score =   372 bits (956),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 192/375 (51%), Positives = 245/375 (65%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI+MHVA  G GP VLFLHGFPE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MENIEHTTVPTNGINMHVASIGTGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P+  P+ +T++H+VGDL+ LL  +  D+  VF+V HDWGA+MAW  CL+RPD
Sbjct  61    GFGDTDAPPS--PTSYTAMHIVGDLIGLLDHLGIDQ--VFLVAHDWGAVMAWWFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F+PRNPK KP++T RA++GDDYYI                         
Sbjct  117   RVKALVNMSVAFSPRNPKRKPIDTFRALFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE +F  + T  V++CFLT  +
Sbjct  152   ---------CRF---------------------QEPGEIEQDFDSIDTAAVMKCFLTGRS  181

Query  942   PSPLYLPKKGKLFE-GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  +PK   L    +   LP+WL++ DV+Y+ SKF KTGFTGG+NYYRAL+L WEL+ 
Sbjct  182   PKPPCIPKDQGLKSWAAPVTLPAWLTEEDVNYFASKFSKTGFTGGLNYYRALNLTWELTG  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVKFIVGDLDITY+ PG + YIHKGG KRDVP L+EVVV+E   HFI++EK
Sbjct  242   PWTGLQIKVPVKFIVGDLDITYHIPGIQNYIHKGGFKRDVPFLQEVVVMEDAAHFINQEK  301

Query  1299  PHEINTHILNFLHNF  1343
             P E++ H+ +F+  F
Sbjct  302   PDEVSQHVYDFIKKF  316



>gb|AAA81893.1| epoxide hydrolase, partial [Solanum tuberosum]
Length=305

 Score =   369 bits (948),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 238/361 (66%), Gaps = 59/361 (16%)
 Frame = +3

Query  270   HVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYGDTTGAPTDDPSKF  449
             H+A+ GQGP +LF+HGFPE WY+WRHQM +LA +GYRAVAPDLRGYGDTTGAP +DPSKF
Sbjct  1     HIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPINDPSKF  60

Query  450   TSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVKALVNMSVCFTPRN  629
             +  H+VGD+VALL  +A +E+KVFVV HDWGA +AW LCL+RPDKVKALVN+SV + PRN
Sbjct  61    SIFHLVGDVVALLEAIAPNEDKVFVVAHDWGAFIAWHLCLFRPDKVKALVNLSVHYLPRN  120

Query  630   PKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACSASSCCQCRFDIWH  809
                 P+E L+A+YG+DYYICRFQ   V   I  +  PIG +S                  
Sbjct  121   SNMNPVEGLKALYGEDYYICRFQ---VQGDIEAEFAPIGAKS------------------  159

Query  810   WLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSPLYLPKKGKLFEGS  989
                                               VL+  LTY +P+P Y P KGK  E  
Sbjct  160   ----------------------------------VLKKMLTYRDPAPFYFP-KGKGLEAI  184

Query  990   TD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTGAKVMVPVKFI  1160
              D    L +WLS+ ++DYY SKFE+TGFTG +NYYRAL +D EL+A W GA+V VP KFI
Sbjct  185   ADAPIALSTWLSEEELDYYASKFEQTGFTGALNYYRALSIDSELTAPWQGAEVKVPTKFI  244

Query  1161  VGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEINTHILNFLHN  1340
             VG+  + Y+  GAKEYIH GG K+ VPLLEEVVVLEG  HF+++E+PHEI+ HI +F+  
Sbjct  245   VGEFALVYHMRGAKEYIHNGGFKKYVPLLEEVVVLEGAAHFVNQERPHEISKHIYDFIQK  304

Query  1341  F  1343
             F
Sbjct  305   F  305



>ref|XP_008789846.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   370 bits (949),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 193/377 (51%), Positives = 253/377 (67%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI H +V+VNGI+MH+A+ G+GP+VLF+HGFPE WY+WRHQM  LA +GYRAVAPDLR
Sbjct  1     MEGITHRTVAVNGINMHIAEKGEGPMVLFVHGFPELWYSWRHQMVALAGRGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   + +T  H+VG    +  + A   ++VFVVGHDWGA++AW LC+ RPD
Sbjct  61    GYGDTDAPPS--ATDYTIFHLVG--DLVALLDALALDQVFVVGHDWGAVVAWWLCMLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V+ALVNMSV F+PRNP  +P+++LRA++GDD+YICRFQ+                   G
Sbjct  117   RVRALVNMSVAFSPRNPARRPVDSLRALFGDDHYICRFQE------------------PG  158

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A  A                                     EFA + T  +L+ FL Y  
Sbjct  159   AVEA-------------------------------------EFARISTALLLKKFLAYRK  181

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P  L + K+ K F GS D    LPSWL++ DV+YYTSKFEK+GFTGG+NYYR L+L+WEL
Sbjct  182   PEALLVSKE-KGFGGSPDTEITLPSWLTEEDVNYYTSKFEKSGFTGGLNYYRCLNLNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTG ++ VPVKFIVGDLD+TY+ PG ++Y+HKGG KRDVP L +VVV++GVGHF+++
Sbjct  241   TAPWTGVQIKVPVKFIVGDLDLTYHTPGIQDYLHKGGFKRDVPFLHDVVVMQGVGHFLNQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             EKPHEI+ HI  F+  F
Sbjct  301   EKPHEISDHIYEFIQKF  317



>ref|XP_011006451.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=322

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 203/380 (53%), Positives = 250/380 (66%), Gaps = 64/380 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             M+ IEH ++  NGI+MHVA  G    PV+LFLHGFPE WY+WR+Q+  L+S GYR+VAPD
Sbjct  1     MDSIEHRTIHANGITMHVAIKGSENAPVILFLHGFPESWYSWRYQILALSSLGYRSVAPD  60

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             LRGYGDT  AP +  S +T  H+VGDL+ LL VVA +E+KVFVV HDWGA++AW +CL+R
Sbjct  61    LRGYGDTD-APAEITS-YTCFHLVGDLIGLLDVVAPNEDKVFVVAHDWGAVIAWYMCLFR  118

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVN SV F PRNP+ K +ETLRA+YGDDYY+                       
Sbjct  119   PDRVKALVNTSVLFIPRNPERKFVETLRALYGDDYYM-----------------------  155

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                        CRF                     QE G IE E+A  GT++VL+  LTY
Sbjct  156   -----------CRF---------------------QEPGVIEAEYAERGTERVLKELLTY  183

Query  936   YNPSPLYLPKKGKLFEGSTDD----LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLD  1103
                 PL+LPK GK   G+  D    LPSWLS+ D  YYT+KFE+ GFTGG+NYYR LD +
Sbjct  184   RVAGPLFLPK-GKGLNGTPLDAPIVLPSWLSEEDFKYYTNKFEQKGFTGGLNYYRNLDRN  242

Query  1104  WELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHF  1283
             WEL+A WTGA+V VPVKFIVGD D+TYN+ G K+YI  GG KRDVP LEE+VV+EGVGHF
Sbjct  243   WELTAPWTGAQVTVPVKFIVGDEDLTYNSLGGKDYIDSGGFKRDVPFLEELVVMEGVGHF  302

Query  1284  IHEEKPHEINTHILNFLHNF  1343
             +++EK  EIN HI +F   F
Sbjct  303   LNQEKADEINKHIYDFFQKF  322



>ref|XP_008784769.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=322

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/377 (51%), Positives = 245/377 (65%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M  I H  V VNGI+MH+A+ G+GPVVL LHGFPE WY+WRHQ+  LA++GYRA+APDLR
Sbjct  6     MAEISHRLVEVNGINMHIAEKGEGPVVLLLHGFPELWYSWRHQILALAARGYRAIAPDLR  65

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P  D S +T  HVVGDLVAL+  +   +EKVFVVGHDWGA++AW+LCL+RPD
Sbjct  66    GFGDTDAPP--DVSSYTMFHVVGDLVALIHTLG--QEKVFVVGHDWGALVAWSLCLFRPD  121

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KV+ALVN+SV F PR+P  KP+ET RA+YGDDYYIC FQ+            P    +E 
Sbjct  122   KVRALVNLSVAFRPRSPDRKPVETFRALYGDDYYICTFQE------------PGRTEAEF  169

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A   ++    +F  +H                                           +
Sbjct  170   ARIPTALVIKKFLTYH-------------------------------------------D  186

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P+ + K+   F  S D    LPSWLS+ DVDY+ SKF+K+GFTGG+NYYRALDL+WEL
Sbjct  187   PGPVIVSKENG-FAASPDKEITLPSWLSEEDVDYFASKFDKSGFTGGLNYYRALDLNWEL  245

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTG ++ VPVKFIVG+ D+ YN PG K+YIHKGG +RDVP LE+VVV+EG GHFI++
Sbjct  246   TAPWTGMQIKVPVKFIVGNQDLIYNIPGVKDYIHKGGFERDVPFLEDVVVIEGAGHFINQ  305

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP EI  HI  F+  F
Sbjct  306   EKPQEITDHIYEFIQKF  322



>emb|CDP17111.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 192/377 (51%), Positives = 247/377 (66%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ I+H  V VNGI++HVA+ G GP +LFLHGFPE WY+WRHQ+  L+++GYRA+APDLR
Sbjct  1     MDKIQHRQVPVNGINLHVAEIGDGPAILFLHGFPELWYSWRHQLLSLSAKGYRALAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+  PS +T+LH+VGDLV LL  +  D  +VF+VGHDWGA+MAW  CL RPD
Sbjct  61    GYGDSDAPPS--PSNYTALHIVGDLVGLLDSLGLD--RVFLVGHDWGAVMAWYFCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVNMSV FTPRNPK KPLE +RA +GDDYYICRFQ+              G   E 
Sbjct  117   RIKALVNMSVVFTPRNPKRKPLEAMRARFGDDYYICRFQEP-------------GEAEEE  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                  +                  I  +FL S + G                        
Sbjct  164   FARVDTA----------------RIIKKFLTSRRPG------------------------  183

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               PL +PK+   F GS  +   LPSWLS++DV+Y+ SKF + GFTGG+NYYRA+DL+WEL
Sbjct  184   --PLCVPKEVG-FGGSPHNPIQLPSWLSEDDVNYFASKFSQKGFTGGLNYYRAMDLNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTG ++ VPVKFIVGDLD+T+  PG KEYI KGG KRDVP L+E+VV+EGV HF+++
Sbjct  241   TAPWTGLQIKVPVKFIVGDLDVTFTTPGVKEYIQKGGFKRDVPFLQELVVMEGVAHFVNQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP E++ HI +F+  F
Sbjct  301   EKPEEVSAHIYDFIQKF  317



>ref|NP_567228.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAC19281.1| T14P8.15 [Arabidopsis thaliana]
 emb|CAB80727.1| AT4g02340 [Arabidopsis thaliana]
 gb|AAM26670.1| AT4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AAN18121.1| At4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AEE82157.1| putative epoxide hydrolase [Arabidopsis thaliana]
Length=324

 Score =   367 bits (943),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 242/378 (64%), Gaps = 62/378 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++S NGI+MHVA  G GPV+LF+HGFP+ WY+WRHQ+   A+ GYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGPVILFVHGFPDLWYSWRHQLVSFAALGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+ +   +T LH+VGDLV LL  +  D  +VF+VGHDWGA++AW LC+ RPD
Sbjct  61    GYGDSDAPPSRE--SYTILHIVGDLVGLLDSLGVD--RVFLVGHDWGAIVAWWLCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V ALVN SV F PRNP  KP++  RA++GDDYYI                         
Sbjct  117   RVNALVNTSVVFNPRNPSVKPVDAFRALFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE +FA + TKK++  F T  N
Sbjct  152   ---------CRF---------------------QEPGEIEEDFAQVDTKKLITRFFTSRN  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRAL+L WEL+
Sbjct  182   PRPPCIPKSVG-FRGLPDPPSLPAWLTEQDVRFYGDKFSQKGFTGGLNYYRALNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTG ++ VPVKFIVGDLDITYN PG KEYIH+GGLK+ VP L+EVVV+EGVGHF+H+E
Sbjct  241   APWTGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLHQE  300

Query  1296  KPHEINTHILNFLHNFSS  1349
             KP E+  HI  F   F +
Sbjct  301   KPDEVTDHIYGFFKKFRT  318



>gb|EPS69728.1| epoxide hydrolase [Genlisea aurea]
Length=318

 Score =   367 bits (942),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 195/375 (52%), Positives = 241/375 (64%), Gaps = 58/375 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ I H +V+ NG+ MHVA+ G+GP VLF+HGFPE WY+WRHQM FLA++GYRAVAPDLR
Sbjct  1     MDEIRHRTVAANGLQMHVAELGEGPTVLFVHGFPELWYSWRHQMSFLAARGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDTTGAP  D SKFT +H+VGDL+ALL  +A DE KVFVVGHDWGA++ W LCLYRPD
Sbjct  61    GFGDTTGAPIGDASKFTVVHLVGDLIALLDAIAPDEGKVFVVGHDWGAVVTWQLCLYRPD  120

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV  + RNP    ++ LR  YGDDYY+ RFQ+                    
Sbjct  121   RVKALVNLSVPLSRRNPDRSIVDALRKAYGDDYYVIRFQEPG------------------  162

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    EI+  F              A +G K+V +    Y  
Sbjct  163   -----------------------EIEAEF--------------AEIGFKQVFKNIFAYRT  185

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P PLYLP KGK F G + D PSWL++ D+DY+ +KF+++GFTGG+NYYRA  L WEL AA
Sbjct  186   PGPLYLP-KGKGF-GYSADRPSWLTEEDLDYFVTKFQQSGFTGGVNYYRAWPLSWELDAA  243

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIH-KGGLKRDVPlleevvvleGVGHFIHEEK  1298
             W  AKV VP KFIVGDLD+TY+ PG KE IH   G K  VP L+EVVV+E  GHFI++EK
Sbjct  244   WADAKVNVPTKFIVGDLDLTYHNPGVKELIHGDDGFKGRVPSLKEVVVVEDAGHFINQEK  303

Query  1299  PHEINTHILNFLHNF  1343
             P  I+ HI  FL  +
Sbjct  304   PDLISQHIYAFLEQY  318



>ref|XP_008775993.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=318

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 193/372 (52%), Positives = 240/372 (65%), Gaps = 59/372 (16%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGY  407
             GI H +V VNGI MHVA+ G+GP VL LHGFPE  Y+WRHQ+  LA++GYRA+APDLRGY
Sbjct  6     GISHRTVEVNGIRMHVAEKGEGPAVLLLHGFPELGYSWRHQIAGLAARGYRAIAPDLRGY  65

Query  408   GDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKV  587
             GDT   P  D + +T  H+VGDLVALL  ++  +  VFVVGHDWGA +AW LCL+RPD+V
Sbjct  66    GDTDAPP--DVASYTICHLVGDLVALLDALSLSQ--VFVVGHDWGAFVAWHLCLFRPDRV  121

Query  588   KALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGAC  767
             KALVN+SV F PR P +KPL+  RA+YGDD YI RFQ+                   GA 
Sbjct  122   KALVNLSVAFMPRKPAAKPLDDFRALYGDDSYISRFQE------------------PGAA  163

Query  768   SASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPS  947
              A                                     EFA LGT  VL+ F TY NP 
Sbjct  164   EA-------------------------------------EFARLGTATVLRKFFTYRNPG  186

Query  948   PLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWT  1127
             P+++PK G         LPSWLS+ D++Y+ SKFEK+GFTG INYYR  DL+WEL+A WT
Sbjct  187   PIFIPKDGWGSPNEHITLPSWLSEEDINYFKSKFEKSGFTGPINYYRCFDLNWELAAPWT  246

Query  1128  GAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHE  1307
             GA++ VP KFI+GDLD+TY+ P  ++YIHKGG K+DVP L+EVVV+EGV HFI++EK  E
Sbjct  247   GAQIKVPAKFIIGDLDLTYHFPRMQDYIHKGGFKKDVPFLQEVVVMEGVAHFINQEKAQE  306

Query  1308  INTHILNFLHNF  1343
             I  HI +F+  F
Sbjct  307   ITDHIYDFIQKF  318



>ref|XP_010914485.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=319

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 196/373 (53%), Positives = 242/373 (65%), Gaps = 60/373 (16%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGY  407
             GI H +V VNGI MHVA+ G+GP VL LHGFPE WYTWRHQ+  LA++GYRA+APDLRGY
Sbjct  6     GISHRTVEVNGIRMHVAEKGEGPPVLLLHGFPELWYTWRHQIAGLAARGYRAIAPDLRGY  65

Query  408   GDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKV  587
             GDT   P  D + +T  H+VGDLVALL  +A  +  VFVVGHDWGA +AW LC+ RPD+V
Sbjct  66    GDTDAPP--DVASYTVFHLVGDLVALLDTLALSQ--VFVVGHDWGAFVAWHLCMLRPDRV  121

Query  588   KALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGAC  767
             KALVN+SV F  RNP +KPL+ +RA YGD+YYI RFQ++                  GA 
Sbjct  122   KALVNLSVPFMSRNPAAKPLDRVRASYGDEYYIIRFQEH------------------GAA  163

Query  768   SASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPS  947
              A                                     EFA LGT  VL+ F TY NP 
Sbjct  164   EA-------------------------------------EFARLGTATVLRKFFTYRNPG  186

Query  948   PLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWT  1127
             PL++PK+G         LP WLS+ D++Y TSKFEK+GFTG INYYR LDL+WEL+A WT
Sbjct  187   PLFMPKEGWCSPNEQIPLPFWLSEEDINYLTSKFEKSGFTGPINYYRCLDLNWELAAPWT  246

Query  1128  GAKVMVPVKFIVGDLDITY-NAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPH  1304
             GA++ VP KFI+GDLD+ Y + P  ++YIHKGG ++DVPLL EVVV+EGV HFI++EK  
Sbjct  247   GAQIKVPTKFIIGDLDLNYHDPPLMQDYIHKGGFQKDVPLLREVVVMEGVAHFINQEKAQ  306

Query  1305  EINTHILNFLHNF  1343
             EI  HI +F+  F
Sbjct  307   EITDHIYDFIRKF  319



>ref|XP_007015353.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32972.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 246/378 (65%), Gaps = 61/378 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEG+EH ++ VNGI+MH+A+ GQGPV+LFLHGFPE WY+WRHQ+  L+S GYRAVAPDLR
Sbjct  1     MEGVEHRTLKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQINALSSLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP D  S +T  HVVGDLV LL  VA  +EKVFVVGHDWGA MAW LCL+RPD
Sbjct  61    GFGDTD-AP-DRVSSYTCFHVVGDLVQLLDAVAPPQEKVFVVGHDWGAFMAWYLCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKAL+N+SV +     +  P++  RA YG+DYYI                         
Sbjct  119   KVKALLNLSVPYIQLGRQMNPIDGWRAFYGNDYYI-------------------------  153

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE EFA +GT++V++ FLTY  
Sbjct  154   ---------CRF---------------------QEPGEIEAEFAEIGTERVVKEFLTYRV  183

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P+ LP+ GKLF  S D    LPSWL++ +V+YY ++F+K GFTGGINYYR  + +WEL
Sbjct  184   PGPILLPE-GKLFGHSADTPITLPSWLTQEEVNYYVTQFDKKGFTGGINYYRNFNRNWEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
              A W G ++ VP KFIVGD D+ Y+ PG KEYIH GG K+DVP L++VVV+EGVGHFI+ 
Sbjct  243   LAPWGGCEIKVPAKFIVGDQDLVYHMPGIKEYIHNGGFKKDVPHLQQVVVMEGVGHFINM  302

Query  1293  EKPHEINTHILNFLHNFS  1346
             EK  +IN HI +F   F 
Sbjct  303   EKADDINKHIYDFFRQFD  320



>ref|XP_010038230.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50053.1| hypothetical protein EUGRSUZ_K03494 [Eucalyptus grandis]
Length=319

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 197/378 (52%), Positives = 239/378 (63%), Gaps = 63/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQ--GPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             ME IEH +V  NGI+MHVA  G   G  VLFLHGFP+ WYTWR QM  LA+ GYRAVAPD
Sbjct  1     METIEHATVPTNGINMHVASVGGAGGDTVLFLHGFPDLWYTWRRQMLSLAALGYRAVAPD  60

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             LRGYGDT   P+   + +T+ H+VGDLV LL  +    E+VF+VGHDWGA+MAW  CL R
Sbjct  61    LRGYGDTDAPPS--AASYTAFHIVGDLVGLLDALGV--ERVFLVGHDWGAVMAWYFCLLR  116

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVN SV F PRNPK KP+++LRA++GDDYYI                       
Sbjct  117   PDRVKALVNTSVVFQPRNPKRKPIDSLRALFGDDYYI-----------------------  153

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                        CRF                     QE GE E +FA     K+++ FLT 
Sbjct  154   -----------CRF---------------------QEPGEAEEDFARADITKLMKLFLTS  181

Query  936   YNPSPLYLPKKGKL--FEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
              NP P  +PK+        S D LP WLS+ DV+YY SKF + GFTGG+NYYRAL+L WE
Sbjct  182   RNPKPPCIPKEIGYSGLANSRDKLPPWLSEEDVNYYASKFSQKGFTGGLNYYRALNLTWE  241

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG ++ VPVKFIVGDLDITY+ PG KEYIH GGLK+ VP L+EVVV+EGV HF+ 
Sbjct  242   LAAPWTGVQIKVPVKFIVGDLDITYHVPGVKEYIHNGGLKKLVPFLQEVVVMEGVAHFLQ  301

Query  1290  EEKPHEINTHILNFLHNF  1343
             +EKP E+  HI +F+  F
Sbjct  302   QEKPEEVTNHIYDFIKKF  319



>ref|XP_004298141.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=322

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 199/377 (53%), Positives = 250/377 (66%), Gaps = 59/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEG+EH +V VNGI+MHVA+ GQG VVL +HGFPE WY+WRHQ+  LAS GYRAVAPDLR
Sbjct  1     MEGVEHRTVRVNGINMHVAEKGQGQVVLLIHGFPELWYSWRHQIQSLASLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP D  S +T  HVVGDL+ALL  VA D++KVFVVGHDWGA++AW LCL+RPD
Sbjct  61    GFGDTD-APAD-ASSYTCFHVVGDLIALLDTVAGDQKKVFVVGHDWGALIAWYLCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV + PRNP+ K LE+++A YG+DY+ C+F +  +  +I  +   IG     
Sbjct  119   RVKALVNLSVQYFPRNPQRKILESMKAAYGEDYHFCKFSE-FLPGEIEAEFAQIG-----  172

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                            T +V++ FLTY +
Sbjct  173   -----------------------------------------------TARVIREFLTYRH  185

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+LP KGK F   +D    LPSWLS+ DV+YY  KFEK GFTGGINYYR  D +WEL
Sbjct  186   PGPLFLP-KGKGFGHPSDSPIALPSWLSEADVNYYVGKFEKKGFTGGINYYRNSDRNWEL  244

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
              A WTGA+V VPVK+IVGD D+ YN+ GAK+YIH G  K+ VP LEEVV++EGV HFI++
Sbjct  245   LAPWTGAQVKVPVKYIVGDQDLVYNSLGAKDYIHNGEFKKYVPFLEEVVIMEGVAHFINQ  304

Query  1293  EKPHEINTHILNFLHNF  1343
             EK  EI+ HI +F+  F
Sbjct  305   EKGDEISKHIHDFIKKF  321



>ref|XP_009335707.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
 ref|XP_009335715.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=316

 Score =   365 bits (938),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 190/375 (51%), Positives = 243/375 (65%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI+MHVA  G GP VLFLHGFPE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MENIEHTTVPTNGINMHVASIGTGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P+  P+ +T++H+VGDL+ LL  +  D+  VF+V HDWGA+MAW  CL+RPD
Sbjct  61    GFGDTDAPPS--PTSYTAMHIVGDLIGLLDHLGIDQ--VFLVAHDWGAVMAWWFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F+PRNPK KP++T RA++GDDYYI                         
Sbjct  117   RVKALVNMSVAFSPRNPKRKPIDTFRALFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE +F  + T  V++ FLT  +
Sbjct  152   ---------CRF---------------------QEPGEIEQDFDSIDTAAVMKRFLTGRS  181

Query  942   PSPLYLPKKGKLFE-GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  +PK   L    +   LP+WL++ DV+Y+ SKF KTGFTGG+NYYRAL+L WEL+ 
Sbjct  182   PKPPCIPKDQGLKSWAAPVTLPAWLTEEDVNYFASKFSKTGFTGGLNYYRALNLTWELTG  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVKFIVGDLDITY+ PG + YIHKGG KRDV  L+EVVV+E   HFI++EK
Sbjct  242   PWTGLQIKVPVKFIVGDLDITYHIPGIQNYIHKGGFKRDVAFLQEVVVMEDAAHFINQEK  301

Query  1299  PHEINTHILNFLHNF  1343
             P E++ H+ +F+  F
Sbjct  302   PDEVSQHVYDFIKKF  316



>gb|KDP27828.1| hypothetical protein JCGZ_18908 [Jatropha curcas]
Length=321

 Score =   365 bits (938),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 200/379 (53%), Positives = 246/379 (65%), Gaps = 63/379 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             ME IEH +V+VNGI+MHVA+ G  QGPV+LF+HGFPE WY WR ++  LASQGYRAVAPD
Sbjct  1     MEAIEHKTVNVNGINMHVAELGPVQGPVILFIHGFPELWYCWRREILALASQGYRAVAPD  60

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             LRGYGDT  AP D P  +   H+VGDL+ LL  VA  +EKVF VGHDWGA +AW LCL+R
Sbjct  61    LRGYGDTD-APAD-PQSYPCFHIVGDLIGLLDAVAPQQEKVFGVGHDWGAPIAWDLCLFR  118

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVN+SV F  RNP+ K ++  RA YGDD+Y+CRFQ                   
Sbjct  119   PDRVKALVNLSVPFFRRNPEMKFVDAFRAAYGDDFYMCRFQ-------------------  159

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                                   +Y +I+  F              A LGT++V++ FLTY
Sbjct  160   ----------------------EYGDIEAEF--------------AELGTERVMKEFLTY  183

Query  936   YNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
              NP P   P KGK+F     D   LPSWLS+ +V YYT+KF+KTG TGG+NYYR +D +W
Sbjct  184   RNPGPFIFP-KGKVFSQPAGDPIILPSWLSEEEVHYYTTKFDKTGLTGGVNYYRNIDRNW  242

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+A WT A+V VP KFIVGD D+ Y   G K+YI KGG KRDVPLLEEVVV+EGV HF+
Sbjct  243   ELTAPWTEAQVKVPSKFIVGDEDLVYRFVGMKDYIEKGGFKRDVPLLEEVVVMEGVAHFL  302

Query  1287  HEEKPHEINTHILNFLHNF  1343
             ++E+P EIN HI +F   F
Sbjct  303   NQERPDEINNHIYDFFKKF  321



>ref|XP_002270853.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   365 bits (937),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 200/376 (53%), Positives = 243/376 (65%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +V  NGI++H+A+ GQGP++L LHGFPE WY+WRHQ+  LAS GYRAVAPDLR
Sbjct  1     MEGIEHTTVRANGINIHLAEKGQGPIILLLHGFPEFWYSWRHQIHALASLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+  AP D  S +T  H+VGDL+ +L  + AD  KVFVVGHDWGA + W LCL+RPD
Sbjct  61    GYGDSD-APADVDS-YTYFHLVGDLIGVLDAIGAD--KVFVVGHDWGAFIGWNLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F+PRN  +KPL+T RA+YGDDYYI                         
Sbjct  117   RVKALVNLSVSFSPRNAMNKPLQTFRALYGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G IE EFA +G  KVL+ FLT   
Sbjct  152   ---------CRF---------------------QEPGAIETEFAEIGIDKVLKYFLTSLP  181

Query  942   PSPLYLPKKGKLFE--GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
               PL+LPK   L +  G    LPSWLS+ +++YY +K+E TGFTGG+NYYR LDL WEL+
Sbjct  182   AGPLFLPKGKALRDQLGIPITLPSWLSEEELNYYVTKYENTGFTGGLNYYRNLDLSWELT  241

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTG++V VP KFIVGDLD+TYN PG  E +    LK+ VPLLEEVVV++GVGHF+ EE
Sbjct  242   APWTGSQVEVPAKFIVGDLDLTYNTPGFNESMTFDELKKHVPLLEEVVVMKGVGHFLQEE  301

Query  1296  KPHEINTHILNFLHNF  1343
             K  EIN HI  F   F
Sbjct  302   KADEINQHIHAFFQRF  317



>ref|XP_011079631.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/374 (50%), Positives = 240/374 (64%), Gaps = 57/374 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H  +  NGI++HVA+ G+GP +LFLHGFPE WYTWRHQM  L+S+GYRA+APDLR
Sbjct  1     MERIQHRHIQTNGINIHVAEIGEGPAILFLHGFPELWYTWRHQMLSLSSRGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+   S +T+ H++GDLV LL  +  D+  VF+VGHDWGA+MAW  CL+RPD
Sbjct  61    GYGDSDAPPS--ASSYTAFHIIGDLVGLLDALGLDQ--VFLVGHDWGAVMAWYFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVNMSV F PRNP+ KP+E++RA+ GDDYYICRFQK            P     E 
Sbjct  117   RIKALVNMSVVFQPRNPRRKPVESMRAILGDDYYICRFQK------------PGEAEEEF  164

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A   ++    +F      L       LR       GG  +                    
Sbjct  165   ARVDTAQLIKKF------LISRNPTPLRVPKEVGFGGRTD--------------------  198

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
               P+ LP              SWLS++DV YY +KF K GFTGG+NYYRA+DL WEL+AA
Sbjct  199   -KPIILP--------------SWLSEDDVQYYATKFNKKGFTGGLNYYRAMDLTWELTAA  243

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             WTG ++ VPVKFIVGDLD+TYN PG KEYIH GG ++ VP L+E+V++EGV HF+++EKP
Sbjct  244   WTGVQIKVPVKFIVGDLDLTYNTPGVKEYIHNGGFRKQVPFLQELVIMEGVAHFLNQEKP  303

Query  1302  HEINTHILNFLHNF  1343
              EI+ HI +F+  F
Sbjct  304   EEISQHIYDFVQRF  317



>gb|KEH24395.1| epoxide hydrolase [Medicago truncatula]
Length=317

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 193/377 (51%), Positives = 241/377 (64%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI MHVA  G GPV++FLHGFPE WY+WRHQ+  L++ GYRAVAPDLR
Sbjct  1     MEKIEHTTVQTNGIKMHVASIGSGPVIIFLHGFPELWYSWRHQLLSLSALGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT    +   S +T+ H+VGDLV LL  +  D  +VF+VGHDWGA MAW  CL +PD
Sbjct  61    GYGDTDSPSSP--SSYTAHHIVGDLVGLLDALNVD--RVFLVGHDWGAAMAWYFCLLKPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F  RNP  KP++T+RA+ GDDYY+                         
Sbjct  117   RVKALVNMSVVFRSRNPVRKPVQTMRALMGDDYYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE E EFA  G  ++++ FLT  +
Sbjct  152   ---------CRF---------------------QKPGEAEEEFARAGATRIIKSFLTLRD  181

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P  L +PK+   F GS +    LP WLS+ DV+YY +KFE+ GFTGG+NYYRALDL WEL
Sbjct  182   PRALCVPKEIG-FGGSPNTHITLPKWLSEEDVNYYATKFEQKGFTGGLNYYRALDLTWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
              A WTG ++ VP KFIVGDLD+TYN PG KEYIH GG KR+VP L+E+VV+EGV HFI++
Sbjct  241   MAPWTGEQIKVPAKFIVGDLDLTYNTPGVKEYIHNGGFKREVPYLQEMVVMEGVAHFINQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EI+ HI +F+  F
Sbjct  301   ERPEEISAHIYDFIKKF  317



>ref|XP_009775353.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional epoxide hydrolase 
2-like [Nicotiana sylvestris]
Length=318

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 249/377 (66%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H  VSVNGI+MHVA+ G+GP V+F+HGFPE WY+WRHQM +L+ +GYRA+APDLR
Sbjct  1     MEKIQHKYVSVNGINMHVAEIGEGPAVVFVHGFPELWYSWRHQMLYLSKKGYRAMAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P  D + +T+ H+VGDLVALL V+  D+  VF+VGHDWGA++AW   L+RPD
Sbjct  61    GYGDTDSPP--DATHYTAFHIVGDLVALLDVLGLDQ--VFLVGHDWGALIAWYFSLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN+SV F PR+P  KP+++LR ++GDDYY+                         
Sbjct  117   RIKALVNLSVVFRPRHPSRKPVDSLRELFGDDYYV-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E EFA + T  V++ FL+  +
Sbjct  152   ---------CRF---------------------QKPGEVEEEFASVDTATVVKGFLSSRD  181

Query  942   PSPLYLPKKGKLFEG---STDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P  +PK+    +    S   LPSW+++ DV Y+  K ++TGFTGG+NYYR LD +WEL
Sbjct  182   PRPPCIPKEIGFHQALAKSPATLPSWITEEDVHYFAEKLKETGFTGGLNYYRNLDKNWEL  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A ++G K+ VP KF+VGDLD TY+ PG KEYIH GG K++VP L+EVVV+EGVGHFI++
Sbjct  242   TAPFSGCKIQVPTKFVVGDLDXTYHVPGTKEYIHNGGFKKEVPNLQEVVVMEGVGHFINQ  301

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP EIN+HI +F+  F
Sbjct  302   EKPDEINSHIYDFIQRF  318



>ref|XP_006288215.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
 gb|EOA21113.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
Length=324

 Score =   363 bits (931),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/378 (50%), Positives = 237/378 (63%), Gaps = 62/378 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +VS NGI+MHVA  G GPV+LFLHGFP+ WY+WRHQ+   A+ GYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFATLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+  P  ++ LH+VGDLV LL  +  D  +VF+VGHDWGA++AW LC+ RPD
Sbjct  61    GYGDSDAPPS--PESYSILHIVGDLVGLLDSLGVD--RVFLVGHDWGAIIAWWLCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V ALVN SV F PRNP  KP++  RA++GDDYYI                         
Sbjct  117   RVSALVNTSVVFNPRNPTLKPVDAFRALFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE +FA + TKK++  F    N
Sbjct  152   ---------CRF---------------------QEAGEIEEDFAQVDTKKLITKFFVSRN  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRA++L WEL+
Sbjct  182   PRPPCIPKSVG-FRGLPDPPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G ++ VPVKFIVGDLDI YN PG KEYIH GGLK+ VP L+EVVV+EGVGHF+ +E
Sbjct  241   APWAGLQIKVPVKFIVGDLDIVYNIPGTKEYIHDGGLKKHVPFLQEVVVMEGVGHFLQQE  300

Query  1296  KPHEINTHILNFLHNFSS  1349
             KP E+  HI  F   F +
Sbjct  301   KPDEVTDHIYGFFEKFRT  318



>ref|XP_009629123.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   363 bits (931),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/377 (49%), Positives = 249/377 (66%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H +VS+NGI+MHVA+ G+GP V+F+HGFPE WY+WRHQM +L+++GYRA+APDLR
Sbjct  1     MEKIQHKNVSINGINMHVAEIGEGPAVVFVHGFPELWYSWRHQMLYLSNKGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P  D + +T  H+VGDLVALL V+  D+  V++VGHDWGA++AW   L+RPD
Sbjct  61    GYGDTDSPP--DATNYTVFHIVGDLVALLDVLGLDQ--VYLVGHDWGALIAWYFSLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN+SV F PR+P  KP+++LR ++GDDYY+                         
Sbjct  117   RIKALVNLSVVFRPRHPSRKPVDSLRELFGDDYYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E EFA + T  V++ FL+  +
Sbjct  152   ---------CRF---------------------QKPGEVEEEFASVDTATVIKGFLSSRD  181

Query  942   PSPLYLPKKGKLFEG---STDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P  +PK+    +    S   LPSW+++ DV Y+  K +KTGFTGG+NYYR LD +WEL
Sbjct  182   PRPPCIPKEIGFHQALAKSPATLPSWITEEDVHYFAEKLKKTGFTGGLNYYRNLDKNWEL  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A ++G K+ VP KF+VGDLD TY+ PG KEYIH GG K++VP L+EVVV+EG GHFI++
Sbjct  242   TAPFSGCKIQVPTKFVVGDLDATYHVPGTKEYIHNGGFKKEVPNLQEVVVMEGAGHFINQ  301

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP EIN+HI +F+  F
Sbjct  302   EKPAEINSHIYDFIQRF  318



>ref|NP_001055069.1| Os05g0273800 [Oryza sativa Japonica Group]
 dbj|BAF16983.1| Os05g0273800 [Oryza sativa Japonica Group]
 gb|EAY97338.1| hypothetical protein OsI_19261 [Oryza sativa Indica Group]
 dbj|BAG87495.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63064.1| hypothetical protein OsJ_17872 [Oryza sativa Japonica Group]
Length=331

 Score =   362 bits (930),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 246/378 (65%), Gaps = 65/378 (17%)
 Frame = +3

Query  231   IEHISVSVNGISMHVAQTGQ--GPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             I H +V  NG+ MHVA+ G    P VL LHGFP+ WY WRHQM  LA  GYRAVAPDLRG
Sbjct  12    ITHRTVDANGLRMHVAEAGPPGAPPVLLLHGFPQVWYAWRHQMRALADAGYRAVAPDLRG  71

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGD+  AP  +  ++T++HVVGDLVALL  V    + VFVV HDWGA+ AW LCL+RPD+
Sbjct  72    YGDSD-APAAE-LQYTAMHVVGDLVALLDAVVGAGKPVFVVAHDWGALTAWNLCLFRPDR  129

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             V+ALV++SV FTPR+P  +P++ LRA+YGDDYYICR Q+                   GA
Sbjct  130   VRALVSLSVAFTPRSPARRPVDGLRALYGDDYYICRIQE------------------PGA  171

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
               A                                     EFA LGT+ VL+ FL Y  P
Sbjct  172   IEA-------------------------------------EFARLGTELVLRKFLAYRTP  194

Query  945   SPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL +PK G    GS DD   LPSW+++ D+ YY SKF+KT FTGG+NYYRAL+  WEL+
Sbjct  195   GPLMMPKSG---WGSPDDEVPLPSWITEEDIKYYASKFDKTNFTGGLNYYRALNKTWELT  251

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA++ VPVKFIVGDLD+TY+ PG +++IHKGG K+ VPLL++VVV++GVGHFI EE
Sbjct  252   APWTGAEIKVPVKFIVGDLDLTYHTPGIQDFIHKGGFKKYVPLLDDVVVMKGVGHFISEE  311

Query  1296  KPHEINTHILNFLHNFSS  1349
             KP E++ H+++F+   S+
Sbjct  312   KPKEVSEHVISFIRKLSA  329



>ref|XP_010038235.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 194/383 (51%), Positives = 241/383 (63%), Gaps = 66/383 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGP-VVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME IEH +V  NGI+MHVA  G GP  VLF+HGFPE WY+WRHQM  LA+ GYRA+APDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMLSLAALGYRAIAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYG T   P  +   +T+ HVVGDLV +L  +     +VFVVGHDWGA+MAW LCL RP
Sbjct  61    RGYGGTDAPPRVE--SYTAFHVVGDLVGMLDALGIG--RVFVVGHDWGAIMAWHLCLVRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D+VKALVN SV + PRNP+ KP+E++RA +GDDYY+                        
Sbjct  117   DRVKALVNTSVAWFPRNPERKPVESMRATFGDDYYV------------------------  152

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                       CRF                     QE G  E +FA     K++Q FLT  
Sbjct  153   ----------CRF---------------------QEPGVAEEDFAKADIAKLIQLFLTGR  181

Query  939   NPSPLYLPKKG------KLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDL  1100
             +PSP  +PK        KL +    +LPSWL+ +D+ YY ++F +TGFTGG NYYR LDL
Sbjct  182   DPSPPIVPKDVGISGLIKLLDQQQVELPSWLTDDDISYYATQFSRTGFTGGFNYYRCLDL  241

Query  1101  DWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGH  1280
             +WELSA WTGA++ VPVKFIVGDLD+TY+ PG KEYIH GG K+ VP LE+VVV+EGV H
Sbjct  242   NWELSAPWTGARIEVPVKFIVGDLDLTYHFPGVKEYIHDGGFKKAVPNLEDVVVMEGVAH  301

Query  1281  FIHEEKPHEINTHILNFLHNFSS  1349
             F+ +EKP E+  HI +F+  FSS
Sbjct  302   FLQQEKPQEVTAHIHDFIKKFSS  324



>ref|XP_011041992.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 247/377 (66%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V+ NGI+MH+A  G GP +LFLHGFPE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MEKIEHTTVATNGINMHIASIGTGPEILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP D   ++T  H++GDLV L+  +  D  KVF+VGHDWGA++AW  CL RPD
Sbjct  61    GYGDTD-APKDH-REYTVFHILGDLVGLIDSLGID--KVFLVGHDWGAVVAWYFCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVNMSV F PRNP    ++  R ++GDDYYI                         
Sbjct  117   RIKALVNMSVVFQPRNPDKSFVQISRDLFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GE+E +FA + T ++++ FLT  N
Sbjct  152   ---------CRF---------------------QEPGEVEEDFAQMDTARIIRKFLTSRN  181

Query  942   PSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK+   F G  D+  LPSWLS+ D+++Y  KF KTGFTGG+NYYR LDL+WEL+
Sbjct  182   PKPPRIPKEVG-FRGLPDNPNLPSWLSEKDINHYAGKFNKTGFTGGLNYYRCLDLNWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             AAWTG ++ VPVKFIVGDLDITYN PGA++YI +GGLK+ VP L+EV ++EGV HF+++E
Sbjct  241   AAWTGLQIKVPVKFIVGDLDITYNMPGAQDYISEGGLKKYVPFLQEVAIMEGVAHFLNQE  300

Query  1296  KPHEINTHILNFLHNFS  1346
             KP E+++HI +F+  F+
Sbjct  301   KPEEVSSHIYDFIKKFN  317



>ref|XP_009386486.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/377 (50%), Positives = 250/377 (66%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI H ++ VNG+++HVA+ G+GPVVL LHGFPE W++WRHQ+  LA++GYRAVAPDLR
Sbjct  1     MEGISHRTLLVNGVNIHVAEMGEGPVVLLLHGFPELWFSWRHQIVSLAARGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GD+   P+   S +T+ HVVGDLVAL+  +  D+  VFVVGHDWGA MAW LC+ RPD
Sbjct  61    GFGDSDAPPSS--SVYTAFHVVGDLVALIQALGPDQ--VFVVGHDWGAYMAWWLCILRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKALVN+SV + PRNP  +P++  R ++GDD+YICRFQ++                  G
Sbjct  117   MVKALVNLSVAYAPRNPGRRPVDACRTIFGDDHYICRFQEH------------------G  158

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A  A                                     E A +GT   ++ FLTY  
Sbjct  159   AMEA-------------------------------------EIAQIGTTLFMKKFLTYRK  181

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+ + +PK  K  E S +    LPSWLS+ D++Y+ SKFEK+GFTGG+NYYR L+L+WEL
Sbjct  182   PAAINIPKD-KGLEVSLETPVTLPSWLSEEDINYFASKFEKSGFTGGLNYYRCLNLNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             SA WT  +V VPVKFI+GDLD+TY+ PG ++YIHKGG K  VP LE+VVV+EGVGHFI++
Sbjct  241   SAPWTEVQVDVPVKFIIGDLDLTYHTPGIQDYIHKGGFKSAVPFLEDVVVMEGVGHFINQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             E+PHE++  I +F+H F
Sbjct  301   ERPHEVSDLIYHFIHKF  317



>ref|XP_004230258.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=314

 Score =   359 bits (922),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 193/374 (52%), Positives = 243/374 (65%), Gaps = 60/374 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +++VNGI+MHVA+ G+GPVVLFLHGFPE WYTWRHQ+  LA QGYRAVAPDLR
Sbjct  1     MEGIEHRTLNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQIVALADQGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +  S +T  HVVGDLVAL+  +    E VF+V HDWGAM+ W LC++RPD
Sbjct  61    GYGDTD-APKEVTS-YTYFHVVGDLVALIESLGV--ESVFLVAHDWGAMIGWYLCMFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKA V +SV F PRNPK KP+ T+RA  GDDYY+                         
Sbjct  117   LVKAYVCLSVPFRPRNPKMKPIPTMRAFLGDDYYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ G +E E A  G++ +L+  L    
Sbjct  152   ---------CRF---------------------QDPG-MEDEIAKYGSEAILKKILIDRT  180

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P  LPK+      + D LP WLS++D++YY++KF++ GFTGG+NYYRALDL+WEL+A 
Sbjct  181   PGPPRLPKENPFGISTNDKLPLWLSQDDLNYYSTKFDQKGFTGGLNYYRALDLNWELTAP  240

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             WTG KV VPVKF+VGDLD+ Y  PG KEY+H GG K+DVP+LE VVVLEG  HFI++E+ 
Sbjct  241   WTGVKVNVPVKFVVGDLDVVYTTPGVKEYVHGGGFKKDVPMLEGVVVLEGAAHFINQERA  300

Query  1302  HEINTHILNFLHNF  1343
              E N+HI +F++ F
Sbjct  301   QETNSHIYDFINKF  314



>ref|XP_010039296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   359 bits (922),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 194/383 (51%), Positives = 243/383 (63%), Gaps = 66/383 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGP-VVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME IEH +V  NGI+MHVA  G GP  VLF+HGFPE WY+WRHQM  LA+ GYR VAPDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMVSLAALGYRTVAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYG+T   P+ D   +T+ HVVGDLV +L  +     +VFVVGHDWGAM+AW LCL RP
Sbjct  61    RGYGNTDAPPSVD--SYTAFHVVGDLVGMLDALGIG--RVFVVGHDWGAMIAWYLCLLRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D+VKALVN SV + PR+P+ KP+E +RA++GDDYY+                        
Sbjct  117   DRVKALVNTSVAWFPRDPERKPVEKMRAMFGDDYYV------------------------  152

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                       CRF                     QE GE E +FA     K+ + FL   
Sbjct  153   ----------CRF---------------------QEPGEAEEDFAKADPAKLFKLFLAGR  181

Query  939   NPSPLYLPKK------GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDL  1100
             +PSP  + K        KLFE    DLPSWLS++D+++Y ++F +TGFTGG+NYYR  DL
Sbjct  182   DPSPPIVTKDVGFSGMTKLFEDHQVDLPSWLSEDDINFYAAQFSRTGFTGGLNYYRCWDL  241

Query  1101  DWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGH  1280
             +WELSA+WTG  + VP+KFIVGDLD+TY+ PG KEYIH GG K+ VP LEEVVV+EGV H
Sbjct  242   NWELSASWTGVPIEVPMKFIVGDLDLTYHIPGVKEYIHGGGFKQAVPNLEEVVVMEGVAH  301

Query  1281  FIHEEKPHEINTHILNFLHNFSS  1349
             F+ +EKP E+ +HI NF+  FSS
Sbjct  302   FLMQEKPQEVTSHIHNFIKKFSS  324



>ref|XP_009391487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/377 (50%), Positives = 245/377 (65%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I H +V+VNGI+MHVA+ G+GPVVL +HGFPE WY+WRHQ+  LA+ GY AVAPDLR
Sbjct  1     MEEITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYSWRHQIVALAAHGYHAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P    + +T  HVVGD+V L+  +  D+  VFVVGHDWGA++AW LC++RPD
Sbjct  61    GFGDTDAPPA--VTSYTMFHVVGDIVGLIEALGRDQ--VFVVGHDWGALVAWCLCMFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV F PRNP  KP+ETLR  YGDDYY+CRFQ+            P    +E 
Sbjct  117   KVKALVNLSVVFRPRNPTGKPVETLRTAYGDDYYVCRFQE------------PGRTEAEF  164

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                 +S    +F  +H                                           +
Sbjct  165   GRVGTSLIIKKFLTYH-------------------------------------------D  181

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P+ +PK+ K F  + D    LPSWLS++D++Y+  KFEK+GFTGG+NYYRALDL+WEL
Sbjct  182   PGPVIVPKE-KGFGDAPDKENALPSWLSEDDLNYFAGKFEKSGFTGGLNYYRALDLNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTG ++ VPVKFIVGD D+ Y+ PG ++YI KGG KRDVPLLE++VV+EGVGHFI++
Sbjct  241   TAPWTGVQIKVPVKFIVGDQDLAYHFPGVQDYISKGGFKRDVPLLEDMVVMEGVGHFINQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P EI+  IL F+  F
Sbjct  301   ERPQEISNIILEFIKKF  317



>gb|KHG07158.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=316

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 187/375 (50%), Positives = 241/375 (64%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V+ NGI MHVA  G GP++LFLHGFPE WYTWR Q+  L+S GYR VAPDLR
Sbjct  1     MEKIEHTTVTTNGIKMHVASIGSGPIILFLHGFPELWYTWRRQLLSLSSLGYRCVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+  P  +T  HVVGDLV LL  +  D  KVF+VGHDWGAM+AW  CL+RPD
Sbjct  61    GYGDSDAPPS--PESYTVFHVVGDLVGLLDALGVD--KVFLVGHDWGAMIAWNFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN+SV + PRNPK K ++  RA++GDD+YI                         
Sbjct  117   RIKALVNLSVPYHPRNPKVKTVDGYRALFGDDFYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q  GE E  FA + T KVL+ FLT  +
Sbjct  152   ---------CRF---------------------QVPGEAEAHFAQMDTAKVLKKFLTTRD  181

Query  942   PSPLYLPKKGKLFE-GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P+P  +PK+  L        LPSWLS+++++Y+ +KF + GFTGG+NYYRA++L+WEL A
Sbjct  182   PNPPCIPKETGLKALPDPPALPSWLSEDEINYFATKFNQKGFTGGLNYYRAMNLNWELMA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVKFIVGDLDITY+ PG KEY+  GG K++VP L+E+VV+EGV HFI++EK
Sbjct  242   PWTGLQIQVPVKFIVGDLDITYHIPGVKEYLQNGGFKKNVPFLQELVVMEGVAHFINQEK  301

Query  1299  PHEINTHILNFLHNF  1343
             P EI+ HI +F+  F
Sbjct  302   PQEISMHIYDFVKKF  316



>ref|XP_006283220.1| hypothetical protein CARUB_v10004250mg, partial [Capsella rubella]
 gb|EOA16118.1| hypothetical protein CARUB_v10004250mg, partial [Capsella rubella]
Length=715

 Score =   372 bits (954),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 204/389 (52%), Positives = 250/389 (64%), Gaps = 76/389 (20%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQ---------TGQGPVVLFLHGFPECWYTWRHQMCFLASQG  374
             ++G+EH ++ VNGI+MHVA+          G+ P++LF+HGFPE WYTWRHQM  L+S G
Sbjct  68    LDGVEHKTLKVNGINMHVAEKPASGPGSGAGEDPIILFIHGFPELWYTWRHQMAALSSLG  127

Query  375   YRAVAPDLRGYGDTTGAPTDDPSK---FTSLHVVGDLVALLSVVAADEEKVFVVGHDWGA  545
             YR +APDLRGYGDT     D P K   +T  +VVGDLVAL+  V   ++ VFVVGHDWGA
Sbjct  128   YRTIAPDLRGYGDT-----DAPEKVEGYTYFNVVGDLVALIHAVTDGDKAVFVVGHDWGA  182

Query  546   MMAWALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQIN  725
             M+AW LC YRP+KVKALVNMSV F+PRN    P+ TLR V+GDDYYI             
Sbjct  183   MLAWQLCQYRPEKVKALVNMSVLFSPRNRDRVPVPTLRYVFGDDYYI-------------  229

Query  726   KKLHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGT  905
                                  CRF                     Q+ G+IE EF  LGT
Sbjct  230   ---------------------CRF---------------------QKPGDIEAEFKNLGT  247

Query  906   KKVLQCFLTYYNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGI  1076
             +KVL+ FLTY  P PL+LPK  K FE S +    LP WL++ D+DYY +K++K GFTG I
Sbjct  248   EKVLKEFLTYKTPGPLHLPKD-KCFERSENAACALPPWLTQEDLDYYVTKYDKKGFTGPI  306

Query  1077  NYYRALDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleev  1256
             NYYR +D +WEL+A WTGAK+ VPVKFIVGD D+TYN PGAKEYI+ GG KRDVPLL+E 
Sbjct  307   NYYRNIDRNWELTAPWTGAKINVPVKFIVGDHDLTYNFPGAKEYINGGGFKRDVPLLDET  366

Query  1257  vvleGVGHFIHEEKPHEINTHILNFLHNF  1343
             VVL+G+GHF+HEE P  IN HI +F   F
Sbjct  367   VVLKGLGHFLHEEDPDVINQHIHSFFQKF  395


 Score =   339 bits (870),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 190/379 (50%), Positives = 233/379 (61%), Gaps = 72/379 (19%)
 Frame = +3

Query  246   VSVNGISMHVAQ-------------TGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             V VN I+MHVA+               + PV+LFLHGFPE WYTWRHQM  L+S GYR +
Sbjct  396   VKVNVITMHVAEKIPSVVGSDAFDGIIRPPVILFLHGFPELWYTWRHQMVALSSLGYRTI  455

Query  387   APDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             APDLRGYGDT      D   +TSLHVVGDL+ L+  V  D+EKVFVVGHDWGA++AW  C
Sbjct  456   APDLRGYGDTDAPERVD--AYTSLHVVGDLIGLIDAVVGDQEKVFVVGHDWGAIIAWHFC  513

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L RPD+VKALVNMSV F P NPK KP+   R+ YGDDYYICRFQ+               
Sbjct  514   LLRPDRVKALVNMSVVFDPWNPKRKPISMFRSFYGDDYYICRFQE---------------  558

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                   C                     EI+  F              A +G ++ L  F
Sbjct  559   ------CG--------------------EIEAEF--------------AKVGVERSLLEF  578

Query  927   LTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
             LTY NP P+ LP KGK ++     LPSWL++ DV+YY SK+EK GFTG +NYYR +D  W
Sbjct  579   LTYRNPGPILLP-KGKSYDDPI-SLPSWLTEYDVNYYVSKYEKNGFTGPVNYYRNMDRTW  636

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL  + + A+V VPVKFI+GD D+TY+ PG K+YIH G  K  VPLL+EVVV+EGVGHF+
Sbjct  637   ELMGSLSKAQVKVPVKFIIGDQDLTYHIPGTKKYIHDGRFKSHVPLLDEVVVIEGVGHFL  696

Query  1287  HEEKPHEINTHILNFLHNF  1343
             HEE+P EI+ HI ++  NF
Sbjct  697   HEERPDEISKHIHDYFVNF  715



>ref|XP_002320333.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|ABK93786.1| unknown [Populus trichocarpa]
 gb|EEE98648.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/377 (50%), Positives = 245/377 (65%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V+ NGI+MH+A  G GP +LFLHGFPE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MEKIEHTTVATNGINMHIASIGTGPEILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +   ++T  H++GDLV L+  +  D  KVF+VGHDWGAM+AW  CL RPD
Sbjct  61    GYGDTD-APKNY-REYTVFHILGDLVGLIDSLGID--KVFLVGHDWGAMVAWYFCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP    ++  R ++GDDYYI                         
Sbjct  117   RVKALVNMSVVFQPRNPHKSFVQISRDLFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GE+E +FA + T ++++ FLT  N
Sbjct  152   ---------CRF---------------------QEPGEVEEDFAQMDTARIIRKFLTSRN  181

Query  942   PSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK+   F G  D+  LPSWLS+ D++YY  KF +TGFTGG+NYYR LDL+WEL 
Sbjct  182   PKPPCIPKEVG-FRGLPDNPNLPSWLSEKDINYYAGKFNQTGFTGGLNYYRCLDLNWELM  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             AAWTG ++ VPVKFIVGDLDITYN P A++YI KGGLK+ VP L+EV ++EGV HF+++E
Sbjct  241   AAWTGLQIKVPVKFIVGDLDITYNMPEAQDYISKGGLKKYVPFLQEVAIMEGVAHFLNQE  300

Query  1296  KPHEINTHILNFLHNFS  1346
             KP E+++HI +F+  F+
Sbjct  301   KPEEVSSHIYDFIKKFN  317



>ref|XP_009111296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=316

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 188/376 (50%), Positives = 239/376 (64%), Gaps = 62/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++S NGI++HVA  G GP +LFLHGFP+ WY+WR Q+  LA  GYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSLADLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+ +   +T LHVVGDLV LL  +  D  +VF+VGHDWGA++AW +C+ RPD
Sbjct  61    GYGDSDSPPSHE--SYTVLHVVGDLVGLLDSLGVD--RVFLVGHDWGAIVAWWMCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN SV F PRNP  KP++  +A++G+DYYI                         
Sbjct  117   RVKALVNTSVVFNPRNPSVKPVDAFKALFGEDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE +FA + TKK++  F T  N
Sbjct  152   ---------CRF---------------------QEPGEIEEDFAQVDTKKLINRFFTSRN  181

Query  942   PSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRA++L WEL+
Sbjct  182   PRPPCIPKSLG-FRGLPDPPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G ++ VPVKFIVGDLDITYN PG KEYIH+GGLK+ VP L+EVVV+EGVGHF+ +E
Sbjct  241   APWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQE  300

Query  1296  KPHEINTHILNFLHNF  1343
             KP E+  HI +F   F
Sbjct  301   KPDEVTDHIYSFFSKF  316



>ref|XP_007015342.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32961.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   358 bits (919),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 190/377 (50%), Positives = 244/377 (65%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI+H +V VNGI+MH+A+ G+GPV+LFLHGFPE WY+WRHQ+  LAS GYRA+APDLR
Sbjct  1     MEGIQHKTVRVNGINMHLAEKGEGPVILFLHGFPELWYSWRHQINGLASLGYRALAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYG+T  AP    S +T LHVVGDL+ALL  VA D+EKVFVVGHDWGA++AW +CL+RPD
Sbjct  61    GYGETD-APASIAS-YTCLHVVGDLIALLDAVAPDQEKVFVVGHDWGAIIAWYMCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKAL N+SV F P NP+ KP+ET +A +G+D+YI RFQ+  V                 
Sbjct  119   RVKALFNLSVPFIPYNPRFKPVETWKAYFGNDHYIVRFQEPGV-----------------  161

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                              +  +++EI                     G  + +   L+Y  
Sbjct  162   -----------------IEAEFEEI---------------------GLGRAVLELLSYRV  183

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PLYLP KG LF    D   DLP WLS  D +YY ++FEKTG T  +NYYR  D +WEL
Sbjct  184   PDPLYLP-KGNLFGHPLDGPVDLPPWLSHQDANYYATQFEKTGITPALNYYRNFDRNWEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             SA W+G+++ VPVKF++GDLD+ Y  PG KEYIH GG KRDVP LEE VV++GV H+I++
Sbjct  243   SAPWSGSQIKVPVKFVMGDLDLVYTMPGMKEYIHNGGFKRDVPFLEEAVVMKGVTHWINQ  302

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP +IN  + +F   F
Sbjct  303   EKPDDINKQMFDFFSKF  319



>gb|KDP27824.1| hypothetical protein JCGZ_18904 [Jatropha curcas]
Length=321

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 196/379 (52%), Positives = 243/379 (64%), Gaps = 63/379 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             M+ IEH  V VNGI++HVA+ G   GPV+LF+HGFPE WY+WRHQ+  LAS GYRAVAPD
Sbjct  1     MDAIEHRFVQVNGINIHVAEAGPVNGPVILFIHGFPELWYSWRHQIVALASLGYRAVAPD  60

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             +RGYGDT  AP DD   +T  H+VGDL+ LL  VA  +EKVFVVGHDWGA +AW LCL+R
Sbjct  61    MRGYGDTD-AP-DDLQSYTCFHIVGDLIGLLDAVAPQQEKVFVVGHDWGAYIAWHLCLFR  118

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVN+SV F  RNP  K +E +RAVYGDDYY+CRFQ+     +I  +   +G   
Sbjct  119   PDRVKALVNLSVVFALRNPNGKRIEVMRAVYGDDYYMCRFQE---PGEIEAEFAELG---  172

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                                      E  L+  F+++  G                     
Sbjct  173   ------------------------TERILKEFFTYRHPG---------------------  187

Query  936   YNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
                 P++LP KGK F    +    LPSW S+ DV YYT+KFEK GFTGG+NYYR LD +W
Sbjct  188   ----PIFLP-KGKAFSRLPETPLVLPSWFSEEDVQYYTNKFEKKGFTGGLNYYRILDRNW  242

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+A W GA+V VP KFIVGD D+TYN+ GAK+YI KGG K+ VP LEEVV++EGV HF+
Sbjct  243   ELTAPWNGAQVKVPAKFIVGDQDLTYNSFGAKDYIEKGGFKKAVPFLEEVVIMEGVAHFL  302

Query  1287  HEEKPHEINTHILNFLHNF  1343
             ++EKP EIN HI +F   F
Sbjct  303   NQEKPEEINKHIYDFFQKF  321



>gb|KDP28184.1| hypothetical protein JCGZ_13955 [Jatropha curcas]
Length=315

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 190/376 (51%), Positives = 241/376 (64%), Gaps = 63/376 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++  NGI+MHVA  G GPV+LFLHGFPE WY+WRHQ+  L++ GYR +APDLR
Sbjct  1     MEKIEHTTIPTNGINMHVASIGTGPVILFLHGFPELWYSWRHQLLSLSALGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+  P+++T LH+VGDLV LL  +    E+VF+VGHDWGA++AW +CL+RPD
Sbjct  61    GYGDTDAPPS--PTQYTILHLVGDLVGLLDSLGI--EQVFLVGHDWGAIVAWHMCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN SV FTPRNP  KPLE  R + GDD+YICRFQ+              G   E 
Sbjct  117   RIKALVNTSVVFTPRNPNHKPLEKYRELLGDDFYICRFQEP-------------GEIEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                A +    R                RFL S                           N
Sbjct  164   FAQAGAAKVLR----------------RFLAS--------------------------RN  181

Query  942   PSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK G  F G  D+  LP WLS+ D++YY SKF + GFTGG+NYYR LDL+WEL+
Sbjct  182   PKPPCIPKIG--FRGLPDNPSLPPWLSEEDINYYVSKFNQKGFTGGLNYYRCLDLNWELT  239

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTG ++ VPVKFIVGDLD+TY+ PG KEYIH GGLK+ VP L+EVV++EGV H++++E
Sbjct  240   APWTGLQIKVPVKFIVGDLDVTYHFPGVKEYIHNGGLKKYVPFLQEVVIMEGVCHYLNQE  299

Query  1296  KPHEINTHILNFLHNF  1343
             KP EI+ HI +F+  F
Sbjct  300   KPEEISAHIYDFIKKF  315



>emb|CDY65636.1| BnaAnng20810D [Brassica napus]
Length=316

 Score =   357 bits (916),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 187/376 (50%), Positives = 238/376 (63%), Gaps = 62/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++S NGI++HVA  G GP +LFLHGFP+ WY+WR Q+   A  GYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSFADLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+ +   +T LHVVGDLV LL  +  D  +VF+VGHDWGA++AW +C+ RPD
Sbjct  61    GYGDSDAPPSHE--SYTVLHVVGDLVGLLDSLGVD--RVFLVGHDWGAIVAWWMCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN SV F PRNP  KP++  +A++G+DYYI                         
Sbjct  117   RVKALVNTSVVFNPRNPSVKPVDAFKALFGEDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE +FA + TKK++  F T  N
Sbjct  152   ---------CRF---------------------QEPGEIEEDFAQVDTKKLINRFFTSRN  181

Query  942   PSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRA++L WEL+
Sbjct  182   PRPPCIPKSLG-FRGLPDPPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G ++ VPVKFIVGDLDITYN PG KEYIH+GGLK+ VP L+EVVV+EGVGHF+ +E
Sbjct  241   APWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQE  300

Query  1296  KPHEINTHILNFLHNF  1343
             KP E+  HI +F   F
Sbjct  301   KPDEVTDHIYSFFSKF  316



>ref|XP_006414412.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
 gb|ESQ55865.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
Length=374

 Score =   359 bits (921),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 195/381 (51%), Positives = 245/381 (64%), Gaps = 65/381 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQ---TGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAP  392
             ++G+EH +++VNGI+MH A+   +G+ P++LF+HGFPE WYTWRHQM  L+S GYR +AP
Sbjct  49    LDGVEHKTLNVNGINMHYAEISGSGRDPIILFIHGFPELWYTWRHQMAALSSLGYRTIAP  108

Query  393   DLRGYGDTTGAPTDDPSK---FTSLHVVGDLVALL-SVVAADEEKVFVVGHDWGAMMAWA  560
             DLRGYGDT     D P K   +T L+VVGDLVAL+ +V  + +E VFVVGHDWGAM+AW 
Sbjct  109   DLRGYGDT-----DAPEKVEDYTYLNVVGDLVALIDAVTTSGDEAVFVVGHDWGAMIAWQ  163

Query  561   LCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHP  740
             LC YRP+KVKALVNMSV F+PR P   P+ TLR V+GDDYYICRFQK     +I  +   
Sbjct  164   LCQYRPEKVKALVNMSVVFSPRYPDRVPVPTLRHVFGDDYYICRFQK---PGEIEAEFKK  220

Query  741   IGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQ  920
             +G                            E  L+   +++  G +              
Sbjct  221   LG---------------------------TENVLKKFLTYKTPGPL--------------  239

Query  921   CFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDL  1100
                  Y P P    K  K  E +   LP WL++ D+DYY +K++K GFTG INYYR +D 
Sbjct  240   -----YLPKP----KLFKRSENAASALPPWLTQEDLDYYVNKYDKKGFTGPINYYRNIDR  290

Query  1101  DWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGH  1280
             +WEL+A WTGAK+ VPVKFIVGD D+TYN+PGAKEYIH GG KRDVPLL+E VVL G+GH
Sbjct  291   NWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYIHGGGFKRDVPLLDETVVLNGLGH  350

Query  1281  FIHEEKPHEINTHILNFLHNF  1343
             F+HEE P EIN HI NF   F
Sbjct  351   FLHEESPDEINQHIHNFFQKF  371



>ref|XP_009629075.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=315

 Score =   357 bits (915),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 199/375 (53%), Positives = 243/375 (65%), Gaps = 61/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH SV+VNGI+MHVA+ GQGPVVLFLHGFPE WYTWRHQ+   A  GYRAVAPDLR
Sbjct  1     MEGIEHRSVNVNGINMHVAEKGQGPVVLFLHGFPELWYTWRHQLVAFAELGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +  S +T  HVVGDLVAL+  +    E VF+V HDWGAM+ W LCL+RPD
Sbjct  61    GYGDTD-APGEVAS-YTYFHVVGDLVALIESLGV--ESVFLVAHDWGAMIGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKA V +SV F PR+PK KP+ T+RA +GDDYY+CRFQ   +  +I K           
Sbjct  117   LVKAYVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPGMEDEIAKY----------  166

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                     G  AVL  KK+    LT   
Sbjct  167   ----------------------------------------GSEAVL--KKI----LTDRK  180

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P  LPK+      S   LPSWLS++D++YY+SKF++ GFTGG+NYYRALDL WEL+AA
Sbjct  181   PGPPCLPKENPFGISSDSKLPSWLSQDDLNYYSSKFDQKGFTGGLNYYRALDLSWELTAA  240

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPllee-vvvleGVGHFIHEEK  1298
             WTGA V VPVKF+VG+LD+ Y  PG KEY+H GG K+DVP+LEE VVV+EG  HFI++E+
Sbjct  241   WTGATVKVPVKFVVGELDLVYTTPGMKEYVHGGGFKKDVPMLEEDVVVMEGAAHFINQER  300

Query  1299  PHEINTHILNFLHNF  1343
               E N+HI +F++ F
Sbjct  301   AQETNSHIHDFINKF  315



>ref|XP_010043042.1| PREDICTED: bifunctional epoxide hydrolase 2 [Eucalyptus grandis]
 gb|KCW85062.1| hypothetical protein EUGRSUZ_B01907 [Eucalyptus grandis]
Length=318

 Score =   357 bits (915),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 195/377 (52%), Positives = 245/377 (65%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH ++SVNGI+MHVA+ G+GP VL LHGFPE WYTWR Q+  LA+QGYRAVAPDLR
Sbjct  1     MEGIEHRTLSVNGITMHVAEKGRGPAVLLLHGFPELWYTWRRQIHALAAQGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +   ++T  H VGD+VAL+  +   E    VVGHDWGA++ W LC++RP+
Sbjct  61    GYGDTE-APAEV-ERYTCHHAVGDVVALMDELGLGE-AAHVVGHDWGALVGWYLCMFRPE  117

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V++ V ++V F PRNP +KP+E+LRA +GDDYYI                         
Sbjct  118   RVRSYVCLTVPFRPRNPAAKPVESLRAHFGDDYYI-------------------------  152

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G+IE +   LG + VL+  LT   
Sbjct  153   ---------CRF---------------------QEPGDIESDIERLGVRNVLRKILTERK  182

Query  942   PSPLYLPKKGKLFE---GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P   PK G+ F    G    LPSWLS+ D+DYYTSKFEK GFTGG+NYYRALDL+WEL
Sbjct  183   PGPPMWPK-GQDFSCRPGKPMALPSWLSEEDLDYYTSKFEKRGFTGGLNYYRALDLNWEL  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WT A+V VPVKF+VGDLDITY  PG KE++H GG K+ VPLLE+VVV+EG  HFI++
Sbjct  242   TAPWTDARVRVPVKFVVGDLDITYTTPGVKEFVHGGGFKKHVPLLEDVVVIEGASHFINQ  301

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P E+N+HI NF+  F
Sbjct  302   ERPEEVNSHIHNFIKKF  318



>ref|XP_009414133.1| PREDICTED: bifunctional epoxide hydrolase 2 [Musa acuminata subsp. 
malaccensis]
Length=349

 Score =   358 bits (918),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 198/376 (53%), Positives = 250/376 (66%), Gaps = 64/376 (17%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             EGI H  VSVNGI+MHVA+ G+GP VL LHGFPE WYTWRHQM  LA+ G+RAVAPDLRG
Sbjct  35    EGISHRMVSVNGINMHVAEKGEGPTVLLLHGFPELWYTWRHQMHGLAACGFRAVAPDLRG  94

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             +GDT   P    + ++ LH+VGDL+ALL  +  D  KVFVVGHDWG+M+AW L ++RPDK
Sbjct  95    FGDTDAPPAA--AAYSILHIVGDLIALLDSLGQD--KVFVVGHDWGSMVAWNLSMFRPDK  150

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             V A+VN+S  FTPRNP  K LE LR V+GDDYY+CRFQ+            P    +E A
Sbjct  151   VNAMVNLSQAFTPRNPTRKSLEYLRTVFGDDYYMCRFQE------------PGKIEAEFA  198

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
                ++          W+L K+                                 LTY NP
Sbjct  199   RLGTA----------WVLKKF---------------------------------LTYRNP  215

Query  945   SPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PLY+ +      GS+D    LPSWLS+ D++YYTSK+EK GFTGG+NYYR+LDL+WEL+
Sbjct  216   GPLYITEDQGW--GSSDSKILLPSWLSEVDINYYTSKYEKAGFTGGLNYYRSLDLNWELT  273

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA++ VP KFIVGDLD+TY++PGA+++IHKGGLK  VPLL+EVVV++ VGHFI+EE
Sbjct  274   APWTGARIKVPAKFIVGDLDLTYHSPGAQDFIHKGGLKNYVPLLDEVVVMKEVGHFINEE  333

Query  1296  KPHEINTHILNFLHNF  1343
             KP EI  +I +F+  F
Sbjct  334   KPTEITENICDFITKF  349



>ref|XP_008386679.1| PREDICTED: bifunctional epoxide hydrolase 2 [Malus domestica]
Length=316

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/375 (49%), Positives = 239/375 (64%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI+MHVA  G GP VLFLHGFPE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MEKIEHTTVPTNGINMHVASIGAGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P+  P+ +T++H+VGDL+ LL  +  D+  VF+V HDWGA+ AW  CL+RPD
Sbjct  61    GFGDTDAPPS--PTSYTAMHIVGDLIGLLDHLGIDQ--VFLVAHDWGAVXAWWFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMS+ F+PRNPK KP++  RA++GDDYYICRFQ+     +I +    IG     
Sbjct  117   RVKALVNMSIAFSPRNPKRKPVDGFRALFGDDYYICRFQE---PEEIERDFDSIG-----  168

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                            T  V++ FLT  +
Sbjct  169   -----------------------------------------------TAAVMKRFLTSRS  181

Query  942   PSPLYLPKKGKLFE-GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  +PK   L    +   LP+WL++ D++Y  SKF K+GFTGG+NYYRAL+L WEL+ 
Sbjct  182   PKPPCIPKDQGLKSWAAPVTLPAWLTEEDLNYIVSKFSKSGFTGGLNYYRALNLTWELTG  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVKFIVG+LD+TYN PG + YIHKGG KRDVP L+EVVV+EG  HFI +EK
Sbjct  242   PWTGLQIKVPVKFIVGELDVTYNIPGVQAYIHKGGFKRDVPFLQEVVVMEGAAHFIAQEK  301

Query  1299  PHEINTHILNFLHNF  1343
             P E++ H+ +F+  F
Sbjct  302   PDEVSQHVYDFIKKF  316



>emb|CDY50394.1| BnaCnng19260D [Brassica napus]
Length=316

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/376 (50%), Positives = 237/376 (63%), Gaps = 62/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++S NGI++HVA  G GP +LFLHGFP+ WY+WR Q+   A  GYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSFAGLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+ +   +T LHVVGDLV LL  +  D  +VF+VGHDWGA++AW +C+ RPD
Sbjct  61    GYGDSDSPPSHE--SYTVLHVVGDLVGLLDSLGVD--RVFLVGHDWGAIVAWWMCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN SV F PRNP  KP++  +A++G+DYYI                         
Sbjct  117   RVKALVNTSVVFNPRNPSVKPVDAFKALFGEDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE +FA + TKK++  F T  N
Sbjct  152   ---------CRF---------------------QEPGEIEEDFAQVDTKKLINRFFTSRN  181

Query  942   PSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRA++L WEL+
Sbjct  182   PRPPCIPKSLG-FRGLPDPPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G ++ VPVKFIVGDLDITYN PG KEYIH+GGLK+ VP L+EVVV+EGVGHF+ +E
Sbjct  241   APWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQE  300

Query  1296  KPHEINTHILNFLHNF  1343
             KP E+  HI  F   F
Sbjct  301   KPDEVTDHIYGFFSKF  316



>ref|XP_008775992.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=319

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 246/373 (66%), Gaps = 60/373 (16%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGY  407
             GI H +V  NGI MHVA+ G+G  VL LHGFPE WYTWRHQ+  LA++GYRA+APDLRGY
Sbjct  6     GISHRTVEANGIRMHVAEKGKGLPVLLLHGFPELWYTWRHQIAGLAARGYRAIAPDLRGY  65

Query  408   GDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKV  587
             GDT   P  D + +T  H+VGDLVALL  +A  +  VFVVGHDWGA +AW LCL+RPD+V
Sbjct  66    GDTDAPP--DVASYTIFHLVGDLVALLDALALSQ--VFVVGHDWGAFVAWHLCLFRPDRV  121

Query  588   KALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGAC  767
             KALVN+SV F PRNP +KPL  +RA+ GD+YYI RFQ++                  GA 
Sbjct  122   KALVNLSVPFMPRNPAAKPLNHVRALNGDEYYISRFQEH------------------GAV  163

Query  768   SASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPS  947
              A                                     EFA LGT  VL+ FLTY NP 
Sbjct  164   EA-------------------------------------EFARLGTATVLRKFLTYRNPG  186

Query  948   PLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWT  1127
             PL++PK+G         LPSWLS+ D++Y+TSKFEK+GFTG INYYR LDL+WEL+AAWT
Sbjct  187   PLFIPKEGWGSPNEHITLPSWLSEEDINYFTSKFEKSGFTGPINYYRCLDLNWELAAAWT  246

Query  1128  GAKVMVPVKFIVGDLDITY-NAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPH  1304
             GA++ VP KFI+GDLD+ Y + P  ++YIHKGG K+DVPLL+EVVV+EGV HFI++EK  
Sbjct  247   GAQIKVPAKFIIGDLDLNYHDPPRRQDYIHKGGFKKDVPLLQEVVVMEGVAHFINQEKAQ  306

Query  1305  EINTHILNFLHNF  1343
             EI  HI +F+  F
Sbjct  307   EITDHIFDFIQKF  319



>ref|XP_010649574.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
 emb|CBI22972.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 193/377 (51%), Positives = 246/377 (65%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEG+EH +V  NGI++HVA+ G+GP++LF+HGFPE WY+WRHQ+  LA  GYRAVAPDLR
Sbjct  1     MEGVEHRTVKANGINIHVAEKGEGPIILFIHGFPESWYSWRHQIHALALLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+  AP+D  S +T LHVVGDL+ +L  + AD  KVFVVGHDWGA++AW LCL+RPD
Sbjct  61    GYGDSD-APSDVGS-YTCLHVVGDLIGVLDAMGAD--KVFVVGHDWGAIIAWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV + PRNP  KPLE  R +YGDD+Y+CRFQ+     QI  ++  +G     
Sbjct  117   RVKALVNMSVAYFPRNPMHKPLEIYRHLYGDDFYVCRFQE---PGQIEIEIAEVG-----  168

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                            T   L+      +
Sbjct  169   -----------------------------------------------TATALKSIFANRD  181

Query  942   PSPLYLPKKGKLFE---GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             PSP  LP KGK F+   G+   LP WL + +V++Y +KFE+TGFTGGINYYR  D +WEL
Sbjct  182   PSPPCLP-KGKAFQDVSGAPIVLPPWLPEEEVNFYVTKFEETGFTGGINYYRNFDRNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTG+++ VP KF+VGD+D+TY+  GAKEYIH G  K++VPLLEEVVV+EGVGHF+HE
Sbjct  241   TAPWTGSQIKVPTKFMVGDMDLTYHFAGAKEYIHSGEFKKNVPLLEEVVVMEGVGHFLHE  300

Query  1293  EKPHEINTHILNFLHNF  1343
             EK  EIN HI +F   F
Sbjct  301   EKADEINKHIHDFFQKF  317



>emb|CDP17110.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   355 bits (910),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 182/379 (48%), Positives = 246/379 (65%), Gaps = 64/379 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H SV VNGI+MHVA+ G+GP VL LHGFPE WY+WRHQM +LAS+GYRA+APDLR
Sbjct  1     MENIKHQSVVVNGINMHVAEVGEGPAVLLLHGFPELWYSWRHQMLYLASKGYRALAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+  PS +T+ HVVGDLVALL+ +  D  KVF+VGHDWG+++AW LCL+RPD
Sbjct  61    GYGDSDAPPS--PSSYTAFHVVGDLVALLNSLGLD--KVFLVGHDWGSLIAWHLCLFRPD  116

Query  582   KVKALVNMSVC---FTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRR  752
             ++KALVNMS     F P+NP  KPLE +R  +GDDYY+                      
Sbjct  117   RIKALVNMSCVYHYFDPKNPSKKPLEEMRETFGDDYYV----------------------  154

Query  753   SEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLT  932
                         CRF                     Q  GE+E EFA + T ++++ FL+
Sbjct  155   ------------CRF---------------------QATGEVEEEFAGVDTAELVKAFLS  181

Query  933   YYNPSPLYLPKKGKLF--EGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
               +  P  +P+ G  +    + + LP WL++ D++YY +KF+KTGF+GG N+YR +DL+W
Sbjct  182   NRDTRPPCIPRGGFQYFAHQNPNPLPEWLTQEDLNYYATKFKKTGFSGGFNFYRCIDLNW  241

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             ELSA W  A++ VPVKF+VGDLD+TY+ PG ++YIH GG K+DVP L+EV+V+ G  HFI
Sbjct  242   ELSAPWREAQIQVPVKFVVGDLDLTYHIPGIQDYIHNGGFKKDVPDLQEVIVIPGAAHFI  301

Query  1287  HEEKPHEINTHILNFLHNF  1343
             ++EK  E + HI +F+  F
Sbjct  302   NQEKADECSIHIYDFISKF  320



>ref|XP_006344695.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=314

 Score =   354 bits (908),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 192/374 (51%), Positives = 242/374 (65%), Gaps = 60/374 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +++VNGI+MHVA+ G+GPVVLFLHGFPE WYTWRHQ+  LA QGYRAVAPDLR
Sbjct  1     MEGIEHRTLNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQIVALADQGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +  S +T  HVVGDLVAL+  +    E VF+V HDWGAM+ W LCL+RPD
Sbjct  61    GYGDTD-APKEVTS-YTYFHVVGDLVALIESLGV--ENVFLVAHDWGAMIGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKA V +SV   PR+PK KP+ T+RA  GDDYY+                         
Sbjct  117   LVKAYVCLSVPLRPRHPKMKPIPTMRAFLGDDYYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ G +E E A  G++ VL+  L    
Sbjct  152   ---------CRF---------------------QDPG-MEDEMAKYGSEAVLKKILIDRK  180

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P  LPK       + D LP WLS++D++YY++KF++ GFTGG+NYYRALDL+WEL+A 
Sbjct  181   PGPPCLPKDNPFGISTDDKLPLWLSQDDLNYYSTKFDQKGFTGGLNYYRALDLNWELTAP  240

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             WTG KV VPVKF+VGDLD+ Y  PG KEY+H GG K+DVP+L++VVVLEG  HFI++E+ 
Sbjct  241   WTGVKVNVPVKFVVGDLDVVYTTPGMKEYVHGGGFKKDVPMLDDVVVLEGAAHFINQERA  300

Query  1302  HEINTHILNFLHNF  1343
              E N+HI +F++ F
Sbjct  301   QETNSHIYDFINKF  314



>ref|XP_004290809.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/375 (49%), Positives = 237/375 (63%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI+MHVA  G GP +LFLHGFPE WY+WRHQ+  L++ GYR +APDLR
Sbjct  1     MEKIEHTTVPTNGINMHVASIGSGPPILFLHGFPELWYSWRHQLLSLSALGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P  D S +T++H+VGDL+ LL  +    E+VF+V HDWGA++AW  CL+RPD
Sbjct  61    GFGDTDAPP--DASSYTAMHIVGDLIGLLDHLGI--EQVFLVAHDWGAVIAWWFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VK LVNMSV F PRNPK KP++  +A++GDDYYI                         
Sbjct  117   RVKCLVNMSVAFNPRNPKRKPVDGFKALFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GE E  F  L T  V++ FLT  N
Sbjct  152   ---------CRF---------------------QEPGEAEAYFGGLDTASVMKMFLTGRN  181

Query  942   PSPLYLPKK-GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P+P  + K+ G       + +P+WLS+ DV+Y+ +KF KTGFTGG+NYYRA++L WEL+A
Sbjct  182   PAPPKISKELGFASWKPVEPMPAWLSEEDVNYFATKFSKTGFTGGLNYYRAINLTWELTA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVKFIVGDLDITYN PG KEYIH GG K  VP L+EV+++EG  HFI++EK
Sbjct  242   PWTGVQIKVPVKFIVGDLDITYNIPGIKEYIHNGGFKSQVPFLQEVIIVEGAAHFINQEK  301

Query  1299  PHEINTHILNFLHNF  1343
               E + HI +F+  F
Sbjct  302   AEECSAHIYDFIKKF  316



>gb|EYU46742.1| hypothetical protein MIMGU_mgv1a010264mg [Erythranthe guttata]
Length=317

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 245/377 (65%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H ++SVNGI+MHVA+ G GP VLFLHGFPE WYTWRHQM +L+++GYRA+APDLR
Sbjct  1     MEKIKHSNMSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLYLSARGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+  P+ +T+ H+VGDLVALL  +    E+VF+V HDWGA++AW  CL+RP+
Sbjct  61    GYGDTDAPPS--PADYTAFHLVGDLVALLDALGL--EQVFLVAHDWGAIVAWWFCLFRPE  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++K LVNMSV F PR+P+ KP+E  + + GDD+Y+CRFQK                 +E 
Sbjct  117   RIKGLVNMSVQFHPRHPEIKPIEMYKNLLGDDFYMCRFQK--------------AGEAEK  162

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A  +    Q                 ++ LFS++ G                        
Sbjct  163   AFESVEASQV----------------IKSLFSFRGG------------------------  182

Query  942   PSPLYLPKK---GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               P+ +P++     LF+   +  P WL++ D+DY+  KF+KTG+TGG+NYYRA+DL WEL
Sbjct  183   -KPIIVPREIGLEALFQAPAES-PPWLTEEDLDYFAGKFKKTGYTGGLNYYRAMDLTWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A W GA+V VPVKFI+G+ DITY  PG KEYIH GG K+DVP LE+VVV+EGV HFI++
Sbjct  241   AAPWVGAQVKVPVKFIIGEQDITYYVPGIKEYIHDGGFKKDVPNLEQVVVMEGVAHFINQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP E++ HI  F+ NF
Sbjct  301   EKPEEVSQHIYEFITNF  317



>gb|ACE82566.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 195/375 (52%), Positives = 241/375 (64%), Gaps = 61/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V+VNGI+MHVA+ G+GPVVLFLHGFPE WYTWRHQ+   A  GYRAVAPDLR
Sbjct  1     MESIEHRTVNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQLVAFADLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP D  S +T  HVVGDLVAL+  +    E VF+V HDWGAM+ W LCL+RPD
Sbjct  61    GYGDTD-APADVAS-YTCFHVVGDLVALIESLGV--ESVFLVAHDWGAMIGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKA V +SV F PR+PK KP+ T+RA +GDDYY+CRFQ   +  +I K           
Sbjct  117   LVKAYVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPRMEDEIAKN----------  166

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                     G  AVL  KK+    LT   
Sbjct  167   ----------------------------------------GSEAVL--KKI----LTDRK  180

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P  LPK+          LPSWLS++D+ YY++KF++ GFTGG+NYYRALDL+WEL+AA
Sbjct  181   PGPPCLPKENPFGISPDSKLPSWLSQDDLKYYSTKFDQKGFTGGLNYYRALDLNWELTAA  240

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPll-eevvvleGVGHFIHEEK  1298
             WTGAK  VPVKF+VG+LD+ Y  PG KEY+H GG K+DVP+L E+VVV+EG  HFI++E+
Sbjct  241   WTGAKAKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGAAHFINQER  300

Query  1299  PHEINTHILNFLHNF  1343
               E N+HI NF++ F
Sbjct  301   AQETNSHIHNFINKF  315



>ref|XP_002874922.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51181.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 190/378 (50%), Positives = 236/378 (62%), Gaps = 62/378 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +VS NGI+MHVA  G GPV+LFLHGFP+ WY+WRHQ+   A+ GYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+ +   +T LH+VGDLV LL+ +  D  +VF+VGHDWGA++AW LC+ RPD
Sbjct  61    GYGDSDAPPSRE--SYTILHIVGDLVGLLNSLGVD--RVFLVGHDWGAIVAWWLCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V ALVN SV F PRNP  KP++  RA++GDDYYICRFQ+              G   E 
Sbjct  117   RVNALVNTSVVFNPRNPSVKPVDAFRALFGDDYYICRFQEP-------------GEIEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                  +                K++  RF  S                           N
Sbjct  164   FAQVDT----------------KKLITRFFIS--------------------------RN  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRAL+L WEL+
Sbjct  182   PRPPCIPKSVG-FRGLPDPPSLPAWLTEEDVSFYGDKFSQKGFTGGLNYYRALNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G ++ VPVKFIVGDLDITYN PG KEYIH+GGLK+ VP L+EVVVLEGVGHF+H+E
Sbjct  241   APWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVLEGVGHFLHQE  300

Query  1296  KPHEINTHILNFLHNFSS  1349
             KP EI  HI  F   F +
Sbjct  301   KPDEITDHIYGFFKKFRT  318



>ref|XP_006444386.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 ref|XP_006479994.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
 dbj|BAD13534.1| soluble epoxide hydrolase [Citrus jambhiri]
 gb|ESR57626.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 gb|KDO87173.1| hypothetical protein CISIN_1g021158mg [Citrus sinensis]
Length=316

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/375 (50%), Positives = 235/375 (63%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V+ NGI+MHVA  G GP VLF+HGFPE WY+WR+Q+ +L+S+GYRA+APDLR
Sbjct  1     MEKIEHTTVATNGINMHVASIGTGPAVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   + +T+LH+VGDL+ LL  +     +VF+VGHDWGA++AW  CL+RPD
Sbjct  61    GYGDTDAPPSV--TSYTALHLVGDLIGLLDKLGI--HQVFLVGHDWGALIAWYFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP  +PL   RAVYGDDYYI                         
Sbjct  117   RVKALVNMSVPFPPRNPAVRPLNNFRAVYGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE EFA + T ++++ FL    
Sbjct  152   ---------CRF---------------------QEPGEIEEEFAQIDTARLMKKFLCLRI  181

Query  942   PSPLYLPKKGKLFE-GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P PL +PK   L        LPSWLS+ DV+YY SKF + GFTG +NYYR  DL+WEL A
Sbjct  182   PKPLCIPKDTGLSTLPDPSALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCWDLNWELMA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVK+IVGD D+ YN  G KEYIH GG K+ VP L++VVV+EGV HFI++EK
Sbjct  242   PWTGVQIKVPVKYIVGDQDLVYNNKGTKEYIHNGGFKKYVPYLQDVVVMEGVAHFINQEK  301

Query  1299  PHEINTHILNFLHNF  1343
               E+  HI  F+  F
Sbjct  302   AEEVGAHIYEFIKKF  316



>ref|XP_010693593.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=369

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 197/376 (52%), Positives = 251/376 (67%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             + GIEH ++ VNGI+MH+A+ G  + PVVLF+HGFP+ WY+WR Q+  L++ GYRAVAPD
Sbjct  53    ISGIEHRTIHVNGINMHIAEKGDKEAPVVLFIHGFPDLWYSWRQQIFDLSALGYRAVAPD  112

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             +RGYGDT  APTD  S +T  H+VGDLV L+  + A  ++VFVVGHDWGA++AW LCL+R
Sbjct  113   MRGYGDTD-APTD-ASSYTYGHIVGDLVGLIDELGA--QQVFVVGHDWGAIVAWWLCLFR  168

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVNMSV F+PRNPK KPL+ LRA YGD YYI RFQ   V   I +++   G   
Sbjct  169   PDRVKALVNMSVAFSPRNPKMKPLDMLRAAYGDSYYIVRFQ---VPGDIEEEIMEAG---  222

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
              GA                      EI LR ++S                         +
Sbjct  223   -GA----------------------EIFLRKIYS-------------------------H  234

Query  936   YNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             ++P PL+LP KG+ F       PSW+SK  + YY  KF +TGFTGG+NYYRAL+L+WE++
Sbjct  235   HSPGPLFLP-KGESFNDVPASFPSWMSKEMIAYYCDKFSQTGFTGGLNYYRALNLNWEIT  293

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA+V VP KFIVGDLD+TYNA G K+YIHKGG+KRDVPLLE+VV+LEGV HF+  E
Sbjct  294   APWTGAQVKVPTKFIVGDLDLTYNATGVKDYIHKGGMKRDVPLLEDVVILEGVHHFLQHE  353

Query  1296  KPHEINTHILNFLHNF  1343
             KP  I+ HI +F+  F
Sbjct  354   KPDMISKHIYDFIKKF  369



>gb|EMT04118.1| hypothetical protein F775_13984 [Aegilops tauschii]
Length=322

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 248/377 (66%), Gaps = 66/377 (18%)
 Frame = +3

Query  231   IEHISVSVNGISMHVAQTGQG--PVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             I H SV VNG+ +HVA+ G    PVVL LHGFPE WYTWRHQM  LA+ GYRAVAPD+ G
Sbjct  7     ITHRSVEVNGVRLHVAEAGPAGAPVVLLLHGFPELWYTWRHQMPALAAAGYRAVAPDMPG  66

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGD+  AP+  P ++T+LH+VGD VAL+  +   +E+VFVVGHDWGA++AW+LCL+RPD+
Sbjct  67    YGDSE-APSAGPDQYTALHIVGDFVALIDSLG--QERVFVVGHDWGAIIAWSLCLFRPDR  123

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALV +SV F PR+P  KP++ +RA+YGDD+YIC FQ+                   GA
Sbjct  124   VKALVPLSVPFIPRSPAVKPVDAVRALYGDDFYICSFQE------------------PGA  165

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
               A                                     EF  LGT+ VL+ F     P
Sbjct  166   IEA-------------------------------------EFKRLGTELVLRKFFADRTP  188

Query  945   SPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
              PL++PK G    GS DD   LPSW+++ DV YYT++ +K+GFTGG+NYYRAL+  WEL+
Sbjct  189   GPLFIPKSG---WGSPDDEVPLPSWITEEDVKYYTTQLDKSGFTGGLNYYRALNKTWELT  245

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             + WTGA++MVP KF VGDLD+TYN  GAK +I+KGGLK+ VPLL++VV+++ VGHFI+E+
Sbjct  246   SPWTGAEIMVPTKFTVGDLDLTYNIAGAKVFINKGGLKKFVPLLDDVVIMKDVGHFINEQ  305

Query  1296  KPHEINTHILNFLHNFS  1346
             KP EI+  I+ F+  F+
Sbjct  306   KPEEISALIIGFIKKFN  322



>gb|KEH32298.1| epoxide hydrolase [Medicago truncatula]
Length=355

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 196/377 (52%), Positives = 246/377 (65%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             +EGIEH +V+VNGI+MH+A+ GQGP++LF+HGFP+ WY+WRHQ+ +LA  GYR VAPDLR
Sbjct  37    LEGIEHRTVTVNGINMHIAEKGQGPLILFIHGFPDLWYSWRHQITYLACHGYRCVAPDLR  96

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+  P+ +TSLHVVGD++ LL  +A D+EKVFVVGHDWGA+ AW L LY   
Sbjct  97    GYGDTD-IPSS-PTSYTSLHVVGDIIGLLDAIAGDQEKVFVVGHDWGALTAWYLSLY---  151

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
                           R  + K L  L   +               T  N K  P+   +  
Sbjct  152   --------------RPERIKALVNLSVAF---------------TPRNPKRKPLD--TLR  180

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A   +     RF                     QE G+IE EFA +GT++VL+ FLTY N
Sbjct  181   AVYGNDYYISRF---------------------QEPGDIEAEFAEIGTQRVLKEFLTYRN  219

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PLYLPK GK F    D    LP WLS+ + +YY SKF+KTGFTG +NYYR +DL+WEL
Sbjct  220   PGPLYLPK-GKGFGHPIDSPILLPPWLSEQECNYYASKFDKTGFTGALNYYRNIDLNWEL  278

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTGA+V VPVKFIVGDLD+TYNAPGAK+YIHKGG+KRDVPLLE+VVV+EG GHFIH+
Sbjct  279   NAPWTGAQVKVPVKFIVGDLDLTYNAPGAKDYIHKGGMKRDVPLLEDVVVIEGAGHFIHQ  338

Query  1293  EKPHEINTHILNFLHNF  1343
             E+  +INT+I +F   F
Sbjct  339   ERADKINTYIYDFFKKF  355



>ref|XP_010038234.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50059.1| hypothetical protein EUGRSUZ_K03500 [Eucalyptus grandis]
Length=325

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 193/383 (50%), Positives = 240/383 (63%), Gaps = 66/383 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGP-VVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME IEH +V  NGI+MHVA  G GP  VLF+HGFPE WY+WRHQM  LA+ GYR V PDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGNGPDTVLFIHGFPELWYSWRHQMVSLAALGYRTVGPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RG+GDT   P+ +   +T+ HVVGDLV +L V+     +VFVVGHDWGA++AW LCL RP
Sbjct  61    RGFGDTDAPPSVE--SYTAFHVVGDLVGMLDVLGIG--RVFVVGHDWGAIIAWYLCLLRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D+VKALVN SV + PRNP+ KP+E LRA +GDDYY+CRFQ+                   
Sbjct  117   DRVKALVNTSVAWFPRNPERKPVEKLRATFGDDYYVCRFQE------------------P  158

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
             G   A                K    KL  LF                        L   
Sbjct  159   GEAEAD-------------FAKADPAKLFKLF------------------------LVSR  181

Query  939   NPSPLYLPKK------GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDL  1100
             +PSP  LPK        K+FE    DLPSWLS++D+++Y ++F +TGFTGG+NYYR  DL
Sbjct  182   DPSPPILPKDVGFSGMTKIFEDHQVDLPSWLSEDDINFYAAQFSRTGFTGGLNYYRCSDL  241

Query  1101  DWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGH  1280
             +WELSA+WTG  + VPVKFIVGDLD+TY+ PG KEYI+ GG KR VP LEEVVV+EGV H
Sbjct  242   NWELSASWTGVPIEVPVKFIVGDLDLTYHIPGVKEYINGGGFKRAVPNLEEVVVMEGVAH  301

Query  1281  FIHEEKPHEINTHILNFLHNFSS  1349
             F+ +EKP ++ +HI +F+  FSS
Sbjct  302   FLQQEKPRDVTSHIHDFIKKFSS  324



>ref|XP_006444387.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 ref|XP_006479995.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR57627.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 gb|KDO87172.1| hypothetical protein CISIN_1g021184mg [Citrus sinensis]
Length=316

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 187/376 (50%), Positives = 244/376 (65%), Gaps = 62/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H +V+ NGI+MHVA  G GP VLFLHGFPE WY+WR Q+ +L+S+GYRA+APDLR
Sbjct  1     MEKIKHTTVATNGINMHVASIGTGPAVLFLHGFPELWYSWRKQLLYLSSRGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   + +T+LHVVGDLV LL       E+VF+VGHDWGA++AW  CL RPD
Sbjct  61    GYGDTDAPPSI--TSYTALHVVGDLVGLLDEFGI--EQVFLVGHDWGALIAWYFCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F  RNP +KP++  RA++GDD+YI                         
Sbjct  117   RVKALVNLSVVFRSRNPATKPVDQYRALFGDDFYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G  E +FA + T ++++ FL   +
Sbjct  152   ---------CRF---------------------QEPGVAEEDFAQIDTARLIKKFLGGRS  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK+   F G  D   LPSWLS+ DV+YY SKF + GFTGG+NYYR LDL+WEL 
Sbjct  182   PKPPCVPKEIG-FRGLPDLRTLPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELL  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA++ +PVKF+VGDLDITY+ PG +EYI  GG K+DVP L+EV+V+EGV HFI++E
Sbjct  241   APWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQE  300

Query  1296  KPHEINTHILNFLHNF  1343
             K  E+++HI +F+  F
Sbjct  301   KADEVSSHIYDFIKQF  316



>ref|XP_009788536.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=315

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 195/375 (52%), Positives = 242/375 (65%), Gaps = 61/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +V+VNGI+MHVA+ GQGPVVLFLHGFPE WYTWRHQ+   A  GYRAVAPDLR
Sbjct  1     MEGIEHRTVNVNGINMHVAEKGQGPVVLFLHGFPELWYTWRHQLVAFADLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +  S +T  HVVGDLVAL+  +    E VF+V HDWGAM+ W LCL+RPD
Sbjct  61    GYGDTD-APAEAAS-YTCFHVVGDLVALIESLGV--ESVFLVAHDWGAMIGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKA V +SV F PR+PK KP+ T+RA +GDDYY+CRFQ   +  +I K           
Sbjct  117   LVKAYVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPGMEDEIAKY----------  166

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                     G  AVL  KK+    LT   
Sbjct  167   ----------------------------------------GSEAVL--KKI----LTDRK  180

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P  LPK+          LPSWLS++D+ YY++KF++ GFTGG+NYYRALDL+WEL+AA
Sbjct  181   PGPPCLPKENPFGISPDSKLPSWLSQDDLKYYSTKFDQKGFTGGLNYYRALDLNWELTAA  240

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPll-eevvvleGVGHFIHEEK  1298
             WTGAKV VPVKF+VG+LD+ Y  PG KEY+H GG K+DVP+L E+VVV+EG  HFI++E+
Sbjct  241   WTGAKVKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGAAHFINQER  300

Query  1299  PHEINTHILNFLHNF  1343
               + N+HI  F++ F
Sbjct  301   AQDTNSHIHGFINKF  315



>ref|XP_006480000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=316

 Score =   352 bits (902),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 234/375 (62%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI+MHVA  G GPVVLF+HGFPE WY+WR+Q+ +L+S+GYRA+APDLR
Sbjct  1     MEKIEHTTVGTNGINMHVASIGTGPVVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   + +T+LH+VGDL+ LL  +     +VF+VGHDWGA++AW  CL+RPD
Sbjct  61    GYGDTDAPPS--VTSYTALHLVGDLIGLLDKLGI--HQVFLVGHDWGALIAWYFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP  +PL   RAVYGDDYYI                         
Sbjct  117   RVKALVNMSVPFPPRNPAVRPLNNFRAVYGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE GEIE EFA + T ++++ FL    
Sbjct  152   ---------CRF---------------------QEPGEIEEEFAQIDTARLMKKFLCLRI  181

Query  942   PSPLYLPKKGKLFE-GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
               PL +PK   L        LPSWLS+ DV+YY SKF + GFTG +NYYR  DL+WEL A
Sbjct  182   AKPLCIPKDTGLSTVPDPSALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCSDLNWELMA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVKFIVGD D+ YN  G KEYIH GG K+ VP L+EVVV+EGV HFI++EK
Sbjct  242   PWTGVQIEVPVKFIVGDQDLVYNNKGMKEYIHDGGFKKYVPYLQEVVVMEGVAHFINQEK  301

Query  1299  PHEINTHILNFLHNF  1343
               E+  HI  F+  F
Sbjct  302   AEEVGAHIYEFIKKF  316



>ref|XP_010088294.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33519.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 237/377 (63%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQ--GPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             ME IEH +V  NGI+MHVA  G    P ++FLHGFPE WY+WRHQM  L+S GYR +APD
Sbjct  1     MEKIEHTTVPTNGINMHVASIGSTTAPAIIFLHGFPELWYSWRHQMISLSSLGYRCIAPD  60

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             LRGYG+T   P+  P  +T  H+VGDLV LL  +  D+  +FVVGHDWGA++AW LCL+R
Sbjct  61    LRGYGETDAPPS--PESYTVFHIVGDLVGLLDHLGLDQ--IFVVGHDWGAVIAWYLCLFR  116

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVNMSV F+PR+P  KP+E  RA+ G+DYYI                       
Sbjct  117   PDRVKALVNMSVAFSPRHPTRKPIEGFRALLGNDYYI-----------------------  153

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                        CRF                     QE GE E +FA   T  +L+ F   
Sbjct  154   -----------CRF---------------------QEPGEAEKDFARDDTTNLLKKFYLG  181

Query  936   YNPSPLYLPKKGKLFE-GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
              NPSP  +PK+    +  +   +PSWL + DV +Y  KF++ GFTGG+NYYRALDL WEL
Sbjct  182   RNPSPPCIPKEIGFSDLKAPQTMPSWLLEEDVKFYARKFDEKGFTGGLNYYRALDLTWEL  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAW+G +V VPVKFI+GDLD+TY+ PGAKEYIH GG KRDVP L+EVVV+EGV H+I++
Sbjct  242   TAAWSGTQVKVPVKFIIGDLDVTYHVPGAKEYIHNGGFKRDVPYLQEVVVMEGVAHYINQ  301

Query  1293  EKPHEINTHILNFLHNF  1343
             EK  E   HI +F+  F
Sbjct  302   EKAEETAAHIYDFVKKF  318



>emb|CDP17206.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 196/377 (52%), Positives = 243/377 (64%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH  V +NGI+MHVA+ G+GPVVLFLHGFPE WYTWRHQ+   A+ GYRAVAPDLR
Sbjct  1     MEGIEHKIVDLNGINMHVAEKGEGPVVLFLHGFPELWYTWRHQITAFATLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP+   S +T  H+VGDLVAL+  +  D   VF+V HDWGAM+AW LCL+RPD
Sbjct  61    GYGDTD-APSSI-SSYTCFHIVGDLVALIQSLGVDH--VFLVAHDWGAMIAWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKA V++++ F PRNPK KP+  LRA +G++YY+CRFQ+                   G
Sbjct  117   MVKAFVSLTLPFRPRNPKMKPIAGLRAFFGEEYYMCRFQE------------------PG  158

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                A              + KY                  G  AVL  KK+    LT   
Sbjct  159   EIEAE-------------IAKY------------------GSKAVL--KKI----LTDRK  181

Query  942   PSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P  LP KG  F  S D    LP+WLS+ D+ YY +K+ + GFTGG+NYYRALDL+WEL
Sbjct  182   PGPPCLP-KGNPFGISPDTDIKLPAWLSEEDLKYYANKYAQKGFTGGLNYYRALDLNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAWTGA+V VPVKFIVGDLD+ Y  PG +EY+H GG KRDVP LEE V+++G GHF+H+
Sbjct  241   TAAWTGAQVKVPVKFIVGDLDMVYTTPGTQEYVHGGGFKRDVPFLEEPVIMKGTGHFLHQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             E+  EIN HI +F+  F
Sbjct  301   ERAEEINHHIHHFIKMF  317



>ref|XP_008235117.1| PREDICTED: bifunctional epoxide hydrolase 2 [Prunus mume]
Length=316

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 189/374 (51%), Positives = 242/374 (65%), Gaps = 58/374 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI+MH+A  G GPVVLFLHGFPE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MEKIEHTTVRTNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P+  P+ +++LH+VGDL+ LL  +  D+  VF+VGHDWGA++AW  CL+RPD
Sbjct  61    GFGDTDAPPS--PASYSALHIVGDLIGLLDHLGIDQ--VFLVGHDWGAVIAWWFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F+PRNPK KP++  RA++GDDYYICRFQ+     +I K+         G
Sbjct  117   RVKALVNMSVAFSPRNPKRKPVDGFRALFGDDYYICRFQE---PGEIEKEF-------AG  166

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
               +AS   +          C  KE+ LR   +W+                          
Sbjct  167   FDAASIMKKFLTGRSPKPPCLPKELGLR---AWK--------------------------  197

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
              +P  LP               WL + DV+Y+ SKF KTGF GG+NYYRAL+L WEL+  
Sbjct  198   -TPETLP--------------PWLLEEDVNYFASKFSKTGFVGGLNYYRALNLTWELTGP  242

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             WTG ++ VPVKFIVGDLDITY+ PG KEYIH GG KRDVP L+EVVV+E   HFI++EKP
Sbjct  243   WTGLQIKVPVKFIVGDLDITYHIPGMKEYIHNGGFKRDVPFLQEVVVIEDGAHFINQEKP  302

Query  1302  HEINTHILNFLHNF  1343
             HEI+ H+ +F+H F
Sbjct  303   HEISQHVYDFIHKF  316



>ref|XP_010429523.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/378 (49%), Positives = 233/378 (62%), Gaps = 62/378 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +VS NGI+MHVA  G GPV+LFLHGFP+ WY+WRHQ+   A+ GYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+  P  +T LH+VGDLV LL  +  D  +VF+VGHDWGA++AW LC+ RPD
Sbjct  61    GYGDSDAPPS--PESYTILHIVGDLVGLLDSLGVD--RVFLVGHDWGAIVAWWLCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN SV F PRNP  KP++  R ++GDDYY+CRFQ+              G   E 
Sbjct  117   RVKALVNTSVVFNPRNPSVKPVDKFRDLFGDDYYVCRFQET-------------GEIEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                  +                K++  RF  S                           N
Sbjct  164   FAQVDT----------------KKLITRFFVS--------------------------RN  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRA++L WEL+
Sbjct  182   PRPPCIPKSVG-FRGLPDPPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G ++ VPVKFIVGDLDITYN PG KEYIH GGLK+ VP L+EVVV+EGVGHF+ +E
Sbjct  241   APWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHGGGLKKHVPFLQEVVVMEGVGHFLQQE  300

Query  1296  KPHEINTHILNFLHNFSS  1349
             KP E+  HI  F   F +
Sbjct  301   KPDEVTDHIYGFFEKFRT  318



>gb|ACE82565.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 192/375 (51%), Positives = 244/375 (65%), Gaps = 61/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V+VNGI+MHVA+ G+GPV+LFLHGFPE WYTWRHQ+   A  G+RAVAPDLR
Sbjct  1     MESIEHRTVNVNGINMHVAEKGKGPVILFLHGFPELWYTWRHQLVAFADLGHRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +  S +T  HVVGDLVAL+  +    E VF+V HDWGAM+ W LCL+RPD
Sbjct  61    GYGDTD-APAEAAS-YTCFHVVGDLVALIESLGV--ESVFLVAHDWGAMIGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKA V +SV F PR+PK KP+ T+RA +GDDYY+                         
Sbjct  117   LVKAYVCLSVPFRPRHPKMKPIPTMRAFFGDDYYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ G +E E A  G++ VL+  LT   
Sbjct  152   ---------CRF---------------------QDPG-MEEEIAKYGSEVVLKKILTDRK  180

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P  LPK           LPSWLS++D++YY++KF++ GFTGG+NYYRALDL+WEL+AA
Sbjct  181   PGPPCLPKGSPFGISPDSKLPSWLSQDDLNYYSTKFDRKGFTGGLNYYRALDLNWELTAA  240

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPll-eevvvleGVGHFIHEEK  1298
             WTGAKV VPVKF+VG+LD+ Y  PG KEY+H GG K+DVP+L E+VVV+EG  HFI++E+
Sbjct  241   WTGAKVKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGAAHFINQER  300

Query  1299  PHEINTHILNFLHNF  1343
               EIN+HI +F++ F
Sbjct  301   AQEINSHIYDFINKF  315



>ref|XP_006396441.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
 gb|ESQ37894.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
Length=316

 Score =   350 bits (898),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/376 (49%), Positives = 235/376 (63%), Gaps = 62/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++S NGI+MHVA  G GPV+LFLHGFP+ WY+WRHQ+   A  GYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+  P  +T LH+VGDLV LL+ +  D  +VF+VGHDWGA++AW LC+ RPD
Sbjct  61    GYGDSDAPPS--PDSYTILHIVGDLVGLLNSLGVD--RVFLVGHDWGAIVAWWLCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V ALVN SV F PRNP  KP++  RA++GDDYY+CRFQ+              G   E 
Sbjct  117   RVNALVNTSVVFNPRNPSVKPVDAFRALFGDDYYVCRFQEP-------------GEIEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                A +                K++  RF                           T  N
Sbjct  164   FAQADT----------------KKLINRF--------------------------FTSRN  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRAL+L WEL+
Sbjct  182   PRPPCIPKTLG-FRGLPDPPPLPAWLTEQDVRFYADKFSQKGFTGGLNYYRALNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G ++ VPVKFIVGDLD+TY+ PG KEYIH+GGLK+ VP L+EVVV+EGVGHF+H+E
Sbjct  241   APWAGLQIKVPVKFIVGDLDLTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLHQE  300

Query  1296  KPHEINTHILNFLHNF  1343
             KP E+  HI  F   F
Sbjct  301   KPDEVTDHIYGFFKKF  316



>ref|XP_006414587.1| hypothetical protein EUTSA_v10025505mg [Eutrema salsugineum]
 gb|ESQ56040.1| hypothetical protein EUTSA_v10025505mg [Eutrema salsugineum]
Length=371

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 193/381 (51%), Positives = 241/381 (63%), Gaps = 65/381 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQ---TGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAP  392
             ++G+EH ++ VNGI+MH A+   +G  P++LF+HGFPE WYTWRHQM  L+S GYR +AP
Sbjct  46    LDGVEHKTLKVNGINMHYAEISGSGGDPIILFIHGFPELWYTWRHQMAALSSLGYRTIAP  105

Query  393   DLRGYGDTTGAPTDDPSK---FTSLHVVGDLVALL-SVVAADEEKVFVVGHDWGAMMAWA  560
             DLRGYGDT     D P K   +  L+VVGDLVA + +V  + +E VFVVGHDWGAM+AW 
Sbjct  106   DLRGYGDT-----DAPEKVEEYAYLNVVGDLVAHIDAVTTSGDEAVFVVGHDWGAMIAWQ  160

Query  561   LCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHP  740
             LC YRP+KVKALVNMSV F+PRNP   P+ TLR V+GDDYYICRFQK     +I  +   
Sbjct  161   LCQYRPEKVKALVNMSVVFSPRNPDRVPVPTLRHVFGDDYYICRFQK---PGEIEAEFKK  217

Query  741   IGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQ  920
             +G                            E  L+   +++  G +              
Sbjct  218   LG---------------------------TENVLKKFLTYKTPGPL--------------  236

Query  921   CFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDL  1100
                  Y P P    K  K  E +   LP WL++ D+ YY +K++K GFTG INYYR +D 
Sbjct  237   -----YLPKP----KLFKRSENAASALPPWLAQEDLHYYVNKYDKKGFTGPINYYRNIDR  287

Query  1101  DWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGH  1280
             +WEL+A WTGAK+ VPVKFIVGD D+TYN+PGAKEYIH GG KRDVPLL+E VVL G+GH
Sbjct  288   NWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYIHGGGFKRDVPLLDETVVLNGLGH  347

Query  1281  FIHEEKPHEINTHILNFLHNF  1343
             F+HEE P EIN HI NF   F
Sbjct  348   FLHEESPDEINQHIHNFFQKF  368



>ref|XP_010914488.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   349 bits (895),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 240/372 (65%), Gaps = 60/372 (16%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGY  407
             GI H +V VNGI MHVA+ G+GP VL LHGFPE WY+WRHQ+  LA++GYRA+APDLRGY
Sbjct  6     GISHRTVEVNGIRMHVAEKGEGPSVLLLHGFPELWYSWRHQIAGLAARGYRAIAPDLRGY  65

Query  408   GDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKV  587
             GDT   P  D + ++  H+VG    +  + A   + VFVVGHDWGA++AW LC++RPD+V
Sbjct  66    GDTDAPP--DVASYSIFHIVG--DLVALLDALALQHVFVVGHDWGALIAWNLCMFRPDRV  121

Query  588   KALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGAC  767
             KALVN+SV F PRNP  KP++  R +YGDDYY+CRFQ+                   GA 
Sbjct  122   KALVNLSVAFMPRNPAKKPVDYFRHLYGDDYYVCRFQE------------------PGAI  163

Query  768   SASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPS  947
              A                                     +FA + T  + + FL   +P 
Sbjct  164   EA-------------------------------------KFAQIETASIFRMFLPSRDPG  186

Query  948   PLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWT  1127
             PL +PK+G         LPSWLS+ D++++ SKF+K+GFTG +NYYR L+L+WEL+A WT
Sbjct  187   PLLMPKEGWNVPEKI-PLPSWLSEEDINFFASKFDKSGFTGPVNYYRCLNLNWELTAPWT  245

Query  1128  GAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHE  1307
             GA++ VPVKFIVGDLD+TY+ PG ++YIHKGG K++VPLL+EVVV+EGVGHFI++EK HE
Sbjct  246   GAQIKVPVKFIVGDLDLTYHYPGIQDYIHKGGFKQNVPLLQEVVVMEGVGHFINQEKAHE  305

Query  1308  INTHILNFLHNF  1343
             I  HI  F+  F
Sbjct  306   ITDHIYEFIQKF  317



>ref|XP_010094462.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB56095.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   349 bits (895),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 195/378 (52%), Positives = 242/378 (64%), Gaps = 64/378 (17%)
 Frame = +3

Query  222   MEG-IEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             MEG I H +VSVNGI MH+A+ G GPVVLFLHGFPE WY+WRHQ+  L+S GYRAVAPDL
Sbjct  1     MEGKITHRTVSVNGIEMHIAEKGNGPVVLFLHGFPELWYSWRHQISALSSLGYRAVAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT  AP D  S +T LHVVGDLV L+  +    E+V++V  DWG +MAW LCL+RP
Sbjct  61    RGYGDTD-APADVAS-YTCLHVVGDLVGLVDALGV--EQVYLVAQDWGCLMAWYLCLFRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             +KVKA V + V F PRNPK KP+E++RA +GDDYY+CRFQ+     +I  ++  +G    
Sbjct  117   EKVKAFVCLGVPFRPRNPKMKPVESMRAFFGDDYYMCRFQE---PGEIEAEMAQVGAS--  171

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                                         AVL  KK+    LT  
Sbjct  172   --------------------------------------------AVL--KKI----LTTR  181

Query  939   NPSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
              P P +LP KGK F    D    LPSWLS+ D++YY +KF+  GFTGG+NYYR LD++WE
Sbjct  182   KPGPPFLP-KGKAFRADPDASVTLPSWLSEEDLNYYATKFKLKGFTGGLNYYRNLDINWE  240

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L AAW GA+V VPVKFIVGDLD+ Y  PG KEY+H GG K+DVP L+EVVV+E  GHFI 
Sbjct  241   LMAAWDGAEVKVPVKFIVGDLDMVYTTPGTKEYVHNGGFKKDVPYLQEVVVIEDAGHFIS  300

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E+  EI+THI +F+  F
Sbjct  301   QERAEEISTHIYDFIQKF  318



>ref|XP_009393200.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 187/373 (50%), Positives = 237/373 (64%), Gaps = 62/373 (17%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRG  404
             EG+ H  V  NGISMHVA+ G+GP VL LHGFPE WY+WRHQ+  LA++GYRA+APDLRG
Sbjct  4     EGVAHRMVEANGISMHVAEKGEGPAVLLLHGFPELWYSWRHQIAGLAARGYRAIAPDLRG  63

Query  405   YGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDK  584
             YGDT+ AP+   S +T  H+VGDL+ALL  +A    +V++VGHDWGA +AW LCL+RPD+
Sbjct  64    YGDTS-APSAAAS-YTVFHIVGDLIALLDALAI--PQVYLVGHDWGAQIAWNLCLFRPDR  119

Query  585   VKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGA  764
             VKALVN+SV F PRNP  KP +  R+ YGDD+Y+CRFQ+                   GA
Sbjct  120   VKALVNLSVPFMPRNPAGKPTQHFRSFYGDDFYVCRFQE------------------PGA  161

Query  765   CSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNP  944
               A                                     EFA +GT K+L+  L   N 
Sbjct  162   IEA-------------------------------------EFARIGTGKLLRIVLCNRNA  184

Query  945   SPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAW  1124
              PL L +    FE     LPSWLS+ D+DY+ SK +K+GFTG +NYYR LDL+WEL A W
Sbjct  185   GPLLLSEVD--FEAEV-ALPSWLSEEDIDYFASKLDKSGFTGPVNYYRCLDLNWELGAPW  241

Query  1125  TGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPH  1304
             +G ++ VPVKFI+GD D+TY+ PG KEYI  GG +RDVP+LEE VV+EGV HFI++EK  
Sbjct  242   SGVQIQVPVKFIIGDQDMTYHFPGIKEYIQGGGFRRDVPMLEEAVVMEGVAHFINQEKAP  301

Query  1305  EINTHILNFLHNF  1343
             EI  HI +F+  F
Sbjct  302   EITDHICDFIRRF  314



>ref|XP_010556730.1| PREDICTED: bifunctional epoxide hydrolase 2 [Tarenaya hassleriana]
Length=316

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 187/376 (50%), Positives = 238/376 (63%), Gaps = 62/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I H +VS NGI+MHVA  G GP +LFLHGFP+ WY+WRHQ+  L++ GYRA+APDLR
Sbjct  1     MEKIVHTTVSTNGINMHVASIGSGPPILFLHGFPDLWYSWRHQLLSLSALGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+ +   +T LH+VGDLV LL  +  D  +VF+VGHDWGA++AW LCL RPD
Sbjct  61    GYGDSDAPPSLE--SYTVLHLVGDLVGLLDSLGLD--RVFLVGHDWGAIVAWWLCLIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V ALVN SV F+PRNP  KP++  RA++GDDYYICRFQ+              G   E 
Sbjct  117   RVNALVNTSVAFSPRNPAVKPVDGFRALFGDDYYICRFQER-------------GEIEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                A +                K++  +F                          LT  N
Sbjct  164   FAQAGA----------------KKLITKF--------------------------LTSRN  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP WL++ D+DYY  KF + GFTGG+NYYRA++L WEL+
Sbjct  182   PRPPCIPKALG-FRGLPDPPSLPDWLTEQDIDYYAEKFSQKGFTGGLNYYRAMNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTGA++ VPVKF+VGDLD+TY+ PG KEYIH+GG+K+ VP L+EVVVLEGVGHF+ +E
Sbjct  241   APWTGAQIKVPVKFMVGDLDVTYHIPGVKEYIHEGGIKKQVPFLQEVVVLEGVGHFLQQE  300

Query  1296  KPHEINTHILNFLHNF  1343
             KP EI  HI +F   F
Sbjct  301   KPEEITAHIHDFFKKF  316



>ref|XP_004965308.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=361

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/378 (49%), Positives = 249/378 (66%), Gaps = 66/378 (17%)
 Frame = +3

Query  231   IEHISVSVN-GISMHVAQTGQG--PVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             I H ++ V+ G+ +HVA+ G    P VL LHGFPE WYTWRHQM  LA+ GYRAVAPDLR
Sbjct  44    ITHRTLEVSTGVRLHVAEAGPAGAPTVLLLHGFPELWYTWRHQMRALAAAGYRAVAPDLR  103

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYG +     ++P ++T++HVVGDLVALL   A  E KVFV  HDWGA+ AW+LCL+RPD
Sbjct  104   GYGGSDAPAVEEPGQYTAMHVVGDLVALLD--ALGERKVFVAAHDWGAVTAWSLCLFRPD  161

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V+ALV +SV +TPR+   +P++ LRA+YGD+YYICR Q+                   G
Sbjct  162   RVRALVALSVAYTPRSAARRPVDGLRAIYGDEYYICRIQE------------------PG  203

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A  A                                     EF  LGT+ VL+ F +Y  
Sbjct  204   AIEA-------------------------------------EFKRLGTELVLRKFFSYRT  226

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL +PK G    GS DD   LPSW+++ D++YYTS+FE+TGFTGG+NYYRAL+  WEL
Sbjct  227   PGPLIIPKTGW---GSPDDQVLLPSWVTEEDLNYYTSEFERTGFTGGLNYYRALNRTWEL  283

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +++WT +++ VPVKFI+GDLD+TY+ PG +++IHKGG K+ VPLL++VVV++ VGHFI+E
Sbjct  284   TSSWTASEINVPVKFIIGDLDLTYHTPGIQDFIHKGGFKKFVPLLDDVVVMKDVGHFINE  343

Query  1293  EKPHEINTHILNFLHNFS  1346
             EKP E++ HI++F+  F+
Sbjct  344   EKPKEVSEHIISFIKKFN  361



>ref|XP_010422608.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/378 (49%), Positives = 233/378 (62%), Gaps = 62/378 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++S NGI+MHV   G GPV+LFLHGFP+ WY+WRHQ+   A+ GYRA+APDLR
Sbjct  1     MERIEHTTISTNGINMHVTSIGTGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+  P  +T LH+VGDLV LL  +  D  +VF+VGHDWGA++AW LC+ RPD
Sbjct  61    GYGDSDAPPS--PESYTILHIVGDLVGLLDSLGVD--RVFLVGHDWGAIVAWWLCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN SV F PRNP  KP++  RA++GDDYY+CRFQ+              G   E 
Sbjct  117   RVKALVNTSVVFNPRNPSVKPVDKFRALFGDDYYVCRFQEA-------------GEIEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                  +                K++  RF  S                           N
Sbjct  164   FAQVDT----------------KKLITRFFVS--------------------------RN  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRA++L WEL+
Sbjct  182   PRPPCIPKSVG-FRGLPDPPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G ++ VPVKFIVGDLDITYN PG KEY+H GGLK+ VP L+EVVV+EGVGHF+ +E
Sbjct  241   APWAGLQIKVPVKFIVGDLDITYNIPGTKEYLHGGGLKKHVPFLQEVVVMEGVGHFLQQE  300

Query  1296  KPHEINTHILNFLHNFSS  1349
             KP E+  HI  F   F +
Sbjct  301   KPDEVTDHIYGFFEKFKT  318



>ref|XP_004152242.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156832.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52825.1| hypothetical protein Csa_4G001920 [Cucumis sativus]
Length=316

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 238/378 (63%), Gaps = 66/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ I+H +++ NGI MH+A  G GPVVL LHGFPE WY+WRHQ+ +L+S GYRA+APDLR
Sbjct  1     MDAIQHTTINTNGIKMHIASIGNGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLY  572
             GYGD     TD P   + +T+LH+VGDL+  L  +    EKVF+VGHDWGA++AW  CL+
Sbjct  61    GYGD-----TDSPGSHTSYTALHIVGDLIGALDELGI--EKVFLVGHDWGAIIAWYFCLF  113

Query  573   RPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRR  752
             RP+++KALVN+SV F PRNP    ++  RA YGDD+Y+CRFQ                  
Sbjct  114   RPERIKALVNLSVQFFPRNPAISFIQRFRAAYGDDFYMCRFQ------------------  155

Query  753   SEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLT  932
               G   A   C                                     + T ++ +  L+
Sbjct  156   VPGEAEADFAC-------------------------------------IDTAQLFKTTLS  178

Query  933   YYNPSPLYLPKK-GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
               +     LPK+ G       ++LPSWL++ D++YY +KF++TGFTG +NYYRA DL WE
Sbjct  179   TRSTEAPCLPKEYGFRAIPPPENLPSWLTEEDINYYAAKFKETGFTGALNYYRAFDLTWE  238

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG ++ VPVKFIVGDLDITY+  GAKEYIH GG KRDVPLLEEVV+++  GHF+H
Sbjct  239   LTAPWTGVQIQVPVKFIVGDLDITYHFKGAKEYIHDGGFKRDVPLLEEVVIVKNAGHFVH  298

Query  1290  EEKPHEINTHILNFLHNF  1343
             EEKPHEINTHI +F+  F
Sbjct  299   EEKPHEINTHIHDFIKKF  316



>emb|CDY05187.1| BnaC05g46160D [Brassica napus]
Length=340

 Score =   349 bits (896),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 190/381 (50%), Positives = 234/381 (61%), Gaps = 70/381 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGI+H  VSVNGI+MH+A+ G  +G VVL LHGFP+ WYTWRHQ+  L+S GYRAVAPD
Sbjct  10    MEGIDHRMVSVNGITMHIAEKGPKEGTVVLLLHGFPDLWYTWRHQITALSSLGYRAVAPD  69

Query  396   LRGYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             LRGYGD+     D P   S++T LH+VGDLVALL  V  D+EKVF+VGHDWGA++ W LC
Sbjct  70    LRGYGDS-----DSPESFSEYTCLHLVGDLVALLDSVVGDQEKVFLVGHDWGAIVGWYLC  124

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L+RP+K+K  V +SV + PRNPK KP+E  +AV+GDDYYICRFQ+            P  
Sbjct  125   LFRPEKIKGFVCLSVPYRPRNPKVKPVEGFKAVFGDDYYICRFQE------------PGK  172

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                E AC+                                             ++VL+  
Sbjct  173   AEGEIACADP-------------------------------------------RRVLKNI  189

Query  927   LTYYNPSPLYLPKKGKLFEGSTD-----DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
              T     P  LPK               +LP W SK D+DYY SKFEKTGFTGG+NYYRA
Sbjct  190   FTGRELGPPILPKDNPFGANPNPNCEQVELPEWFSKEDLDYYVSKFEKTGFTGGLNYYRA  249

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +DL WEL+A WTGAK+ VPVKF+ GDLD+ Y  PG KEYIH GG   DVP L+EVVV+E 
Sbjct  250   MDLTWELTAPWTGAKIQVPVKFMTGDLDMVYTTPGVKEYIHGGGFAADVPNLQEVVVIED  309

Query  1272  VGHFIHEEKPHEINTHILNFL  1334
              GHF+++EKP E+  HI +F 
Sbjct  310   AGHFVNQEKPQEVTAHINDFF  330



>ref|XP_010104146.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB98711.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 195/378 (52%), Positives = 242/378 (64%), Gaps = 64/378 (17%)
 Frame = +3

Query  222   MEG-IEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             MEG I H +VSVNGI MH+A+ G GPVVLFLHGFPE WY+WRHQ+  L+S GYRAVAPDL
Sbjct  1     MEGKITHRTVSVNGIEMHIAEKGNGPVVLFLHGFPELWYSWRHQISALSSLGYRAVAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT  AP D  S +T LHVVGDLV L+  +    E+V++V  DWG +MAW LCL+RP
Sbjct  61    RGYGDTD-APADVAS-YTCLHVVGDLVGLVDALGV--EQVYLVAQDWGCLMAWYLCLFRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             +KVKA V + V F PRNPK KP+E++RA +GDDYY+CRFQ+     +I  ++  +G    
Sbjct  117   EKVKAFVCLGVPFRPRNPKMKPVESMRAFFGDDYYMCRFQE---PGEIEAEMAQVGAS--  171

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                                         AVL  KK+    LT  
Sbjct  172   --------------------------------------------AVL--KKI----LTTR  181

Query  939   NPSPLYLPKKGKLFEGSTD---DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
              P P +LP KGK F    D    LPSWLS+ D++YY +KF+  GFTGG+NYYR LD++WE
Sbjct  182   KPGPPFLP-KGKAFRADPDASVTLPSWLSEEDLNYYATKFKLKGFTGGLNYYRNLDINWE  240

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L AAW GA+V VPVKFIVGDLD+ Y  PG KEY+H GG K+DVP L+EVVV+E  GHFI 
Sbjct  241   LMAAWDGAEVKVPVKFIVGDLDMVYTTPGTKEYVHNGGFKKDVPYLQEVVVIEDAGHFIG  300

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E+  EI+THI +F+  F
Sbjct  301   QERAEEISTHIYDFIQKF  318



>ref|XP_002283462.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 187/377 (50%), Positives = 241/377 (64%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH  VSVNGI MHVA+ GQGPVVLFLHGFPE WYTWRHQ+  +AS GY AVAPDLR
Sbjct  1     MEGIEHRMVSVNGIKMHVAEKGQGPVVLFLHGFPELWYTWRHQIIAMASHGYHAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTS---LHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLY  572
             GY D     ++ P+ FTS   LHVVGDL+AL+  + AD  KVF+VGHDWGA + W +CL+
Sbjct  61    GYSD-----SEAPASFTSYTCLHVVGDLIALIDCLGAD--KVFLVGHDWGAQIGWYMCLF  113

Query  573   RPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRR  752
             RPD+VKA V+++V F PRNPK +P+E +RA +GDDYY+CRFQK     +I  ++  +G  
Sbjct  114   RPDRVKAYVSLTVPFRPRNPKIRPIEGMRAFFGDDYYMCRFQK---PGEIEAEIARLGS-  169

Query  753   SEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLT  932
                                      KE+  R L   + G     +    G K +      
Sbjct  170   -------------------------KEVLKRILTDRKPGPPCLPKENPFGIKAI------  198

Query  933   YYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
                PSP                LPSW S+ D++YY  K+++ GFTGG+NYYRALDL+WEL
Sbjct  199   --PPSP----------------LPSWFSEEDLNYYARKYDEKGFTGGLNYYRALDLNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A WTG +V VPVKF+VGDLD+ Y  PG KEY+  G  K+DVP LE++V++EG GHFI++
Sbjct  241   TAPWTGEQVRVPVKFVVGDLDMVYTTPGVKEYVDSGAFKKDVPCLEDIVIIEGAGHFINQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             EK  EIN +I++F+  F
Sbjct  301   EKAEEINNYIVDFIRKF  317



>ref|XP_006419517.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
 gb|ESR32757.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
Length=319

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 242/377 (64%), Gaps = 61/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+GI+H  V VNGI+MH+A+ GQGPV+LFLHGFPE WY+WRHQ+  LAS GYRAVAPDLR
Sbjct  1     MDGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P  + + +T  HV+GDLV L+  VA  +EKVFVVGHDWGA+MAW LCL+RPD
Sbjct  61    GFGDTDAPP--EVTSYTCFHVIGDLVGLIDTVAPSDEKVFVVGHDWGALMAWFLCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN+SV F P       +E LRA YGD+YY+CRFQK     +I  +   IG     
Sbjct  119   RIKALVNLSVVFNPFGSNDNLIEALRAYYGDNYYMCRFQK---PGEIEAEFAQIG-----  170

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    E  ++  F++  G  I                     
Sbjct  171   ----------------------TETVIKEFFTFWTGDRI---------------------  187

Query  942   PSPLYLPKKGKLF---EGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
                 +LP KGK F     +   LPSWLS+ DV Y+T+KF+K GFTG +NYYR ++L+ EL
Sbjct  188   ----FLP-KGKGFGRPPNTPIALPSWLSEEDVKYFTTKFDKKGFTGAMNYYRNINLNHEL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
              A W G+++ +P KFI+GDLD+TY+ PG +EYIHKGG KRDVPLLE+VV++EGVGHFI++
Sbjct  243   LAPWAGSQIQIPTKFIIGDLDMTYHMPGVQEYIHKGGFKRDVPLLEKVVIMEGVGHFINQ  302

Query  1293  EKPHEINTHILNFLHNF  1343
              K +EI+ HI +F + F
Sbjct  303   GKSNEISKHIYDFFNKF  319



>gb|KCW50060.1| hypothetical protein EUGRSUZ_K03501 [Eucalyptus grandis]
Length=332

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 188/369 (51%), Positives = 232/369 (63%), Gaps = 66/369 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGP-VVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME IEH +V  NGI+MHVA  G GP  VLF+HGFPE WY+WRHQM  LA+ GYRA+APDL
Sbjct  1     MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMLSLAALGYRAIAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYG T   P  +   +T+ HVVGDLV +L  +     +VFVVGHDWGA+MAW LCL RP
Sbjct  61    RGYGGTDAPPRVE--SYTAFHVVGDLVGMLDALGIG--RVFVVGHDWGAIMAWHLCLVRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D+VKALVN SV + PRNP+ KP+E++RA +GDDYY+                        
Sbjct  117   DRVKALVNTSVAWFPRNPERKPVESMRATFGDDYYV------------------------  152

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                       CRF                     QE G  E +FA     K++Q FLT  
Sbjct  153   ----------CRF---------------------QEPGVAEEDFAKADIAKLIQLFLTGR  181

Query  939   NPSPLYLPKKG------KLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDL  1100
             +PSP  +PK        KL +    +LPSWL+ +D+ YY ++F +TGFTGG NYYR LDL
Sbjct  182   DPSPPIVPKDVGISGLIKLLDQQQVELPSWLTDDDISYYATQFSRTGFTGGFNYYRCLDL  241

Query  1101  DWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGH  1280
             +WELSA WTGA++ VPVKFIVGDLD+TY+ PG KEYIH GG K+ VP LE+VVV+EGV H
Sbjct  242   NWELSAPWTGARIEVPVKFIVGDLDLTYHFPGVKEYIHDGGFKKAVPNLEDVVVMEGVAH  301

Query  1281  FIHEEKPHE  1307
             F+ +EKP E
Sbjct  302   FLQQEKPQE  310



>ref|XP_006414415.1| hypothetical protein EUTSA_v10025689mg [Eutrema salsugineum]
 gb|ESQ55868.1| hypothetical protein EUTSA_v10025689mg [Eutrema salsugineum]
Length=329

 Score =   348 bits (892),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 193/382 (51%), Positives = 236/382 (62%), Gaps = 72/382 (19%)
 Frame = +3

Query  237   HISVSVNGISMHVAQ-----TGQG--------PVVLFLHGFPECWYTWRHQMCFLASQGY  377
             H  V VNGI+MH+A+      G G        PV+LFLHGFPE WYTWRHQM  L+S GY
Sbjct  7     HRFVKVNGINMHIAEKSPSVAGNGAFDGALRRPVILFLHGFPELWYTWRHQMVALSSLGY  66

Query  378   RAVAPDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAW  557
             R +APDLRGYGDT    + D   +TSLHVVGDL+ L+  V  D EKVFVVGHDWGA++AW
Sbjct  67    RTIAPDLRGYGDTEAPESVD--AYTSLHVVGDLIGLIDAVVGDREKVFVVGHDWGAIIAW  124

Query  558   ALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLH  737
              LCL RPD+VKALVNMSV F P NPK KP+ T R+ YGDDYYICR Q             
Sbjct  125   NLCLLRPDRVKALVNMSVVFDPWNPKRKPISTYRSFYGDDYYICRIQ-------------  171

Query  738   PIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVL  917
                                         +Y EI              E EFA +GT++VL
Sbjct  172   ----------------------------EYGEI--------------EAEFAKVGTERVL  189

Query  918   QCFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALD  1097
                LTY NP P+ LP +GK ++     LPSWL++ DV YY SK+EK+GFTG +NYYR +D
Sbjct  190   LELLTYRNPGPILLP-RGKSYDDPV-SLPSWLTEYDVKYYVSKYEKSGFTGPLNYYRNMD  247

Query  1098  LDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVG  1277
               WEL    + A+V VPVKFI+GD D+TY+ PG K+YI +G  K  VPLL+EVVV++GVG
Sbjct  248   RTWELMGPLSKAQVKVPVKFIIGDQDLTYHIPGTKKYIQEGRFKSHVPLLDEVVVMKGVG  307

Query  1278  HFIHEEKPHEINTHILNFLHNF  1343
             HF+HEE P EI+ HI ++   F
Sbjct  308   HFLHEESPDEISKHIHDYFLTF  329



>ref|XP_011092097.1| PREDICTED: bifunctional epoxide hydrolase 2 [Sesamum indicum]
Length=317

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 246/376 (65%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +VSVNGI+MHVA+ GQGP+VLFLHGFPE WYTWRHQ+   A+ GYRAVAPDLR
Sbjct  1     MEGIEHRTVSVNGINMHVAEKGQGPIVLFLHGFPELWYTWRHQIVAFAALGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP  + S ++ LHVVGD+VAL+  +   ++ VF+V HDWGAM+ W LCL+RPD
Sbjct  61    GYGDTD-APA-EVSSYSCLHVVGDIVALIESLGGGDQ-VFLVAHDWGAMIGWYLCLFRPD  117

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKA V+++V F PR+P  KP+E +RA +G+DYY+CRFQ+            P    SE 
Sbjct  118   LVKAYVSLTVPFRPRHPNVKPVEGMRAFFGEDYYMCRFQE------------PGKMESE-  164

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                               + +Y                  G  AV+  KK+L    T   
Sbjct  165   ------------------IARY------------------GAEAVI--KKIL----TDRT  182

Query  942   PSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P YLPK+   F  + DD  LP W +++D+ YY   +EK GFTGG+NYYRALDL+WEL+
Sbjct  183   PGPPYLPKETP-FGSNIDDIKLPPWFTEDDLKYYAENYEKRGFTGGLNYYRALDLNWELT  241

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             AAWTGAKV VPVKF+VGD+D+ Y  PG KEY+H GG K DVPLLEE VV++ VGHF+++E
Sbjct  242   AAWTGAKVRVPVKFVVGDVDMVYTTPGLKEYVHGGGFKNDVPLLEECVVMDNVGHFLNQE  301

Query  1296  KPHEINTHILNFLHNF  1343
             K  E+N +I  F+  F
Sbjct  302   KADEVNAYIHEFIKKF  317



>ref|XP_002523108.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39293.1| epoxide hydrolase, putative [Ricinus communis]
Length=316

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 185/375 (49%), Positives = 240/375 (64%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V+ NGI+MHVA  G GP +LFLHGFPE WY+WRHQ+  L+S+GYR +APDLR
Sbjct  1     MEKIEHTTVATNGINMHVAAIGTGPEILFLHGFPELWYSWRHQLLSLSSRGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +  + +T+LH+VGDL+ LL  +    E+VF+VGHDWGAMMAW LC++RPD
Sbjct  61    GYGDTD-AP-ESLTGYTALHIVGDLIGLLDSMGI--EQVFLVGHDWGAMMAWYLCMFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN SV +  RNP+ K LE  R VYGDDYY+                         
Sbjct  117   RIKALVNTSVAYMSRNPQLKSLELFRTVYGDDYYV-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G  E +FA + T K+++   T  +
Sbjct  152   ---------CRF---------------------QEPGGAEEDFAQVDTAKLIRSVFTSRD  181

Query  942   PSPLYLPKK-GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P+P  +PK+ G         LPSWLS+ DV+YY  KF K GFTGG+NYYR +D +WEL+A
Sbjct  182   PNPPIVPKEIGFRSLPDPPSLPSWLSEEDVNYYADKFNKKGFTGGLNYYRNIDQNWELTA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              W G ++ VPVKF++GDLD+TY+ PG K+YIH GG K+ VPLL+EVVV+EGV HFI++EK
Sbjct  242   PWDGLQIKVPVKFVIGDLDLTYHFPGIKDYIHNGGFKQVVPLLQEVVVMEGVAHFINQEK  301

Query  1299  PHEINTHILNFLHNF  1343
             P EI+ HI +F+  F
Sbjct  302   PEEISEHIYDFIKKF  316



>ref|XP_010039619.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW84772.1| hypothetical protein EUGRSUZ_B015792 [Eucalyptus grandis]
Length=317

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 192/377 (51%), Positives = 245/377 (65%), Gaps = 63/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H +V VNG+++HVA++G+GP+VL +HGFPE WYTWRHQ+  LA+ G+RAVAPDLR
Sbjct  1     METIKHRTVKVNGVNLHVAESGEGPLVLLIHGFPELWYTWRHQILGLAALGFRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+          +T+LHVVGDLV LL   A  EEK FVV HDWGA+MAW LCL RPD
Sbjct  61    GYGDSDAPAAA--DAYTALHVVGDLVGLLD--AEGEEKAFVVAHDWGALMAWYLCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA+V++SV + PRNP  KPL+  RA YGDDYY+CRFQ+                    
Sbjct  117   RVKAMVSLSVPWMPRNPGMKPLDGYRAAYGDDYYMCRFQEPG------------------  158

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    EI+ +F              A +GT++V++ FLTY  
Sbjct  159   -----------------------EIEAQF--------------AEMGTRRVIEGFLTYRI  181

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+   KGK F    DD   LPSWL++ D+DYY  KFE+ GFTGGINYYR L+ +WEL
Sbjct  182   PGPLFF-VKGKGFGHPVDDPVVLPSWLTQEDIDYYVDKFEEKGFTGGINYYRNLNRNWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
              A W G +V VPVKFIVG+LD+ Y+ PG K++IHKGGLK+ VPLLEEVVV+EGV HF+++
Sbjct  241   MAPWDGVQVKVPVKFIVGELDLVYHMPGVKDFIHKGGLKKTVPLLEEVVVMEGVAHFLNQ  300

Query  1293  EKPHEINTHILNFLHNF  1343
             E+P +   HI +FL  F
Sbjct  301   ERPQDTTQHIYDFLSKF  317



>ref|XP_010039627.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW84775.1| hypothetical protein EUGRSUZ_B015791 [Eucalyptus grandis]
Length=320

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 195/378 (52%), Positives = 246/378 (65%), Gaps = 62/378 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H +V VNG+++HVA++G+GP+VL +HGFPE WYTWRHQ+  LA+ G+RAVAPDLR
Sbjct  1     METIKHRTVKVNGVNLHVAESGEGPLVLLIHGFPELWYTWRHQILGLAALGFRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAAD-EEKVFVVGHDWGAMMAWALCLYRP  578
             GYGD+          +T+LHVVGDLV LL  VAA+ EEK FVV HD GA MAW LCL RP
Sbjct  61    GYGDSDAPAAA--DAYTALHVVGDLVGLLDAVAAEGEEKAFVVAHDVGAQMAWYLCLLRP  118

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D+VKALV++S+ + PRNP  KPL+  RA YGDDYY+CRFQ+                   
Sbjct  119   DRVKALVSLSLPWVPRNPGMKPLDGYRAAYGDDYYMCRFQEPG-----------------  161

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                     EI+ +F              A +GT++VL+  LTY 
Sbjct  162   ------------------------EIEAQF--------------AEMGTRRVLEGVLTYR  183

Query  939   NPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
              P PL+L  KGK F    DD   LPSWL++ DVDYY  KFEK GFTGGINYYR ++ +WE
Sbjct  184   IPGPLFL-VKGKGFGHPVDDPVVLPSWLTQKDVDYYVDKFEKKGFTGGINYYRNMNRNWE  242

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L A W GA+V VPVKFIVG+LD+ Y+ PG K++IHKGG K+ VPLLEEVVV+EGV HF++
Sbjct  243   LMAPWDGAQVKVPVKFIVGELDLVYHMPGVKDFIHKGGFKKMVPLLEEVVVMEGVAHFLN  302

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E+P +   HI +FL  F
Sbjct  303   QERPQDTTQHIYDFLSKF  320



>ref|XP_002884518.1| hypothetical protein ARALYDRAFT_317420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60777.1| hypothetical protein ARALYDRAFT_317420 [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score =   347 bits (890),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 190/381 (50%), Positives = 236/381 (62%), Gaps = 70/381 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGI+H  VSVNGI+MH+A+ G  +GPVVL LHGFP+ WYTWRHQ+C L+S GYRAVAPD
Sbjct  1     MEGIDHRMVSVNGITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQICGLSSLGYRAVAPD  60

Query  396   LRGYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             LRGYGD+     D P   S++T L+VVGDLVALL  VA D+EKVF+VGHDWGA++ W LC
Sbjct  61    LRGYGDS-----DSPESFSEYTCLNVVGDLVALLDSVAGDQEKVFLVGHDWGAIIGWFLC  115

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L+RP+K+K  V +SV +  RNP  KP++  +AV+GDDYYICRFQ+              G
Sbjct  116   LFRPEKIKGFVCLSVPYRSRNPLVKPVQGFKAVFGDDYYICRFQEP-------------G  162

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
             +      SA                    I LR LF+ +  G                  
Sbjct  163   KTEAEIASADP-----------------RIFLRNLFTGRSLG------------------  187

Query  927   LTYYNPSPLYLPKKGKLFEGSTD-----DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
                    P  LPK     E         +LP W SK D+D+Y SKFEKTGFTGG+NYYRA
Sbjct  188   -------PPILPKDNPFGENPNPNSENIELPEWFSKKDLDFYVSKFEKTGFTGGLNYYRA  240

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +DL+WEL+  WTGAKV VPVKF+ GD D+ Y  PG KEYIH GG   DVP L+E+VV+E 
Sbjct  241   MDLNWELTTPWTGAKVQVPVKFMTGDFDMVYTTPGMKEYIHGGGFSADVPTLQEIVVIED  300

Query  1272  VGHFIHEEKPHEINTHILNFL  1334
              GHF+++EKP E+  HI +F 
Sbjct  301   AGHFVNQEKPQEVTAHINDFF  321



>ref|XP_008454322.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Cucumis 
melo]
Length=316

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 236/375 (63%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ I+H ++  NGI MH+A  G GPVVL LHGFPE WY+WRHQ+ +L+S GYRA+APDLR
Sbjct  1     MDAIQHTTIKTNGIKMHIASVGNGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT     +  + +T+LH+VGDLV  L  +    EKVF+VGHDWGA++AW  CL+RP+
Sbjct  61    GYGDTDSP--ESHTSYTALHIVGDLVGALDELGI--EKVFLVGHDWGAIIAWYFCLFRPE  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN+SV F PRNP    ++  RA YGDD+Y+CRFQ                    G
Sbjct  117   RIKALVNLSVQFFPRNPAISFIQRFRAAYGDDFYMCRFQ------------------VPG  158

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                A   C                                     + T ++ +  L+  +
Sbjct  159   EAEADFAC-------------------------------------IDTAQLFKTTLSNRS  181

Query  942   PSPLYLPKK-GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
                  LPK+ G       ++LPSWL++ D++YY +KF++TGFTG +NYYRA DL WEL+A
Sbjct  182   TKAPCLPKEYGFRAIPPPENLPSWLTEEDINYYAAKFKETGFTGALNYYRAFDLTWELTA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVKFIVGD D+TY+  GAKEYIH+GG KRDVPLLEEVV++E  GHF+HEEK
Sbjct  242   PWTGVQIQVPVKFIVGDSDLTYHFKGAKEYIHEGGFKRDVPLLEEVVIVENAGHFVHEEK  301

Query  1299  PHEINTHILNFLHNF  1343
             PHEINTHI +F+  F
Sbjct  302   PHEINTHIHDFIKKF  316



>gb|KGN66047.1| hypothetical protein Csa_1G569240 [Cucumis sativus]
Length=317

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 240/376 (64%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ I H +VSVNGI+MH+A+ G+GP+VLF+HGFPE WYTWRHQ+  L+S GY AVAPDLR
Sbjct  1     MDTISHRTVSVNGINMHIAEKGEGPIVLFIHGFPELWYTWRHQILALSSLGYHAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+  AP D  S ++ +H+VGDLVAL+      E  VFVV HDWGA++AW+LCL+R +
Sbjct  61    GYGDSD-AP-DSISSYSIMHIVGDLVALVESFGVKE--VFVVAHDWGALIAWSLCLFRAE  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
              VKA V +SV F PR+P  KP+ET+R V+GDDYYICRFQ      +I +++  +G     
Sbjct  117   MVKAFVCLSVPFRPRHPNRKPVETMRMVFGDDYYICRFQN---PGEIEEEMAQVG-----  168

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                                             K VL+  LT   
Sbjct  169   -----------------------------------------------AKDVLRGILTTRR  181

Query  942   PSPLYLPKKG--KLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
               P   PKK   +   G    LPSWLS+ D+ Y+ SK+E+ GFTG +NYYR++DL+WEL+
Sbjct  182   QGPPIYPKKQAFRARAGPPSPLPSWLSEEDLSYFASKYEQKGFTGPLNYYRSMDLNWELT  241

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTG +V VPVKFIVGD+D+ Y  PG KEY++ GG K+DVP L++VVV++GVGHF+++E
Sbjct  242   APWTGVQVKVPVKFIVGDVDMVYTTPGVKEYVNGGGFKKDVPFLQDVVVMDGVGHFLNQE  301

Query  1296  KPHEINTHILNFLHNF  1343
             KP EINTHI +F+  F
Sbjct  302   KPEEINTHIYDFIKKF  317



>emb|CDX90553.1| BnaA03g42280D [Brassica napus]
Length=326

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 191/379 (50%), Positives = 237/379 (63%), Gaps = 69/379 (18%)
 Frame = +3

Query  237   HISVSVNGISMHVAQ-----TGQG-----PVVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             H  V VNGI+MH A+     T  G     PV+LFLHGFPE WYTWRHQM  L+S GYR +
Sbjct  7     HRFVKVNGINMHFAEKTPSFTDNGASRPPPVILFLHGFPELWYTWRHQMVALSSLGYRTI  66

Query  387   APDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             APDLRGYGDT    + D   +TSLHVVGDL+ L+  V  D EKVFVVGHDWGA++AW LC
Sbjct  67    APDLRGYGDTEAPESAD--AYTSLHVVGDLIGLIDAVVGDREKVFVVGHDWGAIIAWHLC  124

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L RPD+VKALVNMSV F P N K KP+   ++ YGDDYYICRFQ                
Sbjct  125   LLRPDRVKALVNMSVVFEPWNLKRKPISMFKSFYGDDYYICRFQ----------------  168

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                                      +Y EI              E EFA +GT++VL   
Sbjct  169   -------------------------EYGEI--------------EAEFAKVGTERVLLEM  189

Query  927   LTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
             LTY N  P+ LP KGK ++     LPSWL++ DV YY SK+EK+GFTG +NYYR +D  W
Sbjct  190   LTYRNTGPILLP-KGKSYDDPV-SLPSWLTEYDVKYYVSKYEKSGFTGPVNYYRNMDRTW  247

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             E+  A++ A+V VPVKFI+GD D+TY+ PG K+YIH+G  K  VPLL++VVV++GVGHF+
Sbjct  248   EMMGAFSNAQVKVPVKFIIGDKDLTYHIPGTKKYIHEGRFKSHVPLLDKVVVIKGVGHFL  307

Query  1287  HEEKPHEINTHILNFLHNF  1343
             HEE+P EI+ HI ++   F
Sbjct  308   HEERPDEISKHIHDYFLTF  326



>ref|XP_002443185.1| hypothetical protein SORBIDRAFT_08g014640 [Sorghum bicolor]
 gb|EES17023.1| hypothetical protein SORBIDRAFT_08g014640 [Sorghum bicolor]
Length=374

 Score =   348 bits (892),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 187/379 (49%), Positives = 249/379 (66%), Gaps = 66/379 (17%)
 Frame = +3

Query  231   IEHISVSVN-GISMHVAQTGQ--GPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             I H +V ++ G+ +H+A+ G    P VL LHGFPE WYTWRHQM  LA+ GYRAVAPDLR
Sbjct  55    ITHRTVELSTGVRLHLAEAGPSGAPTVLLLHGFPELWYTWRHQMRALAAAGYRAVAPDLR  114

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+      DP ++T+LHVVGDLVAL+  V   E++VFV  HDWGA+ AW+LCL+RPD
Sbjct  115   GYGDSDAPAVADPGQYTALHVVGDLVALIDDVLG-EKQVFVAAHDWGALTAWSLCLFRPD  173

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KV+ LV +SV +TPR+   KP++ LRA++GDDYYICR Q+                    
Sbjct  174   KVRTLVALSVAYTPRSAARKPVDGLRALFGDDYYICRIQEA-------------------  214

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    EI+  F              A LGT+ VL+ F +Y  
Sbjct  215   ----------------------GEIEAEF--------------ARLGTELVLKKFFSYRY  238

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL+ PK G    GS DD   LPSW+++ D+ YYT+KFEKTGFTGG+NYYRAL+  WEL
Sbjct  239   PGPLFFPKSGW---GSLDDEVPLPSWVTEEDLKYYTNKFEKTGFTGGLNYYRALNKTWEL  295

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPll-eevvvleGVGHFIH  1289
             ++ WT AK+ VPVKFI+GDLD+TY++PG ++++HKGG K+ VPLL +++VV++ VGHFI+
Sbjct  296   TSPWTLAKINVPVKFIIGDLDLTYHSPGIQDFLHKGGFKKFVPLLDDDIVVMKDVGHFIN  355

Query  1290  EEKPHEINTHILNFLHNFS  1346
             EEKP+E++ HI+NF+  FS
Sbjct  356   EEKPNEVSEHIINFIKKFS  374



>ref|XP_010088295.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33520.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 184/377 (49%), Positives = 240/377 (64%), Gaps = 64/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI+MHVA  G GP +LFLHGFPE WY+WRHQM  L+S GYR +APDLR
Sbjct  1     MEKIEHSTVHTNGINMHVASVGTGPAILFLHGFPELWYSWRHQMISLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+  P+ +TSLH+VGDLV L+  +    EK+F+VGHDWGAM+AW  CL+RPD
Sbjct  61    GYGDTDAPPS--PTSYTSLHIVGDLVGLIDHLVI--EKLFLVGHDWGAMIAWYFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN+SV F PRNPK   ++  RA  GDD+YICRFQ+                 SE 
Sbjct  117   RIKALVNLSVPFFPRNPKINFVDGFRAELGDDFYICRFQEPG--------------ESEA  162

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
               S+ +    R                                 +L  +          +
Sbjct  163   DFSSDTVAVFR--------------------------------RILANR----------D  180

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P  +PK+   F G  +D   LPSWL+++D++++ +KF +TGFTGG+NYYRAL+L WEL
Sbjct  181   PKPPLIPKEIG-FRGVYEDPVALPSWLTEDDINHFANKFNETGFTGGLNYYRALNLTWEL  239

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +AAWTGA+V VP KFI+GDLD+ Y  PG KEYI  GG KRDVPLL+E+V++EG  HFI++
Sbjct  240   TAAWTGARVQVPTKFIMGDLDLVYYFPGMKEYILNGGFKRDVPLLQELVIIEGAAHFINQ  299

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP EI++HI +F+  F
Sbjct  300   EKPDEISSHIHHFIQKF  316



>ref|XP_011023717.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 185/376 (49%), Positives = 244/376 (65%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+GI H  V VNGI MH+A+ GQGPVVLFLHGFPE WY+WRHQ+  L+S GY+AVAPDLR
Sbjct  1     MDGISHRMVKVNGIDMHIAEKGQGPVVLFLHGFPELWYSWRHQILALSSLGYQAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP    S ++ LH+VGDL+AL+  +    EKVF+V HDWGA++ W LCL+RPD
Sbjct  61    GYGDTE-APASI-SSYSCLHIVGDLIALIDYLGV--EKVFLVAHDWGALIGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA V +SV + PRNPK KP+E+++ V+G+DYY+                         
Sbjct  117   RVKAYVCLSVPYRPRNPKMKPVESMKLVFGEDYYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G +E E A  GT++VL+  LT   
Sbjct  152   ---------CRF---------------------QEPGVVEDEIARAGTEEVLKKILTDRK  181

Query  942   PSPLYLPKKGK--LFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P PL LPK+    ++      +PSWLS+ D+ +Y +K+ + GFTGG+NYYRALDL+WEL+
Sbjct  182   PGPLCLPKENPFGIYPEEPVTMPSWLSEADLSFYATKYSQKGFTGGLNYYRALDLNWELT  241

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A+WTGA V VPVKF+VGDLD+ Y  PG KE+++ GG K  VPLLEE+VV+EGVGHFI++E
Sbjct  242   ASWTGAPVNVPVKFVVGDLDMVYTNPGMKEFVNSGGFKHYVPLLEEIVVMEGVGHFINQE  301

Query  1296  KPHEINTHILNFLHNF  1343
             K  EI+ HI +++  +
Sbjct  302   KAEEISNHIYDYISKY  317



>ref|XP_009136732.1| PREDICTED: bifunctional epoxide hydrolase 2 [Brassica rapa]
Length=326

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 192/379 (51%), Positives = 237/379 (63%), Gaps = 69/379 (18%)
 Frame = +3

Query  237   HISVSVNGISMHVAQ-----TGQG-----PVVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             H  V VNGI+MH A+     T  G     PV+LFLHGFPE WYTWRHQM  L+S GYR +
Sbjct  7     HRFVKVNGINMHFAEKTPSFTDNGASRPPPVILFLHGFPELWYTWRHQMVALSSLGYRTI  66

Query  387   APDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             APDLRGYGDT    + D   +TSLHVVGDL+ L+  V  D EKVFVVGHDWGA++AW LC
Sbjct  67    APDLRGYGDTEAPESAD--AYTSLHVVGDLIGLVDAVVGDREKVFVVGHDWGAIIAWHLC  124

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L RPD+VKALVNMSV F P N K KP+   ++ YGDDYYICRFQ                
Sbjct  125   LLRPDRVKALVNMSVVFEPWNLKRKPISMFKSFYGDDYYICRFQ----------------  168

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                                      +Y EI              E EFA +GT++VL   
Sbjct  169   -------------------------EYGEI--------------EAEFAKVGTERVLLEM  189

Query  927   LTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
             LTY N  P+ LP KGK ++     LPSWL++ DV YY SK+EK+GFTG +NYYR +D  W
Sbjct  190   LTYRNTGPILLP-KGKSYDDPV-SLPSWLTEYDVKYYVSKYEKSGFTGPVNYYRNMDRTW  247

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             E+  A++ A+V VPVKFI+GD D+TY+ PG K+YIH+G  K  VPLL+EVVV++GVGHF+
Sbjct  248   EMMGAFSNAQVKVPVKFIIGDQDLTYHIPGTKKYIHEGRFKSHVPLLDEVVVIKGVGHFL  307

Query  1287  HEEKPHEINTHILNFLHNF  1343
             HEE+P EI+ HI ++   F
Sbjct  308   HEERPVEISKHIHDYFLTF  326



>ref|XP_006419522.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
 gb|ESR32762.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
Length=324

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 189/381 (50%), Positives = 242/381 (64%), Gaps = 64/381 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI+H  V VNGI+MH+A+ GQGPV+LFLHGFPE WY+WRHQ+  LA  GYRAVAPDLR
Sbjct  1     MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALACLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P  D + +T  HV+GDLV L+  VA ++EKVFVVGHDWGA MAW LCL+RPD
Sbjct  61    GFGDTDAPP--DVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGAFMAWFLCLFRPD  118

Query  582   KVKALVNMSVCFTP-----RNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             +VKALVN+SV F P         + P+E LRA YGDDYY+CRFQ+     +I  +   IG
Sbjct  119   RVKALVNLSVVFNPFGSNTSESNNNPIEALRAYYGDDYYMCRFQE---PGEIEAEFAQIG  175

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                                         E  ++   +++  G I           +L   
Sbjct  176   ---------------------------TETVIKEFLTFRTPGPI-----------ILPKG  197

Query  927   LTYYNP--SPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDL  1100
               + +P  +P+ LP              SWLS+ DV Y+T+KF+K GFTGGINYYR ++L
Sbjct  198   KGFGHPPDAPMALP--------------SWLSEEDVKYFTAKFDKKGFTGGINYYRNINL  243

Query  1101  DWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGH  1280
               EL A W G+++ +P KFI+GDLD+ Y+ PG KEYIHKGG KRDVPLLEEVV++EGVGH
Sbjct  244   SQELLAPWAGSRLQIPTKFIIGDLDLVYHMPGVKEYIHKGGFKRDVPLLEEVVIMEGVGH  303

Query  1281  FIHEEKPHEINTHILNFLHNF  1343
             FI++EK  EI+ HI +F + F
Sbjct  304   FINQEKGDEISKHIYDFFNKF  324



>ref|XP_010456047.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 187/378 (49%), Positives = 233/378 (62%), Gaps = 62/378 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++S NGI+MHVA  G G V+LFLHGFP+ WY+WRHQ+   A+ GYRA+APDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGSVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+  AP   P  +T LH+VGDLV LL  +  D  +VF+VGHDWGA++AW LC+ RPD
Sbjct  61    GYGDSD-AP-QSPESYTILHIVGDLVGLLDSLGVD--RVFLVGHDWGAIVAWWLCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN SV F PRNP  KP++  RA++GDDYYICRFQ+              G   E 
Sbjct  117   RVKALVNTSVVFNPRNPTVKPVDKFRALFGDDYYICRFQEA-------------GEIEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                  +                K++  RF  S                           N
Sbjct  164   FAQVDT----------------KKLITRFFVS--------------------------RN  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK    F G  D   LP+WL++ DV +Y  KF + GFTGG+NYYRA++L WEL+
Sbjct  182   PRPPCIPKSVG-FRGLPDPPSLPAWLTEQDVSFYGDKFGQKGFTGGLNYYRAMNLSWELT  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G ++ VPVKFIVGDLDITYN PG KEYIH GGLK+ VP L+EVVV+EGVGHF+ +E
Sbjct  241   APWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHGGGLKKHVPFLQEVVVMEGVGHFLQQE  300

Query  1296  KPHEINTHILNFLHNFSS  1349
             KP E+  HI  F   F +
Sbjct  301   KPDEVTDHIYGFFEKFRT  318



>ref|XP_009111297.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=315

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 182/374 (49%), Positives = 233/374 (62%), Gaps = 59/374 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +VS NGI+MHVA  G GPVVLFLHGFP+ WY+WRHQ+   A  GYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+ +   +T LH+VGDLV LL  +  D+  VF+VGHDWGA++AW +C+ RPD
Sbjct  61    GYGDSDSPPSHE--SYTLLHIVGDLVGLLDSLGVDQ--VFLVGHDWGAIIAWWMCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP  K ++  +A++G+DYYI                         
Sbjct  117   RVKALVNMSVEFHPRNPSVKTVDAFKALFGEDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G+IE +FA + TKK++  F T +N
Sbjct  152   ---------CRF---------------------QEPGDIEEDFAQVDTKKLVNGFFTSHN  181

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
               P  +PK    +      LP W ++ DV +Y  KF + GFTGG+NYYRA++L WEL+A 
Sbjct  182   TRPPCIPKSVFRYLPDPPALPGWFTEQDVCFYADKFSQKGFTGGLNYYRAMNLSWELTAP  241

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             W G ++ VPVK+I GDLD TY+ PG KEYIH+GGLK+ VP L+EVVV+EGVGHF+ +EKP
Sbjct  242   WDGLQIKVPVKYITGDLDPTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQEKP  301

Query  1302  HEINTHILNFLHNF  1343
              EI  HI  F   F
Sbjct  302   KEITDHIYGFFKKF  315



>ref|XP_006489041.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=319

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 187/376 (50%), Positives = 242/376 (64%), Gaps = 59/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI+H  V VNGI+MH+A+ GQGPV+LFLHGFPE WY+WRHQ+  LAS GYRAVAPDLR
Sbjct  1     MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P  D + +T  HV+GDLV L+  VA ++EKVFVVGHDWGA MAW LCL+RPD
Sbjct  61    GFGDTDAPP--DVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGAFMAWFLCLFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F P    +  +E LRA YGD+YY+CRFQ+     +I  +   IG     
Sbjct  119   RVKALVNLSVVFNPFGSINNVIEALRAYYGDNYYMCRFQE---PGEIEAEFAQIG-----  170

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    E  ++   +++  G I           +L     + +
Sbjct  171   ----------------------TETVIKEFLTFRTPGPI-----------ILPKGKGFGH  197

Query  942   P--SPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P  +P+ LP              SWLS+ DV ++T+KF+K GFTGGINYYR ++L  EL 
Sbjct  198   PPDAPMALP--------------SWLSEEDVKHFTAKFDKKGFTGGINYYRNINLSQELL  243

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A W G+++ +P KFI+GDLD+ Y+ PG KEYIHKGG KRDVPLLEEVV++EGVGHFI++E
Sbjct  244   APWAGSRLQIPTKFIIGDLDLVYHMPGVKEYIHKGGFKRDVPLLEEVVIMEGVGHFINQE  303

Query  1296  KPHEINTHILNFLHNF  1343
             K  EI+ HI +F + F
Sbjct  304   KGDEISKHIYDFFNKF  319



>ref|XP_009393199.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 183/375 (49%), Positives = 240/375 (64%), Gaps = 62/375 (17%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGY  407
             GI H +V VNGIS+HVA+ G+GPVVL +HGFPE WY+WRHQ+  LA++GYRA+APDLRGY
Sbjct  5     GITHRTVEVNGISIHVAEKGEGPVVLLVHGFPELWYSWRHQILGLAARGYRALAPDLRGY  64

Query  408   GDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKV  587
             GD++  P+   + ++  H+VGDLVALL  +A    +VF+VGHDWGA++AW +CL+RPD+V
Sbjct  65    GDSSAPPS--VASYSVFHIVGDLVALLDALAI--PQVFLVGHDWGALVAWYMCLFRPDRV  120

Query  588   KALVNMSVC---FTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             KALVN+SV    F PRNP  K +E  R++YGDDYY+CRFQ+                   
Sbjct  121   KALVNLSVALVPFIPRNPAGKLVEYFRSLYGDDYYVCRFQE------------------P  162

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
             GA  A                                     +F  LGT+ +L+      
Sbjct  163   GAVEA-------------------------------------DFDRLGTESLLRMVFASR  185

Query  939   NPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             NP PL LPK+  +       LP WLS+ D+ Y+TSKF+++GFTG +NYYR LDL+ EL A
Sbjct  186   NPGPLLLPKEAFVPLDRQIPLPDWLSEEDISYFTSKFDESGFTGPVNYYRCLDLNRELGA  245

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              W G K+ VPVKFIVGD D+TY+ PG ++Y+H GG K DVP+LEEVVV+EGV HFI++EK
Sbjct  246   PWCGVKIQVPVKFIVGDQDLTYHYPGIQDYLHGGGFKEDVPMLEEVVVMEGVAHFINQEK  305

Query  1299  PHEINTHILNFLHNF  1343
              HEI  HI +F+  F
Sbjct  306   AHEITDHIYHFIRKF  320



>emb|CDY65635.1| BnaAnng20800D [Brassica napus]
Length=315

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 182/374 (49%), Positives = 233/374 (62%), Gaps = 59/374 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +VS NGI+MHVA  G GPVVLFLHGFP+ WY+WRHQ+   A  GYRA+APDLR
Sbjct  1     MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+ +   +T LH+VGDLV LL  +  D+  VF+VGHDWGA++AW +C+ RPD
Sbjct  61    GYGDSDSPPSHE--SYTLLHIVGDLVGLLDSLGVDQ--VFLVGHDWGAIIAWWMCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVNMSV F PRNP  K ++  +A++G+DYYI                         
Sbjct  117   RVKALVNMSVEFHPRNPSVKTVDAYKALFGEDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G+IE +FA + TKK++  F T +N
Sbjct  152   ---------CRF---------------------QEPGDIEEDFAQVDTKKLVNGFFTSHN  181

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
               P  +PK    +      LP W ++ DV +Y  KF + GFTGG+NYYRA++L WEL+A 
Sbjct  182   TRPPCIPKSVFRYLPDPPALPGWFTEQDVCFYADKFSQKGFTGGLNYYRAMNLSWELTAP  241

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             W G ++ VPVK+I GDLD TY+ PG KEYIH+GGLK+ VP L+EVVV+EGVGHF+ +EKP
Sbjct  242   WDGLQIKVPVKYITGDLDPTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQEKP  301

Query  1302  HEINTHILNFLHNF  1343
              EI  HI  F   F
Sbjct  302   KEITDHIYGFFKKF  315



>ref|XP_009147218.1| PREDICTED: bifunctional epoxide hydrolase 2 [Brassica rapa]
Length=331

 Score =   344 bits (883),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 188/381 (49%), Positives = 234/381 (61%), Gaps = 70/381 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGI+H  VSVNGI+MH+A+ G  +G VVL LHGFP+ WYTWRHQ+  L+S G+RAVAPD
Sbjct  1     MEGIDHRMVSVNGITMHIAEKGPKEGTVVLLLHGFPDLWYTWRHQITALSSLGHRAVAPD  60

Query  396   LRGYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             LRGYGD+     D P   S++T LH+VGDLVALL  VA D+EKVF+VGHDWGA++ W LC
Sbjct  61    LRGYGDS-----DSPECFSEYTCLHLVGDLVALLDSVAGDQEKVFLVGHDWGAIVGWYLC  115

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L+RP+K+K  V +SV + PRNPK KP+E  +AV+GDDYYICRFQ+            P  
Sbjct  116   LFRPEKIKGFVCLSVPYRPRNPKVKPVEGFKAVFGDDYYICRFQE------------PGK  163

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                E AC+                                             ++VL+  
Sbjct  164   AEREIACADP-------------------------------------------RRVLKNI  180

Query  927   LTYYNPSPLYLPKKGKLFEGSTDD-----LPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
                    P  LPK          +     LP W SK D+DYY SKF+KTGFTGG+NYYRA
Sbjct  181   FIGRELGPPILPKDNPFGANPNPNCEQVKLPEWFSKEDLDYYVSKFKKTGFTGGLNYYRA  240

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +DL WEL+A WTGAK+ VPVKF+ GDLD+ Y  PG KEYIH GG   DVP L+EVVV+E 
Sbjct  241   MDLTWELTAPWTGAKIQVPVKFMTGDLDMVYTTPGVKEYIHGGGFAADVPNLQEVVVIED  300

Query  1272  VGHFIHEEKPHEINTHILNFL  1334
              GHF+++EKP E+  HI +F 
Sbjct  301   AGHFVNQEKPQEVTAHINDFF  321



>dbj|BAK07144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 188/377 (50%), Positives = 249/377 (66%), Gaps = 66/377 (18%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQTGQG--PVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
              I H SV VNG+ +HVA+ G    PVVL LHGFPE WYTWRHQM  LA+ GYRAVAPD+R
Sbjct  36    AITHRSVDVNGVRLHVAEAGPAGAPVVLLLHGFPELWYTWRHQMRALAAAGYRAVAPDMR  95

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYG +  AP+  P ++T+LHVVGDLVAL+  +   E++VFVV HDWGAM+AW+LCL+RPD
Sbjct  96    GYGGSD-APSGGPDEYTALHVVGDLVALIDSLG--EKQVFVVAHDWGAMIAWSLCLFRPD  152

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALV +SV FTPR+P  KP++ L+A+YGD+YYICR Q+  V   I  +   +G     
Sbjct  153   RVKALVALSVPFTPRSPARKPVDGLKALYGDEYYICRIQEPGV---IEAEFARLG-----  204

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                    E+ LR  F                         TY  
Sbjct  205   ----------------------TELVLRKFF-------------------------TYRT  217

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL++PK G    GS DD   LPSW+++ D+ YY ++F+K+GFTGG+NYYRAL+  WEL
Sbjct  218   PGPLFIPKSG---WGSPDDEVPLPSWITEEDIKYYAAQFDKSGFTGGLNYYRALNKTWEL  274

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             ++ WTGA++ VP KFIVGD+D++Y+  GA ++I+KGGLK+ VPLLE+VVV++ VGHFI+E
Sbjct  275   TSPWTGAEIKVPTKFIVGDVDLSYHVAGAYDFINKGGLKKFVPLLEDVVVMKDVGHFINE  334

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP EI+ HI++F+  F
Sbjct  335   EKPEEISAHIISFVKKF  351



>ref|XP_003563920.2| PREDICTED: bifunctional epoxide hydrolase 2-like [Brachypodium 
distachyon]
Length=355

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 249/378 (66%), Gaps = 64/378 (17%)
 Frame = +3

Query  231   IEHISVSVN-GISMHVAQTGQGPV--VLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             I H  VS++ G+ +HVA+ G      VL LHGFPE WYTWRHQM  LA+ GYRAVAPD+R
Sbjct  36    ITHRDVSLSTGVRLHVAEAGPAGAPAVLLLHGFPELWYTWRHQMRALAAAGYRAVAPDMR  95

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYG +   P     ++T+LHVVGDLVAL+  +  +++ VFVV HDWGA+ AW+LCL+RPD
Sbjct  96    GYGGSDAPPGAPEEQYTALHVVGDLVALIDSLGEEKQPVFVVAHDWGAVTAWSLCLFRPD  155

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +V+A+V +SV FTPR+P  KP++ LRA++GD+YY+CR Q+                   G
Sbjct  156   RVRAMVALSVAFTPRSPARKPVDGLRALFGDEYYVCRIQE------------------PG  197

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A  A                                     EFA LGT  VL+ F TY  
Sbjct  198   AIEA-------------------------------------EFARLGTDLVLRKFFTYRT  220

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P PL++PK G    GS DD   LPSW+++ DV YY ++F+KTGFTGG+NYYRAL+  WEL
Sbjct  221   PGPLFIPKSGW---GSPDDEVPLPSWITEEDVKYYATQFDKTGFTGGLNYYRALNKTWEL  277

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             ++ WTGA++ VPVKF++GDLD+TY+ PG +++I+KGGLK+ VPLL++VV+++ VGHFI+E
Sbjct  278   TSPWTGAEIKVPVKFVIGDLDLTYHTPGIQDFINKGGLKKYVPLLDDVVIMKDVGHFINE  337

Query  1293  EKPHEINTHILNFLHNFS  1346
             EKP E++ HI++F+  F+
Sbjct  338   EKPEEVSAHIISFIKKFN  355



>emb|CDY09727.1| BnaC07g33340D [Brassica napus]
Length=327

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 194/380 (51%), Positives = 238/380 (63%), Gaps = 70/380 (18%)
 Frame = +3

Query  237   HISVSVNGISMHVAQ-----TGQG-----PVVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             H  V VNGI+MH A+     T  G     PV+LFLHGFPE WYTWRHQM  L+S GYR +
Sbjct  7     HRFVKVNGINMHFAEKTPSFTDNGASRPPPVILFLHGFPELWYTWRHQMAALSSLGYRTI  66

Query  387   APDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALL-SVVAADEEKVFVVGHDWGAMMAWAL  563
             APDLRGYGDT    + D   +TSLHVVGDL+ L+ +VV  D EKVFVVGHDWGA++AW L
Sbjct  67    APDLRGYGDTEAPESAD--AYTSLHVVGDLIGLIDAVVGGDREKVFVVGHDWGAVIAWHL  124

Query  564   CLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPI  743
             CL RPD+VKALVNMSV F P N K KP+   ++ YGDDYYICRFQ               
Sbjct  125   CLLRPDRVKALVNMSVVFEPWNLKRKPISMFKSFYGDDYYICRFQ---------------  169

Query  744   GRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQC  923
                                       +Y EI              E EFA +GT++VL  
Sbjct  170   --------------------------EYGEI--------------EAEFAKVGTERVLLE  189

Query  924   FLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLD  1103
              LTY NP P+ LP KGK ++     LPSWL++ DV YY SK+EK+GFTG +NYYR +D  
Sbjct  190   MLTYRNPGPILLP-KGKSYDDPV-SLPSWLTEYDVKYYVSKYEKSGFTGPVNYYRNMDRT  247

Query  1104  WELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHF  1283
             WE+  A++ A+V VPVKFI+GD D+TY+ P  K+YIH G  K  VPLL+EVVVL+GVGHF
Sbjct  248   WEMMGAFSNAQVKVPVKFIIGDQDLTYHIPRTKKYIHDGRFKSHVPLLDEVVVLKGVGHF  307

Query  1284  IHEEKPHEINTHILNFLHNF  1343
             +HEE+P EI+ HI ++   F
Sbjct  308   LHEERPDEISKHIHDYFLTF  327



>ref|XP_007050977.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX95134.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=316

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 187/382 (49%), Positives = 231/382 (60%), Gaps = 74/382 (19%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+ NGI+MHVA  G GPV+LFLHGFPE WY+WRHQ+  L+S GYR VAPDLR
Sbjct  1     MEKIEHTMVTTNGINMHVASVGSGPVILFLHGFPELWYSWRHQLLSLSSLGYRCVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P+   + +T  H+VGDLV LL  +  D   VF+VGHDWGA++AW  C +RPD
Sbjct  61    GFGDTDAPPS--AASYTVFHIVGDLVGLLDALGVD--SVFLVGHDWGAVIAWYFCHFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQK--------NTVNTQINKKLH  737
             +VKALVNMSV + PR+   KP+E  RA++GDDYYICRFQ+          ++T    K+ 
Sbjct  117   RVKALVNMSVAYRPRHRSMKPVEGFRALFGDDYYICRFQEPGEIEEDFAQMDTAKIMKIF  176

Query  738   PIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVL  917
                R     C                    KEI  R                        
Sbjct  177   LTSRNPRPPCIP------------------KEIGFR------------------------  194

Query  918   QCFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALD  1097
                  Y +P PL                PSWLS+ D++Y+ SKF + GFTGG+NYYRALD
Sbjct  195   ----GYPDPPPL----------------PSWLSEEDINYFASKFNEKGFTGGLNYYRALD  234

Query  1098  LDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVG  1277
             L WEL A WTG ++ VPVKFIVGDLDITY+ PGAKEYIH GG K+DVP L+EVVV+EGV 
Sbjct  235   LSWELMAPWTGLQIKVPVKFIVGDLDITYHIPGAKEYIHNGGFKKDVPFLQEVVVMEGVA  294

Query  1278  HFIHEEKPHEINTHILNFLHNF  1343
             HFI++EK  EI+ HI +F+  F
Sbjct  295   HFINQEKSEEISKHIYDFIKKF  316



>ref|XP_004152245.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156836.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52816.1| hypothetical protein Csa_4G001830 [Cucumis sativus]
Length=316

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 187/375 (50%), Positives = 232/375 (62%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +++ NGI MH+A  G GPVVL LHGFPE WY+WRHQ+ +L+S GYRA+APDLR
Sbjct  1     METIEHTTINTNGIKMHIASIGTGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP +  + +T+ H+VGDLV  L  +    EKVFVVGHDWGA++AW  CL+RPD
Sbjct  61    GFGDTD-AP-ESHTAYTAFHIVGDLVGALDELGI--EKVFVVGHDWGAIIAWYFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F PRNP    ++  R  +GDD+YI                         
Sbjct  117   RVKALVNLSVHFLPRNPAISFVQGFRFAFGDDFYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q  GE E +F  + T ++ +  L    
Sbjct  152   ---------CRF---------------------QVPGEAEKDFGSIDTTELFKKILCGRT  181

Query  942   PSPLYLPKK-GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  LPK  G     S  DLPSWLS+ D++Y+ +KF  TGFTGG NYYRALDL WEL+A
Sbjct  182   PDPPILPKGLGIRSIPSPHDLPSWLSQEDINYFATKFNHTGFTGGFNYYRALDLTWELTA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
             +W  A+V VPVKFIVGDLD+TY  PGAKEYIH GG K DVP LEEVVV+E   HFI++E+
Sbjct  242   SWNKAQVQVPVKFIVGDLDLTYYFPGAKEYIHNGGFKTDVPFLEEVVVMEDTAHFINQER  301

Query  1299  PHEINTHILNFLHNF  1343
             PHEI+ HI  F+  F
Sbjct  302   PHEISVHIHEFIKKF  316



>ref|XP_010038231.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50055.1| hypothetical protein EUGRSUZ_K03496 [Eucalyptus grandis]
Length=322

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 187/381 (49%), Positives = 237/381 (62%), Gaps = 66/381 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGP-----VVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             ME IEH +V  NGI+MHVA  G         VLFLHGFP+ WYTWR QM  LA+ GYRAV
Sbjct  1     METIEHATVPTNGINMHVASVGGDGGAGGDTVLFLHGFPDLWYTWRRQMLSLAALGYRAV  60

Query  387   APDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             APDLRGYGDT   P+   + +T+ H+VGDLV LL  +    E+VF+VGHDWGA+MAW  C
Sbjct  61    APDLRGYGDTDAPPS--AASYTAFHIVGDLVGLLDALGV--ERVFLVGHDWGAVMAWYFC  116

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L RPD+VKALVN SV F P + K KP+++LRA++GDDYYI                    
Sbjct  117   LLRPDRVKALVNTSVAFLPGSRKRKPVDSLRALFGDDYYI--------------------  156

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                           CRF                     QE GE E +FA     K+++ F
Sbjct  157   --------------CRF---------------------QEPGEAEEDFARADITKLMKLF  181

Query  927   LTYYNPSPLYLPKKGKL--FEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDL  1100
             LT  +P P  +PK+        S D LP WLS+ D+++Y SKF + GFTGG+NYYRA++L
Sbjct  182   LTCRSPKPPCIPKEIGCSGLASSRDKLPPWLSEEDINFYASKFSQKGFTGGLNYYRAMNL  241

Query  1101  DWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGH  1280
              W+L+A WTG ++ VPVKFIVGDLDITY+ PGAK++IH GGLK+ VP L+EVVV+EGV H
Sbjct  242   TWKLAAPWTGVQIKVPVKFIVGDLDITYHVPGAKQHIHNGGLKKLVPFLQEVVVMEGVAH  301

Query  1281  FIHEEKPHEINTHILNFLHNF  1343
             F+ +EKP E+  HI +F+  F
Sbjct  302   FLQQEKPEEVTNHIYDFIKKF  322



>ref|NP_001148885.1| epoxide hydrolase 2 [Zea mays]
 gb|ACG33290.1| epoxide hydrolase 2 [Zea mays]
 gb|ACG37254.1| epoxide hydrolase 2 [Zea mays]
Length=325

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 231/380 (61%), Gaps = 65/380 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG----QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVA  389
             +EG+ H ++  NG+ +HVA+ G      PVVL LHGFP+ WY WRHQM  LA++GYRAVA
Sbjct  5     VEGVRHRTLEANGVRLHVAEAGPEEGSAPVVLLLHGFPDLWYGWRHQMSALAARGYRAVA  64

Query  390   PDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCL  569
             PDLRGYGD+   P  D S +T+ HVVGDLVAL+S +   + +VFVVGHDWGA++AW LCL
Sbjct  65    PDLRGYGDSDSPP--DASSYTTFHVVGDLVALISDLG--QRQVFVVGHDWGAIVAWQLCL  120

Query  570   YRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGR  749
              RPD V+ALVN+SV + PR P+  PL+ +RA  G+D+Y+                     
Sbjct  121   LRPDLVRALVNLSVVYHPRRPEMSPLQAIRAACGEDHYM---------------------  159

Query  750   RSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFL  929
                          CRF                     QE G  E EFA+   K V +   
Sbjct  160   -------------CRF---------------------QEFGVAEAEFALYDIKWVFKKTF  185

Query  930   TYYNPSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLD  1103
                 P+PL LPK    F+    D   P WLS+ D+ YY  KF KTGFTGG+NYYR +D  
Sbjct  186   GMRKPAPLILPKDKSFFDSLDSDGTCPPWLSEEDISYYAEKFAKTGFTGGLNYYRCIDRS  245

Query  1104  WELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHF  1283
             WELSAAWTGA + VP KFIVGDLDITYNAPG  +YIHKGG K  VP LE+VVV+EGV HF
Sbjct  246   WELSAAWTGAPIKVPSKFIVGDLDITYNAPGVPDYIHKGGFKASVPNLEDVVVMEGVSHF  305

Query  1284  IHEEKPHEINTHILNFLHNF  1343
             I++EKP+E++ HI  F   F
Sbjct  306   INQEKPNEVSDHICEFFSKF  325



>gb|KFK41012.1| hypothetical protein AALP_AA2G073800 [Arabis alpina]
Length=329

 Score =   342 bits (877),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 189/383 (49%), Positives = 235/383 (61%), Gaps = 72/383 (19%)
 Frame = +3

Query  234   EHISVSVNGISMHVAQTGQG-------------PVVLFLHGFPECWYTWRHQMCFLASQG  374
             +H  V VNGI+MH+A+                 PV+LFLHGFPE WYTWRHQM  L+S G
Sbjct  6     DHSFVKVNGITMHIAEKNPSVAENCAFGGVLNRPVILFLHGFPELWYTWRHQMVTLSSLG  65

Query  375   YRAVAPDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMA  554
             YR +APDLRGYGDT     +    +TSLHVVGDL+ L+  V  ++EKVFVVGHDWGA++A
Sbjct  66    YRTIAPDLRGYGDTDSP--ESVEAYTSLHVVGDLIGLIDAVVGEKEKVFVVGHDWGAIIA  123

Query  555   WALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKL  734
             W LCL RPD+VKALVNMSV F P NPK KP+ T R+ YGDDYYICRFQ            
Sbjct  124   WHLCLLRPDRVKALVNMSVVFDPWNPKRKPISTYRSFYGDDYYICRFQ------------  171

Query  735   HPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKV  914
                                          +Y EI              E EFA +GT++ 
Sbjct  172   -----------------------------EYGEI--------------EEEFAKVGTERA  188

Query  915   LQCFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRAL  1094
             L   LTY  P P+ LP KGK ++     LPSWL+  DV YY SK++K GFTG +NYYR +
Sbjct  189   LLELLTYRKPGPVLLP-KGKSYDVPV-LLPSWLTDYDVKYYVSKYQKNGFTGPVNYYRNM  246

Query  1095  DLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGV  1274
             D  WEL  + +GA+V VPVKFI+GD D+TY+ PG K+YI +G  K  VPLL+EVVV++GV
Sbjct  247   DRTWELMGSLSGAQVKVPVKFIIGDQDLTYHIPGTKKYIEEGRFKSHVPLLDEVVVMKGV  306

Query  1275  GHFIHEEKPHEINTHILNFLHNF  1343
             GHF+HEE+P EI+ HI ++   F
Sbjct  307   GHFLHEERPDEISKHINDYFLTF  329



>tpg|DAA53983.1| TPA: epoxide hydrolase 2 [Zea mays]
Length=325

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 230/380 (61%), Gaps = 65/380 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG----QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVA  389
             +EG+ H ++  NG+ +HVA+ G      PVVL LHGFP+ WY WRHQM  LA++GYRAVA
Sbjct  5     VEGVRHRTLEANGVRLHVAEAGPEEGSAPVVLLLHGFPDLWYGWRHQMSALAARGYRAVA  64

Query  390   PDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCL  569
             PDLRGYGD+   P  D S +T+ HVVGDLVAL+S +   + +VFVVGHDWGA +AW LCL
Sbjct  65    PDLRGYGDSDSPP--DASSYTTFHVVGDLVALISDLG--QRQVFVVGHDWGATVAWQLCL  120

Query  570   YRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGR  749
              RPD V+ALVN+SV + PR P+  PL+ +RA  G+D+Y+                     
Sbjct  121   LRPDLVRALVNLSVVYHPRRPEMSPLQAIRAACGEDHYM---------------------  159

Query  750   RSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFL  929
                          CRF                     QE G  E EFA+   K V +   
Sbjct  160   -------------CRF---------------------QEFGVAEAEFALYDIKWVFKKTF  185

Query  930   TYYNPSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLD  1103
                 P+PL LPK    F+    D   P WLS+ D+ YY  KF KTGFTGG+NYYR +D  
Sbjct  186   GMRKPAPLILPKDKSFFDSLDSDGTCPPWLSEEDISYYAEKFAKTGFTGGLNYYRCIDRS  245

Query  1104  WELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHF  1283
             WELSAAWTGA + VP KFIVGDLDITYNAPG  +YIHKGG K  VP LE+VVV+EGV HF
Sbjct  246   WELSAAWTGAPIKVPSKFIVGDLDITYNAPGVPDYIHKGGFKASVPNLEDVVVMEGVSHF  305

Query  1284  IHEEKPHEINTHILNFLHNF  1343
             I++EKP+E++ HI  F   F
Sbjct  306   INQEKPNEVSDHICEFFSKF  325



>ref|XP_008807392.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/373 (51%), Positives = 242/373 (65%), Gaps = 62/373 (17%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGY  407
             GI H +V VNGI MHV + G+GP VL LHGFPE WY+WRHQ+  LA++GYRA+APDLRGY
Sbjct  6     GISHRTVEVNGIRMHVVEKGEGPAVLLLHGFPELWYSWRHQIAGLAARGYRAIAPDLRGY  65

Query  408   GDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKV  587
             GDT   P  D + +++LH+VGDLVALL  +A     VFVVGHDWGA++AW LC++RPDKV
Sbjct  66    GDTDAPP--DVASYSALHIVGDLVALLDALALPH--VFVVGHDWGALIAWYLCMFRPDKV  121

Query  588   KALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGAC  767
             KALVN+SV F PRNP  K ++  R +YGDDYYICRFQ+                   GA 
Sbjct  122   KALVNLSVAFMPRNPAMKTVDYFRKLYGDDYYICRFQE------------------PGAI  163

Query  768   SASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPS  947
              A                                      FA +GT  + +  L   +P 
Sbjct  164   EA-------------------------------------RFAQIGTASIFRTILQSRDPG  186

Query  948   PLYLPKKG-KLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAW  1124
             P  +PK+G  L E S   L SWLS+ D++YY SKF+K+GFTG +NYYR ++L+WEL+A W
Sbjct  187   PFLIPKEGWDLPEKSP--LCSWLSEEDINYYASKFDKSGFTGPVNYYRCMNLNWELTAPW  244

Query  1125  TGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPH  1304
             TG ++ VP KFIVGDLD+TY+ PG ++YIH GG K++VPLL+EVVV+EGVGHFI++EK H
Sbjct  245   TGVQIKVPAKFIVGDLDLTYHYPGIQDYIHNGGFKQNVPLLQEVVVMEGVGHFINQEKGH  304

Query  1305  EINTHILNFLHNF  1343
             EI  HI +F+  F
Sbjct  305   EITDHIYDFIQKF  317



>ref|XP_010449872.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=379

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 240/384 (63%), Gaps = 70/384 (18%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQ---------TGQGPVVLFLHGFPECWYTWRHQMCFLASQGYR  380
             G+EH ++ VNGI+MHVA+         +G+ P++LF+HGFPE WYTWRHQM  L+S GYR
Sbjct  53    GVEHKTLKVNGINMHVAEKPASGSGTGSGEDPIILFIHGFPELWYTWRHQMAALSSLGYR  112

Query  381   AVAPDLRGYGDTTGAPTDDPSK---FTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMM  551
              +APDLRGYGDT     D P K   +T L+VVGDLVAL++ V   ++ VFVVGHDWGAM+
Sbjct  113   TIAPDLRGYGDT-----DAPEKVEDYTYLNVVGDLVALINAVTDGDKAVFVVGHDWGAML  167

Query  552   AWALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKK  731
             AW LC YRPDKVKALVNMSV F+PRN +  P+ TLR ++GDDYYICRFQK     +I  +
Sbjct  168   AWQLCQYRPDKVKALVNMSVLFSPRNSERVPVPTLRHIFGDDYYICRFQK---PGEIEAE  224

Query  732   LHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKK  911
                +G                            E  L+   +++  G +      L   K
Sbjct  225   FMKLG---------------------------TEKVLKEFLTYKTPGPLH-----LPKGK  252

Query  912   VLQCFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
               +C                   E     LP WL++ D+DYY +K++K GFTG INYYR 
Sbjct  253   CFEC------------------SENDACALPPWLTQEDLDYYVTKYDKKGFTGPINYYRN  294

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +D +WEL+A WTGAK+ VPVKFIVGD D+TYN PGAKEYI+ G  KR+VPLL+E VVL+G
Sbjct  295   IDRNWELTAPWTGAKIHVPVKFIVGDQDLTYNFPGAKEYINGGCFKREVPLLDETVVLKG  354

Query  1272  VGHFIHEEKPHEINTHILNFLHNF  1343
             +GHF+HEE P  IN HI +F H F
Sbjct  355   LGHFLHEEDPDVINQHIHSFFHKF  378



>ref|NP_187211.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAF26137.1|AC011620_13 putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAL49778.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAM51432.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AEE74264.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=331

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 186/381 (49%), Positives = 237/381 (62%), Gaps = 70/381 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGI+H  VSVNGI+MH+A+ G  +GPVVL LHGFP+ WYTWRHQ+  L+S GYRAVAPD
Sbjct  1     MEGIDHRMVSVNGITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQISGLSSLGYRAVAPD  60

Query  396   LRGYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             LRGYGD+     D P   S++T L+VVGDLVALL  VA ++EKVF+VGHDWGA++ W LC
Sbjct  61    LRGYGDS-----DSPESFSEYTCLNVVGDLVALLDSVAGNQEKVFLVGHDWGAIIGWFLC  115

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L+RP+K+   V +SV +  RNPK KP++  +AV+GDDYYICRFQ+               
Sbjct  116   LFRPEKINGFVCLSVPYRSRNPKVKPVQGFKAVFGDDYYICRFQEPG-------------  162

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
              + EG  +++                   I LR LF+ +  G                  
Sbjct  163   -KIEGEIASAD----------------PRIFLRNLFTGRTLG------------------  187

Query  927   LTYYNPSPLYLPKKGKLFE-----GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
                    P  LPK     E         +LP W SK D+D+Y SKFEK GFTGG+NYYRA
Sbjct  188   -------PPILPKDNPFGEKPNPNSENIELPEWFSKKDLDFYVSKFEKAGFTGGLNYYRA  240

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +DL+WEL+A WTGAK+ VPVKF+ GD D+ Y  PG KEYIH GG   DVP L+E+VV+E 
Sbjct  241   MDLNWELTAPWTGAKIQVPVKFMTGDFDMVYTTPGMKEYIHGGGFAADVPTLQEIVVIED  300

Query  1272  VGHFIHEEKPHEINTHILNFL  1334
              GHF+++EKP E+  HI +F 
Sbjct  301   AGHFVNQEKPQEVTAHINDFF  321



>ref|XP_006378063.1| hypothetical protein POPTR_0010s01420g [Populus trichocarpa]
 gb|ERP55860.1| hypothetical protein POPTR_0010s01420g [Populus trichocarpa]
Length=306

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/380 (49%), Positives = 237/380 (62%), Gaps = 80/380 (21%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             M+ IEH ++  NGI+MHVA  G    PV+LFLHGFPE WY+WR+Q+  L+S GYR++   
Sbjct  1     MDSIEHRTIHANGITMHVAIKGSENAPVILFLHGFPESWYSWRYQILALSSLGYRSI---  57

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
                            + +T  H+VGDL+ LL VVA +E+KVFVV HDWGA++AW +CL+R
Sbjct  58    ---------------TSYTCFHLVGDLIGLLDVVAPNEDKVFVVAHDWGAIIAWYMCLFR  102

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD+VKALVN SV F PRNPK K +ETLRA+YGDDYY+                       
Sbjct  103   PDRVKALVNTSVLFIPRNPKRKFVETLRALYGDDYYM-----------------------  139

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                        CRF                     QE G IE E+A  GT++VL+  LT+
Sbjct  140   -----------CRF---------------------QEPGVIEAEYAERGTERVLKELLTH  167

Query  936   YNPSPLYLPKKGKLFEGSTDD----LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLD  1103
                 PL+LPK GK   G+  D    LPSWLS+ D  YYT+KFE+ GFTGG+NYYR LD +
Sbjct  168   RVAGPLFLPK-GKGLNGAPLDAPIVLPSWLSEEDFKYYTNKFEQKGFTGGLNYYRNLDRN  226

Query  1104  WELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHF  1283
             WEL+A WTGA+V VPVKFI+GD D+TYN+ G K+YI  GG KRDVP LEE+VV+EGVGHF
Sbjct  227   WELTAPWTGAQVTVPVKFIIGDEDLTYNSLGGKDYIDSGGFKRDVPFLEELVVMEGVGHF  286

Query  1284  IHEEKPHEINTHILNFLHNF  1343
             +++EK  EIN HI +F   F
Sbjct  287   LNQEKADEINKHIYDFFQKF  306



>ref|XP_008454325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=324

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/376 (48%), Positives = 242/376 (64%), Gaps = 57/376 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++  NGI+MHVA  G GP VLFLHGFP+ WY+WRHQ+ FLAS+G+RA+APDLR
Sbjct  1     MEKIEHTTIPTNGINMHVASIGSGPAVLFLHGFPQLWYSWRHQLLFLASKGFRALAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P+  PS +T LH++GDL+ LL  +    EKVF+VGHDWGAM+AW  CL+RPD
Sbjct  61    GFGDTDAPPS--PSSYTFLHIIGDLIGLLDHLGL--EKVFLVGHDWGAMIAWYFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV +  R+P    ++  RAV GD++YIC+FQ+  V                G
Sbjct  117   RVKALVNLSVYYIKRHPSISFVDGFRAVAGDNFYICQFQEAGV-----------AEADFG  165

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                 ++  +                  +F+      G  + E  ++ TK+  + F +   
Sbjct  166   RVDTATMMK------------------KFM------GMRDPEAPLIFTKE--KGFSSMET  199

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P                LP WL++ D+D++ +KF KTGFTGG NYYRAL+L WEL+AA
Sbjct  200   PDP----------------LPCWLTEEDIDFFATKFSKTGFTGGFNYYRALNLSWELTAA  243

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             W G+K+ VPVKFIVGDLD+ Y+ PGAK+YIH G  K+DVP LEEVVV++   HFIH+EKP
Sbjct  244   WNGSKIEVPVKFIVGDLDLVYHFPGAKQYIHGGEFKKDVPFLEEVVVIKDAAHFIHQEKP  303

Query  1302  HEINTHILNFLHNFSS  1349
             H+IN+ I +F++ FS+
Sbjct  304   HQINSLIYHFINKFST  319



>emb|CDY27752.1| BnaA05g31610D [Brassica napus]
Length=340

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/381 (49%), Positives = 234/381 (61%), Gaps = 70/381 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGI+H  VSVNGI+MH+A+ G  +G VVL LHGFP+ WYTWRHQ+  L+S G+RAVAPD
Sbjct  10    MEGIDHRMVSVNGITMHIAEKGPKEGTVVLLLHGFPDLWYTWRHQITALSSLGHRAVAPD  69

Query  396   LRGYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             LRGYG++     D P   S++T LH+VGDLVAL+  V+ D+EKVF+VGHDWGA++ W LC
Sbjct  70    LRGYGES-----DSPECFSEYTCLHLVGDLVALIDSVSGDQEKVFLVGHDWGAIVGWYLC  124

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L+RP+K+K  V +SV + PRNPK KP+E  +AV+GDDYYICRFQ+            P  
Sbjct  125   LFRPEKIKGFVCLSVPYKPRNPKVKPVEGFKAVFGDDYYICRFQE------------PGK  172

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                E AC+                                             ++VL+  
Sbjct  173   AEREIACADP-------------------------------------------RRVLKNI  189

Query  927   LTYYNPSPLYLPKKGKLFEGSTDD-----LPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
                    P  LPK          +     LP W SK D+DYY SKF+KTGFTGG+NYYRA
Sbjct  190   FIGRELGPPILPKDNPFGANPNPNCEQVKLPEWFSKEDLDYYVSKFKKTGFTGGLNYYRA  249

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +DL WEL+A WTGAK+ VPVKF+ GDLD+ Y  PG KEYIH GG   DVP L+EVVV+E 
Sbjct  250   MDLTWELTAPWTGAKIQVPVKFMTGDLDMVYTTPGVKEYIHGGGFAADVPNLQEVVVIED  309

Query  1272  VGHFIHEEKPHEINTHILNFL  1334
              GHF+++EKP E+  HI +F 
Sbjct  310   AGHFVNQEKPQEVTAHINDFF  330



>gb|ACU19478.1| unknown [Glycine max]
 gb|KHN43316.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 182/375 (49%), Positives = 234/375 (62%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H  V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L+S GYRAVAPDLR
Sbjct  1     MEQIKHRIVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   S +   H+VGDLVAL+  +    ++VF+V HDWGA++ W LC++RPD
Sbjct  61    GYGDTEAPPSI--SSYNCFHIVGDLVALIDSLGV--QQVFLVAHDWGAIIGWYLCMFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKA V +SV F PRNPK KP++ +RA+YGDDYYICRFQ+                ++EG
Sbjct  117   KVKAYVCLSVPFWPRNPKVKPVDAMRAIYGDDYYICRFQEPG--------------KAEG  162

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
               + +S                                         T++V++       
Sbjct  163   ELAKNS-----------------------------------------TEQVIKNVFISRK  181

Query  942   PSPLYLPKKGKLFEGSTD-DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  L K+G  F  +T   LP+WLS+ D+ YY SKFEKTGFTGG+NYYR  +L+WEL+A
Sbjct  182   PGPPILEKEGMGFNPNTSMPLPTWLSQEDLTYYASKFEKTGFTGGLNYYRNFNLNWELTA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTGA+V VPVKFI GDLD+ Y + G K YI  G  K+DVP LEEVVV EGV HF ++E 
Sbjct  242   PWTGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAFKKDVPNLEEVVVQEGVAHFNNQEA  301

Query  1299  PHEINTHILNFLHNF  1343
               +++ HI +F+  F
Sbjct  302   AEDVSNHIYDFIKKF  316



>ref|XP_006604802.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43315.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 236/378 (62%), Gaps = 64/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH +V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L+S GYRAVAPDLR
Sbjct  1     MEGIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   S +   H+VGDLVAL+  +    ++VF+V HDWGA++ W LC++RPD
Sbjct  61    GYGDTEAPPS--ISSYNCFHIVGDLVALIDSLGV--QQVFLVAHDWGAIIGWYLCMFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKA V +SV F  R+P  + ++ +RA+YGDDYY+                         
Sbjct  117   KVKAYVCLSVPFLRRDPNIRTVDGMRALYGDDYYV-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E + A +GT  VL+  LT   
Sbjct  152   ---------CRF---------------------QKPGEMEAQMAEVGTGYVLKNILTSRK  181

Query  942   PSPLYLPKKGKLFEG----STDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
               P +LP  G+   G     +D LPSWL+++D+ YY SKFEKTGFTGG+NYYR  +LDWE
Sbjct  182   TGPPFLPH-GEFGTGFNPDMSDSLPSWLTEDDLAYYVSKFEKTGFTGGLNYYRNFNLDWE  240

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG ++ VPVKFI G+LD  Y +   KEYIH GG K+DVP LE+V+V +GV HF +
Sbjct  241   LTAPWTGVQIKVPVKFITGELDSVYTSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNN  300

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E   EINTHI +F+  F
Sbjct  301   QEAAEEINTHIYDFIKKF  318



>ref|XP_006433457.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
 gb|ESR46697.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
Length=317

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 239/376 (64%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H  V VNGI MH+A+ G+GPVVLFLHGFPE WYTWR Q+  L+S GYRA+APDLR
Sbjct  1     MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP+   S ++  H+VGDLVAL++ +    E+VFVV HDWGA++AW LCL+ P+
Sbjct  61    GYGDTE-APSSI-SSYSCHHIVGDLVALINSLGV--EQVFVVAHDWGAIIAWYLCLFCPE  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA V +SV F PRNP  KP+E++RA++GDDYYI                         
Sbjct  117   RVKAFVCLSVPFLPRNPNIKPVESMRALFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G+IE + A +GT +VL+  L    
Sbjct  152   ---------CRF---------------------QEPGKIEAQIAQVGTAEVLKNILANRK  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P   P++        +   LPSW S+ D+ +Y +KF +TGFTG +NYYRA++L+WE++
Sbjct  182   PGPSCFPEENAFGIDPENRVTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLNWEMT  241

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             AAWT  +V VPVKFIVG+LD+ Y  PG KEY+H GG K+DVPLLEE+VV+E  GHFI++E
Sbjct  242   AAWTEVQVKVPVKFIVGELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHFINQE  301

Query  1296  KPHEINTHILNFLHNF  1343
             +  EIN HI +F+  F
Sbjct  302   RAEEINAHIYDFIKKF  317



>ref|XP_002318980.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|EEE94903.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 243/376 (65%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI H  V VN I MH+A+ GQGPVVLFLHGFPE WY+WRHQ+  L+S GY AVAPDLR
Sbjct  1     MEGISHRMVKVNDIDMHIAEKGQGPVVLFLHGFPELWYSWRHQILALSSLGYHAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP    S ++ LH+VGDL+AL+  +    E+VF+V HDWGA++ W LCL+RPD
Sbjct  61    GYGDTE-APASI-SSYSCLHIVGDLIALIDYLGV--EQVFLVAHDWGALIGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA V +SV + PRNPK KP+E+++ V+G+DYY+CRFQ+  V              +E 
Sbjct  117   RVKAYVCLSVPYRPRNPKMKPVESMKLVFGEDYYMCRFQEPGV------------IEAEI  164

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             AC+                                           GT++VL+  LT   
Sbjct  165   ACA-------------------------------------------GTEEVLKKILTGRK  181

Query  942   PSPLYLPKKGK--LFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  LPK+    ++   +  +PSWL + D+ +Y +K+ + GFTGG+NYYRALDL+WEL+
Sbjct  182   PGPPCLPKENPFGIYPEESVTMPSWLPEADLSFYATKYSQKGFTGGLNYYRALDLNWELT  241

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A+WTGA V+VPVKF+VGDLD+ Y  PG KE+++ GG K  VPLLEEVVV+EGVGHFI++E
Sbjct  242   ASWTGAPVIVPVKFVVGDLDMVYTTPGMKEFVNSGGFKHYVPLLEEVVVMEGVGHFINQE  301

Query  1296  KPHEINTHILNFLHNF  1343
             K  EI+ HI +++  +
Sbjct  302   KAEEISNHIYDYISKY  317



>ref|XP_006414584.1| hypothetical protein EUTSA_v10025778mg [Eutrema salsugineum]
 gb|ESQ56037.1| hypothetical protein EUTSA_v10025778mg [Eutrema salsugineum]
Length=313

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 223/350 (64%), Gaps = 59/350 (17%)
 Frame = +3

Query  294   PVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLRGYGDTTGAPTDDPSKFTSLHVVGD  473
             PV+LFLHGFPE WYTWRHQM  L+S GYR +APDLRGYGDT    + D   +TSLHVVGD
Sbjct  23    PVILFLHGFPELWYTWRHQMVALSSLGYRTIAPDLRGYGDTEAPESVD--AYTSLHVVGD  80

Query  474   LVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPDKVKALVNMSVCFTPRNPKSKPLET  653
             L+ L+  V  D EKVFVVGHDWGA++AW LCL RPD+VKALVNMSV F P NPK KP+ T
Sbjct  81    LIGLIDAVVGDREKVFVVGHDWGAIIAWNLCLLRPDRVKALVNMSVVFDPWNPKRKPIST  140

Query  654   LRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKE  833
              R+ YGDDYYICRFQ                                         +Y E
Sbjct  141   FRSFYGDDYYICRFQ-----------------------------------------EYGE  159

Query  834   IKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSPLYLPKKGKLFEGSTDDLPSWL  1013
             I              E EFA +GT++VL   LTY NP P+ LP KGK ++     LPSWL
Sbjct  160   I--------------EAEFAKVGTERVLLELLTYRNPGPILLP-KGKSYDDPV-SLPSWL  203

Query  1014  SKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAP  1193
             ++ DV YY SK+EK GFTG +NYYR +D  WEL    + A+V VPVKFI+GD D+TY+ P
Sbjct  204   TEYDVKYYVSKYEKCGFTGPLNYYRNMDRTWELMGPLSKAQVKVPVKFIIGDQDLTYHNP  263

Query  1194  GAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEINTHILNFLHNF  1343
             G K+YI +G  K  VPLL+EVVV++GVGHF+HEE+P EI+ HI ++   F
Sbjct  264   GTKKYIQEGRFKSHVPLLDEVVVMKGVGHFLHEERPDEISKHIHDYFLTF  313



>ref|XP_003554633.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=341

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 182/375 (49%), Positives = 234/375 (62%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H  V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L+S GYRAVAPDLR
Sbjct  26    MEQIKHRIVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  85

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   S +   H+VGDLVAL+  +    ++VF+V HDWGA++ W LC++RPD
Sbjct  86    GYGDTEAPPSI--SSYNCFHIVGDLVALIDSLGV--QQVFLVAHDWGAIIGWYLCMFRPD  141

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKA V +SV F PRNPK KP++ +RA+YGDDYYICRFQ+                ++EG
Sbjct  142   KVKAYVCLSVPFWPRNPKVKPVDAMRAIYGDDYYICRFQEPG--------------KAEG  187

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
               + +S                                         T++V++       
Sbjct  188   ELAKNS-----------------------------------------TEQVIKNVFISRK  206

Query  942   PSPLYLPKKGKLFEGSTD-DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  L K+G  F  +T   LP+WLS+ D+ YY SKFEKTGFTGG+NYYR  +L+WEL+A
Sbjct  207   PGPPILEKEGMGFNPNTSMPLPTWLSQEDLTYYASKFEKTGFTGGLNYYRNFNLNWELTA  266

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTGA+V VPVKFI GDLD+ Y + G K YI  G  K+DVP LEEVVV EGV HF ++E 
Sbjct  267   PWTGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAFKKDVPNLEEVVVQEGVAHFNNQEA  326

Query  1299  PHEINTHILNFLHNF  1343
               +++ HI +F+  F
Sbjct  327   AEDVSNHIYDFIKKF  341



>ref|XP_010449873.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=331

 Score =   340 bits (872),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 191/384 (50%), Positives = 234/384 (61%), Gaps = 73/384 (19%)
 Frame = +3

Query  234   EHISVSVNGISMHVAQ--------------TGQGPVVLFLHGFPECWYTWRHQMCFLASQ  371
             +H  V VNGI+MHVA+                + PV+LFLHGFPE WYTWRHQM  L+S 
Sbjct  7     DHSFVKVNGITMHVAEKIPSVSVNGAFDGVINRPPVILFLHGFPELWYTWRHQMVALSSL  66

Query  372   GYRAVAPDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMM  551
             GYR +APDLRGYGDT      D   +TS HVVGDL+ L+  V  D EKVFVVGHDWGA++
Sbjct  67    GYRTIAPDLRGYGDTDAPERVD--AYTSFHVVGDLIGLIDAVVGDGEKVFVVGHDWGAII  124

Query  552   AWALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKK  731
             AW LCL RPD+VKALVNMSV F P NPK KP+   R+ YGDDYYICRFQ           
Sbjct  125   AWHLCLLRPDRVKALVNMSVVFDPWNPKRKPISMFRSFYGDDYYICRFQ-----------  173

Query  732   LHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKK  911
                               +C             EI+  F              A LGT++
Sbjct  174   ------------------EC------------GEIEAEF--------------AKLGTER  189

Query  912   VLQCFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
              L  FLTY +P P+ LP KGK ++     LPSWL+  DV YY SK+EK GFTG +NYYR 
Sbjct  190   ALLEFLTYRSPGPILLP-KGKRYDDPV-SLPSWLTDCDVKYYVSKYEKNGFTGPVNYYRN  247

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +D  WEL  + + A+V VPVKF++GD D+TY+ PG K+YIH G  K  VPLL+EVVV+EG
Sbjct  248   MDRTWELMGSLSKAQVKVPVKFVIGDQDLTYHIPGTKKYIHDGRFKSHVPLLDEVVVIEG  307

Query  1272  VGHFIHEEKPHEINTHILNFLHNF  1343
             VGHF+HEE+P EI+ HI ++  +F
Sbjct  308   VGHFLHEERPDEISKHIHDYFGSF  331



>ref|NP_001240943.1| uncharacterized protein LOC100803974 [Glycine max]
 gb|ACU18288.1| unknown [Glycine max]
 gb|KHN03960.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   339 bits (870),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 188/378 (50%), Positives = 234/378 (62%), Gaps = 66/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI H +V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L++ GYRAVAPDLR
Sbjct  1     MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSNLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP    S +T LH+V D+VAL+  +A D+  VF+V HDWGA++ W LCL+RPD
Sbjct  61    GYGDTE-APASI-SSYTILHLVSDIVALIHSLAVDQ--VFLVAHDWGAVIGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KA V +SV F PRNPK KP++ +RA+YGDDYYI                         
Sbjct  117   RIKAYVCLSVPFMPRNPKVKPVDAMRALYGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G+ E EFA    ++V++  LT   
Sbjct  152   ---------CRF---------------------QEPGKAEAEFANNSIEQVIKNILTSRR  181

Query  942   PSPLYLPKKGKLFEGSTDD----LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             P P  L K+G    GS  D    LP+WLS+ DV YY SKF KTG TGG+NYYR L+L+WE
Sbjct  182   PGPPILRKEGA---GSNSDPSRPLPTWLSQEDVTYYASKFTKTGLTGGLNYYRNLNLNWE  238

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WTG +V VPVKFI GDLD  Y + G K YI  G  K+DVP LEEVVV EGV HF +
Sbjct  239   LTAPWTGVQVKVPVKFITGDLDAVYTSLGMKNYIESGAFKKDVPCLEEVVVQEGVAHFNN  298

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E   ++  HI +F++ F
Sbjct  299   QEAAEDVTNHIYDFINKF  316



>gb|EMT09897.1| hypothetical protein F775_52362 [Aegilops tauschii]
Length=337

 Score =   340 bits (871),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 187/391 (48%), Positives = 249/391 (64%), Gaps = 79/391 (20%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQTGQGPVVLFL--HGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
              I H SV VNG+ +HVA+ G       L  HGFPE WYTWRHQM  LA+ GYRAVAPD+R
Sbjct  6     AITHRSVDVNGVRLHVAEAGPAGAPAALLLHGFPEVWYTWRHQMRALAAAGYRAVAPDMR  65

Query  402   GYGD--------------TTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDW  539
             GYG               T+ +P   P ++T+LHVVGDLVAL+  +   E++VFVV HDW
Sbjct  66    GYGGSARPPAGRTSTPRCTSSSPPGGPDQYTALHVVGDLVALIDSLG--EKQVFVVAHDW  123

Query  540   GAMMAWALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQ  719
             GAM+AW+LCL+RPD+VKALV +SV F+PR+P  KP++ L+A+YGD+YYICR Q+      
Sbjct  124   GAMIAWSLCLFRPDRVKALVALSVPFSPRSPARKPVDGLKALYGDEYYICRIQE------  177

Query  720   INKKLHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVL  899
                          GA  A                                     EFA L
Sbjct  178   ------------PGAIEA-------------------------------------EFARL  188

Query  900   GTKKVLQCFLTYYNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTG  1070
             GT+ VL+ F TY  P PL++PK G    GS DD   LPSW+++ D+ YY ++F+K+GFTG
Sbjct  189   GTELVLRKFFTYRTPGPLFIPKSG---WGSPDDEVPLPSWITEEDIKYYAAQFDKSGFTG  245

Query  1071  GINYYRALDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlle  1250
             G+NYYRAL+  WEL++ WTGA++ VP KFIVGD+D++Y+  GA ++I+KGGLK+ VPLL+
Sbjct  246   GLNYYRALNKTWELTSPWTGAEIKVPTKFIVGDVDLSYHVAGAHDFINKGGLKKFVPLLD  305

Query  1251  evvvleGVGHFIHEEKPHEINTHILNFLHNF  1343
             +VVV++ VGHFI+EEKP EI+ HI++F+  F
Sbjct  306   DVVVMKDVGHFINEEKPEEISAHIISFIKKF  336



>ref|XP_010914487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   338 bits (868),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 184/374 (49%), Positives = 235/374 (63%), Gaps = 59/374 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             + GI H +V  NGI MHVA+ G+GP VL LHGFPE WY+WRHQ+  LA++GYRA+APDLR
Sbjct  4     VSGISHQTVEANGIRMHVAEKGEGPAVLLLHGFPELWYSWRHQIASLAARGYRAIAPDLR  63

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P  D S +   H+VGDLVALL  +A  +   FVVGHDWGA +AW LC++RPD
Sbjct  64    GFGDTDAPP--DVSSYNIFHLVGDLVALLDALALSQ--AFVVGHDWGAHVAWHLCMFRPD  119

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA+VN+SV F PRNP  KP++  R++YGD+YYICRFQ+            P    +E 
Sbjct  120   RVKAVVNLSVAFLPRNPAMKPVDYFRSIYGDEYYICRFQE------------PDAAEAEF  167

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A   ++    +F                                            TY +
Sbjct  168   ARLGAATVLKKF-------------------------------------------FTYRD  184

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P+Y+PK G         LPSWLS+ D++YYTSKFEK+GFTG INYYR  DL+WEL+  
Sbjct  185   PGPIYIPKDGWGSPNEQITLPSWLSEADINYYTSKFEKSGFTGPINYYRCFDLNWELTEP  244

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             W GA+  VP KFIVGDLD+TY+ P  ++YIHKGG K+DVPLL+EVVV+EGV HFI++EK 
Sbjct  245   WNGAQANVPAKFIVGDLDLTYHYPNMQDYIHKGGFKKDVPLLQEVVVMEGVAHFINQEKA  304

Query  1302  HEINTHILNFLHNF  1343
              EI  HI +F+  F
Sbjct  305   QEIADHIYDFIQKF  318



>ref|XP_002455386.1| hypothetical protein SORBIDRAFT_03g009830 [Sorghum bicolor]
 gb|EES00506.1| hypothetical protein SORBIDRAFT_03g009830 [Sorghum bicolor]
Length=325

 Score =   339 bits (869),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 181/380 (48%), Positives = 235/380 (62%), Gaps = 65/380 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQ----GPVVLFLHGFPECWYTWRHQMCFLASQGYRAVA  389
             +EG+ H +V  NG+ +HVA+ G      PVVL +HGFP+ WY WRHQM  LA++GYRAVA
Sbjct  5     VEGVRHRTVEANGVRLHVAEAGPEEAGAPVVLLVHGFPDLWYGWRHQMAALAARGYRAVA  64

Query  390   PDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCL  569
             PDLRGYGD+   P  D S +T+ HVVGDLVAL+S +   + +VFVVGHDWGA++AW LCL
Sbjct  65    PDLRGYGDSDSPP--DASSYTTFHVVGDLVALISDLG--QPRVFVVGHDWGAIVAWQLCL  120

Query  570   YRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGR  749
              RPD V+ALVN+SV + PR P+  PL+T+RA  G+D+Y+CRFQ+  V             
Sbjct  121   LRPDLVRALVNLSVVYHPRRPEMSPLQTIRAACGEDHYMCRFQEPGV-------------  167

Query  750   RSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFL  929
                         +  F ++            +++F               G +K      
Sbjct  168   -----------AEAEFALY----------DTKYVFK-----------KTFGMRK------  189

Query  930   TYYNPSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLD  1103
                 P+PL LPK    F+    D   P WLS+ D+ YY  KF KTGFTGG+NYYR +D  
Sbjct  190   ----PAPLVLPKDKSFFDSLDSDGTCPPWLSEEDISYYAEKFAKTGFTGGLNYYRCMDRS  245

Query  1104  WELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHF  1283
             WELSA WTGA++ VP KFIVGDLDITYNAPG  +YIHKGG K  VP LE+VV++EGV HF
Sbjct  246   WELSAPWTGAQIKVPSKFIVGDLDITYNAPGVPDYIHKGGFKASVPNLEDVVIMEGVSHF  305

Query  1284  IHEEKPHEINTHILNFLHNF  1343
             +++EKP+E++ HI  F   F
Sbjct  306   LNQEKPNEVSDHICEFFSKF  325



>gb|KHG24497.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=317

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/376 (49%), Positives = 233/376 (62%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I H  V+VNGISMHVA+ G+GPV+LFLHGFPE WYTWRHQ+  L+S GY AVAPDLR
Sbjct  1     MERIRHKMVNVNGISMHVAEKGEGPVILFLHGFPELWYTWRHQIIALSSLGYHAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  APT   S ++ + +VGDLVAL+  +    E+VF+V HDWGA++ W LCL+RPD
Sbjct  61    GYGDTE-APTAI-SSYSCMQIVGDLVALIDSLGV--EQVFLVAHDWGAIIGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA V +SV F PR P+ KP+E++R  +GDDYYI                         
Sbjct  117   RVKAFVCLSVPFMPRKPQMKPVESMRLFFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G+IE E A  G   VL+  ++   
Sbjct  152   ---------CRF---------------------QEPGKIEAEIARYGASNVLKKIISSRK  181

Query  942   PSPLYLPKKGK--LFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK     +   +   LPSW S+ D+ YY +KF K GFTG +NYYRA DL+WE +
Sbjct  182   PGPPCMPKDNAFGIKPDTPITLPSWFSEEDLSYYANKFNKKGFTGALNYYRAFDLNWEQT  241

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WT  +V VPVKFIVGDLD  Y  PG KEY++ G  KRD P+LEEVV+++GVGHFI++E
Sbjct  242   APWTNTQVKVPVKFIVGDLDSVYTTPGMKEYVNGGDFKRDAPMLEEVVIMKGVGHFINQE  301

Query  1296  KPHEINTHILNFLHNF  1343
             +  EIN+HI +F+ NF
Sbjct  302   RADEINSHIHDFIKNF  317



>ref|XP_007147002.1| hypothetical protein PHAVU_006G088500g [Phaseolus vulgaris]
 gb|ESW18996.1| hypothetical protein PHAVU_006G088500g [Phaseolus vulgaris]
Length=320

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 188/380 (49%), Positives = 237/380 (62%), Gaps = 66/380 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEG+EH +V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L++ GYRAVAPDLR
Sbjct  1     MEGVEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSALGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP    S +T LH+V D+VAL+  +  D+  VF+V HDWGA++ W  CL+RPD
Sbjct  61    GYGDTD-APAS-VSSYTILHLVADVVALIDSLGVDQ--VFLVAHDWGALVGWYTCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KA V +SV F PRNPK KP++ +RA+YGDDYYI                         
Sbjct  117   RIKAYVCLSVPFMPRNPKVKPVDAMRALYGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G++E  +     ++ ++  LT   
Sbjct  152   ---------CRF---------------------QEPGKMETLYDN-NIEEAIKNMLTSRR  180

Query  942   PSPLYLPKKGK----LFEGS--TDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLD  1103
             P P  LPK+G     L  GS  +  LPSWLS+ D+ YY SKF KTG TGG+NYYR L+L+
Sbjct  181   PGPPILPKEGAGSNPLASGSLPSRPLPSWLSQEDLTYYASKFGKTGLTGGLNYYRNLNLN  240

Query  1104  WELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHF  1283
             WEL+AAWTG +V VPVKFI GDLDI Y + G K+YI  G  KRDVP LEEVVV EGV HF
Sbjct  241   WELTAAWTGVQVKVPVKFITGDLDIVYTSLGTKDYIESGAFKRDVPFLEEVVVQEGVAHF  300

Query  1284  IHEEKPHEINTHILNFLHNF  1343
              ++E   +++ HI NF+ NF
Sbjct  301   NNQEAAEDVSNHIYNFIKNF  320



>gb|KEH24510.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 188/378 (50%), Positives = 236/378 (62%), Gaps = 63/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG-QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME IEH +V VNGI MH+A+ G +GPVVLFLHGFPE WY+WRHQ+  L S GYRAVAPDL
Sbjct  1     MEEIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQISALGSLGYRAVAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT  AP    S +T  H+VGD+VAL+  +  D  +VF+V HDWGA++ W LCL+RP
Sbjct  61    RGYGDTD-APASI-SSYTIFHLVGDIVALIDSLGVD--RVFLVAHDWGAIIGWYLCLFRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             +++KA V +SV + PRNPK KP++ +RAVYGDDYYICRFQ+            P    +E
Sbjct  117   ERIKAYVCLSVPYLPRNPKLKPVDGMRAVYGDDYYICRFQE------------PGKMEAE  164

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
              A  +S            LL K                                  LT  
Sbjct  165   IAKGSSE-----------LLIK--------------------------------AMLTSR  181

Query  939   NPSPLYLPKKGKLFE---GSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             NP P  LPK+G L      ST  LPSWL+  DV YY SKFE+TGF+GG+NYYR  +L+WE
Sbjct  182   NPGPPILPKEGILSHPSVSSTMPLPSWLTLEDVAYYASKFEQTGFSGGLNYYRNFNLNWE  241

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+AAWTG+ + VPVKFI+GDLD+ Y + G K+YI  GG K DVP LEEVV+ +GV HF +
Sbjct  242   LTAAWTGSHIKVPVKFIIGDLDLVYTSFGTKQYIESGGFKNDVPNLEEVVIQKGVAHFNN  301

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E   EI+ HI +F+  F
Sbjct  302   QEAAEEISNHIYDFIKKF  319



>gb|KFK37968.1| hypothetical protein AALP_AA3G053200 [Arabis alpina]
Length=328

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 240/377 (64%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             M GIEH  VSVNGI+MH+A+ G  +GPVVL LHGFP+ WYTWRHQ+  L+S GYRA+APD
Sbjct  1     MGGIEHRMVSVNGITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQITGLSSLGYRAIAPD  60

Query  396   LRGYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             LRGYGDT     D P   S++T L+VVGDLVAL+  VA D+EKVF+V HDWGA++ W +C
Sbjct  61    LRGYGDT-----DSPESFSEYTCLNVVGDLVALMDSVAGDQEKVFLVAHDWGAIIGWFIC  115

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
              +RPDK+K  V +SV + PR+PK KPL+  +AV+GDDYYICRFQ+               
Sbjct  116   WFRPDKIKGFVCLSVPYRPRHPKVKPLQGFKAVFGDDYYICRFQEPG-------------  162

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
              + EG  +++   +                 LR +F+ +  G       +L  +K     
Sbjct  163   -KIEGEIASAGPRRV----------------LRNIFTGRALGP-----PILPKEKPFG--  198

Query  927   LTYYNPSPLYLPKKGKLFEGSTD-DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLD  1103
                 NP+P            S D +LP W SK D+++Y SKFEK GFTGG+NYYRA+DL+
Sbjct  199   ---ENPNP-----------NSEDIELPEWFSKEDLEFYVSKFEKAGFTGGLNYYRAMDLN  244

Query  1104  WELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHF  1283
             WEL+A WTGAK+ VPVKFI GD D  Y  PG KEYIH GG   DVP L+E+VV+E  GHF
Sbjct  245   WELTAPWTGAKIHVPVKFITGDFDTVYTTPGIKEYIHGGGFAADVPNLKEIVVIEDAGHF  304

Query  1284  IHEEKPHEINTHILNFL  1334
             +++EKP E+  HI +F 
Sbjct  305   VNQEKPQEVTAHINDFF  321



>gb|AAO27849.1|AF482450_1 soluble epoxide hydrolase [Euphorbia lagascae]
Length=321

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/376 (48%), Positives = 235/376 (63%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG-QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             ME IEH  VS NGI+MH+A  G QGPV+LFLHGFP+ WY+WRHQ+ +L+S GYR +APDL
Sbjct  5     MEKIEHSMVSTNGINMHIASIGTQGPVILFLHGFPDLWYSWRHQLLYLSSVGYRCIAPDL  64

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT   P  +  ++T  H++GDLV LL  +  D+  VF+VGHDWGA+++W  CL  P
Sbjct  65    RGYGDTDAPPAIN--QYTVFHILGDLVGLLDSLGIDQ--VFLVGHDWGAIISWYFCLLMP  120

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
              ++KALVN SV FTPR+P+ K +E  R   G+D+YI                        
Sbjct  121   FRIKALVNASVVFTPRDPRCKTVEKYRKELGEDFYI------------------------  156

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                       CRF                     QE GEIE +FA  GT K++  FLT  
Sbjct  157   ----------CRF---------------------QEVGEIEDDFAQAGTAKIITKFLTSR  185

Query  939   NPSPLYLPKK-GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             +  P  +PK+ G         +PSWLS++D++YY SK+ K GF+GG+NYYR LDL+WEL+
Sbjct  186   HIRPPCIPKETGYRSLREPSHIPSWLSQDDINYYVSKYNKKGFSGGLNYYRCLDLNWELT  245

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             A WTG ++ VPVKFIVGD D TY+ PG KE+IH GGLK+ VP L+E+V+LEG  HF+ +E
Sbjct  246   APWTGVQIKVPVKFIVGDQDATYHLPGVKEFIHNGGLKKHVPFLQEIVILEGAAHFLQQE  305

Query  1296  KPHEINTHILNFLHNF  1343
             KP EI+ HIL+F   F
Sbjct  306   KPEEISAHILDFFEKF  321



>gb|KFK30821.1| hypothetical protein AALP_AA6G030400 [Arabis alpina]
Length=316

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 232/375 (62%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH ++S NGI+MHVA  G GPV+LFLHGFP+ WY+WRHQ+   A  GY+A+APDLR
Sbjct  1     MEKIEHTTISTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFADLGYKAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+   P+ +   +T LH+VGDL+ LL+ +  D  KV +VGHDWGA++AW LC+ RPD
Sbjct  61    GYGDSDAPPSHE--SYTVLHIVGDLIGLLNSLGVD--KVLLVGHDWGAIVAWWLCMIRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN SV F PRNP  KPL+T R+++GDDYYICRFQ+              G   E 
Sbjct  117   RVKALVNTSVVFNPRNPNVKPLDTFRSLFGDDYYICRFQEP-------------GEIEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                  +                K++  RF                           T  N
Sbjct  164   FAQTDT----------------KKLITRFF--------------------------TSRN  181

Query  942   PSPLYLPKK-GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  +PK  G     +   LP+W ++ DV +Y  KF + GFTGG+NYYRA++L WEL+A
Sbjct  182   PRPPCIPKTVGFRGLPAPPPLPAWFTEEDVSFYVDKFNQKGFTGGLNYYRAMNLSWELTA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              W G ++ VPVKFIVGDLDITY+ PG KEYIH GGLK+ VP L+EVV++EGVGHF+ +EK
Sbjct  242   PWAGLQIKVPVKFIVGDLDITYHIPGTKEYIHDGGLKKHVPFLQEVVIMEGVGHFLQQEK  301

Query  1299  PHEINTHILNFLHNF  1343
             P E+  HI +F   F
Sbjct  302   PEEVTDHIYSFFKKF  316



>ref|XP_004967831.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=325

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 233/380 (61%), Gaps = 65/380 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG----QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVA  389
             ++G+ H +V  NG+ +HVA+ G      P VL LHGFP+ WY WRHQM  LA++GYRAVA
Sbjct  5     VDGVRHRTVEANGVRLHVAEAGPEGGAAPAVLLLHGFPDLWYGWRHQMAALAARGYRAVA  64

Query  390   PDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCL  569
             PDLRGYGD+   P  D S +T+ HVVGDLVAL++ +   + +VFVVGHDWGA++AW LCL
Sbjct  65    PDLRGYGDSDAPP--DASAYTTFHVVGDLVALIADLG--QPQVFVVGHDWGAIVAWQLCL  120

Query  570   YRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGR  749
              RPD V+ALVN+SV + PR P+  PL+T++A  G+D+Y+CRFQ+  V             
Sbjct  121   LRPDLVRALVNLSVVYHPRRPEGSPLQTIKAACGEDHYMCRFQEPGVAE-----------  169

Query  750   RSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFL  929
                                     ++ +   +++F+              G +K      
Sbjct  170   -----------------------AEFAQYDAKYIFN-----------KTFGMRK------  189

Query  930   TYYNPSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLD  1103
                 P+PL LPK    F+    D   P WLS+ D+ YY  KF KTGFTGG NYYR +DL+
Sbjct  190   ----PAPLILPKDKSFFDSLDSDGTCPPWLSEEDISYYAEKFSKTGFTGGFNYYRCMDLN  245

Query  1104  WELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHF  1283
             WELSA WTGA + VP KFIVGDLDITYN PG ++YIHKGG K  VP LE+VVV+EGV HF
Sbjct  246   WELSAPWTGAPIKVPTKFIVGDLDITYNTPGVQDYIHKGGFKASVPKLEDVVVMEGVSHF  305

Query  1284  IHEEKPHEINTHILNFLHNF  1343
             I++EKP E++ HI  F   F
Sbjct  306   INQEKPSEVSDHICEFFSKF  325



>ref|XP_004247402.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=318

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/377 (48%), Positives = 243/377 (64%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H +VS NGI MHVA+ G+GP VLFLHGFPE WY+WRHQ+ + +++GYRA+APDLR
Sbjct  1     MEKIQHKTVSANGIKMHVAEIGEGPAVLFLHGFPELWYSWRHQLLYFSNKGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P++  S +T+ H+VGDL++LL ++    EKVF++GHDWGA++AW  CL+RPD
Sbjct  61    GYGDTE-IPSEI-SSYTAFHIVGDLISLLDILDL--EKVFLIGHDWGALIAWFFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN+S    PRNP  KP++ LR + GDDYY+                         
Sbjct  117   RIKALVNLSCELRPRNPLRKPIDCLRELLGDDYYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E EFA + T K++  FL+  +
Sbjct  152   ---------CRF---------------------QKPGEVEEEFASIDTAKLIIGFLSSRD  181

Query  942   PSPLYLPKK---GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               P  +PK+    + F      LPSWL++ DV+YY  K  KTGFTGG+NYYR +D +WEL
Sbjct  182   TRPPCIPKEIGFHQAFAQLPAALPSWLTQEDVNYYAEKLNKTGFTGGLNYYRNMDKNWEL  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A ++G K+ VP KF+VG+LD+TYN PG KEYIH GG K++VP LEEVVV+EG  HFI++
Sbjct  242   TALFSGCKIQVPTKFVVGELDLTYNIPGIKEYIHNGGFKKEVPSLEEVVVMEGAAHFINQ  301

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP EIN HI +F+  F
Sbjct  302   EKPDEINAHIYDFIQKF  318



>ref|XP_010486015.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=331

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 184/376 (49%), Positives = 237/376 (63%), Gaps = 60/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGI+H  VSVNGI+MH+A+ G   GPVVL LHGFP+ WYTWRHQ+  L+S GYRAVAPD
Sbjct  1     MEGIDHKMVSVNGITMHIAEKGPIDGPVVLLLHGFPDLWYTWRHQITGLSSLGYRAVAPD  60

Query  396   LRGYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             LRGYGD+     D P   S++T L+VVGDLVALL  VA D+EKVF+VGHDWGA++ W LC
Sbjct  61    LRGYGDS-----DSPKSFSEYTCLNVVGDLVALLDSVAGDQEKVFLVGHDWGAIIGWFLC  115

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L+RP+K+K  V +SV + PRNP  KP++  +AV+G++YYICRFQ+              G
Sbjct  116   LFRPEKIKGFVCLSVPYKPRNPNVKPIQGFKAVFGENYYICRFQE-------------AG  162

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
             +  E    A      RF              LR +F+ +           LG   + +  
Sbjct  163   KIEEEIARADP---RRF--------------LRNIFTGR----------TLGPSILPKND  195

Query  927   LTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
                 NP P Y             +LP W SK D+D+Y SKF+KTGFTG +NYYRA+DL+W
Sbjct  196   PFGENPKPNY----------ENIELPKWFSKEDLDFYASKFDKTGFTGALNYYRAMDLNW  245

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+A WTGAK+ VPVKF+ GD D+ Y  PG KEY+H GG    VP L+E+VV+E  GHF+
Sbjct  246   ELTAPWTGAKIQVPVKFMTGDFDMVYTTPGIKEYVHGGGFAAAVPNLQEIVVIEDAGHFV  305

Query  1287  HEEKPHEINTHILNFL  1334
             ++EKP E+  HI +F 
Sbjct  306   NQEKPQEVTAHINDFF  321



>gb|EMT14639.1| hypothetical protein F775_19531 [Aegilops tauschii]
Length=363

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 178/365 (49%), Positives = 242/365 (66%), Gaps = 38/365 (10%)
 Frame = +3

Query  330   WYTWRHQMCFLASQGYRAVAPDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADE  509
             WY WRHQ+  LA+ GYRAVAPD+RGYGD+  AP+  P ++T+LHVVGDLVAL+  +   E
Sbjct  11    WYAWRHQLPALAAAGYRAVAPDMRGYGDSD-APSGGPDQYTALHVVGDLVALIDSLG--E  67

Query  510   EKVFVVGHDWGAMMAWALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYIC  689
             ++VFVV HDWGA++AW+LCL+RPD+VKALV +SV F PRNP  KP++  RA+YGDDYY+C
Sbjct  68    KQVFVVAHDWGALIAWSLCLFRPDRVKALVALSVAFNPRNPAVKPVDGFRALYGDDYYVC  127

Query  690   RFQKNTVNTQINKKLHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKE------------  833
             RFQ       I +   P        CS    C  R    +W + K +             
Sbjct  128   RFQLLFDLRTIKQSSTP-----RSICSGRLKCPGR-RPGYWPITKIRPRLYFTLVKGTPV  181

Query  834   -----------IKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYNPSPLYLPKKGKLF  980
                         K  F+   +E G  E EF  LGT+ VL+ F  Y  P PL++PK G   
Sbjct  182   TQDYYSECQSPTKSVFMLVMKEPGAAEAEFRRLGTELVLRKFFAYRTPGPLFIPKSG---  238

Query  981   EGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAAWTGAKVMVPV  1151
              GS D+   LPSW+++ D+ YYT++F+K+GFTGG+NYYRAL+  W+L++ WT AK+ VP 
Sbjct  239   WGSPDEEVPLPSWITEEDIKYYTTQFDKSGFTGGLNYYRALNKTWDLTSPWTEAKITVPT  298

Query  1152  KFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKPHEINTHILNF  1331
             KFIVGDLD+TYN  GA+++I+KGG K+ VPLL++VV+++ V HFI+EEKP EI+ HI+NF
Sbjct  299   KFIVGDLDLTYNTAGAQDFINKGGFKKFVPLLDDVVIMKDVTHFINEEKPKEISAHIINF  358

Query  1332  LHNFS  1346
             ++ F+
Sbjct  359   INKFN  363



>ref|XP_006359858.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 183/377 (49%), Positives = 244/377 (65%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H +V+VNGI MHVA+ G+GP VLFLHGFPE WY+WRHQ+ + +++GYRA+APDLR
Sbjct  1     MEKIQHKNVTVNGIKMHVAEIGEGPAVLFLHGFPELWYSWRHQLLYFSNKGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P++  S +T+ H+VGDL+ALL ++    EKVF+VGHDWGA++AW  CL+RPD
Sbjct  61    GYGDTE-IPSEI-SSYTAFHIVGDLIALLDILDL--EKVFLVGHDWGALIAWFFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN+S    PRNP  KP++ LR + GDDYY+                         
Sbjct  117   RIKALVNLSCELRPRNPLRKPIDCLRELLGDDYYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E EFA + T K++  FLT  +
Sbjct  152   ---------CRF---------------------QKPGEVEEEFASIDTAKLMIGFLTSRD  181

Query  942   PSPLYLPKK---GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               P  +PK+    + F      LPSWL++ DV+YY  K  KTGFTGG+NYYR +D +WEL
Sbjct  182   TRPPCIPKEIGFHQAFAQLPATLPSWLTQEDVNYYVEKLNKTGFTGGLNYYRNMDKNWEL  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A ++G K+ VP KF+VG+LD+TY+ PG KEYIH GG K++VP LEEVVV+EG  HFI++
Sbjct  242   TAPFSGCKIQVPTKFVVGELDLTYHIPGIKEYIHNGGFKKEVPSLEEVVVMEGAAHFINQ  301

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP EIN HI +F+  F
Sbjct  302   EKPDEINAHIYDFIQKF  318



>gb|KDP28185.1| hypothetical protein JCGZ_13956 [Jatropha curcas]
Length=315

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 177/375 (47%), Positives = 236/375 (63%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+HI V+ NGI+MHVA  G GP +LFLHGFPE WY+WRHQ+  L++ GYR +APDLR
Sbjct  1     MENIQHIRVAANGINMHVATIGTGPAILFLHGFPELWYSWRHQLLHLSALGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP +  +++T  H+VGDL+ LL  +    EKVF+VGHDWGA++AW  CL+RPD
Sbjct  61    GFGDTD-AP-ESVTEYTGFHIVGDLIGLLDELGI--EKVFLVGHDWGAVIAWYFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN S+ FTPR P + P++ L+A +GDDYY+                         
Sbjct  117   RIKALVNSSIAFTPRTPVN-PVDGLKACFGDDYYV-------------------------  150

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE  E E +F++L    +L+   T  N
Sbjct  151   ---------CRF---------------------QEPIEAEEKFSLLDIASLLKTIFTARN  180

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P+P  +PK+ +  +     LPSWLS+ D++YY +KF +TG TGG+NYYRA+ L WEL A 
Sbjct  181   PNPPRIPKEIEFPDCLCSCLPSWLSEEDINYYAAKFHQTGITGGLNYYRAIKLTWELMAP  240

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             W G ++ VPVKFIVGDLD  Y+ PG KEYI  GG K+DVP L+EVV++EGVGHFI +EK 
Sbjct  241   WAGQQIKVPVKFIVGDLDTAYHLPGMKEYIKNGGFKKDVPNLQEVVIMEGVGHFIIQEKA  300

Query  1302  HEINTHILNFLHNFS  1346
              E++ HI +F+ NF 
Sbjct  301   EEVSNHIYDFIKNFD  315



>ref|XP_007147004.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
 gb|ESW18998.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
Length=318

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 184/377 (49%), Positives = 238/377 (63%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI+H  V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L+S+GYRAVAPDLR
Sbjct  1     MEGIQHKEVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP    S ++   +VGDLVAL+ ++    E+VF+V HDWGA++ W LC++RPD
Sbjct  61    GYGDTE-APAS-MSSYSCFDIVGDLVALIDLLGV--EQVFLVAHDWGAIIGWYLCMFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA V +SV    RNP+ + ++ +RA+YGDDYYI                         
Sbjct  117   RVKAYVCLSVPLLHRNPEIRTVDAMRAMYGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E + A +GT+ VL+  LT   
Sbjct  152   ---------CRF---------------------QKPGEMEAQMAEVGTEYVLKNILTTRK  181

Query  942   PSPLYLPKK--GKLFEGS-TDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P P   PK   G  F    T+ LPSWLS++D+ YY SKF+KTGFTG +NYYR ++ +WEL
Sbjct  182   PGPPIFPKGEYGTGFNPDMTNSLPSWLSQHDLAYYVSKFQKTGFTGPLNYYRNMNPNWEL  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A W+GAK+ VPVKFI GDLD+ Y +   KEYIH GG K DVP LEEV+V +GV HF ++
Sbjct  242   TAPWSGAKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIVQKGVAHFNNQ  301

Query  1293  EKPHEINTHILNFLHNF  1343
             E   EINTHI +F++ F
Sbjct  302   EAAEEINTHIYDFINKF  318



>ref|XP_011079630.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=316

 Score =   336 bits (862),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 180/377 (48%), Positives = 240/377 (64%), Gaps = 64/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I H +++VNGI+MHVA+ G GP VLFLHGFPE WY+WRHQM +L+++GYRA+APDLR
Sbjct  1     MERIVHKNLNVNGINMHVAEIGDGPAVLFLHGFPELWYSWRHQMLYLSARGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+  PS +T+ H+VGDLVALL  +  D+  VF+V HDWGA++AW  CL+RPD
Sbjct  61    GYGDTDAPPS--PSSYTTFHIVGDLVALLDALGLDQ--VFLVAHDWGALIAWCFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVNMSV F PR+P+ K L+  R + GDD+Y+                         
Sbjct  117   RIKALVNMSVQFHPRHPEIKTLQRYRDLLGDDFYM-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE E  FA     +V++   ++  
Sbjct  152   ---------CRF---------------------QKPGEAEEAFACEEITQVIKSLFSFRG  181

Query  942   PSPLYLPKK---GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               P+ +PK+     LF+   + LP WL++ D++Y+ +KF+KTGFTGG+NYYRA+DL WEL
Sbjct  182   GRPIVVPKELGLEVLFQAPAE-LPPWLTEEDINYFATKFKKTGFTGGLNYYRAMDLSWEL  240

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
                WTG +V VPVKFI+GD DITY+ PG +EYIHKGG K+DVP   EVVV+EGV HFI++
Sbjct  241   MGPWTGVEVKVPVKFIIGDADITYHVPGVEEYIHKGGFKKDVP-DLEVVVMEGVAHFINQ  299

Query  1293  EKPHEINTHILNFLHNF  1343
             EK  E++ HI  F+  F
Sbjct  300   EKAEEVSHHIYQFITRF  316



>ref|XP_004981166.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=330

 Score =   337 bits (863),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 184/380 (48%), Positives = 225/380 (59%), Gaps = 64/380 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG----QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVA  389
             M  + H  V  NGISMHVA+ G      P VLF+HGFPE WY+WRHQM +LA++GYR VA
Sbjct  1     MAAVRHRQVEANGISMHVAEAGPEGSSAPAVLFVHGFPELWYSWRHQMGYLAARGYRCVA  60

Query  390   PDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCL  569
             PDLRGYG TT  P  +PS +T+ HVVGDL+ALL   A    KVFVVGHDWGA+++W LC+
Sbjct  61    PDLRGYGGTTAPP--EPSSYTAFHVVGDLIALLD--ALRLPKVFVVGHDWGAIVSWNLCV  116

Query  570   YRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGR  749
              RPD+V+ALVN+SV F PR P  KP+E  RA YGDDYY+                     
Sbjct  117   LRPDRVRALVNLSVAFMPRRPGVKPVEYFRAAYGDDYYV---------------------  155

Query  750   RSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFL  929
                          CRF                     QE G +E EFA    K   +  L
Sbjct  156   -------------CRF---------------------QEPG-VEAEFAAFDLKSFFKLAL  180

Query  930   TYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
             T        +  +          LPSWLS+ DV Y  S + KTGF GG+NYYR LDL+WE
Sbjct  181   TVNTTGSSSMNLRKMQAYNKEIALPSWLSEEDVSYLASVYAKTGFAGGVNYYRCLDLNWE  240

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L A WTGAKV VP KFIVGD D+ Y+ PG + YIHKGGLKRDVP+LEEVVV++G GHFI 
Sbjct  241   LMAPWTGAKVQVPTKFIVGDGDLAYHHPGVRSYIHKGGLKRDVPMLEEVVVIKGAGHFIQ  300

Query  1290  EEKPHEINTHILNFLHNFSS  1349
             +E+  EI+ HI +++  F +
Sbjct  301   QERAQEISKHIYDYIKKFET  320



>ref|XP_010464087.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=331

 Score =   337 bits (863),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 182/381 (48%), Positives = 233/381 (61%), Gaps = 70/381 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGI+H  VSVNGI+MH+A+ G   GPVVL LHGFP+ WYTWRHQ+  L+S GYRAVAPD
Sbjct  1     MEGIDHRMVSVNGITMHIAEKGPIDGPVVLLLHGFPDLWYTWRHQINGLSSLGYRAVAPD  60

Query  396   LRGYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             LRGYGD+     D P   S+++ L+VVGDLVALL  VA D+EKVF+V HDWGA++ W LC
Sbjct  61    LRGYGDS-----DSPKSFSEYSCLNVVGDLVALLESVAGDQEKVFLVAHDWGAIIGWFLC  115

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L+RP+K+K  V +SV + PRNP  KP++  +AV+G++YYICRFQ+              G
Sbjct  116   LFRPEKIKGFVCLSVPYKPRNPNVKPIQGFKAVFGENYYICRFQEP-------------G  162

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
             +  E    A                       RFL                      +  
Sbjct  163   KTEEEIARADP--------------------RRFL----------------------RNI  180

Query  927   LTYYNPSPLYLPKKGKLFEGSTD-----DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
              T   P P  LPK     E         +LP+W SK D+D+Y SKF+KTGFTG +NYYRA
Sbjct  181   FTGRTPGPSILPKNDPFGENPKPNYENIELPNWFSKEDLDFYASKFDKTGFTGALNYYRA  240

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +DL+WEL+A WTGAK+ VPVKF+ GD+D+ Y  PG KEYIH G    DVP L+E+VV+E 
Sbjct  241   MDLNWELTAPWTGAKIQVPVKFMTGDVDMVYTTPGIKEYIHGGRFAADVPNLQEIVVIED  300

Query  1272  VGHFIHEEKPHEINTHILNFL  1334
              GHF+++EKP E+  HI +F 
Sbjct  301   AGHFVNQEKPQEVTAHINDFF  321



>gb|AFZ93648.1| epoxide hydrolase [Euphorbia lathyris]
 gb|AFZ93653.1| epoxide hydrolase [Euphorbia lathyris]
Length=315

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 188/376 (50%), Positives = 235/376 (63%), Gaps = 63/376 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH  V+ NGI+MHVA  G+G  +LFLHG+PE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MEKIEHTKVATNGINMHVASIGEGRPILFLHGYPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT    + +  K+T LH+VGDLV LL  +  D+  VF+VGHDWGA++AW +CL+RPD
Sbjct  61    GYGDTDAPHSVE--KYTVLHIVGDLVGLLDALQIDQ--VFLVGHDWGAIIAWYVCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN SV F PR+P +  +E  R +YG+DYYI R+QK  V                 
Sbjct  117   RIKALVNTSVPFLPRDPTTPFVEFYRNLYGEDYYIVRYQKPGVAE---------------  161

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                 +Y +I    LF                     +  LT  +
Sbjct  162   -------------------AEYAKINSAKLF---------------------RIILTNRD  181

Query  942   PSP-LYLPKK-GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P+P   LPK  GK  + ST  LP WL++ DVDYY  KF KTGFTGGINYYR  D  WEL+
Sbjct  182   PNPEATLPKDIGKQPDPST--LPCWLTEKDVDYYARKFHKTGFTGGINYYRNFDRTWELT  239

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             AAWTGA+V VPVKFIVGDLD+ YN PG KEYIH GG KRDVP LEEVV++EGV HF+++E
Sbjct  240   AAWTGAQVKVPVKFIVGDLDLVYNIPGMKEYIHNGGFKRDVPFLEEVVIMEGVAHFLNQE  299

Query  1296  KPHEINTHILNFLHNF  1343
             K  EI+ HI +F+  F
Sbjct  300   KADEISKHIYDFIKKF  315



>ref|XP_002523107.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39292.1| epoxide hydrolase, putative [Ricinus communis]
Length=315

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/374 (49%), Positives = 236/374 (63%), Gaps = 59/374 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V  NGI+MH+A  G+GPV+LFLHGFP+ WYTWRHQ+  L+S GYR +APDLR
Sbjct  1     MEKIEHTTVYTNGINMHIASIGKGPVILFLHGFPDLWYTWRHQLLALSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P+  P+++T LH+VGDLV LL  +    E+VF+VGHDWGA +AW LCL+RPD
Sbjct  61    GFGDTDAPPS--PNEYTVLHIVGDLVGLLDSLGV--EQVFLVGHDWGATVAWHLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVN SV F+PRNP  KP+E  R + GDD+YICRFQ++             G   E 
Sbjct  117   RIKALVNTSVAFSPRNPHKKPVERYRELLGDDFYICRFQEH-------------GEIEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                A +    R                RFL S         +    G + +         
Sbjct  164   FAKAGAARIIR----------------RFLASRSTAPPCVPK--ATGFRSL---------  196

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             P P  LP              SWLS+ D++YY SK+ + GFTGG+NYYR LDL+WEL+A 
Sbjct  197   PVPQNLP--------------SWLSEEDINYYVSKYGQKGFTGGLNYYRCLDLNWELTAP  242

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             WTG+++ VPVKFIVGD+DITY+ PG KEYIH  G+K+ VP L+EVVVLEGV HF+ +EKP
Sbjct  243   WTGSQIKVPVKFIVGDMDITYHFPGVKEYIHH-GMKKHVPFLQEVVVLEGVAHFLSQEKP  301

Query  1302  HEINTHILNFLHNF  1343
              E+  HI +F+  F
Sbjct  302   DEVTAHIHDFIKKF  315



>ref|XP_007147001.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
 gb|ESW18995.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
Length=316

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 184/375 (49%), Positives = 235/375 (63%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I H +V VNGI MHVA+ G+GP VLFLHGFPE WYTWRHQ+  L+S+GY AVAPDLR
Sbjct  1     MEYIVHRTVEVNGIKMHVAEKGEGPAVLFLHGFPELWYTWRHQILDLSSRGYHAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP    S ++   +VGDLVAL+ ++  D+  VF+V HDWGA++ W LC++RPD
Sbjct  61    GYGDTE-APA-SMSSYSCFDIVGDLVALIDLLGVDQ--VFLVAHDWGAIIGWYLCMFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA V +SV F PRNPK KP++ +RA+YGDDYYICRFQ+                ++EG
Sbjct  117   RVKAYVCLSVPFWPRNPKVKPVDAMRALYGDDYYICRFQE--------------AGKAEG  162

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
               + +S                                         T++VL+  LT   
Sbjct  163   ELAKNS-----------------------------------------TEEVLKKLLTNRT  181

Query  942   PSPLYLPKKGKLFEGSTD-DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  L K+G     +T   LPSWLS  D+ YY SKFEKTGFTGG+NYYR ++L+WEL+A
Sbjct  182   PGPPILQKEGMGSNLNTSMPLPSWLSLQDLKYYASKFEKTGFTGGLNYYRNINLNWELTA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTGA+V VPVKFI GDLD  Y + G K YI  G  K+DVP LEEV+V EGV HF ++E 
Sbjct  242   PWTGAQVKVPVKFITGDLDSVYTSLGMKNYIESGAFKKDVPNLEEVIVQEGVAHFNNQEA  301

Query  1299  PHEINTHILNFLHNF  1343
               +++ HI +F+ NF
Sbjct  302   AEDVSNHIYDFIKNF  316



>ref|XP_010693594.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=362

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 190/375 (51%), Positives = 245/375 (65%), Gaps = 62/375 (17%)
 Frame = +3

Query  225   EGIEHISVSVNGISMHVAQTGQ--GPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             +GI+H S+ VNGI+MHV + G    PVVLF+HGFPE WY+WRHQ+  L++ GYRAVAPD+
Sbjct  48    DGIKHRSLHVNGINMHVVEKGDEGSPVVLFIHGFPELWYSWRHQILSLSALGYRAVAPDM  107

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT  AP+D   K+T +H+VGDLVAL+  +  D+  VFVVGHDWGA++ W LCL+RP
Sbjct  108   RGYGDTE-APSD-ARKYTYVHIVGDLVALIDELGVDQ--VFVVGHDWGAVIGWWLCLFRP  163

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D+VKA V+MSV F+PRNP  K L+ L A YG DYYICRFQ   V  +I  ++   G    
Sbjct  164   DRVKAFVSMSVAFSPRNPNMKLLDMLCAAYGPDYYICRFQ---VPGEIESEIAEAG----  216

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
             GA                      +  LR +FS++                         
Sbjct  217   GA----------------------DKLLRKIFSFR-------------------------  229

Query  939   NPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             +P PL LP KGK F       P+WLS+ +  YY  KF K+GFTGG+NYYRAL+L+WEL+A
Sbjct  230   DPGPLMLP-KGKAFTDMA-SYPNWLSQEESSYYVDKFTKSGFTGGLNYYRALNLNWELTA  287

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTGA+V VPVKF+VGDLD+ Y+ PG KEYI++GG+K+DVPLLEEVV+LEGV HF+ +EK
Sbjct  288   PWTGAQVEVPVKFVVGDLDLAYHMPGVKEYINQGGMKKDVPLLEEVVILEGVAHFLQQEK  347

Query  1299  PHEINTHILNFLHNF  1343
             P  +  HI +F+  F
Sbjct  348   PDVVTDHIYDFIRKF  362



>ref|XP_002463580.1| hypothetical protein SORBIDRAFT_01g002410 [Sorghum bicolor]
 gb|EER90578.1| hypothetical protein SORBIDRAFT_01g002410 [Sorghum bicolor]
Length=333

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 184/377 (49%), Positives = 226/377 (60%), Gaps = 64/377 (17%)
 Frame = +3

Query  231   IEHISVSVNGISMHVAQTG----QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             + H  +  NGISMHVA+ G      P VLF+HGFPE WY+WRHQM +LA++GYR VAPDL
Sbjct  6     VRHRQLEANGISMHVAEAGPVDASAPAVLFVHGFPELWYSWRHQMDYLAARGYRCVAPDL  65

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYG TT  P  +PS +T+ H+VGDLVALL   A    +VFVVGHDWGA+++W LCL RP
Sbjct  66    RGYGGTTAPP--EPSSYTAFHIVGDLVALLD--ALHLPQVFVVGHDWGAIVSWNLCLLRP  121

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             D+V+ALVN+SV F PRNP  KPLE  RA YGDDYY+                        
Sbjct  122   DRVRALVNLSVAFMPRNPGVKPLEYFRAAYGDDYYV------------------------  157

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                       CRF                     QE G +E EFA    K   +  LT  
Sbjct  158   ----------CRF---------------------QEPG-LEAEFAAFDLKSFFKLALTLR  185

Query  939   NPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
                   +  +         +LPSWLS+ DV+Y  S + KTGF GG+NYYR LDL+WEL A
Sbjct  186   ATGSSVMDLRKMQTYAKQIELPSWLSEEDVNYLASVYSKTGFAGGVNYYRCLDLNWELMA  245

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WT AKV VP KFIVGD D+ Y+ PG K YIHKGGLKRDVP+LEEVVV++G GHFI +E+
Sbjct  246   PWTRAKVQVPTKFIVGDGDLAYHHPGVKSYIHKGGLKRDVPMLEEVVVIKGAGHFIQQER  305

Query  1299  PHEINTHILNFLHNFSS  1349
               EI+ HI +++  F +
Sbjct  306   AQEISEHIHDYIKKFEA  322



>ref|XP_010440228.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Camelina 
sativa]
Length=331

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 190/384 (49%), Positives = 234/384 (61%), Gaps = 73/384 (19%)
 Frame = +3

Query  234   EHISVSVNGISMHVAQ-----TGQG---------PVVLFLHGFPECWYTWRHQMCFLASQ  371
             +H  V VNGI+MHVA+     +G G         PV+LFLHGFPE WYTWRHQM  L+S 
Sbjct  7     DHSFVKVNGITMHVAEKSPSVSGNGALDGVINRPPVILFLHGFPELWYTWRHQMVALSSL  66

Query  372   GYRAVAPDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMM  551
             GYR +APDLRGYGDT      D   +TSLHVVGDL+ L+  V  D EKVFVVGHDWGA++
Sbjct  67    GYRTIAPDLRGYGDTDAPERVD--AYTSLHVVGDLIGLIDAVVGDREKVFVVGHDWGAII  124

Query  552   AWALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKK  731
             AW LCL RPD+VKAL N+SV F P NPK KP+   R+ YGDDYYICR Q           
Sbjct  125   AWHLCLLRPDRVKALANLSVVFDPWNPKRKPISMFRSFYGDDYYICRLQ-----------  173

Query  732   LHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKK  911
                               +C             EI+  F              A LGT++
Sbjct  174   ------------------EC------------GEIEAEF--------------AKLGTER  189

Query  912   VLQCFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
              L  FLTY +P P+ LP KGK ++     LPSWL+  DV YY SK+EK GFTG +NYYR 
Sbjct  190   ALLEFLTYRSPGPILLP-KGKRYDDHV-SLPSWLTDCDVKYYVSKYEKNGFTGPVNYYRN  247

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +D  WEL  + + A+V V VKF++GD D+TY+ PG K+YIH G  K  VPLL+EVVV+EG
Sbjct  248   MDRTWELMGSLSKAQVKVLVKFVIGDQDLTYHIPGTKKYIHDGRFKSHVPLLDEVVVIEG  307

Query  1272  VGHFIHEEKPHEINTHILNFLHNF  1343
             VGHF+HEE+P EI+ HI ++  +F
Sbjct  308   VGHFLHEERPDEISKHIHDYFGSF  331



>ref|XP_010524544.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional epoxide hydrolase 
2 [Tarenaya hassleriana]
Length=385

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 193/382 (51%), Positives = 236/382 (62%), Gaps = 60/382 (16%)
 Frame = +3

Query  228   GIEHISVSVNGISMHVAQ-------TGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             G+ H ++ VNGISMHVA+       +   PV+LFLHGFPE WYTWRHQ+  L+S GYR V
Sbjct  53    GVAHRNLHVNGISMHVAEKPGVDGASANAPVILFLHGFPELWYTWRHQIEALSSLGYRTV  112

Query  387   APDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             APDLRGYGDT  AP +    +T  HVVGD+VAL+  V   +  VFVVGHDWGAM+AW LC
Sbjct  113   APDLRGYGDTD-AP-ESVEDYTYFHVVGDIVALIDAVTGGDAPVFVVGHDWGAMIAWQLC  170

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             LYRPDKVKALVN+   F      S         + D     R  K+T N + N       
Sbjct  171   LYRPDKVKALVNIYSAFXFVELTS---------HEDIQNQNRVYKSTHNHKFND------  215

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
                                  + +C++           QE G IE EF   G+++VL+  
Sbjct  216   ---------------------YYICRF-----------QENGGIEAEFEEFGSERVLKEI  243

Query  927   LTYYNPSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALD  1097
             LTY  P PL +PK GK+FE   +    LP WLS+ D+ YY SK+EK GFTGGINYYR +D
Sbjct  244   LTYKTPRPLLMPK-GKIFERPKNAAIALPPWLSERDLAYYVSKYEKRGFTGGINYYRNID  302

Query  1098  LDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVG  1277
              +WEL+A WTGAK+ VPVKF+VGD D+TY +PG KEYIH GGLKRDVPLLEE VV+EG+G
Sbjct  303   RNWELTAPWTGAKIRVPVKFMVGDQDLTYLSPGTKEYIHGGGLKRDVPLLEEAVVMEGLG  362

Query  1278  HFIHEEKPHEINTHILNFLHNF  1343
             HF+HEE P  IN HI +F   F
Sbjct  363   HFLHEECPDRINLHIHDFFRKF  384



>ref|XP_002302724.1| epoxide hydrolase family protein [Populus trichocarpa]
 gb|EEE81997.1| epoxide hydrolase family protein [Populus trichocarpa]
Length=316

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 235/376 (63%), Gaps = 62/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ IEH +V+ NGI+MH+A  G GPV+LFLHGFPE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MDKIEHQTVATNGINMHIASIGTGPVILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP  +  ++T  H+VGDLV L+  +  D  KVF+VGHDWG+ +AW  CL RPD
Sbjct  61    GYGDTD-APK-NVREYTIFHIVGDLVGLIDSLGID--KVFLVGHDWGSTVAWYFCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVNMSV F PRNP    ++  R ++GDD+YICR Q+              G   E 
Sbjct  117   RIKALVNMSVVFQPRNPHKSSVQISRELFGDDFYICRIQEP-------------GEVEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                  +                  I  RFL                          T  +
Sbjct  164   FAQMDTAS----------------IITRFL--------------------------TSRD  181

Query  942   PSPLYLPKKGKLFEG--STDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK+   F G     +LPSWLS+ D++YY  KF +TGFTGG+NYYR LDL+WEL 
Sbjct  182   PKPPCIPKEVG-FRGIPYNPNLPSWLSEKDINYYAGKFNQTGFTGGLNYYRCLDLNWELM  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             AAWTG ++ VPVKFIVGD+D+TY+ PG KEYI KGGLK+ VP L+EVVV+EGVGHF+++E
Sbjct  241   AAWTGLQIKVPVKFIVGDVDLTYHIPGVKEYISKGGLKKYVPFLQEVVVMEGVGHFLNQE  300

Query  1296  KPHEINTHILNFLHNF  1343
             KP E++ HI +F+  F
Sbjct  301   KPEEVSEHIYDFIKKF  316



>gb|ADP68585.1| epoxide hydrolase A [Vigna radiata]
Length=319

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 236/378 (62%), Gaps = 63/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L+S+GYRAVAPDLR
Sbjct  1     MEEIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +  S +T +H+VGD+VAL+  +   +  VF+V HDWGA++ W LCL+RP+
Sbjct  61    GYGDTE-AP-ESISSYTIMHLVGDIVALIDSLGVGQ--VFLVAHDWGAIVGWYLCLFRPE  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             K+KA V +SV F PRNPK +P++ +RA+YGDDYYI                         
Sbjct  117   KIKAYVCLSVPFMPRNPKVRPVDAMRALYGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGT-KKVLQCFLTYY  938
                      CRF                     QE G+ E  +       +V++  LT  
Sbjct  152   ---------CRF---------------------QEPGKAEALYGSNNNIGEVIKSILTNR  181

Query  939   NPSPLYLPKKG-KLFEGS--TDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
              P P  LPK+G  L  GS  +  LPSWLS+ DV YY SKF KTG TGG+NYYR L+L+WE
Sbjct  182   RPGPPILPKEGVALPSGSLPSRPLPSWLSEEDVTYYASKFSKTGLTGGLNYYRNLNLNWE  241

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+AAWTGAKV VPVKFI GDLD+ Y + G K+YI  G  KRDV  LEEVVV EGV HF +
Sbjct  242   LTAAWTGAKVKVPVKFITGDLDVVYTSLGIKDYIDSGAFKRDVHYLEEVVVQEGVAHFNN  301

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E   +I+ HI  F+  F
Sbjct  302   QEAAEDISNHIYEFIKKF  319



>gb|KDP28186.1| hypothetical protein JCGZ_13957 [Jatropha curcas]
Length=319

 Score =   334 bits (856),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 233/381 (61%), Gaps = 69/381 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+HI V  NGI+MHVA  G GP +LFLHGFPE WY+WRHQ+  L++ GYR +APDLR
Sbjct  1     MEKIQHIRVPTNGINMHVATIGTGPAILFLHGFPELWYSWRHQLLHLSALGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLY  572
             GYGD     TD P   S++T  H+VGDL+ LL  +    E+VF+VGHDWG+++AW  CL+
Sbjct  61    GYGD-----TDVPASVSEYTGFHIVGDLIGLLDALGI--EQVFLVGHDWGSIIAWYFCLF  113

Query  573   RPDKVKALVNMSVCFTPRNPK-SKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGR  749
             RPD++KALVN SV FTPR P+   P+E LRA+ GDDYY+CRFQ             PI  
Sbjct  114   RPDRIKALVNTSVAFTPRFPQLLNPVENLRAIIGDDYYVCRFQG------------PIEH  161

Query  750   RSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFL  929
              ++ A   ++                    LR ++                         
Sbjct  162   EAQFAGVNTASL------------------LRSIY-------------------------  178

Query  930   TYYNPSPLYLPKK---GKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDL  1100
             T  +P P  +PK      LF  S   LPSWLS+ D+DY+ +KF++TGFTGG+NYYR L  
Sbjct  179   TARDPKPPRIPKNIAYESLFPDSLCSLPSWLSEEDIDYFATKFKQTGFTGGLNYYRNLKS  238

Query  1101  DWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGH  1280
              WEL A WTG +V VPVKFIVGDLD  YN PG KEY++ GG K DVPLLEEVV++EGV H
Sbjct  239   TWELMAPWTGQQVKVPVKFIVGDLDTAYNLPGVKEYVNNGGFKNDVPLLEEVVIMEGVAH  298

Query  1281  FIHEEKPHEINTHILNFLHNF  1343
             FI +EK  EI+ HI +F+  F
Sbjct  299   FIIQEKAQEISQHIYDFIKKF  319



>gb|KHN43314.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   333 bits (855),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 177/375 (47%), Positives = 234/375 (62%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI H +V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L+S GYRAVAPDLR
Sbjct  1     MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   S +   H+VGDLVAL+  +    ++VF+V HDWGA++ W LC++RPD
Sbjct  61    GYGDTEAPPSI--SSYNCFHIVGDLVALIDSLGV--QQVFLVAHDWGAIIGWYLCMFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKA V +SV    R+P  + ++ +RA+YGDDYY+                         
Sbjct  117   KVKAYVCLSVPLLRRDPNIRTVDGMRALYGDDYYV-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E + A +GT+ VL+  LT  N
Sbjct  152   ---------CRF---------------------QKPGEMEAQMAEVGTEYVLENILTTRN  181

Query  942   PSPLYLPKKGKLFEGST-DDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  LPK    F     + LPSWL++ D+ YY SKFEKTGFTG +NYYR  +L+WEL+A
Sbjct  182   PGPPILPKGRFQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNWELTA  241

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVK+I G+LD+ YN+   KEYIH GG K+DVP LE+V+V +GV HF ++E 
Sbjct  242   PWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNNQEA  301

Query  1299  PHEINTHILNFLHNF  1343
               EI+ +I +F++ F
Sbjct  302   AEEIDNYIYDFINKF  316



>ref|XP_003566463.1| PREDICTED: bifunctional epoxide hydrolase 2 [Brachypodium distachyon]
Length=322

 Score =   333 bits (855),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 234/378 (62%), Gaps = 64/378 (17%)
 Frame = +3

Query  225   EGIEHISVSV-NGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             EG+ H +V V  G+ +HVA++G   GP VL LHGFP+ WY WRHQM  LA++G+RAVAPD
Sbjct  4     EGVRHRTVEVARGVRLHVAESGPEDGPAVLLLHGFPDLWYGWRHQMAALAARGFRAVAPD  63

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             LRGYGD+   P  D   +T+ HVVGDLVAL++ +A  + +VFV GHDWGA++AW LCL R
Sbjct  64    LRGYGDSDAPP--DAGSYTTFHVVGDLVALIADLA--QPQVFVAGHDWGAIVAWQLCLLR  119

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD V+ALVN+SV + PR  +  PLE +RA+ G+D+Y+C FQK  V               
Sbjct  120   PDLVRALVNLSVVYHPRRSEGSPLEAVRALCGEDHYMCHFQKPGVAE-------------  166

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                                   ++    +R LF             VLG +K        
Sbjct  167   ---------------------AEFALPDMRHLFK-----------KVLGMRKA-------  187

Query  936   YNPSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
                +PL LPK    F+    D   P+WLS+ D+ YY  KFEKTGFTGG NYYR +D +WE
Sbjct  188   ---APLILPKDKTFFDSLDSDGTCPAWLSEEDISYYADKFEKTGFTGGFNYYRCMDKNWE  244

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             LSA WTGA + VP KFIVGDLD+TYN PG K+YIHKGGLK  VP LE++V++EGVGHFI+
Sbjct  245   LSAPWTGAPIKVPTKFIVGDLDLTYNTPGVKDYIHKGGLKAMVPNLEDLVIMEGVGHFIN  304

Query  1290  EEKPHEINTHILNFLHNF  1343
             +EKP+E++ HI  F   F
Sbjct  305   QEKPNEVSDHICEFFSKF  322



>ref|XP_006299381.1| hypothetical protein CARUB_v10015540mg [Capsella rubella]
 gb|EOA32279.1| hypothetical protein CARUB_v10015540mg [Capsella rubella]
Length=328

 Score =   334 bits (856),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 184/376 (49%), Positives = 241/376 (64%), Gaps = 63/376 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG--QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGI+H  VSVNGI++HVA+ G  +GPVVL LHGFP+ WYTWRHQ+  L+S GYRAVAPD
Sbjct  1     MEGIDHRMVSVNGITLHVAEKGPKEGPVVLLLHGFPDLWYTWRHQITGLSSLGYRAVAPD  60

Query  396   LRGYGDTTGAPTDDP---SKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALC  566
             LRGYGD+     D P   S++T L+VVGDL++LL  + A +  VF+VGHDWGA++ W LC
Sbjct  61    LRGYGDS-----DSPESFSEYTCLNVVGDLISLLDTLFAGD--VFLVGHDWGAIIGWHLC  113

Query  567   LYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIG  746
             L+RP+K+K  V +SV + PRNPK KP++  +AV+GDDYYICRFQ+               
Sbjct  114   LFRPEKIKGFVCLSVPYKPRNPKVKPVQGFKAVFGDDYYICRFQEPG-------------  160

Query  747   RRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCF  926
              + EG  ++      RF              LR +F+ +           LG   + +  
Sbjct  161   -KIEGEIASDP---RRF--------------LRSIFTGR----------TLGPPILPKND  192

Query  927   LTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
                 NP P Y           + +LP W SK D+D+YTSKF+KTGFTGG+NYYRA+DL+W
Sbjct  193   PFAENPKPDY----------ESIELPKWFSKEDLDFYTSKFDKTGFTGGLNYYRAMDLNW  242

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL+A WTGAK+ VPVKF+ GD D+ Y  PG KEYIH GG   DVP L+E+VV+E  GHF+
Sbjct  243   ELTAPWTGAKIQVPVKFMTGDFDMVYTTPGIKEYIHGGGFAADVPNLQEIVVIEDAGHFV  302

Query  1287  HEEKPHEINTHILNFL  1334
             ++EKP E+  HI +F 
Sbjct  303   NQEKPREVTAHINDFF  318



>gb|EPS62395.1| hypothetical protein M569_12392 [Genlisea aurea]
Length=318

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/377 (47%), Positives = 230/377 (61%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I H ++  NGI++HVA+ G GP VLFLHGFP  WYTWRHQM FL+S+GYRA+APDLR
Sbjct  1     MESIRHSTIPTNGINLHVAEIGDGPAVLFLHGFPGLWYTWRHQMLFLSSKGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYG +   P+  PS +T  HVVGDLV LL  +  D  KVF+VGHDWG+++AW   L+RPD
Sbjct  61    GYGGSDVPPS--PSSYTIFHVVGDLVGLLDGLGVD--KVFLVGHDWGSIVAWYFSLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALV+ S+ F PR+P  + ++ LR   GDD+YI +FQ+  +              +E 
Sbjct  117   RVKALVSTSIEFKPRHPAVRTVDFLRQKLGDDFYIVKFQEPGL--------------AEA  162

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
               +A+   +                                         +L    T  +
Sbjct  163   EFAAADTSK-----------------------------------------LLTKIFTSRD  181

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
             P+P    K    F    +D   LP WLS++DV YY   F+KTGFTGG+N++RALDL+WEL
Sbjct  182   PNPPRRSKGSAGFGTLPEDPIPLPPWLSEDDVKYYADAFDKTGFTGGLNHFRALDLNWEL  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +  WT A+V VP K IVGDLDI+YN PG KEY+H GG KRDVPLL EVVVL+GV HF++E
Sbjct  242   TGPWTAAEVGVPAKLIVGDLDISYNTPGVKEYVHGGGFKRDVPLLHEVVVLDGVAHFLNE  301

Query  1293  EKPHEINTHILNFLHNF  1343
             E PHE+N HI NF+  F
Sbjct  302   ESPHEVNRHIYNFIAKF  318



>ref|XP_010684348.1| PREDICTED: bifunctional epoxide hydrolase 2 [Beta vulgaris subsp. 
vulgaris]
Length=319

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/379 (47%), Positives = 237/379 (63%), Gaps = 65/379 (17%)
 Frame = +3

Query  222   MEGIEHISVSVN-GISMHVAQTGQGP--VVLFLHGFPECWYTWRHQMCFLASQGYRAVAP  392
             M+ IEH ++ +N GI+MH+A+ G+     +L LHGFPE WYTWRHQ+  L++ GYRA+AP
Sbjct  1     MDKIEHRNILLNNGINMHIAEIGEAKKGTILLLHGFPELWYTWRHQLLSLSAAGYRALAP  60

Query  393   DLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLY  572
             DLRGYGDT   P  +   +TS HVVGDL++L+     D+  +F+VGHDWGA++AW   L+
Sbjct  61    DLRGYGDTDAPPCAE--SYTSFHVVGDLISLIDHFHIDQ--IFLVGHDWGAIIAWHFSLF  116

Query  573   RPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRR  752
             RPD++KALVN+SV FTPRNP  KP+E LR   GDD+YI                      
Sbjct  117   RPDRIKALVNLSVPFTPRNPTLKPVERLRNSLGDDFYI----------------------  154

Query  753   SEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLT  932
                         CRF                     QE GE+E E   + T K+++ FL 
Sbjct  155   ------------CRF---------------------QEPGEMEKELDSIDTAKLMKKFLV  181

Query  933   YYNPSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDW  1106
               +P P   PK GKL   +     LPSWLS+ D++Y+  KF++TGFTGG+NYYR++DL W
Sbjct  182   SRDPEPPCFPK-GKLAAAAEKPVTLPSWLSEEDINYFADKFKQTGFTGGLNYYRSMDLTW  240

Query  1107  ELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFI  1286
             EL A WTG +V VP KFI+G+LDITY  P  K YIH GG+KRDVPLL++VV++EG  HFI
Sbjct  241   ELMAPWTGMQVKVPTKFILGELDITYRFPLTKNYIHNGGMKRDVPLLDDVVIMEGAAHFI  300

Query  1287  HEEKPHEINTHILNFLHNF  1343
             ++E+P EI+ HIL++   F
Sbjct  301   NQERPEEISKHILDYFDQF  319



>ref|XP_008454330.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=316

 Score =   332 bits (850),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 183/374 (49%), Positives = 235/374 (63%), Gaps = 58/374 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +++ NGI+MH+A  G GPVVL LHGFPE WY+WRHQ+ +L+S GYRA+APDLR
Sbjct  1     MEAIEHTTINTNGINMHIASIGTGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT  AP +  + +T  H+VGDLV  L  +    EKVFVVGHDWGA++AW LCL+RPD
Sbjct  61    GFGDTD-AP-ESHTVYTPFHIVGDLVGALDELGI--EKVFVVGHDWGAIIAWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKALVN+SV F  RNP    ++  R  +GDD+YICRFQ   V  +  K          G
Sbjct  117   RVKALVNLSVHFLRRNPTISFVQGFRIAFGDDFYICRFQ---VPGEAEKDF--------G  165

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             +   +       +++   LC              +   +  EF +               
Sbjct  166   SIDTA-------ELFKKFLCGRS----------PDPPILPKEFGIRSI------------  196

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSAA  1121
             PSP  LP              SWLS+ D++Y+ +KF +TGFTGG NYYRALDL WEL+A+
Sbjct  197   PSPQNLP--------------SWLSQEDINYFATKFNRTGFTGGFNYYRALDLTWELTAS  242

Query  1122  WTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEKP  1301
             W  A+V VPVKFIVGDLD+TY+ PGAKEYIH GG K DVP LEEVVV+E   HFI++E+P
Sbjct  243   WNKAQVQVPVKFIVGDLDLTYHFPGAKEYIHNGGFKTDVPFLEEVVVMEDTAHFINQERP  302

Query  1302  HEINTHILNFLHNF  1343
             HEI+ HI +F+  F
Sbjct  303   HEISAHIHDFIKKF  316



>emb|CAA55294.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   332 bits (852),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 176/375 (47%), Positives = 234/375 (62%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H +V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L+S GYRAVAPDLR
Sbjct  26    MEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  85

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   S +   H+VGDLVAL+  +    ++VF+V HDWGA++ W LC++RPD
Sbjct  86    GYGDTEAPPSI--SSYNCFHIVGDLVALIDSLGV--QQVFLVAHDWGAIIGWYLCMFRPD  141

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKA V +SV    R+P  + ++ +RA+YGDDYY+                         
Sbjct  142   KVKAYVCLSVPLLRRDPNIRTVDGMRALYGDDYYV-------------------------  176

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E + A +GT+ VL+  LT  N
Sbjct  177   ---------CRF---------------------QKPGEMEAQMAEVGTEYVLENILTTRN  206

Query  942   PSPLYLPKKGKLFEGST-DDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  LPK    F     + LPSWL++ D+ YY SKFEKTGFTG +NYYR  +L+WEL+A
Sbjct  207   PGPPILPKGRFQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNWELTA  266

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVK+I G+LD+ YN+   KEYIH GG K+DVP LE+V+V +GV HF ++E 
Sbjct  267   PWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNNQEA  326

Query  1299  PHEINTHILNFLHNF  1343
               EI+ +I +F++ F
Sbjct  327   AEEIDNYIYDFINKF  341



>ref|XP_010548981.1| PREDICTED: bifunctional epoxide hydrolase 2 [Tarenaya hassleriana]
Length=331

 Score =   332 bits (851),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 189/387 (49%), Positives = 236/387 (61%), Gaps = 76/387 (20%)
 Frame = +3

Query  231   IEHISVSVNGISMHVAQ-------TGQG--------PVVLFLHGFPECWYTWRHQMCFLA  365
              +H  + VNGI+MH A+        G+G        PV+LF+HGFPE WY+WRHQM  L+
Sbjct  5     FQHKFIKVNGINMHFAEKSPSPAAAGEGDFGGIRGPPVILFIHGFPELWYSWRHQMTALS  64

Query  366   SQGYRAVAPDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGA  545
             + GYR +APDLRGYGDT  AP +    +T LHVVGDL+ L+  +  + EKVFVVGHDWGA
Sbjct  65    ALGYRTIAPDLRGYGDTD-AP-ESVGAYTGLHVVGDLIGLIDAIVGEREKVFVVGHDWGA  122

Query  546   MMAWALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQIN  725
             ++AW LCL RPD+V+ALVNMSV F P NPK KP+ T + +YGDDYYICRFQ+        
Sbjct  123   IIAWQLCLLRPDRVRALVNMSVVFDPWNPKRKPIPTWKHLYGDDYYICRFQEY-------  175

Query  726   KKLHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGT  905
                        GA  A                                     EFA +GT
Sbjct  176   -----------GAIEA-------------------------------------EFAKMGT  187

Query  906   KKVLQCFLTYYNPSPLYLPK-KGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINY  1082
             ++ L  FLTY NPSPL LPK KG     S    PSWLS  D+ YY SK+EK GFTG +NY
Sbjct  188   ERALMEFLTYRNPSPLRLPKGKGYSVHLSR---PSWLSDYDLQYYVSKYEKKGFTGPLNY  244

Query  1083  YRALDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvv  1262
             YR +D  WEL A  + A+V VPVKFI+GD D+TY+  G K+YIH G  K +VPLL++VVV
Sbjct  245   YRNMDRTWELMAPLSKAEVKVPVKFIIGDQDLTYHLHGVKDYIHGGRFKANVPLLDQVVV  304

Query  1263  leGVGHFIHEEKPHEINTHILNFLHNF  1343
             LEGVGHF+HEE+P +I+ HI ++   F
Sbjct  305   LEGVGHFLHEERPDDISKHIHDYFLTF  331



>ref|NP_001238563.1| epoxide hydrolase [Glycine max]
 dbj|BAA09852.1| Epoxide hydrolase [Glycine max]
 emb|CAA55293.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   332 bits (851),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 176/375 (47%), Positives = 234/375 (62%), Gaps = 60/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H +V VNGI MHVA+ G+GPVVLFLHGFPE WY+WRHQ+  L+S GYRAVAPDLR
Sbjct  26    MEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  85

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   S +   H+VGDLVAL+  +    ++VF+V HDWGA++ W LC++RPD
Sbjct  86    GYGDTEAPPSI--SSYNCFHIVGDLVALIDSLGV--QQVFLVAHDWGAIIGWYLCMFRPD  141

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKA V +SV    R+P  + ++ +RA+YGDDYY+                         
Sbjct  142   KVKAYVCLSVPLLRRDPNIRTVDGMRALYGDDYYV-------------------------  176

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     Q+ GE+E + A +GT+ VL+  LT  N
Sbjct  177   ---------CRF---------------------QKPGEMEAQMAEVGTEYVLKNILTTRN  206

Query  942   PSPLYLPKKGKLFEGST-DDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
             P P  LPK    F     + LPSWL++ D+ YY SKFEKTGFTG +NYYR  +L+WEL+A
Sbjct  207   PGPPILPKGRFQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNWELTA  266

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG ++ VPVK+I G+LD+ YN+   KEYIH GG K+DVP LE+V+V +GV HF ++E 
Sbjct  267   PWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNNQEA  326

Query  1299  PHEINTHILNFLHNF  1343
               EI+ +I +F++ F
Sbjct  327   AEEIDNYIYDFINKF  341



>ref|XP_002868171.1| hypothetical protein ARALYDRAFT_329917 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44430.1| hypothetical protein ARALYDRAFT_329917 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   338 bits (867),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 240/377 (64%), Gaps = 68/377 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQ-----TGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAV  386
             ++G+EH ++ VNGI+MHVA+     +G+ P++LF+HGFPE WYTWRHQM  L+S GYR +
Sbjct  51    LDGVEHKTLKVNGINMHVAEKPGSGSGEDPIILFIHGFPELWYTWRHQMTALSSLGYRTI  110

Query  387   APDLRGYGDT-TGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWAL  563
             APDLRGYGDT T    +D   +T L+VVGD+VAL+  V   ++ VFVVGHDWGAM+AW L
Sbjct  111   APDLRGYGDTETPERVED---YTYLNVVGDMVALIDAVTGGDKAVFVVGHDWGAMIAWQL  167

Query  564   CLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPI  743
             CLYRP+KVKALVNMSV F+PRNP   P+ TLR V+ +DYYICRFQK     +I  +   I
Sbjct  168   CLYRPEKVKALVNMSVLFSPRNPDRVPVPTLRHVFNNDYYICRFQK---PGEIEAEFKNI  224

Query  744   GRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQC  923
             G                            E  L+   +++  G +               
Sbjct  225   G---------------------------TENVLKEFLTYKTPGPL---------------  242

Query  924   FLTYYNPSPLYLPKKG--KLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALD  1097
                       YLPK    K  E +   LP WL++ D+DYY +K++K GFTG INYYR +D
Sbjct  243   ----------YLPKDKYFKRAENAAFALPPWLTQEDLDYYVTKYDKKGFTGPINYYRNID  292

Query  1098  LDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVG  1277
              +WEL+A WTGAK+ VPVKFIVGD D+TYN+PGAKEYI+ GG  RDVPLL+E VV++ +G
Sbjct  293   RNWELTAPWTGAKIHVPVKFIVGDQDLTYNSPGAKEYINGGGFNRDVPLLDETVVIKALG  352

Query  1278  HFIHEEKP--HEINTHI  1322
             HF+HEE P  + IN H+
Sbjct  353   HFLHEENPDVNGINMHV  369


 Score =   213 bits (541),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 118/163 (72%), Gaps = 15/163 (9%)
 Frame = +3

Query  249  SVNGISMHVAQ-----TGQG--------PVVLFLHGFPECWYTWRHQMCFLASQGYRAVA  389
             VNGI+MHVA+      G G        PV+LFLHGFPE WYTWRHQM  L+S GYR +A
Sbjct  361  DVNGINMHVAEKYPSVAGNGAFDGAIRPPVILFLHGFPELWYTWRHQMVALSSLGYRTIA  420

Query  390  PDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCL  569
            PDLRGYGDT    + D   +TSLHVVGDL+ L+  V  D EKVFVVGHDWGA++AW LCL
Sbjct  421  PDLRGYGDTDAPESVD--AYTSLHVVGDLIGLIDAVVGDREKVFVVGHDWGAIIAWHLCL  478

Query  570  YRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQ  698
             RPD+VKALVNMSV F P NPK KP+   ++ YGDDYYICRFQ
Sbjct  479  LRPDRVKALVNMSVVFDPWNPKRKPISLFKSFYGDDYYICRFQ  521



>ref|XP_010434903.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=331

 Score =   332 bits (850),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 234/384 (61%), Gaps = 73/384 (19%)
 Frame = +3

Query  234   EHISVSVNGISMHVAQ-----TGQG---------PVVLFLHGFPECWYTWRHQMCFLASQ  371
             +H  V VNGI+MHVA+     +G G         PV+LFLHGFPE WYTWRHQM  L+S 
Sbjct  7     DHSFVKVNGITMHVAEKSPCVSGNGAFDGVIYRHPVILFLHGFPELWYTWRHQMVALSSL  66

Query  372   GYRAVAPDLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMM  551
             GYR +APDLRGYGDT    + D   +TSLHVVGDL+ L+  V    EKVFVVGHDWGA++
Sbjct  67    GYRTIAPDLRGYGDTDAPESVD--AYTSLHVVGDLIGLIDAVVGAGEKVFVVGHDWGAII  124

Query  552   AWALCLYRPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKK  731
             AW L L RPD+V+ALVNMSV F P NP  KP+   R+ YGDDYYICRFQ           
Sbjct  125   AWHLSLLRPDRVRALVNMSVVFDPWNPMRKPISMFRSFYGDDYYICRFQ-----------  173

Query  732   LHPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKK  911
                               +C             EI+  F              A  GT++
Sbjct  174   ------------------EC------------GEIEAEF--------------AKAGTER  189

Query  912   VLQCFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRA  1091
              L  FLTY +P P+ LP KGK ++     LPSWL+  DV YY SK+EK GFTG +NYYR 
Sbjct  190   SLLEFLTYRSPGPILLP-KGKSYDDPI-SLPSWLTDCDVKYYVSKYEKNGFTGPVNYYRN  247

Query  1092  LDLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleG  1271
             +D  WEL  + + A+V VPVKF++GD D+TY+ PG K+YIH G  K  VPLL+EVVV+EG
Sbjct  248   MDRTWELMGSLSKAQVKVPVKFVIGDQDLTYHIPGTKKYIHDGRFKSHVPLLDEVVVIEG  307

Query  1272  VGHFIHEEKPHEINTHILNFLHNF  1343
             VGHF+HEE+P EI+ HI ++  +F
Sbjct  308   VGHFLHEERPDEISKHIHDYFGSF  331



>ref|XP_002306333.2| hypothetical protein POPTR_0005s08280g [Populus trichocarpa]
 gb|EEE93329.2| hypothetical protein POPTR_0005s08280g [Populus trichocarpa]
Length=349

 Score =   332 bits (851),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 235/374 (63%), Gaps = 61/374 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ IEHI+V+ NGI+MHVA  G GPV+LFLHGFPE WY+WRHQ+  L+S GYR VAPDLR
Sbjct  1     MDKIEHITVATNGINMHVASIGTGPVILFLHGFPELWYSWRHQLLHLSSLGYRCVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP +  S++T LHVVGDL+ LL     D+  VF+VGHDWGAM+AW LCL RPD
Sbjct  61    GYGDTD-AP-ESASQYTGLHVVGDLIGLLDSFGIDQ--VFLVGHDWGAMIAWYLCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKS-KPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             +V+ALVN++V F  R+PK+  P+E L+++YG+DYY                         
Sbjct  117   RVRALVNLNVAFMARDPKTINPMEVLKSIYGEDYYA------------------------  152

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                 C+++E            GEIE +FA + T K+L+ F + +
Sbjct  153   --------------------CRFQE---------PGPGEIEKDFAQVATAKMLRIFFSSF  183

Query  939   NPSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
              P PL +PK+   F G  D   LP   S+ D+D+Y +KF + GFTG +NYYRA++  W+L
Sbjct  184   GPRPLIVPKETG-FRGIPDPPCLPLGFSEEDIDFYANKFNQKGFTGALNYYRAINQTWDL  242

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
              A W G K+ VPVKFI+GD DI Y+ PG KEYI  GG K+DVP LEEVVV+ GV HF ++
Sbjct  243   MAPWIGVKIQVPVKFIIGDQDINYHLPGLKEYILNGGFKKDVPRLEEVVVMGGVAHFPNQ  302

Query  1293  EKPHEINTHILNFL  1334
              +P E++ HI +F 
Sbjct  303   ARPEEVSEHIYSFF  316



>gb|AES82458.2| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 187/375 (50%), Positives = 233/375 (62%), Gaps = 57/375 (15%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG-QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDL  398
             MEGIEH +V VNGI MH+A+ G +GPVVLFLHGFPE WY+WRHQ+  L S GYRAVAPDL
Sbjct  1     MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  399   RGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRP  578
             RGYGDT  AP    S +T  H+VGD+VAL+  +  D+  VF+V HDWGAM+ W LCL+RP
Sbjct  61    RGYGDTD-APASI-SSYTIFHLVGDIVALIDSLGVDQ--VFLVAHDWGAMIGWYLCLFRP  116

Query  579   DKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSE  758
             +K+KA V +SV + PRNPK KP++ +RA++GDDYYICRFQ+            P    SE
Sbjct  117   EKIKAYVCLSVPYLPRNPKMKPVDGMRALFGDDYYICRFQE------------PGKMESE  164

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
              A                LL K        L S   G  I  +  V+             
Sbjct  165   FAKGGPE-----------LLIK------NMLTSRNSGPPILPKEGVI-------------  194

Query  939   NPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
              P+P             T  LPSWLS+ D+ YY SKFEKTGF+G +NYYR L+L+WEL+A
Sbjct  195   -PNP---------HASGTKALPSWLSQEDITYYASKFEKTGFSGALNYYRNLNLNWELTA  244

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
             AWT AK+ VPVKFI GDLD  Y + G K+YI  GG K+DVP LEEVV+ EGV HF ++E 
Sbjct  245   AWTAAKIKVPVKFITGDLDAVYTSFGTKQYIESGGFKKDVPNLEEVVIQEGVAHFNNQEA  304

Query  1299  PHEINTHILNFLHNF  1343
               +I+ HI +F+  F
Sbjct  305   AEDISNHIYDFIKKF  319



>ref|XP_006472971.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=571

 Score =   339 bits (870),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 239/376 (64%), Gaps = 61/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME I+H  V VNGI MH+A+ G+GPVVLFLHGFPE WYTWR Q+  L+S GYRA+APDLR
Sbjct  1     MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP+   S ++  H+VGDLVAL++ +    E+VFVV HDWGA++AW LCL+ P+
Sbjct  61    GYGDTE-APSSI-SSYSCHHIVGDLVALINSLGV--EQVFVVAHDWGAIIAWYLCLFCPE  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA V +SV F PRNP  KP+E++RA++GDDYYI                         
Sbjct  117   RVKAFVCLSVPFLPRNPNIKPVESMRALFGDDYYI-------------------------  151

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                      CRF                     QE G+IE + A +GT +VL+  L    
Sbjct  152   ---------CRF---------------------QEPGKIEAQIAQVGTAEVLKNILANRK  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P   P++        +   LPSW S+ D+ +Y +KF +TGFTG +NYYRA++L+WE++
Sbjct  182   PGPSCFPEENAFGIDPENRVTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLNWEMT  241

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             AAWT  +V VPVKFIVG+LD+ Y  PG KEY+H GG K+DVPLLEE+VV+E  GHFI++E
Sbjct  242   AAWTEVQVKVPVKFIVGELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHFINQE  301

Query  1296  KPHEINTHILNFLHNF  1343
             +  EIN HI +F+  F
Sbjct  302   RAEEINAHIYDFIKKF  317


 Score =   204 bits (520),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 118/297 (40%), Positives = 171/297 (58%), Gaps = 57/297 (19%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ I+H +V+VNGI +H+A+ G+ PVVLFLHGFPE WY WRHQ+  L+  GYRAVAPDLR
Sbjct  321   MDEIKHSTVNVNGIKIHIAEKGEVPVVLFLHGFPEFWYAWRHQILALSCLGYRAVAPDLR  380

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT   P+   + +T  HV GD++AL+  +    E+VFVV HD+GA++AW LCL+RP+
Sbjct  381   GYGDTE-VPSSSFTSYTCFHVAGDIIALIDFLGV--EQVFVVAHDFGAIIAWHLCLFRPE  437

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VK+ V++ + + P +P  KP+ETLRA+YGD++YIC+FQ+  V   +   +  IG +   
Sbjct  438   RVKSFVSLGMPYLPTDPNLKPVETLRAMYGDNFYICKFQEPGV---LEAGIAHIGSKLML  494

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A S                          L + + G  I  E A+    +          
Sbjct  495   ASS--------------------------LTTRRPGPPIISEDAIAHLAR----------  518

Query  942   PSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
                + LP     F  S ++   +++K D         +TGFTGG+NYYRA+DL+  L
Sbjct  519   -ETINLP-----FWLSEEEFNYYVTKFD---------QTGFTGGLNYYRAIDLNLLL  560



>gb|EYU42194.1| hypothetical protein MIMGU_mgv1a010473mg [Erythranthe guttata]
Length=311

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/344 (51%), Positives = 217/344 (63%), Gaps = 62/344 (18%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQ--GPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPD  395
             MEGIEH +VSVNGI+MH+A+ G   GPVVLFLHGFPE WYTWRHQ+   A+ GYRAVAPD
Sbjct  3     MEGIEHRTVSVNGINMHLAEKGGEGGPVVLFLHGFPELWYTWRHQLTAFAALGYRAVAPD  62

Query  396   LRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYR  575
             LRGYGD+  AP +  S ++ LHVVGD+VAL+  +      V +V HDWGAM+AW LCL+R
Sbjct  63    LRGYGDSD-APAE-ASSYSCLHVVGDIVALIETLGGGGAPVLLVAHDWGAMIAWYLCLFR  120

Query  576   PDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRS  755
             PD VKA   ++V F PR+PK KP+E +RA +GDDYY+                       
Sbjct  121   PDLVKAFAALTVPFRPRHPKMKPVEGMRAFFGDDYYM-----------------------  157

Query  756   EGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTY  935
                        CRF                     QE G+IE E A  G +KV++  L  
Sbjct  158   -----------CRF---------------------QEPGKIESEIAEYGAEKVIKKILAD  185

Query  936   YNPSPLYLPKKGKLFEGSTDD--LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
              +P    LPK+   F   TDD  LP WLS+ D+++Y  K++K GFTGG+NYYRALDL+WE
Sbjct  186   RSPGLPRLPKENP-FGSKTDDIKLPPWLSQQDLNFYAQKYDKKGFTGGLNYYRALDLNWE  244

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVP  1241
             L+AAWTGAKV VPVKFIVGD+D+ YN PG KEY+H GG K DVP
Sbjct  245   LTAAWTGAKVKVPVKFIVGDIDMVYNTPGVKEYVHGGGFKNDVP  288



>gb|KHG22415.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=317

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/377 (47%), Positives = 237/377 (63%), Gaps = 64/377 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGIEH  V VNG ++H+A+ G+GPV+LFLHGFPE WY+WRHQ+  L+S GYRAVAPDLR
Sbjct  1     MEGIEHRMVKVNGTNIHIAEKGEGPVILFLHGFPELWYSWRHQILALSSMGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+     D    +T  H++GDLV L++VV  DE KVFVVGHDWGA++ W LC++RPD
Sbjct  61    GYGDSD--VPDSVDSYTCFHIIGDLVELINVVDPDEGKVFVVGHDWGAILGWYLCMFRPD  118

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             KVKALVN+SV F   + + KP++   + YG D+Y+ RFQ                     
Sbjct  119   KVKALVNLSVPFLRFHREIKPVDFWISYYGSDHYMSRFQ---------------------  157

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                                 +Y EI              EGEFA +G ++V++ +L+ + 
Sbjct  158   --------------------EYGEI--------------EGEFAEIGVERVVKEYLSDF-  182

Query  942   PSPLYLPKKGKLFEGSTDD---LPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               P+ LP KGKLF+   D+   LP WLS+ +  YY +KF+KTGFTG +N+YR L+ +WEL
Sbjct  183   --PVLLP-KGKLFKRPLDEAITLPFWLSEEEASYYVTKFQKTGFTGPLNFYRNLNRNWEL  239

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
                W G+K+  P KFI+GD D+ Y  PG K+YIH GG + DVP L++VVV+EGVGHFI+ 
Sbjct  240   LKPWVGSKIKTPAKFIMGDKDLVYGVPGMKDYIHNGGFQEDVPSLQQVVVMEGVGHFINM  299

Query  1293  EKPHEINTHILNFLHNF  1343
             EKP EIN +I +F   F
Sbjct  300   EKPDEINQYIYDFFTQF  316



>ref|XP_011015179.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Populus 
euphratica]
Length=316

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/376 (48%), Positives = 232/376 (62%), Gaps = 62/376 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+ IEH +++ NGI+MH+A  G GPVVLFLHGFPE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MDKIEHQTIATNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  AP  +  ++T  H+VGDLV L+  +  D  KVF+VGHDWGA +AW  CL RPD
Sbjct  61    GYGDTD-APK-NAREYTIFHIVGDLVGLIDSLGID--KVFLVGHDWGATVAWYFCLLRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             ++KALVNMSV F PRNP    ++  R ++GDD+YICRFQ+              G   E 
Sbjct  117   RIKALVNMSVVFQPRNPHKSSVQISRELFGDDFYICRFQEP-------------GEVEED  163

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
                  +                  I  RFL                          T  +
Sbjct  164   FAQMDTAS----------------IITRFL--------------------------TSRD  181

Query  942   PSPLYLPKKGKLFEGSTD--DLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELS  1115
             P P  +PK+   F G  D  +LPSWLS+ D++YY  KF +TGFTGG+NY R LDL+WEL 
Sbjct  182   PKPPCIPKEVG-FRGIPDNPNLPSWLSEKDINYYAGKFNQTGFTGGLNYNRCLDLNWELM  240

Query  1116  AAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEE  1295
             AAWTG K+ V  KFIVGD+D TY+ PG KEYI KGGLK+ VP L+EVVV+EGV HF+++E
Sbjct  241   AAWTGLKIKVSAKFIVGDVDPTYHIPGVKEYISKGGLKKYVPFLQEVVVMEGVAHFLNQE  300

Query  1296  KPHEINTHILNFLHNF  1343
             KP E++ HI +F+  F
Sbjct  301   KPEEVSEHIYDFIKKF  316



>ref|XP_002512456.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF49908.1| epoxide hydrolase, putative [Ricinus communis]
Length=317

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 233/375 (62%), Gaps = 59/375 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             MEGI H +V+VNGI MH+A+ G+GPV+LFLHGFPE WYTWRHQ+  L S GYRAVAPDLR
Sbjct  1     MEGIMHKTVNVNGIKMHIAEKGEGPVILFLHGFPELWYTWRHQILGLTSLGYRAVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGD+  APT   S +T  H+VGDL+AL+  +    E+VF+V HDWGA+M W LCL+RPD
Sbjct  61    GYGDSD-APTLC-SSYTCHHIVGDLIALIDHLGV--EQVFLVAHDWGAIMGWYLCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQK-NTVNTQINKKLHPIGRRSE  758
             +VKA V +SV F PRNPK KP+E++R ++GDDYY+CRFQ+   +  +I +          
Sbjct  117   RVKAFVCLSVPFRPRNPKMKPVESMRLLFGDDYYVCRFQEPGEIEAEIAR----------  166

Query  759   GACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYY  938
                                 C   E+  + L   + G                       
Sbjct  167   --------------------CGPAEVIKKILTDRKPG-----------------------  183

Query  939   NPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWELSA  1118
              PS L+      +   +   LPSWL++ DV YY + F + GFTG +NYYRA+DL WEL+A
Sbjct  184   -PSCLFKENAFGICPNNPITLPSWLTEEDVAYYAANFNQKGFTGALNYYRAMDLSWELTA  242

Query  1119  AWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHEEK  1298
              WTG  V VPVKF+VGDLD+ Y  PG KEY+H GG +  VPLLEE+VV+E VGHFI++E+
Sbjct  243   PWTGDSVKVPVKFVVGDLDMVYTTPGIKEYVHGGGFRYYVPLLEEIVVMEEVGHFINQER  302

Query  1299  PHEINTHILNFLHNF  1343
             P EIN  I  F+ N+
Sbjct  303   PEEINKLIYEFIRNY  317



>ref|XP_007031041.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY11543.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=317

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 235/378 (62%), Gaps = 65/378 (17%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             M+GI+H  V+VNGI+MHVA+ GQGPV+LFLHGFPE WYTWRHQ+  L+S GY  VAPDLR
Sbjct  1     MDGIQHRMVNVNGITMHVAEKGQGPVILFLHGFPELWYTWRHQILALSSLGYHTVAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             GYGDT  +     + +T LH+VGDL+AL+  +    E+VF+V HDWGA++ W LC++RPD
Sbjct  61    GYGDTEASTC--VTSYTCLHIVGDLIALIDSLGV--EQVFLVAHDWGAIIGWYLCMFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRRSEG  761
             +VKA V +SV F PR PK KP+E++R ++G+DYYICRFQ+            P    +E 
Sbjct  117   RVKAFVCLSVPFMPRKPKMKPVESMRLLFGEDYYICRFQE------------PGKIEAEI  164

Query  762   ACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLTYYN  941
             A   +S                    L+ + S +E G                       
Sbjct  165   AHVGTSEV------------------LKKVLSTREPG-----------------------  183

Query  942   PSPLYLPKKGKLFEGSTDDLP----SWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWE  1109
               P  LPK      G   D P    SW S+ D+ YY +KF + GFTGG+NYYRALDL+WE
Sbjct  184   --PPRLPKDDAF--GIKPDTPVTLPSWFSEEDLSYYANKFNQKGFTGGLNYYRALDLNWE  239

Query  1110  LSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIH  1289
             L+A WT  +V +PVKFIVGDLD  Y  PG KEY+  GG KRDVPLL+EVVV+EGVGHFI+
Sbjct  240   LTAPWTNVQVKLPVKFIVGDLDTVYTTPGIKEYVQSGGFKRDVPLLDEVVVMEGVGHFIN  299

Query  1290  EEKPHEINTHILNFLHNF  1343
             +E+  EIN+ I +F+  F
Sbjct  300   QERAEEINSLIYDFIKKF  317



>gb|AAM28292.1| epoxide hydrolase [Ananas comosus]
Length=318

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 180/377 (48%), Positives = 233/377 (62%), Gaps = 62/377 (16%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTG---QGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAP  392
             MEGI H +V +NGI++HVA+ G       VL LHGFPE WY+WRHQ+  LA++GYRA+AP
Sbjct  1     MEGIVHRTVEINGIAVHVAEKGGDDAAAAVLLLHGFPELWYSWRHQIVGLAARGYRAIAP  60

Query  393   DLRGYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLY  572
             DLRGYGDT+  P+ +   +T  H+VGD+VALL   A +  +VFVVGHDWGA +AW LC+ 
Sbjct  61    DLRGYGDTSAPPSVN--SYTLFHLVGDVVALLD--ALELPQVFVVGHDWGAAIAWTLCMI  116

Query  573   RPDKVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQKNTVNTQINKKLHPIGRR  752
             RPD+VKALVN SV   PRNP   P+  ++ +YGD+ Y+CRFQ+  V              
Sbjct  117   RPDRVKALVNTSVAHMPRNPSVSPVHQIKHLYGDNIYVCRFQEPGVAE------------  164

Query  753   SEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKVLQCFLT  932
                                    ++ E+  + +                  +K+L    T
Sbjct  165   ----------------------AEFAEVGTKNVL-----------------RKIL----T  181

Query  933   YYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRALDLDWEL  1112
               +P P  L  K     G    LPSWLS+ D+DYY SKFEKTGFTGG+NYYR ++L+WEL
Sbjct  182   MRDPRPSSLTHKDWGSTGEEIALPSWLSEEDLDYYASKFEKTGFTGGMNYYRCMNLNWEL  241

Query  1113  SAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGVGHFIHE  1292
             +A W GAK+ VP KFIVGDLD+TY+ P  ++YIHKGG K +VPLLEEVVVLEGVGHFI +
Sbjct  242   TAPWAGAKIQVPTKFIVGDLDLTYHYPNIQDYIHKGGFKNEVPLLEEVVVLEGVGHFIQQ  301

Query  1293  EKPHEINTHILNFLHNF  1343
             E+  E+  HI NF+  F
Sbjct  302   ERAEEVTDHIYNFIKKF  318



>ref|XP_007200440.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
 emb|CAZ86693.1| epoxide hydrolase 2 [Prunus persica]
 gb|EMJ01639.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
Length=316

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 186/383 (49%), Positives = 236/383 (62%), Gaps = 76/383 (20%)
 Frame = +3

Query  222   MEGIEHISVSVNGISMHVAQTGQGPVVLFLHGFPECWYTWRHQMCFLASQGYRAVAPDLR  401
             ME IEH +VS NGI+MH+A  G GPVVLFLHGFPE WY+WRHQ+  L+S GYR +APDLR
Sbjct  1     MEKIEHTTVSTNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  402   GYGDTTGAPTDDPSKFTSLHVVGDLVALLSVVAADEEKVFVVGHDWGAMMAWALCLYRPD  581
             G+GDT   P+  P+ +++LH+VGDL+ LL  +  D+  VF+VGHDWGA++AW  CL+RPD
Sbjct  61    GFGDTDAPPS--PASYSALHIVGDLIGLLDHLGIDQ--VFLVGHDWGAVIAWWFCLFRPD  116

Query  582   KVKALVNMSVCFTPRNPKSKPLETLRAVYGDDYYICRFQK---------NTVNTQINKKL  734
             +VKALVNMSV F+PRNPK KP++  RA++GDDYYICRFQ+             T I KK 
Sbjct  117   RVKALVNMSVAFSPRNPKRKPVDGFRALFGDDYYICRFQEPGEIEKEFAGYDTTSIMKKF  176

Query  735   HPIGRRSEGACSASSCCQCRFDIWHWLLCKYKEIKLRFLFSWQEGGEIEGEFAVLGTKKV  914
                GR  +  C                    KE+ LR   +W+             T + 
Sbjct  177   L-TGRSPKPPCLP------------------KELGLR---AWK-------------TPET  201

Query  915   LQCFLTYYNPSPLYLPKKGKLFEGSTDDLPSWLSKNDVDYYTSKFEKTGFTGGINYYRAL  1094
             L  +L                   S +DL  + SK         F KTGF GG+NYYRAL
Sbjct  202   LPPWL-------------------SEEDLNYFASK---------FSKTGFVGGLNYYRAL  233

Query  1095  DLDWELSAAWTGAKVMVPVKFIVGDLDITYNAPGAKEYIHKGGLKRDVPlleevvvleGV  1274
             +L WEL+  WTG +V VPVKFIVGDLDITY+ PG K YIH GG KRDVP L+EVVV+E  
Sbjct  234   NLTWELTGPWTGLQVKVPVKFIVGDLDITYHIPGVKNYIHNGGFKRDVPFLQEVVVIEDG  293

Query  1275  GHFIHEEKPHEINTHILNFLHNF  1343
              HFI++E+P EI+ H+ +F+  F
Sbjct  294   AHFINQERPDEISRHVYDFIQKF  316



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4419639871620