BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18774_g1_i1 len=1280 path=[1921:0-69 1991:70-300 5:301-362
2630:363-399 104:400-1279]

Length=1280
                                                                      Score     E

ref|XP_009788128.1|  PREDICTED: MADS-box protein CMB1-like              417   4e-142   
gb|AAF22138.1|AF129875_1  MADS box transcription factor MADS1           409   2e-138   Capsicum annuum
ref|NP_001234380.1|  MADS-box protein 1                                 407   4e-138   
ref|XP_006345102.1|  PREDICTED: MADS-box protein CMB1-like              405   3e-137   
gb|AAK21254.1|AF335241_1  MADS-box transcription factor FBP23           401   2e-135   Petunia x hybrida [garden petunia]
gb|AAK21249.1|AF335236_1  MADS-box transcription factor FBP9            387   4e-130   Petunia x hybrida [garden petunia]
ref|XP_009761698.1|  PREDICTED: MADS-box protein CMB1-like              382   4e-128   
ref|XP_010257958.1|  PREDICTED: developmental protein SEPALLATA 1       378   2e-126   
gb|AAF76381.1|AF068723_1  MADS-box protein MADS4                        377   3e-126   Nicotiana tabacum [American tobacco]
ref|XP_009598871.1|  PREDICTED: MADS-box protein CMB1-like              377   4e-126   
ref|XP_010318407.1|  PREDICTED: MADS-box protein 1 isoform X1           375   2e-125   
gb|ADU15479.1|  SEP4                                                    369   7e-123   
ref|XP_010260833.1|  PREDICTED: MADS-box protein CMB1                   368   9e-123   
gb|ADR83588.1|  Sepallata 1-like protein                                359   3e-119   
ref|XP_004299281.1|  PREDICTED: MADS-box protein CMB1-like              358   1e-118   
gb|AEW50208.1|  SEP1                                                    357   3e-118   
ref|XP_006354102.1|  PREDICTED: MADS-box protein CMB1-like              357   4e-118   
gb|AGW23594.1|  MADS1                                                   353   2e-116   
ref|XP_008240082.1|  PREDICTED: MADS-box protein CMB1-like              351   7e-116   
ref|NP_001275579.1|  MADS-box protein CMB1-like                         348   8e-115   
ref|XP_007209505.1|  hypothetical protein PRUPE_ppa010391mg             348   9e-115   
gb|AIU94287.1|  SEPALLATA1-like protein                                 347   2e-114   
gb|ADD25190.1|  SEP1                                                    347   2e-114   Nelumbo nucifera [Indian lotus]
gb|ADC79693.1|  SEPALLATA1-like protein                                 346   4e-114   Akebia trifoliata
emb|CAX65570.1|  GRCD4 protein                                          346   6e-114   Gerbera hybrid cultivar
gb|AFX72877.1|  MADS-box protein SEP2A                                  346   7e-114   
gb|KCW48935.1|  hypothetical protein EUGRSUZ_K02546                     344   3e-113   
gb|ADC79707.1|  SEPALLATA1-like protein                                 344   3e-113   Euptelea pleiosperma
ref|XP_007037631.1|  K-box region and MADS-box transcription fact...    349   6e-113   
dbj|BAM71399.1|  transcription factor                                   341   4e-112   
gb|AAD09206.1|  putative MADS-box family transcription factor           340   8e-112   Pinus radiata
ref|XP_009337956.1|  PREDICTED: MADS-box protein CMB1-like              340   9e-112   
gb|AJC01940.1|  MADS-box protein                                        340   1e-111   
gb|KHG12954.1|  MADS-box CMB1                                           340   2e-111   
ref|XP_002263039.1|  PREDICTED: MADS-box protein CMB1 isoform X2        339   4e-111   Vitis vinifera
ref|XP_006477714.1|  PREDICTED: developmental protein SEPALLATA 1...    338   5e-111   
ref|XP_010660492.1|  PREDICTED: MADS-box protein 2 isoform X1           337   1e-110   
gb|AGW23350.1|  MADS box protein MADS48                                 338   1e-110   
ref|XP_006440806.1|  hypothetical protein CICLE_v10021357mg             339   1e-110   
gb|ADC79694.1|  SEPALLATA1-like protein                                 337   2e-110   Akebia trifoliata
ref|XP_007155209.1|  hypothetical protein PHAVU_003G182800g             336   4e-110   
emb|CAA04323.1|  MADS-box protein                                       336   5e-110   Malus domestica [apple tree]
ref|NP_001281016.1|  MADS-box protein CMB1-like                         336   6e-110   
ref|XP_008811037.1|  PREDICTED: agamous-like MADS-box protein AGL...    335   6e-110   
ref|NP_001268109.1|  MADS-box protein 2                                 335   1e-109   
gb|AFO68782.1|  floral-binding protein 9                                333   3e-109   
ref|XP_006477713.1|  PREDICTED: developmental protein SEPALLATA 1...    334   3e-109   
gb|KHN15201.1|  MADS-box protein CMB1                                   333   6e-109   
ref|XP_002263410.2|  PREDICTED: MADS-box protein CMB1                   333   8e-109   Vitis vinifera
ref|XP_007215876.1|  hypothetical protein PRUPE_ppa010548mg             333   8e-109   
ref|XP_006440804.1|  hypothetical protein CICLE_v10021357mg             335   9e-109   
ref|XP_007032865.1|  K-box region and MADS-box transcription fact...    332   9e-109   
gb|AEJ76841.1|  MADS17                                                  332   2e-108   
ref|NP_001289642.1|  developmental protein SEPALLATA 1-like             332   2e-108   
gb|AFM30904.1|  transcription factor MADS4                              332   3e-108   
gb|AAP83390.1|  SEPALLATA1-like MADS-box                                331   4e-108   Pachysandra terminalis
ref|XP_008811035.1|  PREDICTED: agamous-like MADS-box protein AGL...    331   4e-108   
ref|XP_008230292.1|  PREDICTED: developmental protein SEPALLATA 1...    331   5e-108   
ref|XP_008811034.1|  PREDICTED: agamous-like MADS-box protein AGL...    331   6e-108   
ref|XP_008811033.1|  PREDICTED: agamous-like MADS-box protein AGL...    330   7e-108   
gb|KHG17252.1|  Developmental SEPALLATA 2 -like protein                 330   8e-108   
dbj|BAC80255.1|  MADS-box transcription factor                          330   9e-108   Houttuynia cordata [chameleon-plant]
ref|NP_001242365.1|  uncharacterized protein LOC100797819               330   1e-107   
ref|XP_006477712.1|  PREDICTED: developmental protein SEPALLATA 1...    329   3e-107   
ref|XP_011021072.1|  PREDICTED: developmental protein SEPALLATA 2...    328   4e-107   
ref|XP_007139420.1|  hypothetical protein PHAVU_008G027900g             328   4e-107   
ref|XP_007215877.1|  hypothetical protein PRUPE_ppa010548mg             328   4e-107   
gb|AHM92083.1|  MADS-box protein 7                                      328   5e-107   
ref|XP_010663486.1|  PREDICTED: MADS-box protein CMB1 isoform X1        328   6e-107   
emb|CAN84110.1|  hypothetical protein VITISV_036170                     328   7e-107   Vitis vinifera
gb|KDP24297.1|  hypothetical protein JCGZ_25593                         328   7e-107   
gb|KCW83762.1|  hypothetical protein EUGRSUZ_B00633                     328   8e-107   
ref|XP_010936438.1|  PREDICTED: agamous-like MADS-box protein AGL...    328   8e-107   
ref|XP_008230291.1|  PREDICTED: developmental protein SEPALLATA 1...    328   9e-107   
gb|ACD39982.1|  MADS1                                                   327   9e-107   Carica papaya [mamon]
ref|XP_006482430.1|  PREDICTED: developmental protein SEPALLATA 1...    327   1e-106   
ref|XP_011014957.1|  PREDICTED: developmental protein SEPALLATA 2...    327   2e-106   
ref|XP_008230290.1|  PREDICTED: developmental protein SEPALLATA 1...    326   3e-106   
gb|AGW23364.1|  MADS box protein MADS62                                 326   5e-106   
gb|AAX15922.1|  AGL2                                                    325   6e-106   Acorus americanus [sweetflag]
gb|AAC25922.1|  MADS-box protein 1                                      325   6e-106   Malus domestica [apple tree]
gb|AFS60086.1|  MADS box transcription factor SEP1                      325   6e-106   
gb|AAY30858.1|  MADS-box transcription factor                           325   8e-106   Prunus dulcis [sweet almond]
ref|XP_006430949.1|  hypothetical protein CICLE_v10012593mg             325   1e-105   
ref|XP_004154725.1|  PREDICTED: developmental protein SEPALLATA 2...    325   1e-105   
gb|AHH28266.1|  MADS-box transcription factor                           324   2e-105   
dbj|BAC80254.1|  MADS-box transcription factor                          324   2e-105   Houttuynia cordata [chameleon-plant]
ref|XP_006477711.1|  PREDICTED: developmental protein SEPALLATA 1...    325   2e-105   
ref|NP_001280893.1|  developmental protein SEPALLATA 1                  324   3e-105   
gb|AIE44769.1|  putative MADS-domain transcription factor AGL2          323   3e-105   
ref|XP_010045613.1|  PREDICTED: MADS-box protein CMB1-like              324   4e-105   
ref|XP_010681125.1|  PREDICTED: MADS-box protein CMB1-like              323   4e-105   
gb|KHN18378.1|  MADS-box protein CMB1                                   323   5e-105   
ref|XP_010029406.1|  PREDICTED: developmental protein SEPALLATA 1       323   5e-105   
ref|XP_008230289.1|  PREDICTED: developmental protein SEPALLATA 1...    323   5e-105   
gb|ADJ67241.1|  MADS box transcription factor 11                        323   6e-105   
ref|XP_004507288.1|  PREDICTED: developmental protein SEPALLATA 1...    323   6e-105   
gb|AHH28272.1|  MADS-box transcription factor                           323   7e-105   
ref|XP_006585806.1|  PREDICTED: developmental protein SEPALLATA 1...    322   1e-104   
ref|XP_006856372.1|  hypothetical protein AMTR_s00047p00190220          322   1e-104   
ref|NP_001267667.1|  developmental protein SEPALLATA 2-like             322   1e-104   
ref|XP_003549578.1|  PREDICTED: MADS-box protein CMB1-like              322   2e-104   
dbj|BAM34481.1|  MADS-box transcription factor                          321   3e-104   
gb|ABQ85952.1|  MADS-box transcription factor SEP-like 3                320   4e-104   Trochodendron aralioides
ref|XP_003552609.1|  PREDICTED: developmental protein SEPALLATA 1...    321   4e-104   
ref|XP_007045799.1|  MADS-box transcription factor                      320   4e-104   
ref|XP_009373783.1|  PREDICTED: developmental protein SEPALLATA 1...    320   6e-104   
ref|XP_008464576.1|  PREDICTED: developmental protein SEPALLATA 1...    320   6e-104   
gb|AEX58639.1|  AGL2-1                                                  320   6e-104   
ref|NP_001280849.1|  MADS-box protein CMB1-like                         320   7e-104   
ref|XP_004507289.1|  PREDICTED: developmental protein SEPALLATA 1...    320   8e-104   
ref|XP_004507287.1|  PREDICTED: developmental protein SEPALLATA 1...    320   8e-104   
gb|ABG78619.1|  MADS4                                                   320   9e-104   Populus tomentosa [Chinese white poplar]
dbj|BAD38890.1|  MADS box transcription factor                          320   1e-103   Gentiana triflora
gb|AAL08423.2|AF185574_1  transcription factor MAGL4                    320   1e-103   Populus tremuloides
gb|KCW83763.1|  hypothetical protein EUGRSUZ_B00633                     320   2e-103   
gb|AET98846.1|  SEPALLATA1                                              319   2e-103   
ref|XP_003531877.1|  PREDICTED: developmental protein SEPALLATA 1...    319   2e-103   
ref|XP_002306051.2|  hypothetical protein POPTR_0004s11440g             318   3e-103   Populus trichocarpa [western balsam poplar]
ref|XP_008341807.1|  PREDICTED: developmental protein SEPALLATA 1...    318   3e-103   
ref|XP_006602962.1|  PREDICTED: developmental protein SEPALLATA 1...    318   6e-103   
ref|XP_009373782.1|  PREDICTED: developmental protein SEPALLATA 1...    317   1e-102   
ref|XP_007151389.1|  hypothetical protein PHAVU_004G042300g             317   1e-102   
gb|AFO68788.1|  floral-binding protein 9                                315   2e-102   
sp|Q39685.1|CMB1_DIACA  RecName: Full=MADS-box protein CMB1             316   3e-102   Dianthus caryophyllus [carnation]
gb|AAX15924.1|  AGL9.2                                                  316   3e-102   Persea americana
ref|XP_010678363.1|  PREDICTED: MADS-box protein CMB1-like              316   3e-102   
gb|AFO68784.1|  floral-binding protein 9                                315   3e-102   
ref|NP_001234670.1|  MADS-box transcription factor                      315   4e-102   
ref|XP_010694134.1|  PREDICTED: developmental protein SEPALLATA 1...    315   1e-101   
gb|AFO68790.1|  agamous-like protein 234                                313   2e-101   
gb|AAQ72498.1|  MADS-box protein 12                                     314   2e-101   Petunia x hybrida [garden petunia]
gb|KEH25149.1|  MADS-box transcription factor                           314   2e-101   
ref|XP_006363565.1|  PREDICTED: MADS-box protein CMB1-like              313   5e-101   
emb|CAA04322.1|  MADS-box protein                                       313   5e-101   Malus domestica [apple tree]
ref|XP_003621519.1|  MADS-box protein                                   313   6e-101   
ref|XP_011099041.1|  PREDICTED: developmental protein SEPALLATA 1...    313   6e-101   
ref|NP_001234837.1|  MADS-box transcription factor                      312   8e-101   
ref|XP_011099040.1|  PREDICTED: developmental protein SEPALLATA 1...    312   1e-100   
ref|XP_009378252.1|  PREDICTED: developmental protein SEPALLATA 1...    312   1e-100   
ref|XP_009788435.1|  PREDICTED: MADS-box protein CMB1-like              311   2e-100   
ref|XP_010694125.1|  PREDICTED: developmental protein SEPALLATA 1...    311   2e-100   
gb|ADL36751.1|  MADS domain class transcription factor                  311   3e-100   
ref|XP_002311352.1|  MADS-box protein 4                                 310   4e-100   Populus trichocarpa [western balsam poplar]
gb|AEF59025.1|  MADS-1                                                  310   4e-100   
ref|XP_004304204.1|  PREDICTED: developmental protein SEPALLATA 2...    310   5e-100   
gb|ABV23569.2|  MADS-box protein                                        310   6e-100   Populus deltoides
gb|AHY82574.1|  MADS-box protein 7                                      310   6e-100   
gb|AAQ03227.1|AF411846_1  MADS box transcription factor                 310   7e-100   Elaeis guineensis
gb|AFK42306.1|  unknown                                                 310   1e-99    
ref|XP_008811809.1|  PREDICTED: MADS-box protein CMB1-like isofor...    309   2e-99    
ref|XP_008365428.1|  PREDICTED: developmental protein SEPALLATA 1...    308   2e-99    
gb|AFU81295.1|  SEPALLATA1                                              308   2e-99    
ref|XP_011018962.1|  PREDICTED: MADS-box protein CMB1-like              308   3e-99    
gb|ADL36750.1|  MADS domain class transcription factor                  308   3e-99    
ref|XP_010694117.1|  PREDICTED: developmental protein SEPALLATA 1...    308   4e-99    
ref|XP_008801852.1|  PREDICTED: agamous-like MADS-box protein AGL...    308   5e-99    
gb|AHW52539.1|  SEPALLATA-like MADS-box protein 4                       308   6e-99    
ref|XP_008357795.1|  PREDICTED: LOW QUALITY PROTEIN: developmenta...    308   6e-99    
ref|XP_003544012.1|  PREDICTED: developmental protein SEPALLATA 1...    308   6e-99    
gb|AAX69068.1|  MADS box protein M6                                     307   7e-99    Pisum sativum [garden pea]
gb|AES77737.2|  MADS-box transcription factor                           307   1e-98    
ref|NP_001238296.1|  MADS-box protein                                   307   1e-98    
gb|KHG04329.1|  MADS-box CMB1                                           306   2e-98    
ref|XP_009415892.1|  PREDICTED: agamous-like MADS-box protein AGL...    306   2e-98    
ref|XP_004237061.1|  PREDICTED: MADS-box protein CMB1 isoform X1        306   2e-98    
gb|AHM92082.1|  MADS-box protein 6                                      306   3e-98    
ref|XP_010917559.1|  PREDICTED: agamous-like MADS-box protein AGL...    306   3e-98    
ref|XP_008786031.1|  PREDICTED: truncated transcription factor CA...    305   4e-98    
gb|AGT21645.1|  PFRIN                                                   305   5e-98    
emb|CDP00462.1|  unnamed protein product                                305   5e-98    
gb|AGV54737.1|  developmental protein SEPALLATA 2-like protein          305   5e-98    
gb|AFU61112.1|  MADS-box transcription factor MADS-RIN                  305   6e-98    
gb|AIU94433.1|  MADS-box transcription factor 2 isoform 1               305   6e-98    
ref|XP_010917558.1|  PREDICTED: agamous-like MADS-box protein AGL...    305   7e-98    
gb|AEX58640.1|  AGL2-2                                                  304   9e-98    
gb|AEL33631.1|  SEPALLATA1                                              304   1e-97    
gb|ACJ64678.1|  MADS-box protein MADS2                                  304   1e-97    Musa acuminata AAA Group [Cavendish banana]
ref|XP_006593703.1|  PREDICTED: developmental protein SEPALLATA 1...    304   1e-97    
gb|KDP41334.1|  hypothetical protein JCGZ_15741                         303   1e-97    
ref|XP_010099309.1|  Developmental protein SEPALLATA 2                  304   2e-97    
ref|XP_008811808.1|  PREDICTED: MADS-box protein CMB1-like isofor...    304   2e-97    
gb|AAX15923.1|  AGL9.1                                                  303   2e-97    Persea americana
gb|AAX15920.1|  AGL9                                                    303   2e-97    Liriodendron tulipifera
dbj|BAM34478.1|  MADS-box transcription factor                          303   3e-97    
gb|AFO68783.1|  floral-binding protein 9                                302   3e-97    
gb|AEL33632.1|  SEPALLATA2                                              303   3e-97    
ref|XP_006400104.1|  hypothetical protein EUTSA_v10014493mg             303   3e-97    
emb|CAA04920.1|  MdMADS9                                                303   4e-97    Malus domestica [apple tree]
ref|XP_010549963.1|  PREDICTED: developmental protein SEPALLATA 1       303   4e-97    
gb|ABK41485.1|  putative MADS box protein                               303   5e-97    Elaeis guineensis
gb|AHW58033.1|  SEP4                                                    302   5e-97    
gb|KHN29767.1|  Developmental protein SEPALLATA 2                       303   5e-97    
ref|NP_001234201.1|  TAGL2 transcription factor                         303   5e-97    
emb|CDP02339.1|  unnamed protein product                                302   5e-97    
gb|AHW52537.1|  SEPALLATA-like MADS-box protein 2                       302   6e-97    
gb|AEJ76842.1|  MADS18                                                  302   1e-96    
ref|XP_006338336.1|  PREDICTED: developmental protein SEPALLATA 1...    302   1e-96    
emb|CAA64741.1|  DEFH49                                                 301   1e-96    Antirrhinum majus [garden snapdragon]
ref|XP_009121545.1|  PREDICTED: developmental protein SEPALLATA 1       302   1e-96    
emb|CAN59955.1|  hypothetical protein VITISV_006723                     301   1e-96    Vitis vinifera
ref|XP_010558530.1|  PREDICTED: developmental protein SEPALLATA 1       301   1e-96    
ref|XP_004491904.1|  PREDICTED: developmental protein SEPALLATA 1...    301   1e-96    
gb|AAF12701.2|  Apetala 1 protein                                       301   2e-96    Populus tremuloides
ref|XP_006603756.1|  PREDICTED: MADS-box protein isoform X1             301   2e-96    
emb|CAL36576.1|  deficiens H49 homologue                                301   2e-96    Misopates orontium
ref|XP_010913017.1|  PREDICTED: agamous-like MADS-box protein AGL...    301   2e-96    
gb|AEQ75500.1|  MADS-domain transcription factor                        300   2e-96    
gb|AAX53103.1|  AGL2-like protein                                       300   2e-96    Magnolia grandiflora [southern magnolia]
gb|ADU56820.1|  MADS-box protein AGL2 subfamily                         301   2e-96    
ref|NP_001233911.1|  MADS-box protein                                   301   3e-96    
emb|CDY26462.1|  BnaC09g42060D                                          301   3e-96    
gb|AAA32732.1|  transcription factor                                    300   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008801853.1|  PREDICTED: agamous-like MADS-box protein AGL...    299   8e-96    
gb|ABJ98752.1|  MADS-box transcription factor MADS-RIN                  299   1e-95    Capsicum annuum
gb|AFO68791.1|  agamous-like protein 234                                298   1e-95    
gb|AFO68789.1|  floral-binding protein 9                                298   2e-95    
ref|XP_004491903.1|  PREDICTED: developmental protein SEPALLATA 1...    298   3e-95    
ref|XP_010923638.1|  PREDICTED: MADS-box protein CMB1-like              299   3e-95    
gb|AFO68781.1|  floral-binding protein 9                                296   3e-95    
gb|AAK21247.1|AF335234_1  MADS-box transcription factor FBP4            298   3e-95    Petunia x hybrida [garden petunia]
gb|AHW58036.1|  SEP1/2                                                  298   4e-95    
gb|AAZ95252.1|  MADS box protein SEP1                                   297   5e-95    Dendrobium crumenatum
gb|AIU94430.1|  MADS-box transcription factor 2 isoform 2               297   5e-95    
emb|CAC81072.1|  MADS box transcription factor                          297   5e-95    Daucus carota subsp. sativus
gb|AIU94434.1|  MADS-box transcription factor 2 isoform 2               297   7e-95    
ref|XP_009608616.1|  PREDICTED: developmental protein SEPALLATA 1...    297   7e-95    
gb|AHM92084.1|  MADS-box protein 8                                      296   1e-94    
ref|XP_010315869.1|  PREDICTED: MADS-box protein isoform X1             296   1e-94    
ref|XP_009615088.1|  PREDICTED: MADS-box protein CMB1-like isofor...    296   2e-94    
ref|XP_009131500.1|  PREDICTED: developmental protein SEPALLATA 1...    296   2e-94    
gb|AFO68785.1|  floral-binding protein 9                                295   2e-94    
gb|AIU94432.1|  MADS-box transcription factor 2 isoform 3               295   3e-94    
ref|XP_010913018.1|  PREDICTED: agamous-like MADS-box protein AGL...    295   3e-94    
ref|XP_003518786.1|  PREDICTED: developmental protein SEPALLATA 1...    295   4e-94    
gb|AEX92975.1|  MADS box protein 2                                      295   5e-94    
ref|XP_002873742.1|  hypothetical protein ARALYDRAFT_909555             295   5e-94    
emb|CDX69499.1|  BnaA10g18480D                                          295   6e-94    
gb|AAZ77748.1|  AGL2-like MADS box 3                                    295   7e-94    Castanea mollissima
emb|CBI27678.3|  unnamed protein product                                294   1e-93    
ref|XP_006848294.1|  hypothetical protein AMTR_s00013p00103080          294   1e-93    
ref|XP_010320555.1|  PREDICTED: MADS-box transcription factor iso...    293   1e-93    
gb|AAX15919.1|  AGL2                                                    294   2e-93    Eschscholzia californica
ref|XP_008360083.1|  PREDICTED: MADS-box protein CMB1-like              293   2e-93    
ref|XP_008350888.1|  PREDICTED: MADS-box protein CMB1-like              293   2e-93    
gb|AHJ80843.1|  SEPALLATA3                                              293   2e-93    
gb|AAF13262.1|AF198176_1  MADS box protein DOMADS3                      292   2e-93    Dendrobium grex Madame Thong-In
gb|ABC70706.1|  MADS-box transcription factor                           293   3e-93    Asparagus virgatus
ref|XP_009346321.1|  PREDICTED: MADS-box protein CMB1-like              293   3e-93    
gb|ABQ85951.1|  MADS-box transcription factor SEP-like 2                293   3e-93    Trochodendron aralioides
gb|KFK25803.1|  hypothetical protein AALP_AA8G163200                    293   4e-93    
gb|ADC79703.1|  SEPALLATA3-like protein                                 292   4e-93    Pachysandra terminalis
ref|XP_010319477.1|  PREDICTED: MADS-box protein CMB1 isoform X2        291   4e-93    
ref|XP_009608615.1|  PREDICTED: developmental protein SEPALLATA 1...    292   5e-93    
ref|XP_004490238.1|  PREDICTED: MADS-box protein CMB1-like isofor...    292   5e-93    
dbj|BAD10944.1|  SEPALLATA1 homologous protein                          292   6e-93    Silene latifolia
gb|AFO68778.1|  agamous-like protein 2                                  291   8e-93    
ref|XP_007151388.1|  hypothetical protein PHAVU_004G042300g             291   9e-93    
ref|XP_008243812.1|  PREDICTED: MADS-box protein CMB1-like isofor...    292   9e-93    
ref|NP_001268114.1|  MADS-box protein 4                                 291   1e-92    
gb|AIC33051.1|  flower development transporter SEP1                     291   1e-92    
gb|AAQ83834.1|  MADS box protein                                        291   2e-92    Asparagus officinalis
gb|ADJ67238.1|  MADS box transcription factor 6                         291   2e-92    
gb|ABD62860.1|  SEP3.2                                                  290   2e-92    Persea borbonia [red bay]
ref|XP_009346217.1|  PREDICTED: MADS-box protein CMB1-like              291   2e-92    
gb|AFH66785.1|  SEP-like MADS-box protein                               290   3e-92    
ref|XP_008801850.1|  PREDICTED: agamous-like MADS-box protein AGL...    291   3e-92    
ref|XP_009419371.1|  PREDICTED: agamous-like MADS-box protein AGL...    290   3e-92    
gb|AEQ75501.1|  MADS-domain transcription factor                        289   3e-92    
gb|ADD25177.1|  SEP1-1                                                  289   4e-92    Cabomba caroliniana
gb|AFX72879.1|  MADS-box protein SEP3                                   290   6e-92    
emb|CAH04878.1|  MADS domain protein                                    289   7e-92    Gerbera hybrid cultivar
gb|AAT46095.1|  SEPALLATA-like protein                                  289   8e-92    Akebia trifoliata
ref|XP_009625300.1|  PREDICTED: MADS-box protein CMB1-like              290   8e-92    
gb|AHW52536.1|  SEPALLATA-like MADS-box protein 1                       289   9e-92    
gb|AHY82573.1|  MADS-box protein 6                                      289   1e-91    
gb|ADC79706.1|  SEPALLATA3-like protein                                 289   1e-91    Euptelea pleiosperma
emb|CDX78653.1|  BnaA03g05650D                                          289   1e-91    
gb|ADC79704.1|  SEPALLATA3-like protein                                 288   1e-91    Pachysandra terminalis
gb|ACJ64681.1|  MADS-box protein MADS4                                  288   1e-91    
ref|XP_006408426.1|  hypothetical protein EUTSA_v10021390mg             288   2e-91    
ref|XP_009757151.1|  PREDICTED: developmental protein SEPALLATA 1...    288   2e-91    
ref|XP_004490237.1|  PREDICTED: MADS-box protein CMB1-like isofor...    288   3e-91    
gb|AAX15918.1|  AGL9                                                    288   3e-91    
ref|XP_006298399.1|  hypothetical protein CARUB_v10014470mg             288   3e-91    
ref|XP_009773223.1|  PREDICTED: MADS-box protein CMB1-like isofor...    288   3e-91    
gb|AGT20511.1|  SEP2.a                                                  288   4e-91    
gb|KEH32046.1|  MADS-box transcription factor                           287   4e-91    
gb|AEJ76844.1|  MADS20                                                  287   4e-91    
emb|CDX70651.1|  BnaC03g07350D                                          287   7e-91    
ref|XP_007221848.1|  hypothetical protein PRUPE_ppa1027139mg            287   7e-91    
ref|NP_001233976.1|  MADS-box transcription factor MADS-rin             292   8e-91    
gb|ABD60322.1|  SEP2                                                    287   8e-91    
ref|XP_009589584.1|  PREDICTED: developmental protein SEPALLATA 1...    286   9e-91    
ref|XP_006348663.1|  PREDICTED: MADS-box protein CMB1-like              292   1e-90    
gb|AHM92085.1|  MADS-box protein 9                                      286   1e-90    
dbj|BAO74162.1|  MADS-box transcription factor SEP1.2                   286   1e-90    
ref|XP_010250667.1|  PREDICTED: agamous-like MADS-box protein AGL...    286   1e-90    
gb|AGW23351.1|  MADS box protein MADS49                                 286   1e-90    
ref|XP_009356441.1|  PREDICTED: MADS-box protein CMB1-like              286   1e-90    
gb|AHH28254.1|  MADS-box transcription factor                           285   1e-90    
ref|XP_009757345.1|  PREDICTED: developmental protein SEPALLATA 1...    286   2e-90    
gb|AGL94767.1|  MADS-box protein 1                                      285   2e-90    
ref|XP_009625855.1|  PREDICTED: MADS-box protein CMB1-like              283   2e-90    
ref|XP_011102220.1|  PREDICTED: MADS-box protein CMB1-like              285   3e-90    
ref|XP_010420253.1|  PREDICTED: developmental protein SEPALLATA 1...    285   3e-90    
ref|NP_568322.1|  MADS box transcription factor SEPALLATA 1             285   4e-90    
dbj|BAC80253.1|  MADS-box transcription factor                          285   4e-90    
gb|AHH28301.1|  MADS-box transcription factor                           283   5e-90    
ref|XP_009117898.1|  PREDICTED: developmental protein SEPALLATA 2       285   6e-90    
emb|CDY34718.1|  BnaA01g33070D                                          284   8e-90    
ref|XP_010937979.1|  PREDICTED: truncated transcription factor CA...    284   1e-89    
ref|XP_009773224.1|  PREDICTED: MADS-box protein CMB1-like isofor...    283   1e-89    
ref|XP_010453727.1|  PREDICTED: developmental protein SEPALLATA 1       284   1e-89    
ref|XP_008243814.1|  PREDICTED: MADS-box protein CMB1-like isofor...    283   2e-89    
ref|XP_006288512.1|  hypothetical protein CARUB_v10001783mg             283   2e-89    
ref|XP_009386196.1|  PREDICTED: MADS-box transcription factor 1-l...    283   2e-89    
emb|CDY57524.1|  BnaA05g33600D                                          283   2e-89    
dbj|BAM71401.1|  transcription factor                                   283   2e-89    
gb|AAK21248.1|AF335235_1  MADS-box transcription factor FBP5            283   2e-89    
ref|XP_002884314.1|  SEPALLATA2                                         283   3e-89    
ref|XP_006395681.1|  hypothetical protein EUTSA_v10004767mg             283   3e-89    
ref|XP_009147359.1|  PREDICTED: developmental protein SEPALLATA 2...    283   3e-89    
gb|AHH28302.1|  MADS-box transcription factor                           281   3e-89    
dbj|BAM36705.1|  MADS transcriptional factor SEP3 homolog               283   3e-89    
gb|ADD25197.1|  SEP2                                                    281   4e-89    
gb|AAU82009.1|  SEPALLATA2                                              282   4e-89    
gb|ADU56817.1|  MADS-box protein AGL2 subfamily                         282   4e-89    
gb|ACB69510.1|  SEPALLATA3-like MADS-box protein                        282   5e-89    
ref|XP_008801851.1|  PREDICTED: agamous-like MADS-box protein AGL...    283   6e-89    
ref|NP_186880.1|  developmental protein SEPALLATA 2                     282   7e-89    
dbj|BAM34479.1|  MADS-box transcription factor                          281   7e-89    
gb|AGT20512.1|  SEP2.b                                                  281   8e-89    
gb|AAO42085.1|  putative floral homeotic protein AGL4                   281   9e-89    
gb|ACJ26766.1|  MADS-11                                                 281   9e-89    
dbj|BAB70747.1|  putative MADS-domain transcription factor MpMADS13     281   1e-88    
ref|XP_010463632.1|  PREDICTED: developmental protein SEPALLATA 2...    281   1e-88    
ref|XP_010485469.1|  PREDICTED: developmental protein SEPALLATA 2       281   1e-88    
emb|CAE46179.1|  AGL2-like MADS box transcription factor                280   1e-88    
ref|XP_011020782.1|  PREDICTED: agamous-like MADS-box protein AGL...    281   1e-88    
ref|XP_009608617.1|  PREDICTED: developmental protein SEPALLATA 1...    281   1e-88    
gb|ACB69509.1|  SEPALLATA3-like MADS-box protein                        280   2e-88    
ref|XP_004140534.1|  PREDICTED: agamous-like MADS-box protein AGL...    280   2e-88    
ref|NP_001284431.1|  agamous-like MADS-box protein AGL9 homolog         280   2e-88    
ref|XP_003516451.1|  PREDICTED: developmental protein SEPALLATA 1...    280   2e-88    
ref|NP_849930.1|  protein SEPALLATA 4                                   281   2e-88    
gb|ACB69511.1|  SEPALLATA3-like MADS-box protein                        280   3e-88    
ref|NP_178466.1|  protein SEPALLATA 4                                   281   3e-88    
dbj|BAG55316.1|  transcription factor                                   280   3e-88    
gb|AHW52538.1|  SEPALLATA-like MADS-box protein 3                       280   4e-88    
sp|Q03489.2|AGL9_PETHY  RecName: Full=Agamous-like MADS-box prote...    280   4e-88    
sp|Q38694.1|AGL9_ARADE  RecName: Full=Agamous-like MADS-box prote...    280   5e-88    
gb|EPS70807.1|  hypothetical protein M569_03954                         280   5e-88    
ref|NP_001289529.1|  agamous-like MADS-box protein AGL9 homolog         279   6e-88    
ref|XP_010470619.1|  PREDICTED: developmental protein SEPALLATA 2...    279   6e-88    
dbj|BAN89460.1|  sepallata 3                                            279   7e-88    
ref|XP_002875226.1|  predicted protein                                  280   7e-88    
ref|XP_010937970.1|  PREDICTED: truncated transcription factor CA...    279   7e-88    
ref|XP_008243816.1|  PREDICTED: MADS-box protein CMB1-like isofor...    278   9e-88    
gb|ABD62861.1|  SEP3.1                                                  278   9e-88    
dbj|BAL05005.1|  putative MADS box protein                              278   1e-87    
gb|ABS17562.1|  SEPALLATA 3-like protein                                278   2e-87    
ref|XP_007043947.1|  K-box region and MADS-box transcription fact...    278   2e-87    
gb|AHC54144.1|  sepallata-like MADS box transcription factor 3          275   3e-87    
gb|ADD25178.1|  SEP1-2                                                  276   4e-87    
gb|ABD19719.1|  SEP3-like MADS-box protein                              277   5e-87    
ref|NP_001234384.1|  agamous-like MADS-box protein AGL9 homolog         276   6e-87    
ref|XP_009600809.1|  PREDICTED: agamous-like MADS-box protein AGL...    276   7e-87    
ref|NP_001119230.1|  MADS box transcription factor SEPALLATA 1          277   7e-87    
gb|AGH61294.1|  sepallata 3                                             276   8e-87    
gb|ADX97328.1|  SEPALLATA1-like protein                                 276   8e-87    
gb|KHG25284.1|  Agamous-like MADS-box protein AGL9                      276   9e-87    
ref|XP_010101660.1|  MADS-box protein                                   275   9e-87    
ref|XP_009757152.1|  PREDICTED: developmental protein SEPALLATA 1...    276   1e-86    
ref|XP_009129078.1|  PREDICTED: agamous-like MADS-box protein AGL3      277   1e-86    
emb|CDY04164.1|  BnaA09g19420D                                          276   1e-86    
ref|XP_010653929.1|  PREDICTED: MADS-box protein 4 isoform X1           276   1e-86    
gb|AEX92976.1|  MADS box protein 1                                      276   1e-86    
gb|AEJ76840.1|  MADS16                                                  275   2e-86    
ref|XP_006440805.1|  hypothetical protein CICLE_v10021357mg             276   2e-86    
gb|ADP09004.1|  SEP3-like protein                                       275   2e-86    
dbj|BAM34480.1|  MADS-box transcription factor                          275   2e-86    
ref|XP_006352168.1|  PREDICTED: agamous-like MADS-box protein AGL...    275   3e-86    
gb|AGS42240.1|  MADS-box protein                                        275   3e-86    
gb|AEJ76843.1|  MADS19                                                  275   3e-86    
gb|ABD17387.1|  MADS-box protein SEP3                                   275   3e-86    
ref|XP_007223808.1|  hypothetical protein PRUPE_ppa010679mg             275   3e-86    
gb|AEL33633.1|  SEPALLATA3                                              275   3e-86    
ref|XP_011036099.1|  PREDICTED: agamous-like MADS-box protein AGL...    275   3e-86    
gb|AHW58034.1|  SEP3                                                    275   3e-86    
gb|AAU82031.1|  SEPALLATA2                                              275   3e-86    
ref|XP_009386205.1|  PREDICTED: MADS-box transcription factor 1-l...    275   3e-86    
ref|XP_008222191.1|  PREDICTED: agamous-like MADS-box protein AGL...    274   4e-86    
ref|NP_001289232.1|  agamous-like MADS-box protein AGL9 homolog         274   5e-86    
ref|XP_011086825.1|  PREDICTED: agamous-like MADS-box protein AGL...    274   6e-86    
gb|ABC70710.1|  MADS-box transcription factor                           274   6e-86    
dbj|BAK09619.1|  MADS-box transcription factor                          274   6e-86    
ref|XP_008243815.1|  PREDICTED: MADS-box protein CMB1-like isofor...    274   6e-86    
gb|AEN75254.1|  transcription factor MADS3                              274   7e-86    
gb|ACB69512.1|  SEPALLATA3-like MADS-box protein                        273   8e-86    
gb|KFK33520.1|  hypothetical protein AALP_AA5G023700                    274   9e-86    
emb|CDY51202.1|  BnaA06g39810D                                          274   1e-85    
gb|KHN24051.1|  MADS-box transcription factor 1                         273   1e-85    
ref|XP_010514141.1|  PREDICTED: agamous-like MADS-box protein AGL...    275   1e-85    
gb|AEE60891.1|  MADS-box protein 5                                      273   1e-85    
ref|XP_010502393.1|  PREDICTED: agamous-like MADS-box protein AGL...    274   1e-85    
gb|ACO72983.1|  SEP3-like MADS-box protein                              273   2e-85    
gb|ABD17386.1|  MADS-box protein SEP3-1                                 276   2e-85    
ref|XP_010514140.1|  PREDICTED: agamous-like MADS-box protein AGL...    274   2e-85    
ref|XP_010502392.1|  PREDICTED: agamous-like MADS-box protein AGL...    274   2e-85    
ref|NP_001280756.1|  agamous-like MADS-box protein AGL9 homolog         272   3e-85    
ref|NP_001236390.1|  MADS transcription factor                          272   3e-85    
ref|XP_006579435.1|  PREDICTED: uncharacterized protein LOC100805...    272   3e-85    
gb|KDP26829.1|  hypothetical protein JCGZ_17987                         273   3e-85    
ref|XP_006579436.1|  PREDICTED: uncharacterized protein LOC100805...    272   3e-85    
ref|XP_009384296.1|  PREDICTED: MADS-box transcription factor 8-like    272   4e-85    
ref|XP_007043949.1|  K-box region and MADS-box transcription fact...    272   4e-85    
gb|AFO68779.1|  agamous-like protein 3                                  271   5e-85    
gb|AAT37484.1|  MADS5 protein                                           272   5e-85    
gb|KHN34832.1|  MADS-box transcription factor 1                         271   5e-85    
gb|ABC70707.1|  MADS-box transcription factor                           271   5e-85    
gb|AEZ06315.1|  leafy hull sterile 1-like protein                       271   6e-85    
ref|XP_006579433.1|  PREDICTED: uncharacterized protein LOC100805...    271   6e-85    
ref|XP_004502275.1|  PREDICTED: MADS-box transcription factor 1-l...    271   6e-85    
ref|XP_006585131.1|  PREDICTED: MADS-box transcription factor 1-l...    271   6e-85    
ref|XP_009152152.1|  PREDICTED: agamous-like MADS-box protein AGL3      272   6e-85    
ref|XP_006437995.1|  hypothetical protein CICLE_v10032507mg             271   7e-85    
gb|KFK44483.1|  developmental protein sepallata 3                       271   7e-85    
ref|XP_006585132.1|  PREDICTED: MADS-box transcription factor 1-l...    271   7e-85    
ref|XP_006579434.1|  PREDICTED: uncharacterized protein LOC100805...    271   8e-85    
emb|CAA64743.1|  DEFH200                                                271   9e-85    
ref|XP_004502274.1|  PREDICTED: MADS-box transcription factor 1-l...    271   1e-84    
dbj|BAK09620.1|  MADS-box transcription factor                          271   1e-84    
gb|ABD65406.1|  MADS-box protein                                        271   1e-84    
gb|ABD17385.1|  MADS-box protein SEP1                                   270   1e-84    
ref|XP_006585129.1|  PREDICTED: MADS-box transcription factor 1-l...    271   1e-84    
gb|ADU15477.1|  SEP3                                                    271   1e-84    
ref|XP_006585130.1|  PREDICTED: MADS-box transcription factor 1-l...    270   2e-84    
gb|AAT37483.1|  MADS4 protein                                           270   2e-84    
gb|ACF87411.1|  unknown                                                 270   2e-84    
gb|ADU15478.1|  SEP1                                                    270   2e-84    
gb|AAT37486.1|  MADS7 protein                                           270   2e-84    
ref|XP_006415783.1|  hypothetical protein EUTSA_v10008591mg             270   2e-84    
emb|CAD48302.1|  MADS-box protein AGL3-a                                270   3e-84    
gb|AAT37485.1|  MADS6 protein                                           270   3e-84    
gb|AAO22982.1|  MADS-box transcription factor CDM44                     270   3e-84    
ref|NP_001105149.1|  MADS24                                             270   3e-84    
ref|XP_008453505.1|  PREDICTED: MADS-box protein CMB1-like isofor...    270   3e-84    
gb|AAQ11687.1|  MADS box protein                                        270   4e-84    
gb|AAT37482.1|  MADS3 protein                                           270   4e-84    
emb|CAL36578.1|  deficiens H200 homologue                               269   4e-84    
ref|XP_003538541.1|  PREDICTED: MADS-box transcription factor 1-l...    269   5e-84    
gb|AGV31155.1|  E-class MADS-box protein                                268   7e-84    
gb|ADF49576.1|  transcription factor MADS-box 2                         268   9e-84    
gb|AFO68775.1|  agamous-like protein 2                                  268   9e-84    
gb|ACB45304.1|  MIKC-type MADS-box transcription factor WM10A           269   9e-84    
ref|XP_006291634.1|  hypothetical protein CARUB_v10017787mg             270   1e-83    
gb|AAF77579.1|AF072534_1  pepper MADS-box protein                       266   1e-83    
gb|AEO45959.1|  SEPALLATA3-like protein                                 268   1e-83    
ref|XP_006591442.1|  PREDICTED: MADS-box transcription factor 1-l...    268   1e-83    
ref|XP_003601749.1|  MADS-box transcription factor                      268   1e-83    
dbj|BAJ11578.1|  transcription factor                                   268   2e-83    
ref|XP_010025292.1|  PREDICTED: agamous-like MADS-box protein AGL...    268   2e-83    
gb|ADL36747.1|  MADS domain class transcription factor                  267   2e-83    
ref|XP_006291635.1|  hypothetical protein CARUB_v10017787mg             269   2e-83    
gb|ABW84394.1|  ZMM24 MADS-box protein                                  267   2e-83    
ref|XP_009615089.1|  PREDICTED: MADS-box protein CMB1-like isofor...    266   2e-83    
ref|XP_006660815.1|  PREDICTED: MADS-box transcription factor 8-like    268   2e-83    
ref|XP_009589591.1|  PREDICTED: developmental protein SEPALLATA 1...    266   3e-83    
gb|AAO49811.1|  SEP3-related MADS-box protein                           267   4e-83    
ref|XP_008340236.1|  PREDICTED: agamous-like MADS-box protein AGL...    267   4e-83    
ref|XP_007043948.1|  K-box region and MADS-box transcription fact...    267   4e-83    
gb|AHC54178.1|  sepallata-like MADS box transcription factor 3          264   4e-83    
emb|CAM59053.1|  MIKC-type MADS-box transcription factor WM10A          267   4e-83    
emb|CAX65571.1|  GRCD5 protein                                          267   5e-83    
ref|XP_004504398.1|  PREDICTED: agamous-like MADS-box protein AGL...    266   5e-83    
ref|XP_004490239.1|  PREDICTED: MADS-box protein CMB1-like isofor...    266   6e-83    
ref|XP_006437996.1|  hypothetical protein CICLE_v10032507mg             266   9e-83    
gb|AIC33052.1|  flower development transporter SEP3                     266   1e-82    
ref|NP_001266934.1|  MADS-box transcription factor 34                   265   1e-82    
ref|XP_009372256.1|  PREDICTED: agamous-like MADS-box protein AGL...    266   1e-82    
ref|XP_010530562.1|  PREDICTED: developmental protein SEPALLATA 3...    266   1e-82    
ref|XP_006437997.1|  hypothetical protein CICLE_v10032507mg             266   1e-82    
ref|NP_001105150.1|  MADS31                                             265   2e-82    
gb|AET04966.2|  MADS-box transcription factor                           265   2e-82    
ref|XP_010530561.1|  PREDICTED: developmental protein SEPALLATA 3...    265   2e-82    
emb|CAA64742.1|  DEFH72                                                 265   2e-82    
dbj|BAF34912.1|  MADS-box protein                                       265   3e-82    
gb|AHM92061.1|  MADS-box protein 1                                      265   3e-82    
ref|XP_002890717.1|  hypothetical protein ARALYDRAFT_472923             265   3e-82    
ref|XP_009773225.1|  PREDICTED: MADS-box protein CMB1-like isofor...    261   4e-82    
ref|XP_009102995.1|  PREDICTED: agamous-like MADS-box protein AGL...    265   4e-82    
gb|AHM92068.1|  MADS-box protein 8                                      264   5e-82    
gb|ACA24481.1|  agamous-like 9 protein 1                                263   6e-82    
gb|AAN15182.1|  MADS box protein GHMADS-1                               263   6e-82    
gb|ABI60898.1|  MADS-box transcription factor                           264   6e-82    
gb|AAY21913.2|  putative MADS box protein                               264   7e-82    
ref|NP_850953.1|  MADs box transcription factor SEPALLATA3              264   7e-82    
ref|NP_001266557.1|  MADS-box transcription factor 34                   263   8e-82    
emb|CDY27603.1|  BnaA09g28040D                                          264   8e-82    



>ref|XP_009788128.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=242

 Score =   417 bits (1073),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/245 (85%), Positives = 222/245 (91%), Gaps = 3/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKT+E+YQRCSYA LEA+Q A+DTQNNYHEYLRLKARVELLQRSQRNLLGEDLG LS
Sbjct  61    SSMMKTIEKYQRCSYATLEASQSATDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGTLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLENQLEASLKQIRSRKT  MLDQLA+LQQREQMLAESNK LRRKLEE+ AGIPL
Sbjct  121   TKDLEQLENQLEASLKQIRSRKTHFMLDQLADLQQREQMLAESNKHLRRKLEESAAGIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             RL WEDG Q + Q NR   PQ+EGFFQPLGL  S Q GYN VGTDEVN  ASAHN++GF 
Sbjct  181   RLCWEDGAQAM-QLNR--LPQTEGFFQPLGLTSSPQFGYNHVGTDEVNGGASAHNMNGFI  237

Query  992   PGWML  1006
             PGWML
Sbjct  238   PGWML  242



>gb|AAF22138.1|AF129875_1 MADS box transcription factor MADS1 [Capsicum annuum]
Length=245

 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/247 (82%), Positives = 222/247 (90%), Gaps = 4/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KT+E+YQRCSYA LEANQ A+DTQNNYHEYLRLKARVELLQRSQRN LGEDLG LS
Sbjct  61    SSMVKTIEKYQRCSYATLEANQSATDTQNNYHEYLRLKARVELLQRSQRNFLGEDLGTLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLENQLE+SLKQIRSRKTQ MLDQLA+LQQREQMLAESN+LLRRKLEE+ AG P+
Sbjct  121   TKDLEQLENQLESSLKQIRSRKTQFMLDQLADLQQREQMLAESNRLLRRKLEESTAGFPV  180

Query  812   RLSWEDG-NQEIHQQNRQLPPQSEGFFQPLGLNIS-GQIGYNSVGTDEVNVAASAHNISG  985
             RLSWEDG +Q +HQ NR   P +EGF QPLGL+ S    GYN V TDEVN AA+AHN++G
Sbjct  181   RLSWEDGADQAMHQHNR--LPHTEGFLQPLGLHSSPPHFGYNPVNTDEVNAAATAHNMNG  238

Query  986   FFPGWML  1006
             F  GWML
Sbjct  239   FIHGWML  245



>ref|NP_001234380.1| MADS-box protein 1 [Solanum lycopersicum]
 gb|AAP57412.1| MADS-box protein 1 [Solanum lycopersicum]
Length=246

 Score =   407 bits (1047),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 223/248 (90%), Gaps = 5/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KT+E+YQRCSYA LEANQ  +DTQNNYHEYLRLKARVELLQRSQRN LGEDLG LS
Sbjct  61    SSMVKTIEKYQRCSYATLEANQSVTDTQNNYHEYLRLKARVELLQRSQRNFLGEDLGTLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +K+LEQLENQLE+SLKQIRSRKTQ MLDQLA+LQQ+EQMLAESN+LLRRKLEE+VAG PL
Sbjct  121   SKDLEQLENQLESSLKQIRSRKTQFMLDQLADLQQKEQMLAESNRLLRRKLEESVAGFPL  180

Query  812   RLSWEDG--NQEIHQQNRQLPPQSEGFFQPLGLNISG-QIGYNSVGTDEVNVAASAHNIS  982
             RL WEDG  +Q +HQQNR   P +EGFFQPLGL+ S    GYN V TDEVN AA+AHN++
Sbjct  181   RLCWEDGGDHQLMHQQNR--LPNTEGFFQPLGLHSSSPHFGYNPVNTDEVNAAATAHNMN  238

Query  983   GFFPGWML  1006
             GF  GWML
Sbjct  239   GFIHGWML  246



>ref|XP_006345102.1| PREDICTED: MADS-box protein CMB1-like [Solanum tuberosum]
Length=246

 Score =   405 bits (1041),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 222/248 (90%), Gaps = 5/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KT+E+YQRCSYA LEANQ  ++TQNNYHEYLRLKARVELLQRSQRN LGEDLG L+
Sbjct  61    SSMVKTIEKYQRCSYATLEANQSVTETQNNYHEYLRLKARVELLQRSQRNFLGEDLGTLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLENQLE+SLKQIRSRKTQ MLDQLA+LQQ+EQMLAESN+LLRRKLEE+ AG PL
Sbjct  121   TKDLEQLENQLESSLKQIRSRKTQFMLDQLADLQQKEQMLAESNRLLRRKLEESAAGFPL  180

Query  812   RLSWEDG--NQEIHQQNRQLPPQSEGFFQPLGLNISG-QIGYNSVGTDEVNVAASAHNIS  982
             RL WEDG  +Q +HQQNR   P +EGFFQPLGL+ S    GYN V TDEVN AA+AHN++
Sbjct  181   RLCWEDGAEHQAMHQQNR--LPNTEGFFQPLGLHSSSPHFGYNPVNTDEVNAAATAHNMN  238

Query  983   GFFPGWML  1006
             GF  GWML
Sbjct  239   GFIHGWML  246



>gb|AAK21254.1|AF335241_1 MADS-box transcription factor FBP23 [Petunia x hybrida]
Length=245

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/247 (82%), Positives = 219/247 (89%), Gaps = 4/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KT+E+YQRCSYA LEANQ A+D QNNYHEYLRLKARVELLQRSQRNLLGEDLG LS
Sbjct  61    SSMTKTIEKYQRCSYATLEANQSATDNQNNYHEYLRLKARVELLQRSQRNLLGEDLGTLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLENQLE+SLKQIRSRKTQ MLDQLA+LQQREQMLAESNK LR+KLEE+VAGIP 
Sbjct  121   TKDLEQLENQLESSLKQIRSRKTQFMLDQLADLQQREQMLAESNKQLRQKLEESVAGIPH  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISG--QIGYNSVGTDEVNVAASAHNISG  985
             RL WEDG Q + Q N +L PQ+EGFFQPLGLN S   Q GYN  GTD  N AA+ HN++G
Sbjct  181   RLCWEDGLQAM-QHNSRL-PQTEGFFQPLGLNSSNSPQFGYNPAGTDVENAAATTHNMNG  238

Query  986   FFPGWML  1006
             F  GWML
Sbjct  239   FIHGWML  245



>gb|AAK21249.1|AF335236_1 MADS-box transcription factor FBP9 [Petunia x hybrida]
Length=245

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 195/247 (79%), Positives = 222/247 (90%), Gaps = 4/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLE+YQ+CSYA L+  Q A+DTQNNYHEYLRLKARVELLQRSQRNLLGEDLG L+
Sbjct  61    SSMMKTLEKYQQCSYASLDPMQSANDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGSLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QL++SLKQIRS+KTQ MLDQLA+LQQ+EQMLAE+NK LRRKLEE+ A IPL
Sbjct  121   SKELEQLEHQLDSSLKQIRSKKTQHMLDQLADLQQKEQMLAEANKQLRRKLEESAARIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISG-QIGYNSVGTDEVNVAAS-AHNISG  985
             RLSW++G Q + Q NR LPPQ+EGFFQPLGLN S  Q GY+ +G +EVN A S A N++G
Sbjct  181   RLSWDNGGQPM-QHNR-LPPQTEGFFQPLGLNSSSPQFGYSPMGANEVNNAVSTAQNMNG  238

Query  986   FFPGWML  1006
             F PGWML
Sbjct  239   FIPGWML  245



>ref|XP_009761698.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=245

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 225/246 (91%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSMM+TLE+YQ+CSYA L+  Q ASD TQNNYHEYLRLKARVELLQRSQRNLLGEDLG L
Sbjct  61    SSMMQTLEKYQQCSYASLDPMQSASDHTQNNYHEYLRLKARVELLQRSQRNLLGEDLGTL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +++ELE LE+QL++SLKQIRSRKTQ+MLDQLA+LQQ+EQMLAE+NK LRRKLEE+ A +P
Sbjct  121   NSRELEHLEHQLDSSLKQIRSRKTQNMLDQLADLQQKEQMLAEANKQLRRKLEESAARVP  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LRLSW++G Q + Q NRQLPPQ+EGFFQPLGLN S Q GY+ +G +EVN AA+A+N++GF
Sbjct  181   LRLSWDNGGQTM-QHNRQLPPQTEGFFQPLGLNSSPQFGYSPMGGNEVNAAATANNMNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>ref|XP_010257958.1| PREDICTED: developmental protein SEPALLATA 1 [Nelumbo nucifera]
Length=243

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/245 (76%), Positives = 216/245 (88%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+CSY  LEA+QPA +TQ++Y EYL+LKARVE+LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLKTLERYQKCSYGALEASQPAKETQSSYQEYLKLKARVEVLQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLE SLKQIRS KTQ MLDQL++LQ++EQML E+N+ L+RKL+E+ +  PL
Sbjct  121   TKELEQLEHQLEMSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRALKRKLDESSSENPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             RL+WE G Q I   +RQ P QSEGFFQPL  N + QIGYN VG D++ VAASA N++G+ 
Sbjct  181   RLTWEAGGQNIS-YSRQ-PSQSEGFFQPLEGNSTLQIGYNPVGPDQITVAASAQNVNGYI  238

Query  992   PGWML  1006
             PGWML
Sbjct  239   PGWML  243



>gb|AAF76381.1|AF068723_1 MADS-box protein MADS4 [Nicotiana tabacum]
Length=245

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/246 (78%), Positives = 223/246 (91%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKL EFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLSEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSMM+TLE+YQ+CSYA L+  Q ASD TQNNYHEYLRLKARVELLQRSQRNLLGEDLG L
Sbjct  61    SSMMQTLEKYQQCSYASLDPMQSASDHTQNNYHEYLRLKARVELLQRSQRNLLGEDLGTL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ++ ELE LE+QL++SLKQIRSRKTQ+MLDQLA+LQQ+EQMLAE+NK LRRKLEE+ A +P
Sbjct  121   NSGELEHLEHQLDSSLKQIRSRKTQNMLDQLADLQQKEQMLAEANKQLRRKLEESAARVP  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LRLSW++G Q + Q NRQLPPQ+EGFFQPLGLN S Q GY+ +G +EVN AA+A+N++GF
Sbjct  181   LRLSWDNGGQTM-QHNRQLPPQTEGFFQPLGLNSSPQFGYSPMGGNEVNAAATANNMNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>ref|XP_009598871.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana tomentosiformis]
Length=245

 Score =   377 bits (968),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 225/246 (91%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSMM+TLE+YQ+CSYA L+  Q A++ TQ+NYHEYLRLKARVELLQRSQRNLLGEDLG L
Sbjct  61    SSMMQTLEKYQQCSYASLDPMQSATNHTQSNYHEYLRLKARVELLQRSQRNLLGEDLGTL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ++KEL+ LE+QLE+SLKQIRSRKTQ+MLDQLA+LQQ+EQM+AE+NK L+RKLEE+ A IP
Sbjct  121   NSKELDHLEHQLESSLKQIRSRKTQNMLDQLADLQQKEQMMAEANKQLKRKLEESAARIP  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             +RLSW++G Q + Q NRQLPPQ+EGFFQPLGLN S Q GY+ +G +EVN AA+A+N++GF
Sbjct  181   IRLSWDNGGQTM-QHNRQLPPQTEGFFQPLGLNSSPQFGYSPMGGNEVNAAATANNMNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>ref|XP_010318407.1| PREDICTED: MADS-box protein 1 isoform X1 [Solanum lycopersicum]
Length=232

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 209/248 (84%), Gaps = 19/248 (8%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KT+E+YQRCSYA LEANQ  +DTQNNYHEYLRLKARVELLQRSQRN LGEDLG LS
Sbjct  61    SSMVKTIEKYQRCSYATLEANQSVTDTQNNYHEYLRLKARVELLQRSQRNFLGEDLGTLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +K+LEQLENQLE+SLKQIRSRKTQ MLDQLA+LQQ              KLEE+VAG PL
Sbjct  121   SKDLEQLENQLESSLKQIRSRKTQFMLDQLADLQQ--------------KLEESVAGFPL  166

Query  812   RLSWEDG--NQEIHQQNRQLPPQSEGFFQPLGLNISG-QIGYNSVGTDEVNVAASAHNIS  982
             RL WEDG  +Q +HQQNR   P +EGFFQPLGL+ S    GYN V TDEVN AA+AHN++
Sbjct  167   RLCWEDGGDHQLMHQQNR--LPNTEGFFQPLGLHSSSPHFGYNPVNTDEVNAAATAHNMN  224

Query  983   GFFPGWML  1006
             GF  GWML
Sbjct  225   GFIHGWML  232



>gb|ADU15479.1| SEP4 [Actinidia chinensis]
Length=245

 Score =   369 bits (946),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 210/248 (85%), Gaps = 6/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+V LKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSN GKLYEFCSS
Sbjct  1     MGRGRVVLKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNHGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLE+YQRCSY  L+A+QP  D++N+YHEYLRLK RVE+LQ+SQRNLLGEDLGPLS
Sbjct  61    SSMMKTLEKYQRCSYGSLDASQPVHDSENSYHEYLRLKTRVEILQQSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLE SLKQIRS KTQ+MLDQLA+LQ+REQMLAESNK LRRKLEE+ A IPL
Sbjct  121   TKELEQLEHQLEVSLKQIRSTKTQAMLDQLADLQRREQMLAESNKALRRKLEESTAEIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSV-GTDEVNVAASAHN--IS  982
             R SWE G Q I   +  +P QSE FFQPL LN S QIGYN   G  E+N  A A +  ++
Sbjct  181   RHSWEAGGQTIPYNH--VPAQSE-FFQPLRLNSSLQIGYNHAGGPTEMNAVAPAQDDPVN  237

Query  983   GFFPGWML  1006
             GF PGWML
Sbjct  238   GFIPGWML  245



>ref|XP_010260833.1| PREDICTED: MADS-box protein CMB1 [Nelumbo nucifera]
Length=243

 Score =   368 bits (945),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 181/245 (74%), Positives = 209/245 (85%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTL+RYQ+CSY  LE +QPA +TQ++Y EYL+LKARVE+LQRSQRNLLGEDLGPL+
Sbjct  61    SSMLKTLDRYQKCSYGALETSQPAKETQSSYQEYLKLKARVEVLQRSQRNLLGEDLGPLT  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLE SLKQIRS KTQ MLDQL++LQ++EQML E+N+ L+RKLEE+    PL
Sbjct  121   TKELEQLEHQLEMSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRTLKRKLEESSCENPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             RL+WE G Q I   +RQ   QSEGFFQPL  N + QIGYN VG D++ V     N++GF 
Sbjct  181   RLTWEAGGQNIS-YSRQ-AAQSEGFFQPLECNSTLQIGYNPVGPDQITVTTPTQNVNGFI  238

Query  992   PGWML  1006
             PGWML
Sbjct  239   PGWML  243



>gb|ADR83588.1| Sepallata 1-like protein [Platanus x acerifolia]
Length=244

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/246 (74%), Positives = 207/246 (84%), Gaps = 3/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SS-MMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SS M+KTL RYQRCSY  LEA+QP  +TQ++Y EYL+LKARVELLQRSQRNLLGEDLG L
Sbjct  61    SSSMLKTLGRYQRCSYGTLEASQPPKETQSSYQEYLKLKARVELLQRSQRNLLGEDLGSL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE+QLE SLKQ+RS KTQ MLDQL++LQ++E M  E+N+ LRRKL+E+    P
Sbjct  121   NTKELEQLEHQLEMSLKQVRSTKTQLMLDQLSDLQEKEHMPQEANRALRRKLDESSTENP  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LRLSWE G Q I   NRQ P QSEGFFQ L  N + QIGYN VG D++ V A A N++GF
Sbjct  181   LRLSWEAGGQNIP-YNRQ-PAQSEGFFQALECNSTLQIGYNPVGPDQITVTAPAQNVNGF  238

Query  989   FPGWML  1006
              PGWML
Sbjct  239   IPGWML  244



>ref|XP_004299281.1| PREDICTED: MADS-box protein CMB1-like [Fragaria vesca subsp. 
vesca]
Length=255

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 210/255 (82%), Gaps = 10/255 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSGRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SMMKTLE+YQRCSY  LEANQP ++TQN+Y EYLRLKARVE+LQRSQRNLLGEDLGPL+
Sbjct  61    LSMMKTLEKYQRCSYGALEANQPVNETQNSYQEYLRLKARVEVLQRSQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGIP  808
             TKELEQLE+QLE+SLK IRS KTQ MLD+L++LQ REQML E+NK LRRKLEE N+ G P
Sbjct  121   TKELEQLEHQLESSLKHIRSTKTQFMLDELSDLQNREQMLVETNKSLRRKLEETNLQGAP  180

Query  809   LRLSWED--GNQEIHQQNRQLPPQSEGFFQPL-GLNISG-QIGYNSVGTD-----EVNVA  961
             L L+W+   G   IH+ N + PPQS+GFFQ L G N S  Q+GY  +G+D     ++N  
Sbjct  181   LHLAWDGGYGQNNIHEHNSRFPPQSQGFFQQLQGNNNSAMQMGYTPLGSDHHHHQQMNAG  240

Query  962   ASAHNISGFFPGWML  1006
                 N++GF PGWML
Sbjct  241   NPGQNVNGFIPGWML  255



>gb|AEW50208.1| SEP1 [Acca sellowiana]
Length=245

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/246 (73%), Positives = 207/246 (84%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KT+E+YQ+CSY  LEAN   +D QN+Y EYL+LKARVE+LQRSQRNLLGEDLGPL+
Sbjct  61    SSMTKTIEKYQKCSYGSLEANCSINDMQNSYQEYLKLKARVEVLQRSQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLE SLKQIRS KTQ MLDQLA LQ +EQML E+N+ LR+KLEE+ A IPL
Sbjct  121   TKELEQLEHQLENSLKQIRSTKTQFMLDQLAHLQHKEQMLVEANRDLRKKLEESNARIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGF-FQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             RL WE  +      +R LPPQS+G  FQPLG N + QIGYN  G++E NV+A+  + +GF
Sbjct  181   RLGWEAEDHNSISYSR-LPPQSQGLIFQPLGDNPTLQIGYNPAGSNEANVSAADQHPNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>ref|XP_006354102.1| PREDICTED: MADS-box protein CMB1-like [Solanum tuberosum]
Length=248

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 215/249 (86%), Gaps = 5/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFS+RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSSRGKLYEFSSA  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMM TLE+YQ+CSYA L+   P SDTQ NY+EY+RLKARVELLQRSQRN+LGEDLG L+
Sbjct  61    SSMMTTLEKYQQCSYASLDPMLPVSDTQMNYNEYVRLKARVELLQRSQRNILGEDLGTLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QL+ASLK+IRS+KTQSMLDQLA+LQ++EQML E+NK LR KLEE+ A IPL
Sbjct  121   SKELEQLEHQLDASLKKIRSKKTQSMLDQLADLQEKEQMLEEANKQLRNKLEESAARIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQS-EGFFQPLGLNISG-QIGYN-SVGTD-EVNVAASAHNI  979
              LSW +   +  + NR LPPQ+ + FFQPLGLN S  Q+GYN ++G + EVN A +AHNI
Sbjct  181   GLSWGNNGGQTMEYNR-LPPQTAQPFFQPLGLNSSSPQLGYNPNMGANHEVNAATTAHNI  239

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  240   NGFIPGWML  248



>gb|AGW23594.1| MADS1 [Mangifera indica]
Length=254

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/254 (68%), Positives = 201/254 (79%), Gaps = 9/254 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLERYQRCSY  L+ N+  +++Q  Y EYL+LK  VE+LQRSQRNLLGEDLGPLS
Sbjct  61    SSMMKTLERYQRCSYGALDTNRTGNESQGTYQEYLKLKTTVEVLQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKEL+QLENQLE SLK IR+ KTQ M+DQL+ELQ+REQML E+NK LR+K EE  A +P 
Sbjct  121   TKELDQLENQLETSLKHIRTTKTQFMVDQLSELQKREQMLVETNKALRKKFEETGAQVPF  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYN------SVGTDEV---NVAA  964
             RL+W+    +    N +LP  SEGFFQPLG N +  +GYN      S G +EV   +VA 
Sbjct  181   RLAWDQAGVQNMAYNTRLPGHSEGFFQPLGANSTINMGYNPMAVVASSGAEEVVSFSVAG  240

Query  965   SAHNISGFFPGWML  1006
                 ++G+ PGWML
Sbjct  241   QTQTVNGYIPGWML  254



>ref|XP_008240082.1| PREDICTED: MADS-box protein CMB1-like [Prunus mume]
Length=251

 Score =   351 bits (900),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 176/251 (70%), Positives = 206/251 (82%), Gaps = 6/251 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM+KTLE+YQRCSY  LEAN+P +DTQN+Y EYL+LKARVE+LQ+SQRNLLGEDL PL+
Sbjct  61    MSMLKTLEKYQRCSYGSLEANRPVNDTQNSYQEYLKLKARVEVLQQSQRNLLGEDLAPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLEASL QIRS KTQ MLDQL +LQ +EQML E+NK LRRKLEE     P 
Sbjct  121   TKELEQLEHQLEASLNQIRSTKTQFMLDQLCDLQNKEQMLVEANKALRRKLEETSGQAPP  180

Query  812   RLSWE-DGNQEIHQQNRQLP--PQSEGFFQPLGLNISGQIGYNSVGTD---EVNVAASAH  973
              L+WE  G+   + Q+ +LP  P S+GFF PLG N + QIGY  +G+D   ++NV     
Sbjct  181   PLAWEAAGHGNNNDQHTRLPHHPHSQGFFHPLGNNSTSQIGYTPLGSDHHEQMNVGNHGQ  240

Query  974   NISGFFPGWML  1006
             +++GF PGWML
Sbjct  241   HVNGFIPGWML  251



>ref|NP_001275579.1| MADS-box protein CMB1-like [Solanum lycopersicum]
 gb|AHB86542.1| MADS-box protein EBI [Solanum lycopersicum]
Length=250

 Score =   348 bits (893),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 180/251 (72%), Positives = 212/251 (84%), Gaps = 7/251 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFS+RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSSRGKLYEFSSA  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMM TLE+YQ+CSYA L+   P SDTQ NY+EY+RLKARVELLQRSQR++LGEDLG L+
Sbjct  61    SSMMTTLEKYQQCSYASLDPMLPVSDTQMNYNEYVRLKARVELLQRSQRHILGEDLGTLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QL+ASLK++RS+KTQSMLDQLA+LQ++EQML E+NK L+ KLEE+ A IPL
Sbjct  121   SKELEQLEHQLDASLKKVRSKKTQSMLDQLADLQEKEQMLEEANKQLKNKLEESAARIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEG--FFQPLGLNISG-QIGYN-SVGTD--EVNVAASAH  973
              LSW +   +  + NR LPPQ+    FFQPL LN S  Q GYN ++G +  EVN A +AH
Sbjct  181   GLSWGNNGGQTMEYNR-LPPQTTAQPFFQPLRLNSSSPQFGYNPNMGANDHEVNAATTAH  239

Query  974   NISGFFPGWML  1006
             NI+GF PGWML
Sbjct  240   NINGFIPGWML  250



>ref|XP_007209505.1| hypothetical protein PRUPE_ppa010391mg [Prunus persica]
 gb|AAZ16241.1| MADS box protein [Prunus persica]
 gb|EMJ10704.1| hypothetical protein PRUPE_ppa010391mg [Prunus persica]
Length=251

 Score =   348 bits (893),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 173/251 (69%), Positives = 201/251 (80%), Gaps = 6/251 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM+KTLE+YQRCSY  LEAN+P ++TQN+Y EYL+LKARVE+LQ+SQRNLLGEDL PL+
Sbjct  61    MSMLKTLEKYQRCSYGSLEANRPVNETQNSYQEYLKLKARVEVLQQSQRNLLGEDLAPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLEASL QIRS KTQ MLDQL +LQ +EQML E+NK LRRKLEE     P 
Sbjct  121   TKELEQLEHQLEASLNQIRSTKTQFMLDQLCDLQNKEQMLVEANKALRRKLEETSGQAPP  180

Query  812   RLSWE---DGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTD---EVNVAASAH  973
              L+WE    GN  +        P S+GFF PLG N + QIGY  +G+D   ++NV     
Sbjct  181   LLAWEAAGHGNNNVQHTGLPHHPHSQGFFHPLGNNSTSQIGYTPLGSDHHEQMNVGNHGQ  240

Query  974   NISGFFPGWML  1006
             +++GF PGWML
Sbjct  241   HVNGFIPGWML  251



>gb|AIU94287.1| SEPALLATA1-like protein [Prunus pseudocerasus]
Length=251

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 206/251 (82%), Gaps = 6/251 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM+KTLE+YQRCSY  LEAN+P ++TQN+Y EYL+LKARVE+LQ+SQRNLLGEDL PL+
Sbjct  61    LSMLKTLEKYQRCSYGSLEANKPVNETQNSYQEYLKLKARVEVLQQSQRNLLGEDLAPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLEASL QIRS KTQ MLDQL +LQ +EQML E+NK LRRK+EE     P 
Sbjct  121   TKELEQLEHQLEASLNQIRSTKTQFMLDQLCDLQNKEQMLVEANKALRRKMEETSGQAPP  180

Query  812   RLSWE-DGNQEIHQQNRQLP--PQSEGFFQPLGLNISGQIGYNSVGT---DEVNVAASAH  973
              L+WE  G+   + Q+ +LP  P S+GFF PLG N + QIGY  +G+   D++NV     
Sbjct  181   LLAWEAAGHGHNNVQHTRLPHHPHSQGFFHPLGNNSTSQIGYTPLGSDHHDQMNVGNHGQ  240

Query  974   NISGFFPGWML  1006
             +++GF PGWML
Sbjct  241   HVNGFIPGWML  251



>gb|ADD25190.1| SEP1, partial [Nelumbo nucifera]
Length=230

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 201/232 (87%), Gaps = 2/232 (1%)
 Frame = +2

Query  311   KINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRC  490
             KINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSSM+KTLERYQ+C
Sbjct  1     KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKC  60

Query  491   SYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEA  670
             SY  LEA+QPA +TQ++Y EYL+LKARVE+LQRSQRNLLGEDLGPLSTKELEQLE+QLE 
Sbjct  61    SYGALEASQPAKETQSSYQEYLKLKARVEVLQRSQRNLLGEDLGPLSTKELEQLEHQLEM  120

Query  671   SLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQ  850
             SLKQIRS KTQ MLDQL++LQ++EQML E+N+ L+RKL+E+ +  PLRL+WE G  + H 
Sbjct  121   SLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRDLKRKLDESSSENPLRLTWEAGGAK-HL  179

Query  851   QNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFPGWML  1006
              +RQ P QSEG F PL  N + QIGYN VG D++ VAASA N++G+ PGWML
Sbjct  180   YSRQ-PSQSEGVFPPLEGNSTWQIGYNPVGPDQITVAASAQNVNGYIPGWML  230



>gb|ADC79693.1| SEPALLATA1-like protein [Akebia trifoliata]
Length=246

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 206/248 (83%), Gaps = 5/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VEL+RIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS
Sbjct  1     MGRGRVELRRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTL+RYQ+CSY  LEA+ P  DTQNNY EYLRLKARVE+LQ++QRNLLGEDLGPL+
Sbjct  61    SSMLKTLDRYQKCSYGTLEASMPPKDTQNNYQEYLRLKARVEVLQQTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP-  808
             TKEL+QLENQLE SL+ IRS KTQ + DQL++LQ++EQML E+N+ LRRKL+EN   IP 
Sbjct  121   TKELDQLENQLETSLRTIRSTKTQFLFDQLSDLQRKEQMLHEANRTLRRKLDENSTEIPN  180

Query  809   LRLSWE-DGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVA-ASAHNIS  982
             L+LSW+  G Q +    + LP  S+GFFQPL  N + QIGYN V  D++N    SA N++
Sbjct  181   LQLSWDASGGQNMAYGRQNLP--SDGFFQPLECNSTLQIGYNPVDQDQINNGQTSAQNVN  238

Query  983   GFFPGWML  1006
              F PGWML
Sbjct  239   CFIPGWML  246



>emb|CAX65570.1| GRCD4 protein [Gerbera hybrid cultivar]
Length=249

 Score =   346 bits (887),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 176/251 (70%), Positives = 207/251 (82%), Gaps = 8/251 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLE+Y  CSY  L+A+QP +++Q NYHEYLRLKARVE+LQRSQRNLLGEDL PL+
Sbjct  61    SSMVKTLEKYHSCSYGSLKASQPENESQYNYHEYLRLKARVEVLQRSQRNLLGEDLAPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLE SL++IRS KTQSMLDQLA+LQ++EQ+LAE+NK LR+KLEE+    P+
Sbjct  121   TKELEQLEHQLEMSLRKIRSTKTQSMLDQLADLQRKEQVLAETNKALRKKLEESAQEYPV  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQ-----IGYNSVGTDEVNVAASAHN  976
             R  WE G Q I      LP  S+ FFQPLGLN +       + YN + +DE+NVA + +N
Sbjct  181   RQMWEGGAQTIPYN--PLPTHSDEFFQPLGLNSTMHNSFNGLRYNPIVSDEMNVAGANNN  238

Query  977   -ISGFFPGWML  1006
               +G FPGWML
Sbjct  239   SPNGLFPGWML  249



>gb|AFX72877.1| MADS-box protein SEP2A [Aquilegia coerulea]
Length=243

 Score =   346 bits (887),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 174/245 (71%), Positives = 202/245 (82%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTL++YQ+ SYA LE +  A +TQNNY EYLRLKARVE+LQ+SQRNLLGE+LG LS
Sbjct  61    SSMLKTLDKYQKSSYAALETSTSAKETQNNYQEYLRLKARVEILQQSQRNLLGEELGSLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKEL+QLE+QL+ SLKQIR  KTQ MLDQL++LQ +EQ+L E+N  LRRKL+E +A   L
Sbjct  121   TKELDQLEHQLDMSLKQIRCTKTQFMLDQLSDLQGKEQVLEEANSSLRRKLDERIAENAL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             RL W  G Q I    RQ P QSE FFQPLG N +  +GYN VG +++ VAA A NI+GF 
Sbjct  181   RLPWASGEQNIP-YCRQ-PAQSEEFFQPLGCNSTLHVGYNHVGPEQITVAAPAQNINGFI  238

Query  992   PGWML  1006
             PGWM+
Sbjct  239   PGWMV  243



>gb|KCW48935.1| hypothetical protein EUGRSUZ_K02546 [Eucalyptus grandis]
Length=245

 Score =   344 bits (883),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/246 (71%), Positives = 204/246 (83%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKT+E+YQ+CSY  LE N   ++ QN+Y +YL+LK RVE+LQRSQRNLLGE+LGPL+
Sbjct  61    SSMMKTIEKYQKCSYGSLETNCSINEMQNSYQDYLKLKTRVEVLQRSQRNLLGEELGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QLE SLKQIRS KTQ M DQLA LQ +EQML E+N+ LR+KLEE+   IPL
Sbjct  121   SKELEQLEHQLENSLKQIRSAKTQFMFDQLAHLQHKEQMLVEANRELRKKLEESNTRIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGF-FQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             RL WE  +      +R LP QS+G  FQPLG N + QIGYN  G++E+NV+A+  + +GF
Sbjct  181   RLGWEAEDHNNISYSR-LPTQSQGLIFQPLGGNPTLQIGYNPAGSNELNVSAADQHPNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>gb|ADC79707.1| SEPALLATA1-like protein [Euptelea pleiosperma]
Length=243

 Score =   344 bits (882),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/245 (73%), Positives = 211/245 (86%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEV LIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVGLIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             +SM+KTL+RYQ+CSY  LEA+ P  DTQ++YHEYL+LKARVE+LQRSQRNLLGEDLG L+
Sbjct  61    NSMLKTLDRYQKCSYGALEASMPPKDTQSSYHEYLKLKARVEVLQRSQRNLLGEDLGSLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLE SLKQIRS KTQ +LDQL++LQ++EQ L E+N+ LRRKL+E+   IPL
Sbjct  121   TKELEQLEHQLEMSLKQIRSTKTQLLLDQLSDLQRQEQHLQETNRALRRKLDESSGEIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             +LSWE G Q I   +RQ P QSE FFQPL  N + QIGY+ +G D++N+AA A N++GF 
Sbjct  181   QLSWETGAQNI-SYSRQ-PAQSERFFQPLECNSTLQIGYHPLGPDQLNIAAPAQNVNGFI  238

Query  992   PGWML  1006
             PGWML
Sbjct  239   PGWML  243



>ref|XP_007037631.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY22132.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=407

 Score =   349 bits (896),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 180/237 (76%), Positives = 204/237 (86%), Gaps = 2/237 (1%)
 Frame = +2

Query  272  MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452  SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
            SSMMKTLE+YQ+CSY+ ++ ++ AS+TQ++Y EYL+LKARVE+LQRSQRNLLGEDLGPL+
Sbjct  61   SSMMKTLEKYQKCSYSTVDTSRSASETQSSYQEYLKLKARVEVLQRSQRNLLGEDLGPLN  120

Query  632  TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
            TKELEQLENQLE SLKQIRS K+Q+MLDQL +LQ REQML E+NK LRRKLEE  A   L
Sbjct  121  TKELEQLENQLETSLKQIRSTKSQAMLDQLGDLQNREQMLVETNKSLRRKLEELSAQPHL  180

Query  812  RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNIS  982
            RL+WE G Q I   NR LP QSEGFFQ LG + S QIGYN V +DE+NVAA   N S
Sbjct  181  RLAWETGGQNIP-YNR-LPAQSEGFFQLLGGSSSLQIGYNPVVSDEMNVAAQNQNSS  235


 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 130/186 (70%), Gaps = 21/186 (11%)
 Frame = +2

Query  506   EANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLKQI  685
             E N  A +  ++Y E L+LKARVE+LQRSQRNLLGEDLGPL+TKELEQLENQLE SLKQI
Sbjct  224   EMNVAAQNQNSSYQECLKLKARVEVLQRSQRNLLGEDLGPLNTKELEQLENQLETSLKQI  283

Query  686   RSRKTQSMLDQLAELQQREQMLAESNKLLRRK-------------------LEENVAGIP  808
             RS K+Q+MLDQL +LQ REQML E+NK LRRK                   LEE  A  P
Sbjct  284   RSTKSQAMLDQLGDLQNREQMLVETNKSLRRKYSASLLSTVLILVQILFHLLEELSAQPP  343

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
              RL+WE G Q I   NR LP QSEGFFQ LG + S +IGYN V +DE+NVAA   N+ G+
Sbjct  344   FRLAWETGGQNIP-YNR-LPAQSEGFFQLLGGSSSFRIGYNPVVSDEMNVAAQNQNVCGY  401

Query  989   FPGWML  1006
             FPGWML
Sbjct  402   FPGWML  407



>dbj|BAM71399.1| transcription factor [Pyrus pyrifolia]
Length=249

 Score =   341 bits (875),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 202/251 (80%), Gaps = 8/251 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SMMKTLE+YQ CSY  LEAN PA++TQN+Y +YL LKARVE+LQ+SQRNLLGEDL PL+
Sbjct  61    FSMMKTLEKYQSCSYGSLEANLPANETQNSYQDYLTLKARVEVLQQSQRNLLGEDLQPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELE LE+QLE SLKQIRSRKTQ +LDQL++LQ REQML E+NK L+RKLEE     P 
Sbjct  121   TKELEHLEHQLETSLKQIRSRKTQFILDQLSDLQNREQMLVEANKSLKRKLEETSVQAPE  180

Query  812   RLSWE----DGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGYNSVGTD-EVNVAASAH  973
              ++WE    D N  I QQ R LP  SE FF PL G N S QIGY  +G+D E+NV     
Sbjct  181   GMAWEAAGHDHNYNI-QQTR-LPSHSEAFFHPLEGNNSSSQIGYTHMGSDNEMNVGNPGQ  238

Query  974   NISGFFPGWML  1006
              ++GF PGWML
Sbjct  239   YVNGFIPGWML  249



>gb|AAD09206.1| putative MADS-box family transcription factor [Pinus radiata]
Length=245

 Score =   340 bits (873),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 204/248 (82%), Gaps = 6/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKT+E+YQ+CSY  LE N   ++ QN+Y +YL LKARVE+LQRSQRNLLGE+LGPL+
Sbjct  61    SSMMKTIEKYQKCSYGSLETNCSINEMQNSYQDYLELKARVEVLQRSQRNLLGEELGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QLE SLKQIRS KTQ M DQLA LQ +EQML E+N+ LR+KLEE+   IPL
Sbjct  121   SKELEQLEHQLENSLKQIRSAKTQFMFDQLAHLQHKEQMLVEANRELRKKLEESNTRIPL  180

Query  812   RLSW--EDGNQEIHQQNRQLPPQSEGF-FQPLGLNISGQIGYNSVGTDEVNVAASAHNIS  982
             RL W  ED N   +   R+LP QS+G  FQPLG   + QIGYN  G++E+NV+ +  + +
Sbjct  181   RLGWEAEDHNNISY---RRLPTQSQGLIFQPLGGYPNMQIGYNPAGSNELNVSPADQHPN  237

Query  983   GFFPGWML  1006
             GF PGWML
Sbjct  238   GFIPGWML  245



>ref|XP_009337956.1| PREDICTED: MADS-box protein CMB1-like [Pyrus x bretschneideri]
Length=249

 Score =   340 bits (873),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 200/250 (80%), Gaps = 6/250 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SMMKTLE+YQ CSY  LEAN PA++TQN+Y +YL LKARVE+LQ+SQRNLLGEDL PL+
Sbjct  61    FSMMKTLEKYQSCSYGSLEANLPANETQNSYQDYLTLKARVEVLQQSQRNLLGEDLQPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELE LE+QLE SLKQIRSRKTQ +LDQL++LQ REQML E+NK L+RKLEE     P 
Sbjct  121   TKELEHLEHQLETSLKQIRSRKTQFILDQLSDLQNREQMLVEANKSLKRKLEETSVQAPE  180

Query  812   RLSWEDGNQEIHQQNRQ---LPPQSEGFFQPL-GLNISGQIGYNSVGTD-EVNVAASAHN  976
              ++WE    + H  N Q   LP  SE FF PL G N S QIGY  +G+D E+NV      
Sbjct  181   GMAWEAAGHD-HNYNIQLTRLPSHSEAFFHPLEGNNSSSQIGYTHMGSDNEMNVGNPGQY  239

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  240   VNGFIPGWML  249



>gb|AJC01940.1| MADS-box protein [Ficus carica]
Length=248

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 200/248 (81%), Gaps = 3/248 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LC+AEVALIIFSNRGKLYEFCS 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLE+Y + SY  LEA QP +DTQ++Y EYL+LK RVE+LQRSQRNLLGEDLGPLS
Sbjct  61    SSMVKTLEKYHKYSYGSLEATQPTNDTQSSYQEYLKLKTRVEVLQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE--NVAGI  805
             +KELE LENQLE SL+ IRS +TQSMLDQLA LQQRE  L E+N+ LRR+LEE  N A I
Sbjct  121   SKELEHLENQLETSLRHIRSTRTQSMLDQLANLQQREHTLLEANRALRRQLEENNNSAQI  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISG-QIGYNSVGTDEVNVAASAHNIS  982
             PLRL+WE   ++      + P Q E FFQPLG N +  QIG NS+G D +NV A A + +
Sbjct  181   PLRLAWEAAGEQDSIPFTRHPTQPEWFFQPLGSNSAALQIGNNSMGPDGMNVGAQAQSFN  240

Query  983   GFFPGWML  1006
             G+  GWML
Sbjct  241   GYVHGWML  248



>gb|KHG12954.1| MADS-box CMB1 [Gossypium arboreum]
Length=247

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 200/247 (81%), Gaps = 2/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM KTLE+YQ+CSY+ L+ ++  S+TQN+Y EYL+LKARVE+LQ SQRNLLGEDLGPL 
Sbjct  61    PSMTKTLEKYQKCSYSTLDNSRSISETQNSYQEYLKLKARVEVLQTSQRNLLGEDLGPLD  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KEL+QLE+QLEASLKQIRS K Q+MLDQL +L  RE++L ++NK LRRKLEE    +P 
Sbjct  121   SKELDQLEHQLEASLKQIRSTKVQAMLDQLNDLHNREKLLMDANKSLRRKLEELSTQVPQ  180

Query  812   RLSWED-GNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVAASAHNISG  985
               +W++ G   I   N     QSE FF PLG N S QIGY N V +DE+N A  + N++G
Sbjct  181   GPAWDNIGGPSIPPYNHLTEAQSEAFFHPLGANCSSQIGYSNDVVSDEMNAAVHSQNVNG  240

Query  986   FFPGWML  1006
             +FPGWML
Sbjct  241   YFPGWML  247



>ref|XP_002263039.1| PREDICTED: MADS-box protein CMB1 isoform X2 [Vitis vinifera]
 emb|CBI15338.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   339 bits (869),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/247 (69%), Positives = 205/247 (83%), Gaps = 5/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS+RGKLYEFCS 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              SM KTLE+YQ+CSY  LEA+QP  + TQ++Y EYL+LK RVE+LQRSQR+LLGEDL PL
Sbjct  61    PSMAKTLEKYQKCSYGALEASQPVYELTQSSYQEYLKLKTRVEVLQRSQRHLLGEDLDPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE+QLE SLKQIRS KTQ+MLDQLA+LQ +E ML E+N  LRRKLEE+    P
Sbjct  121   NTKELEQLEHQLEMSLKQIRSTKTQNMLDQLADLQNKEHMLIEANNALRRKLEESNGKHP  180

Query  809   LRLSWE-DGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
             L+ SWE  GN  ++    +LP QSEGFFQPL  N + ++GYN+ G++E+ +AA + N +G
Sbjct  181   LQQSWEAAGNSALYS---RLPAQSEGFFQPLERNSTLEMGYNAAGSNEITLAAPSQNDNG  237

Query  986   FFPGWML  1006
             F PGWML
Sbjct  238   FGPGWML  244



>ref|XP_006477714.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X4 
[Citrus sinensis]
Length=249

 Score =   338 bits (868),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              S+MKTLERY RCS+   EAN+P  +TQ+ Y EYLRLK  VELLQRSQRNLLGEDL PLS
Sbjct  61    PSIMKTLERYHRCSFGAHEANRPPIETQSTYQEYLRLKTAVELLQRSQRNLLGEDLDPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAG--  802
             TKELEQLE+QLE SLK +RS KTQ M+DQL++LQ+REQ+L E NK LR+KL+E N+A   
Sbjct  121   TKELEQLEHQLETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDESNIAHQV  180

Query  803   IPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGYNSVGTDEVNVAASAHNI  979
              P RL+WE  +   +    + P QSEGFFQPL G N   QIGYN +G++E ++   A N+
Sbjct  181   PPHRLAWEAASAGQNITYNRYPVQSEGFFQPLSGGNPILQIGYNPMGSEEAHIPVHAQNV  240

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  241   TGFIPGWML  249



>ref|XP_010660492.1| PREDICTED: MADS-box protein 2 isoform X1 [Vitis vinifera]
 emb|CBI16936.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 202/248 (81%), Gaps = 8/248 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+CSY  +E ++P+ + +++Y EYL+LK++ E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCSYGAVEVSRPSKELESSYREYLKLKSKFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QLE SLKQ+RS KTQ MLDQL++LQ +EQ+L ESNK L RKL+E      L
Sbjct  121   TKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKALTRKLDEISVKNHL  180

Query  812   RLSWEDGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNIS  982
             +LSWE G Q +   HQQ      QS+GFFQPL  N + QIGYN  G+ +++  ++A N++
Sbjct  181   QLSWESGEQSMPYGHQQ-----AQSQGFFQPLECNPTLQIGYNPAGSSQLSAPSNAQNVN  235

Query  983   GFFPGWML  1006
             GF PGWML
Sbjct  236   GFIPGWML  243



>gb|AGW23350.1| MADS box protein MADS48 [Gossypium hirsutum]
Length=247

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/247 (68%), Positives = 198/247 (80%), Gaps = 2/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAE ALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEAALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM KTLE+YQ+CSY+ L+ +   S+TQN+Y EYL+LKARVE+LQ SQRNLLGEDLGPL 
Sbjct  61    PSMTKTLEKYQKCSYSTLDNSSSISETQNSYQEYLKLKARVEVLQTSQRNLLGEDLGPLD  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KEL+QLE+QLEASLKQIRS K Q+MLDQL +L  RE++L ++NK LRRKLEE    +P 
Sbjct  121   SKELDQLEHQLEASLKQIRSTKVQAMLDQLNDLHNREKLLTDANKSLRRKLEELSTQVPQ  180

Query  812   RLSWED-GNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVAASAHNISG  985
               +W++ G   I   N     QSE FF PLG N S QIGY N V +DE+N A  + N++G
Sbjct  181   GPAWDNIGGPCIPPYNHLTEAQSEAFFHPLGANCSSQIGYSNDVVSDEMNAAVHSQNVNG  240

Query  986   FFPGWML  1006
             +FPGWML
Sbjct  241   YFPGWML  247



>ref|XP_006440806.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
 gb|ESR54046.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
Length=300

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  52    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  111

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              S+MKTLERY RCS+  LEAN+P  +TQ+ Y EYLRLK  VELLQRSQRNLLGEDL PLS
Sbjct  112   PSIMKTLERYHRCSFGALEANRPPIETQSTYQEYLRLKTAVELLQRSQRNLLGEDLEPLS  171

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAG--  802
             TKELEQLE+QLE SLK +RS KTQ M+DQL++LQ+REQ+L E NK LR+KL+E N+A   
Sbjct  172   TKELEQLEHQLETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDESNIAHQV  231

Query  803   IPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGYNSVGTDEVNVAASAHNI  979
              P RL+WE  +   +    + P QSEGFFQPL G     QIGYN +G++E ++   A N+
Sbjct  232   PPHRLAWEAASAGQNITYNRYPVQSEGFFQPLSGGTPILQIGYNPMGSEEAHIPVHAQNV  291

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  292   TGFIPGWML  300



>gb|ADC79694.1| SEPALLATA1-like protein [Akebia trifoliata]
Length=243

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 200/248 (81%), Gaps = 8/248 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVA+IIFS+RGKL+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVAVIIFSSRGKLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERYQ+C+Y  +EA+  A++T+++Y +YLRLKARVE+LQ+SQRNLLGE+LG L 
Sbjct  61    SSMSKTLERYQQCNYRAVEASTSANETESSYQDYLRLKARVEVLQQSQRNLLGEELGSLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             T ELEQLE+QLE SL Q+RS KTQ MLDQL +LQ++EQML E+N+ LRRKL+E     P 
Sbjct  121   TGELEQLEHQLEMSLNQVRSTKTQFMLDQLTDLQRKEQMLQEANRTLRRKLDERSTENPY  180

Query  812   RLSWEDGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNIS  982
              LSWE G Q I   HQ     P QSEGFFQPL  N   QIGYN+   D++ VAA   NI+
Sbjct  181   TLSWEAGGQNIPYSHQ-----PAQSEGFFQPLQCNSMLQIGYNTGSPDQLTVAAPTQNIN  235

Query  983   GFFPGWML  1006
             GF PGWML
Sbjct  236   GFIPGWML  243



>ref|XP_007155209.1| hypothetical protein PHAVU_003G182800g [Phaseolus vulgaris]
 gb|ESW27203.1| hypothetical protein PHAVU_003G182800g [Phaseolus vulgaris]
Length=243

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/246 (68%), Positives = 199/246 (81%), Gaps = 4/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLE+YQ+ SY+ LE  +P +D Q NY EYLRLKARVE+LQRSQRNLLGEDL  ++
Sbjct  61    SSMVKTLEKYQKYSYSALETTRPINDIQ-NYQEYLRLKARVEILQRSQRNLLGEDLAQMN  119

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGIP  808
             T +LEQLENQLE +LK IRS KTQ MLDQLA+L  RE +L E+N +LR KLEE N + +P
Sbjct  120   TTDLEQLENQLETALKNIRSTKTQFMLDQLADLHHRETLLVETNNVLRSKLEETNNSQVP  179

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             + L+ E G   IH  N   PPQSEGFFQ +G+N + QIG+N +G D+ NV AS+ ++ GF
Sbjct  180   VSLALEAGGSNIHYTN--FPPQSEGFFQAMGVNPNLQIGFNQIGPDDANVGASSLSMHGF  237

Query  989   FPGWML  1006
               GWML
Sbjct  238   ASGWML  243



>emb|CAA04323.1| MADS-box protein [Malus domestica]
Length=248

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 200/248 (81%), Gaps = 3/248 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SMMKTLE+YQ CSY  LEAN PA++TQN+Y +YL LKARVE+LQ+SQRNLLGEDL  L+
Sbjct  61    FSMMKTLEKYQSCSYGSLEANLPANETQNSYQDYLMLKARVEVLQQSQRNLLGEDLSHLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELE LE+QLE SLKQIRSRKTQ +LDQL++LQ REQML E+NK L+RKLEE     P 
Sbjct  121   TKELEHLEHQLETSLKQIRSRKTQFILDQLSDLQNREQMLVEANKALKRKLEETSVHAPE  180

Query  812   RLSWE-DGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGYNSVGTD-EVNVAASAHNIS  982
              ++WE  G+   + Q  +LP  SE FF PL G N S QIGY  +G+D E+NV      ++
Sbjct  181   GMAWEAAGHGPNNIQQTRLPSHSEAFFHPLEGNNSSSQIGYTHMGSDNEMNVGNPGQYVN  240

Query  983   GFFPGWML  1006
             G+ PGWML
Sbjct  241   GYIPGWML  248



>ref|NP_001281016.1| MADS-box protein CMB1-like [Malus domestica]
 gb|AAD51422.1|U78949_1 MADS-box protein 3 [Malus domestica]
 gb|ADL36749.1| MADS domain class transcription factor [Malus domestica]
Length=248

 Score =   336 bits (861),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 200/248 (81%), Gaps = 3/248 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SMMKTLE+YQ CSY  LEAN PA++TQN+Y +YL LKARVE+LQ+SQRNLLGEDL  L+
Sbjct  61    FSMMKTLEKYQSCSYGSLEANLPANETQNSYQDYLMLKARVEVLQQSQRNLLGEDLSHLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELE LE+QLE SLKQIRSRKTQ +LDQL++LQ REQML E+NK L+RKLEE     P 
Sbjct  121   TKELEHLEHQLETSLKQIRSRKTQFILDQLSDLQNREQMLVEANKALKRKLEETSVQAPE  180

Query  812   RLSWE-DGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGYNSVGTD-EVNVAASAHNIS  982
              ++WE  G+   + Q  +LP  SE FF PL G N S QIGY  +G+D E+NV      ++
Sbjct  181   GMAWEAAGHGPNNIQQTRLPSHSEAFFHPLEGNNSSSQIGYTHMGSDNEMNVGNPGQYVN  240

Query  983   GFFPGWML  1006
             G+ PGWML
Sbjct  241   GYIPGWML  248



>ref|XP_008811037.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Phoenix dactylifera]
Length=245

 Score =   335 bits (860),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 203/246 (83%), Gaps = 3/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF+KRRNGLLKKAYELS+LCD EVA IIFSNRG+L+EFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDVEVAAIIFSNRGRLFEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM++T+ERYQ+CSY   +A  P  +TQN+YHEYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLETIERYQKCSYNASDAIVPPKETQNSYHEYLKLKARVEFLQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQL+NQ+E SLK IRS KTQ MLDQL +++++EQML E+NK LRRKLEE     PL
Sbjct  121   VKELEQLDNQIEISLKHIRSTKTQLMLDQLCDVKRKEQMLQEANKALRRKLEEGTNN-PL  179

Query  812   RLSWEDGNQEI-HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNV-AASAHNISG  985
             +LSW++G  ++ +    + PPQS+GFFQPLG   S QIGY+ V  D++N  AA+  N++G
Sbjct  180   QLSWQNGANDVGNAPCGREPPQSQGFFQPLGCEPSLQIGYHPVCIDQLNTEAAATQNVNG  239

Query  986   FFPGWM  1003
             +FP W+
Sbjct  240   YFPWWI  245



>ref|NP_001268109.1| MADS-box protein 2 [Vitis vinifera]
 gb|AAM21342.1|AF373601_1 MADS-box protein 2 [Vitis vinifera]
Length=244

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 202/249 (81%), Gaps = 9/249 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSM+KTLERYQ+CSY  +E ++P+ +  Q++Y EYL+LK++ E LQR+QRNLLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVSRPSKELEQSSYREYLKLKSKFEALQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLE SLKQ+RS KTQ MLDQL++LQ +EQ+L ESNK L RKL+E      
Sbjct  121   NTKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKALTRKLDEISVKNH  180

Query  809   LRLSWEDGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNI  979
             L+LSWE G Q +   HQQ      QS+GFFQPL  N + QIGYN  G+ +++  ++A N+
Sbjct  181   LQLSWESGEQSMPYGHQQ-----AQSQGFFQPLECNPTLQIGYNPAGSSQLSAPSNAQNV  235

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  236   NGFIPGWML  244



>gb|AFO68782.1| floral-binding protein 9, partial [Nyssa sylvatica]
Length=218

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 187/220 (85%), Gaps = 2/220 (1%)
 Frame = +2

Query  347   NGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYAHLEANQPAS  526
             NGL KKAYELS+LCDAEVALI+FSNRGKLYEFCSSSSM+KTLERYQRCSY  LEA+QP +
Sbjct  1     NGLFKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMLKTLERYQRCSYGSLEASQPVN  60

Query  527   DTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLKQIRSRKTQS  706
             D QN YHEYLRLKARVE+LQ+SQRNLLGEDLGPL+TKELEQLE+QLE SLKQIRS KTQ 
Sbjct  61    DNQNGYHEYLRLKARVEVLQQSQRNLLGEDLGPLNTKELEQLEHQLEMSLKQIRSTKTQF  120

Query  707   MLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQQNRQLPPQSEGF  886
             MLDQL +LQ+REQMLAESNK LRRKLEE    IPL+LSWE G Q I   NR LP QSEGF
Sbjct  121   MLDQLTDLQRREQMLAESNKALRRKLEETTVQIPLQLSWEAGGQAI-PYNR-LPAQSEGF  178

Query  887   FQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFPGWML  1006
             FQPLGLN +   G N VG+DE+N+AA   +++G+ PGWML
Sbjct  179   FQPLGLNSTLPNGNNPVGSDEMNMAAPVQHVNGYIPGWML  218



>ref|XP_006477713.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Citrus sinensis]
Length=250

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 201/250 (80%), Gaps = 5/250 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              S+MKTLERY RCS+   EAN+P  +T Q+ Y EYLRLK  VELLQRSQRNLLGEDL PL
Sbjct  61    PSIMKTLERYHRCSFGAHEANRPPIETQQSTYQEYLRLKTAVELLQRSQRNLLGEDLDPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAG-  802
             STKELEQLE+QLE SLK +RS KTQ M+DQL++LQ+REQ+L E NK LR+KL+E N+A  
Sbjct  121   STKELEQLEHQLETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDESNIAHQ  180

Query  803   -IPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGYNSVGTDEVNVAASAHN  976
               P RL+WE  +   +    + P QSEGFFQPL G N   QIGYN +G++E ++   A N
Sbjct  181   VPPHRLAWEAASAGQNITYNRYPVQSEGFFQPLSGGNPILQIGYNPMGSEEAHIPVHAQN  240

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  241   VTGFIPGWML  250



>gb|KHN15201.1| MADS-box protein CMB1 [Glycine soja]
Length=243

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 168/246 (68%), Positives = 199/246 (81%), Gaps = 4/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLE+YQ+ SY+ LE  +P +DTQ NY EYLRLKARVE+LQRSQRNLLGEDL  ++
Sbjct  61    SSMMKTLEKYQKYSYSALETTRPINDTQ-NYQEYLRLKARVEVLQRSQRNLLGEDLAQMN  119

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGIP  808
             T ELEQLENQLEA+L+ IRS KTQ MLDQL++L  RE +L E+N +LR KLEE + + + 
Sbjct  120   TNELEQLENQLEAALRNIRSTKTQFMLDQLSDLHHRETLLIETNNVLRSKLEETDHSQVQ  179

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             + L+ E G   I   N   PPQSEGFF+P+G+N + QIGYN  G D+ NV AS+ ++ GF
Sbjct  180   VSLALEAGGPSIQYTN--FPPQSEGFFEPVGVNPTLQIGYNQTGPDDTNVGASSLSMHGF  237

Query  989   FPGWML  1006
               GWML
Sbjct  238   ASGWML  243



>ref|XP_002263410.2| PREDICTED: MADS-box protein CMB1 [Vitis vinifera]
 emb|CBI27319.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   333 bits (853),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 169/245 (69%), Positives = 201/245 (82%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS 
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM +TLERYQRCSY+ LEA+QPA +TQN+Y EYL+LK++VE+LQR+QRN LGEDLG L 
Sbjct  61    SSMPETLERYQRCSYSALEASQPAKETQNSYQEYLKLKSKVEVLQRTQRNFLGEDLGHLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QL+ SLKQIRS KTQ MLDQL++LQ++EQ+L E+N  LRRKL E+ A   L
Sbjct  121   TKELEQLEHQLDKSLKQIRSTKTQFMLDQLSDLQRKEQILMEANNALRRKLGESSAESGL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
               +WE     +   NR+ P QSE FF+PL  + + QIGYN V   E+N A++  N++GF 
Sbjct  181   GSTWEAAAHNL-PYNRE-PVQSEDFFEPLQCDSTLQIGYNPVLRVEMNGASTTQNVNGFI  238

Query  992   PGWML  1006
             PGWM+
Sbjct  239   PGWMV  243



>ref|XP_007215876.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
 gb|EMJ17075.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
Length=244

 Score =   333 bits (853),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 200/245 (82%), Gaps = 1/245 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SS++KTLERYQ+CSY  +E N+PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPL+
Sbjct  61    SSILKTLERYQKCSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++  +   +
Sbjct  121   TKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQI  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE GNQ       Q   QS+GFFQPL  N + QIGY++VG+++++    A  ++GF 
Sbjct  181   RQSWEGGNQGGMAYGSQ-HAQSQGFFQPLDCNPTLQIGYSNVGSEQMSATTHAQQVNGFI  239

Query  992   PGWML  1006
             PGWML
Sbjct  240   PGWML  244



>ref|XP_006440804.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
 gb|ESR54044.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
Length=301

 Score =   335 bits (858),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 201/250 (80%), Gaps = 5/250 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  52    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  111

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              S+MKTLERY RCS+  LEAN+P  +T Q+ Y EYLRLK  VELLQRSQRNLLGEDL PL
Sbjct  112   PSIMKTLERYHRCSFGALEANRPPIETQQSTYQEYLRLKTAVELLQRSQRNLLGEDLEPL  171

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAG-  802
             STKELEQLE+QLE SLK +RS KTQ M+DQL++LQ+REQ+L E NK LR+KL+E N+A  
Sbjct  172   STKELEQLEHQLETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDESNIAHQ  231

Query  803   -IPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGYNSVGTDEVNVAASAHN  976
               P RL+WE  +   +    + P QSEGFFQPL G     QIGYN +G++E ++   A N
Sbjct  232   VPPHRLAWEAASAGQNITYNRYPVQSEGFFQPLSGGTPILQIGYNPMGSEEAHIPVHAQN  291

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  292   VTGFIPGWML  301



>ref|XP_007032865.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY03791.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=243

 Score =   332 bits (852),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 196/245 (80%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             +SM+KTLERYQ+CSY  +E ++PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    ASMLKTLERYQKCSYGAVEVSKPAKELESSYREYLKLKARYEALQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QLE SLK +RS KTQ +LDQL++LQ +EQML E+N+ L  KL+E  A    
Sbjct  121   SKELEQLERQLETSLKHVRSTKTQYLLDQLSDLQNKEQMLMEANRALSIKLDEISARNQF  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE G Q +   N+Q   QS+G FQPL  N + QIGYN V +D++     A  ++GF 
Sbjct  181   RASWEGGEQSVPYGNQQ--AQSQGLFQPLECNPTLQIGYNPVASDQIAATTHAQQVNGFI  238

Query  992   PGWML  1006
             PGWML
Sbjct  239   PGWML  243



>gb|AEJ76841.1| MADS17 [Gossypium hirsutum]
Length=244

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 198/246 (80%), Gaps = 3/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKARYEELQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QLE+SLK +RS KTQ MLDQL+ELQ +EQML E+N+ L  KLEE  A    
Sbjct  121   SKELEQLEHQLESSLKHVRSTKTQYMLDQLSELQNKEQMLMETNRALSIKLEEVSARNQF  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVAASAHNISGF  988
             R+SWE G Q +   N+Q   QS G FQPL  N + QIGY N V +D++     A  ++GF
Sbjct  181   RVSWEGGEQSVAFTNQQ--AQSMGLFQPLECNPTLQIGYCNPVASDQMAATTHAQQVNGF  238

Query  989   FPGWML  1006
              PGWML
Sbjct  239   IPGWML  244



>ref|NP_001289642.1| developmental protein SEPALLATA 1-like [Eucalyptus grandis]
 gb|AAC78284.1| MADS box protein [Eucalyptus grandis]
Length=245

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 200/246 (81%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKT+E+YQ+CSY  LE N   ++ QN+Y +YL+LKARVE+LQRSQRN   E+LGPL+
Sbjct  61    SSMMKTIEKYQKCSYGSLETNCSINEMQNSYQDYLKLKARVEVLQRSQRNPPWEELGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QLE SLKQIRS KTQ M DQL  LQ +EQML E+N+ L +KLEE+   IPL
Sbjct  121   SKELEQLEHQLENSLKQIRSAKTQFMFDQLXHLQHKEQMLVEANRELWKKLEESNTRIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGF-FQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             RL WE  +      +R LP QS+G  FQPLG N + QIGYN  G++E+NV+A+  + +GF
Sbjct  181   RLGWEAEDHNNISYSR-LPTQSQGLIFQPLGGNPTLQIGYNPAGSNELNVSAADQHPNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>gb|AFM30904.1| transcription factor MADS4 [Prunus avium]
Length=244

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 199/245 (81%), Gaps = 1/245 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SS++KTLERYQ+CSY  +E N+PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPL+
Sbjct  61    SSILKTLERYQKCSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++  +   +
Sbjct  121   TKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLTLKLDDISSRNQI  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE GNQ       Q   QS+GFFQPL  N   QIGY++VG+++++    A  ++GF 
Sbjct  181   RQSWEGGNQGGMAYGTQ-HAQSQGFFQPLDCNPPLQIGYSNVGSEQMSATTHAQQVNGFI  239

Query  992   PGWML  1006
             PGWML
Sbjct  240   PGWML  244



>gb|AAP83390.1| SEPALLATA1-like MADS-box [Pachysandra terminalis]
Length=238

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 196/243 (81%), Gaps = 8/243 (3%)
 Frame = +2

Query  287   VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMK  466
             V+L+R+ENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSSM  
Sbjct  1     VQLRRMENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSARGKLYEFCSSSSMQN  60

Query  467   TLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELE  646
             TLERYQ+CSY  LE +QPA +TQ++Y EY+RLKARVE LQRSQRNL GE+LGPLSTKELE
Sbjct  61    TLERYQKCSYGPLEPSQPAKETQSSYLEYMRLKARVEGLQRSQRNLFGENLGPLSTKELE  120

Query  647   QLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWE  826
             QLE+QLE SL QIRS KTQ MLDQL++LQ++EQML E+N+ L+RKLEE+ A   L  SWE
Sbjct  121   QLEHQLEMSLNQIRSTKTQFMLDQLSDLQRKEQMLQEANRSLKRKLEESNAENSLGPSWE  180

Query  827   DGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFPG  997
              G   +   HQ     P QSEGFFQPL  N + QIGYN VG D++++     N++GF PG
Sbjct  181   SGGHGVPFGHQ-----PAQSEGFFQPLECNSTLQIGYNHVGADQMSITVPPQNVNGFVPG  235

Query  998   WML  1006
             WM+
Sbjct  236   WMV  238



>ref|XP_008811035.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Phoenix dactylifera]
Length=246

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 203/247 (82%), Gaps = 4/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF+KRRNGLLKKAYELS+LCD EVA IIFSNRG+L+EFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDVEVAAIIFSNRGRLFEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSM++T+ERYQ+CSY   +A  P  +T QN+YHEYL+LKARVE LQRSQRNLLGEDLGPL
Sbjct  61    SSMLETIERYQKCSYNASDAIVPPKETQQNSYHEYLKLKARVEFLQRSQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             S KELEQL+NQ+E SLK IRS KTQ MLDQL +++++EQML E+NK LRRKLEE     P
Sbjct  121   SVKELEQLDNQIEISLKHIRSTKTQLMLDQLCDVKRKEQMLQEANKALRRKLEEGTNN-P  179

Query  809   LRLSWEDGNQEI-HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNV-AASAHNIS  982
             L+LSW++G  ++ +    + PPQS+GFFQPLG   S QIGY+ V  D++N  AA+  N++
Sbjct  180   LQLSWQNGANDVGNAPCGREPPQSQGFFQPLGCEPSLQIGYHPVCIDQLNTEAAATQNVN  239

Query  983   GFFPGWM  1003
             G+FP W+
Sbjct  240   GYFPWWI  246



>ref|XP_008230292.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X4 
[Prunus mume]
Length=244

 Score =   331 bits (848),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 200/245 (82%), Gaps = 1/245 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SS++KTLERYQ+CSY  +E N+PA + +++Y EYL+LK R E LQR+QRNLLGE+LGPL+
Sbjct  61    SSILKTLERYQKCSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEELGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++  +   +
Sbjct  121   TKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQI  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE GNQ       Q   QS+GFFQPL  N + QIGY++VG+++++    A  ++GF 
Sbjct  181   RQSWEGGNQGGMAYGTQ-HAQSQGFFQPLDCNPTLQIGYSNVGSEQMSATTHAQQVNGFI  239

Query  992   PGWML  1006
             PGWML
Sbjct  240   PGWML  244



>ref|XP_008811034.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Phoenix dactylifera]
Length=247

 Score =   331 bits (848),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 203/248 (82%), Gaps = 5/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF+KRRNGLLKKAYELS+LCD EVA IIFSNRG+L+EFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDVEVAAIIFSNRGRLFEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQ--NNYHEYLRLKARVELLQRSQRNLLGEDLGP  625
             SSM++T+ERYQ+CSY   +A  P  +TQ  N+YHEYL+LKARVE LQRSQRNLLGEDLGP
Sbjct  61    SSMLETIERYQKCSYNASDAIVPPKETQVSNSYHEYLKLKARVEFLQRSQRNLLGEDLGP  120

Query  626   LSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGI  805
             LS KELEQL+NQ+E SLK IRS KTQ MLDQL +++++EQML E+NK LRRKLEE     
Sbjct  121   LSVKELEQLDNQIEISLKHIRSTKTQLMLDQLCDVKRKEQMLQEANKALRRKLEEGTNN-  179

Query  806   PLRLSWEDGNQEI-HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNV-AASAHNI  979
             PL+LSW++G  ++ +    + PPQS+GFFQPLG   S QIGY+ V  D++N  AA+  N+
Sbjct  180   PLQLSWQNGANDVGNAPCGREPPQSQGFFQPLGCEPSLQIGYHPVCIDQLNTEAAATQNV  239

Query  980   SGFFPGWM  1003
             +G+FP W+
Sbjct  240   NGYFPWWI  247



>ref|XP_008811033.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Phoenix dactylifera]
Length=248

 Score =   330 bits (847),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 203/249 (82%), Gaps = 6/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF+KRRNGLLKKAYELS+LCD EVA IIFSNRG+L+EFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDVEVAAIIFSNRGRLFEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT---QNNYHEYLRLKARVELLQRSQRNLLGEDLG  622
             SSM++T+ERYQ+CSY   +A  P  +T   QN+YHEYL+LKARVE LQRSQRNLLGEDLG
Sbjct  61    SSMLETIERYQKCSYNASDAIVPPKETQVSQNSYHEYLKLKARVEFLQRSQRNLLGEDLG  120

Query  623   PLSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAG  802
             PLS KELEQL+NQ+E SLK IRS KTQ MLDQL +++++EQML E+NK LRRKLEE    
Sbjct  121   PLSVKELEQLDNQIEISLKHIRSTKTQLMLDQLCDVKRKEQMLQEANKALRRKLEEGTNN  180

Query  803   IPLRLSWEDGNQEI-HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNV-AASAHN  976
              PL+LSW++G  ++ +    + PPQS+GFFQPLG   S QIGY+ V  D++N  AA+  N
Sbjct  181   -PLQLSWQNGANDVGNAPCGREPPQSQGFFQPLGCEPSLQIGYHPVCIDQLNTEAAATQN  239

Query  977   ISGFFPGWM  1003
             ++G+FP W+
Sbjct  240   VNGYFPWWI  248



>gb|KHG17252.1| Developmental SEPALLATA 2 -like protein [Gossypium arboreum]
Length=244

 Score =   330 bits (846),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 196/246 (80%), Gaps = 3/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKARYEELQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QLE+SLK +RS KTQ MLDQL ELQ +EQML E+N+ L  KLEE  A    
Sbjct  121   SKELEQLEHQLESSLKHVRSTKTQYMLDQLTELQNKEQMLMETNRALSIKLEEISARNQF  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVAASAHNISGF  988
             R SWE G Q +   N+Q   QS G FQPL  N + QIGY N V +D++     A  ++GF
Sbjct  181   RASWEGGEQSVAFTNQQ--AQSMGLFQPLECNPTLQIGYCNPVASDQMAATTHAQQVNGF  238

Query  989   FPGWML  1006
              PGWML
Sbjct  239   IPGWML  244



>dbj|BAC80255.1| MADS-box transcription factor [Houttuynia cordata]
Length=247

 Score =   330 bits (846),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 166/249 (67%), Positives = 203/249 (82%), Gaps = 6/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF+KRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMM TLERYQ CSY+  EA  P  +T+ +Y EYL+LK +VELLQR+QRNLLGEDLGPLS
Sbjct  61    SSMMTTLERYQECSYSMPEATGPTRETEKSYQEYLKLKGKVELLQRTQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLENQLE SL+QIRS KTQ++LDQL++L+++EQ + ESNK+L++KL E+     L
Sbjct  121   SKELEQLENQLEHSLRQIRSTKTQALLDQLSDLRRKEQQMLESNKILKKKLAEHGPENLL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASA----HNI  979
             +L+W+   Q  +  +RQ P  SE FFQPL  N + QIGY+ VG +E+ +AA A     N+
Sbjct  181   QLAWQSCGQS-NPYSRQ-PAHSEAFFQPLDCNPTLQIGYHPVGQEEITMAAPAIAPPQNV  238

Query  980   SGFFPGWML  1006
             +GF PGWM+
Sbjct  239   NGFIPGWMV  247



>ref|NP_001242365.1| uncharacterized protein LOC100797819 [Glycine max]
 gb|ACU17644.1| unknown [Glycine max]
Length=243

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/246 (68%), Positives = 198/246 (80%), Gaps = 4/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLE+YQ+ SY+ LE  +P +DTQ NY EYLRLKARVE+LQRSQRNLLGE L  ++
Sbjct  61    SSMMKTLEKYQKYSYSALETTRPINDTQ-NYQEYLRLKARVEVLQRSQRNLLGEGLAQMN  119

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGIP  808
             T ELEQLENQLEA+L+ IRS KTQ MLDQL++L  RE +L E+N +LR KLEE + + + 
Sbjct  120   TNELEQLENQLEAALRNIRSTKTQFMLDQLSDLHHRETLLIETNNVLRSKLEETDHSQVQ  179

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             + L+ E G   I   N   PPQSEGFF+P+G+N + QIGYN  G D+ NV AS+ ++ GF
Sbjct  180   VSLALEAGGPSIQYTN--FPPQSEGFFEPVGVNPTLQIGYNQTGPDDTNVGASSLSMHGF  237

Query  989   FPGWML  1006
               GWML
Sbjct  238   ASGWML  243



>ref|XP_006477712.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Citrus sinensis]
Length=265

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/265 (65%), Positives = 199/265 (75%), Gaps = 20/265 (8%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              S+MKTLERY RCS+   EAN+P  +TQ+ Y EYLRLK  VELLQRSQRNLLGEDL PLS
Sbjct  61    PSIMKTLERYHRCSFGAHEANRPPIETQSTYQEYLRLKTAVELLQRSQRNLLGEDLDPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKL---------  784
             TKELEQLE+QLE SLK +RS KTQ M+DQL++LQ+REQ+L E NK LR+K          
Sbjct  121   TKELEQLEHQLETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKAFLGNYTCLT  180

Query  785   --------EENVAG--IPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGYN  931
                     E N+A    P RL+WE  +   +    + P QSEGFFQPL G N   QIGYN
Sbjct  181   TPPFTQLDESNIAHQVPPHRLAWEAASAGQNITYNRYPVQSEGFFQPLSGGNPILQIGYN  240

Query  932   SVGTDEVNVAASAHNISGFFPGWML  1006
              +G++E ++   A N++GF PGWML
Sbjct  241   PMGSEEAHIPVHAQNVTGFIPGWML  265



>ref|XP_011021072.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011021073.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
Length=244

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 195/245 (80%), Gaps = 1/245 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY   E N+PA + +++Y EYL++KA+ E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGADEVNKPAKELESSYREYLKVKAKFETLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE  LE+SLKQ+RS KTQ MLDQL +LQ +E ML E+N+ L  KL+E  A   L
Sbjct  121   TKELEQLERHLESSLKQVRSTKTQYMLDQLGDLQNKEHMLLEANRALTMKLDEISARNNL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE  +Q+      Q   QS+G FQ L  N + QIGYNSVG+D++  A +A  + GF 
Sbjct  181   RPSWEGDDQQSMSYGHQ-HAQSQGLFQHLECNPTLQIGYNSVGSDQITAAHAAQQVHGFI  239

Query  992   PGWML  1006
             PGWML
Sbjct  240   PGWML  244



>ref|XP_007139420.1| hypothetical protein PHAVU_008G027900g [Phaseolus vulgaris]
 gb|ESW11414.1| hypothetical protein PHAVU_008G027900g [Phaseolus vulgaris]
Length=248

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 197/249 (79%), Gaps = 5/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             +SM+KTLERYQ+CSY  +E ++PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    TSMLKTLERYQKCSYGAVEVSKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +EQML E+N+ L  KL+E  +    
Sbjct  121   TKELEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRSLTMKLDEINSRNHY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASAHNI  979
             R SWE G+Q +     Q    S+GFFQPL  N + QIG    YN V +D++     A  +
Sbjct  181   RQSWEAGDQSMQYGGPQ-NSHSQGFFQPLECNPTLQIGPDYRYNVVASDQITATTPAQQV  239

Query  980   SGFFPGWML  1006
             SGF PGWML
Sbjct  240   SGFIPGWML  248



>ref|XP_007215877.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
 gb|ABO27622.1| transcription factor MADS7 [Prunus persica]
 gb|EMJ17076.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
Length=245

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 200/246 (81%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SS-MMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SS ++KTLERYQ+CSY  +E N+PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPL
Sbjct  61    SSSILKTLERYQKCSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++  +   
Sbjct  121   NTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             +R SWE GNQ       Q   QS+GFFQPL  N + QIGY++VG+++++    A  ++GF
Sbjct  181   IRQSWEGGNQGGMAYGSQ-HAQSQGFFQPLDCNPTLQIGYSNVGSEQMSATTHAQQVNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>gb|AHM92083.1| MADS-box protein 7 [Erycina pusilla]
Length=249

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 203/249 (82%), Gaps = 5/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELK IENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRG+L+EFCSS
Sbjct  1     MGRGRVELKMIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SS++KT+ERYQ+CSY   E + P+ +TQN+Y EYL+LKARVE LQRSQRNLLGEDLG LS
Sbjct  61    SSILKTIERYQKCSYNSTETSIPSKETQNSYQEYLKLKARVEYLQRSQRNLLGEDLGQLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLE SLKQIRS K+Q MLDQL +L+++EQ+L E+N+ LR KL+E    IPL
Sbjct  121   TKELEQLEHQLEMSLKQIRSTKSQLMLDQLCDLKRKEQLLQEANRALRMKLQEEEPEIPL  180

Query  812   RLSWEDGNQEIHQQNRQLP----PQSEGFFQPLGLNISGQIGYNSVGTDE-VNVAASAHN  976
             +LSW  G      QN ++P    PQS+ FFQPL  + S QIGY+ +  ++ +N  +S+H+
Sbjct  181   QLSWPGGGGGGGGQNGRVPCDRQPQSDVFFQPLNCDPSLQIGYSPICIEQHLNNGSSSHS  240

Query  977   ISGFFPGWM  1003
             ++GF PGWM
Sbjct  241   VNGFVPGWM  249



>ref|XP_010663486.1| PREDICTED: MADS-box protein CMB1 isoform X1 [Vitis vinifera]
Length=261

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 171/262 (65%), Positives = 205/262 (78%), Gaps = 20/262 (8%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS+RGKLYEFCS 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              SM KTLE+YQ+CSY  LEA+QP  + TQ++Y EYL+LK RVE+LQRSQR+LLGEDL PL
Sbjct  61    PSMAKTLEKYQKCSYGALEASQPVYELTQSSYQEYLKLKTRVEVLQRSQRHLLGEDLDPL  120

Query  629   STKELEQLENQLEASLKQIRSRK---------------TQSMLDQLAELQQREQMLAESN  763
             +TKELEQLE+QLE SLKQIRS K               TQ+MLDQLA+LQ +E ML E+N
Sbjct  121   NTKELEQLEHQLEMSLKQIRSTKFAVFGDILTVVYGFQTQNMLDQLADLQNKEHMLIEAN  180

Query  764   KLLRRKLEENVAGIPLRLSWE-DGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVG  940
               LRRKLEE+    PL+ SWE  GN  ++    +LP QSEGFFQPL  N + ++GYN+ G
Sbjct  181   NALRRKLEESNGKHPLQQSWEAAGNSALYS---RLPAQSEGFFQPLERNSTLEMGYNAAG  237

Query  941   TDEVNVAASAHNISGFFPGWML  1006
             ++E+ +AA + N +GF PGWML
Sbjct  238   SNEITLAAPSQNDNGFGPGWML  259



>emb|CAN84110.1| hypothetical protein VITISV_036170 [Vitis vinifera]
Length=243

 Score =   328 bits (840),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 167/245 (68%), Positives = 200/245 (82%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS 
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM +TLER+QRCSY+ LEA+QPA +TQN+Y EYL+LK++VE+LQR+QRN LGEDLG L 
Sbjct  61    SSMPETLERHQRCSYSALEASQPAKETQNSYQEYLKLKSKVEVLQRTQRNFLGEDLGHLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QL+ SLKQIRS KTQ MLDQL++LQ++ Q+L E+N  LRRKL E+ A   L
Sbjct  121   TKELEQLEHQLDKSLKQIRSTKTQFMLDQLSDLQRKVQILMEANNALRRKLGESSAESGL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
               +WE     +   NR+ P QSE FF+PL  + + QIGYN V   E+N A++  N++GF 
Sbjct  181   GSTWEAAAHNL-PYNRE-PVQSEDFFEPLQCDSTLQIGYNPVLRVEMNGASTTQNVNGFI  238

Query  992   PGWML  1006
             PGWM+
Sbjct  239   PGWMV  243



>gb|KDP24297.1| hypothetical protein JCGZ_25593 [Jatropha curcas]
Length=243

 Score =   328 bits (840),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 195/245 (80%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSI  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY  +E N+PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGAVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QLE+SLKQ+RS +TQ MLDQL++LQ +EQ+L E+N+ L  KL+E  A   L
Sbjct  121   TKELEQLERQLESSLKQVRSTRTQYMLDQLSDLQNKEQLLLEANRALTIKLDEISARNSL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE G Q +     Q  PQS+  FQPL  N + QIGYN VG+D++     A  +SGF 
Sbjct  181   RSSWEGGEQSMSYG--QQHPQSQELFQPLECNPTLQIGYNPVGSDQMTATTHAQQVSGFI  238

Query  992   PGWML  1006
             PGWML
Sbjct  239   PGWML  243



>gb|KCW83762.1| hypothetical protein EUGRSUZ_B00633 [Eucalyptus grandis]
Length=257

 Score =   328 bits (841),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 169/257 (66%), Positives = 199/257 (77%), Gaps = 12/257 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+V+LKRIENKINRQVTF+KRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYE+CSS
Sbjct  1     MGRGRVQLKRIENKINRQVTFSKRRNGLLKKAYELSLLCDAEVALIIFSSRGKLYEYCSS  60

Query  452   SSMMKTLERYQRCSY-AHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSMMKTLERYQ+CSY A L  ++   +TQ++Y EYLRLKAR E+L +SQRNLLGEDLG L
Sbjct  61    SSMMKTLERYQKCSYGAQLNPSRSIDETQSSYQEYLRLKARAEVLLQSQRNLLGEDLGSL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
              +KELE LE+QLE+SLK IRS KTQSMLDQL  LQ REQ+L E+NK+L RKLEE    IP
Sbjct  121   DSKELEHLESQLESSLKNIRSTKTQSMLDQLFNLQNREQVLLETNKILSRKLEEVSPQIP  180

Query  809   LRLSWEDGNQEIHQQNRQ-----------LPPQSEGFFQPLGLNISGQIGYNSVGTDEVN  955
              +L+WE G Q     +              PPQSEGFF P+  N+S QIGYN    DE+N
Sbjct  181   FQLAWEVGGQGGGGGDGGGGGGGGIPFSLFPPQSEGFFNPMDGNLSLQIGYNPTCLDEMN  240

Query  956   VAASAHNISGFFPGWML  1006
              + S+ N++GF PGWML
Sbjct  241   ASVSSQNVAGFIPGWML  257



>ref|XP_010936438.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
Length=244

 Score =   328 bits (840),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 197/245 (80%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF+KRRNGL+KKA ELS+LCDAEVALIIFSNRG++ EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLVKKANELSVLCDAEVALIIFSNRGRITEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KT+ERYQRCSY   +A  P  +TQN+YHEYL++KAR E L  SQRNLLGEDLGPLS
Sbjct  61    SSMLKTIERYQRCSYNATDAIVPPKETQNSYHEYLKMKARFEFLHHSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLENQ+E SLK IRS+KTQ MLDQL +L+++EQML E+NK LRR+LEE+     L
Sbjct  121   VKELEQLENQIEISLKHIRSKKTQLMLDQLCDLERKEQMLQEANKALRRRLEEDTIN-SL  179

Query  812   RLSWEDGNQEI-HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             +LSW++G   + +      PPQ+EGFFQPLG   S QIGY  V  +++N  A+  +++G+
Sbjct  180   QLSWQNGANVVGNAPCDGEPPQTEGFFQPLGCEPSLQIGYQPVCINQMNTEATTQHVNGY  239

Query  989   FPGWM  1003
              PGW+
Sbjct  240   IPGWI  244



>ref|XP_008230291.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Prunus mume]
Length=245

 Score =   328 bits (840),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 200/246 (81%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SS++KTLERYQ+CSY  +E N+PA +  Q++Y EYL+LK R E LQR+QRNLLGE+LGPL
Sbjct  61    SSILKTLERYQKCSYGQVEVNKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++  +   
Sbjct  121   NTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             +R SWE GNQ       Q   QS+GFFQPL  N + QIGY++VG+++++    A  ++GF
Sbjct  181   IRQSWEGGNQGGMAYGTQ-HAQSQGFFQPLDCNPTLQIGYSNVGSEQMSATTHAQQVNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>gb|ACD39982.1| MADS1 [Carica papaya]
Length=245

 Score =   327 bits (839),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 164/250 (66%), Positives = 198/250 (79%), Gaps = 10/250 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKTRFEALQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QLE+SLK +RS KTQ MLDQL +LQ +E ML E+N+ L  KL+E  A   L
Sbjct  121   TKELEQLERQLESSLKHVRSTKTQYMLDQLTDLQNKEHMLLEANRALTIKLDEISARNHL  180

Query  812   RLSWEDGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHN--  976
             R++WE   Q +   HQ       QS+G FQPL  N + QIGYN VG+D++  AA++    
Sbjct  181   RVAWEGSEQNVSYGHQH-----AQSQGLFQPLECNPTLQIGYNPVGSDQMTAAATSQGQQ  235

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  236   VNGFIPGWML  245



>ref|XP_006482430.1| PREDICTED: developmental protein SEPALLATA 1-like [Citrus sinensis]
 dbj|BAF95941.1| SEPALLATA1 homolog [Citrus unshiu]
Length=243

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 196/245 (80%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+CSY  +E N+PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCSYGAVEVNKPAKELESSYREYLKLKTRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QLE+SLK +RS KTQ MLDQL++LQ +EQ+L ++N+ L  KL+E  A   L
Sbjct  121   SKELEQLERQLESSLKHVRSTKTQYMLDQLSDLQNKEQLLLDTNRALTIKLDEINAKTQL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE G Q++    +    Q++G FQP+  N + QIGYN   +D++   + A  +SGF 
Sbjct  181   RPSWEGGEQQLGYNPQH--AQTQGLFQPIECNPTLQIGYNPSCSDQMTATSHAQQVSGFI  238

Query  992   PGWML  1006
             PGWML
Sbjct  239   PGWML  243



>ref|XP_011014957.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011014958.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011014959.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
Length=244

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 195/245 (80%), Gaps = 1/245 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKL+EFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY   E N+PA + +++Y EYL++KA+ E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGADEVNKPAKELESSYREYLKVKAKFETLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE  LE+SLKQ+RS KTQ MLDQL +LQ +E ML E+N+ L  KL+E  A   L
Sbjct  121   TKELEQLERHLESSLKQVRSTKTQYMLDQLGDLQNKEHMLLEANRALTMKLDEISARNNL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE  +Q+      Q   QS+G FQ L  N + QIGYNSVG+D++  A +A  + GF 
Sbjct  181   RPSWEGDDQQSMSYGHQ-HAQSQGLFQHLECNPTLQIGYNSVGSDQITAAHAAQQVHGFI  239

Query  992   PGWML  1006
             PGWML
Sbjct  240   PGWML  244



>ref|XP_008230290.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Prunus mume]
Length=245

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 200/246 (81%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SS-MMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SS ++KTLERYQ+CSY  +E N+PA + +++Y EYL+LK R E LQR+QRNLLGE+LGPL
Sbjct  61    SSSILKTLERYQKCSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++  +   
Sbjct  121   NTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             +R SWE GNQ       Q   QS+GFFQPL  N + QIGY++VG+++++    A  ++GF
Sbjct  181   IRQSWEGGNQGGMAYGTQ-HAQSQGFFQPLDCNPTLQIGYSNVGSEQMSATTHAQQVNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>gb|AGW23364.1| MADS box protein MADS62 [Gossypium hirsutum]
Length=244

 Score =   326 bits (835),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 163/246 (66%), Positives = 196/246 (80%), Gaps = 3/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S M+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LKAR E LQR+QRN LGEDLGPL+
Sbjct  61    SGMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKARYEELQRTQRNFLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QLE+SLK +RS KTQ MLDQL+ELQ +E+ML E+N+ L  KLEE  A    
Sbjct  121   SKELEQLEHQLESSLKHVRSTKTQYMLDQLSELQNKERMLMETNRALSIKLEEVSARNQF  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVAASAHNISGF  988
             R+SWE G Q +   N+Q   QS G FQPL  N + QIGY N V +D++     A  ++GF
Sbjct  181   RVSWEGGEQGVAFTNQQ--AQSMGLFQPLECNPTLQIGYCNPVASDQMAATTHAQQVNGF  238

Query  989   FPGWML  1006
              PGWML
Sbjct  239   IPGWML  244



>gb|AAX15922.1| AGL2 [Acorus americanus]
Length=237

 Score =   325 bits (833),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 200/244 (82%), Gaps = 8/244 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIEN INRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRG+L+EFCSS
Sbjct  1     MGRGRVELKRIENNINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTL+RYQ+CS+   E++ P+ + Q++Y EYL+LKA+VE LQRSQRNLLGEDLGPL+
Sbjct  61    SSMLKTLDRYQKCSFHAAESSAPSRELQSSYQEYLKLKAKVEALQRSQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QLE SLKQ+RS KTQ MLDQL +L+++EQML E+NK L+RKL+E  +  PL
Sbjct  121   SKELEQLESQLEMSLKQVRSTKTQYMLDQLCDLKRKEQMLQEANKSLKRKLDEYNSENPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             +LSW++G   +    RQ P  SE FFQPL ++ S  IGY      +VN AA+  N++GF 
Sbjct  181   QLSWDNGGSNV-PYGRQ-PTHSEDFFQPLSVDPSLHIGY------QVNAAATGQNVNGFI  232

Query  992   PGWM  1003
             PGWM
Sbjct  233   PGWM  236



>gb|AAC25922.1| MADS-box protein 1 [Malus domestica]
Length=246

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/246 (65%), Positives = 200/246 (81%), Gaps = 1/246 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSM+KTL+RYQ+CSY  ++  N+PA + +++Y EY++LK R E LQR+QRNLLGEDLGPL
Sbjct  61    SSMLKTLDRYQKCSYGAVDQVNRPAKELESSYREYMKLKGRYESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLE SLKQ+RS KTQ MLDQL++LQ +EQ+L E+N+ L  KL+E  +   
Sbjct  121   NTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LR SWE G+Q +    +    QS+GFFQPL  N + Q+GY++VG+++++   +A  ++ F
Sbjct  181   LRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYSAVGSEQMSATTNAQQVNCF  240

Query  989   FPGWML  1006
              PGWML
Sbjct  241   IPGWML  246



>gb|AFS60086.1| MADS box transcription factor SEP1 [Paphiopedilum concolor]
Length=241

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 198/245 (81%), Gaps = 5/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRG+L+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLERYQ+CSY+  E+  P+ +TQN+Y EYL+LK RVE LQRSQRNLLGEDL  L+
Sbjct  61    SSMMKTLERYQKCSYSASESVTPSKETQNSYQEYLKLKLRVEHLQRSQRNLLGEDLEQLT  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKEL++LE+QLE SL+QIRS KTQ MLDQL +L+++EQML E+N+  R+KL+E+   IPL
Sbjct  121   TKELQELEHQLEMSLRQIRSTKTQLMLDQLCDLKRKEQMLQEANRAFRKKLQEDGPEIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTD-EVNVAASAHNISGF  988
             +LSW           RQ  PQSE FFQPL  + S QIG++ +  D ++N  +S H  +GF
Sbjct  181   QLSW--PGGGGGSSTRQ--PQSEEFFQPLPCDPSLQIGFSPLCIDQQLNTGSSTHTANGF  236

Query  989   FPGWM  1003
             FPGWM
Sbjct  237   FPGWM  241



>gb|AAY30858.1| MADS-box transcription factor [Prunus dulcis]
Length=246

 Score =   325 bits (833),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 200/247 (81%), Gaps = 3/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SS-MMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGP  625
             SS ++KTLERYQ+CSY  +E N+PA +  Q++Y EYL+LK R E LQR+QRNLLGEDLGP
Sbjct  61    SSSILKTLERYQKCSYGQVEVNKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEDLGP  120

Query  626   LSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGI  805
             L+TKELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++  +  
Sbjct  121   LNTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
              +R SWE GNQ       Q   QS+GFFQPL  N + QIGY++VG+++++    A  ++G
Sbjct  181   QIRQSWEGGNQGGMAYGSQ-HAQSQGFFQPLDCNPTLQIGYSNVGSEQMSATTHAQQVNG  239

Query  986   FFPGWML  1006
             F PGWML
Sbjct  240   FIPGWML  246



>ref|XP_006430949.1| hypothetical protein CICLE_v10012593mg [Citrus clementina]
 gb|ESR44189.1| hypothetical protein CICLE_v10012593mg [Citrus clementina]
Length=243

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/245 (65%), Positives = 195/245 (80%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+CSY  +E N+PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCSYGAVEVNKPAKELESSYREYLKLKTRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QLE+SLK +RS KTQ MLDQL++LQ +EQ+L ++N+ L  KL+E  A   L
Sbjct  121   SKELEQLERQLESSLKHVRSTKTQYMLDQLSDLQNKEQLLLDTNRALTIKLDEINAKTQL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE   Q++    +    Q++G FQP+  N + QIGYN   +D++   + A  +SGF 
Sbjct  181   RPSWEGSEQQLGYNPQH--TQTQGLFQPIECNPTLQIGYNPSCSDQMTATSHAQQVSGFI  238

Query  992   PGWML  1006
             PGWML
Sbjct  239   PGWML  243



>ref|XP_004154725.1| PREDICTED: developmental protein SEPALLATA 2-like [Cucumis sativus]
Length=246

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 201/250 (80%), Gaps = 9/250 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY  +E  +PA + +++Y EYL+LK+R E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGAVEVTKPAKELESSYREYLKLKSRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L+ KLEE  +   +
Sbjct  121   SKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQIKLEEISSRNNI  180

Query  812   RLSWEDGNQEIH--QQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS---AHN  976
             RL+W+ G+Q +    QN     Q++GFFQPL  N + QIGY S  +D++    +   A  
Sbjct  181   RLTWDGGDQSMSYGPQN----AQTQGFFQPLECNPTLQIGYTSAVSDQITSTTTPTHAQQ  236

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  237   VNGFLPGWML  246



>gb|AHH28266.1| MADS-box transcription factor, partial [Rhizanthes lowii]
Length=244

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 195/245 (80%), Gaps = 1/245 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY  +E N+PA + +++Y EY++LK+R E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGAIEVNKPAKELESSYREYMKLKSRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQ+L E+N+ L  KL+E  A   L
Sbjct  121   TKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQLLLEANRALTIKLDEMGARNNL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE   Q +   +    PQ++  FQPL  N + QIGYN V +D +     A  ++GF 
Sbjct  181   RPSWEGPEQNMAYAHHH-HPQNQELFQPLECNPTLQIGYNPVCSDHMTATTHAQQVNGFI  239

Query  992   PGWML  1006
             PGWML
Sbjct  240   PGWML  244



>dbj|BAC80254.1| MADS-box transcription factor [Houttuynia cordata]
Length=246

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 197/248 (79%), Gaps = 5/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEV LIIFSN GKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVTLIIFSNSGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLERYQ+CSY+  EA  P+ +T+ +Y EYL+LK +VE LQR QRNLLGEDLGPLS
Sbjct  61    SSMMKTLERYQKCSYSMPEATGPSRETEKSYQEYLKLKGKVEHLQRIQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLENQLE SL+QIRS KTQS+LDQL++L+++EQ L ES K+L +KL E+    PL
Sbjct  121   SKELEQLENQLEQSLRQIRSTKTQSLLDQLSDLRRKEQQLLESKKILNKKLAEHGPENPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVA---ASAHNIS  982
             +LSW+   Q     ++  P  SE FFQPL  N + QIGY SVG +++  A   A+  N +
Sbjct  181   QLSWQSCGQSNPYSSQ--PAHSEAFFQPLDCNPTLQIGYPSVGQEQIMAAPATAAPQNAN  238

Query  983   GFFPGWML  1006
             GF PGW++
Sbjct  239   GFIPGWLV  246



>ref|XP_006477711.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Citrus sinensis]
Length=266

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 199/266 (75%), Gaps = 21/266 (8%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              S+MKTLERY RCS+   EAN+P  +T Q+ Y EYLRLK  VELLQRSQRNLLGEDL PL
Sbjct  61    PSIMKTLERYHRCSFGAHEANRPPIETQQSTYQEYLRLKTAVELLQRSQRNLLGEDLDPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKL--------  784
             STKELEQLE+QLE SLK +RS KTQ M+DQL++LQ+REQ+L E NK LR+K         
Sbjct  121   STKELEQLEHQLETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKAFLGNYTCL  180

Query  785   ---------EENVAG--IPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGY  928
                      E N+A    P RL+WE  +   +    + P QSEGFFQPL G N   QIGY
Sbjct  181   TTPPFTQLDESNIAHQVPPHRLAWEAASAGQNITYNRYPVQSEGFFQPLSGGNPILQIGY  240

Query  929   NSVGTDEVNVAASAHNISGFFPGWML  1006
             N +G++E ++   A N++GF PGWML
Sbjct  241   NPMGSEEAHIPVHAQNVTGFIPGWML  266



>ref|NP_001280893.1| developmental protein SEPALLATA 1 [Malus domestica]
 emb|CAA04919.1| MdMADS8 [Malus domestica]
Length=246

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 200/246 (81%), Gaps = 1/246 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SS++KTL+RYQ+CSY  ++  N+PA + +++Y EY++LK R E LQR+QRNLLGEDLGPL
Sbjct  61    SSILKTLDRYQKCSYGAVDQVNRPAKELESSYREYMKLKGRYESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLE SLKQ+RS KTQ MLDQL++LQ +EQ+L E+N+ L  KL+E  +   
Sbjct  121   NTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LR SWE G+Q +    +    QS+GFFQPL  N + Q+GY++VG+++++   +A  ++ F
Sbjct  181   LRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYSAVGSEQMSATTNAQQVNCF  240

Query  989   FPGWML  1006
              PGWML
Sbjct  241   IPGWML  246



>gb|AIE44769.1| putative MADS-domain transcription factor AGL2 [Nuphar advena]
Length=245

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 198/247 (80%), Gaps = 4/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF+KRRNGLLKKAYELS+LCD EVALIIFSNRG+LYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDVEVALIIFSNRGRLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y  +EA+ P+ +TQN+Y EYL+LK++VE LQ SQRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCNYGSIEASVPSRETQNSYQEYLKLKSKVEALQHSQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP-  808
             +KELE LE QLE SLK +RS KTQ MLDQL++L+ +EQ+L ++N  L RKL E  AG   
Sbjct  121   SKELEHLEQQLEVSLKHVRSTKTQFMLDQLSDLKGKEQILQDANMALVRKL-EGAAGSAN  179

Query  809   -LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
               +LSWE+G Q + Q  R   PQ +GF+ PL  + + QIGYN    +++ VAA AHN++G
Sbjct  180   HQQLSWENGGQHL-QYGRHSGPQKDGFYHPLECDSTLQIGYNPTAQEQITVAAPAHNVNG  238

Query  986   FFPGWML  1006
             F P W++
Sbjct  239   FIPSWLV  245



>ref|XP_010045613.1| PREDICTED: MADS-box protein CMB1-like [Eucalyptus grandis]
Length=258

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/258 (66%), Positives = 199/258 (77%), Gaps = 13/258 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+V+LKRIENKINRQVTF+KRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYE+CSS
Sbjct  1     MGRGRVQLKRIENKINRQVTFSKRRNGLLKKAYELSLLCDAEVALIIFSSRGKLYEYCSS  60

Query  452   SSMMKTLERYQRCSY-AHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGP  625
             SSMMKTLERYQ+CSY A L  ++   +T Q++Y EYLRLKAR E+L +SQRNLLGEDLG 
Sbjct  61    SSMMKTLERYQKCSYGAQLNPSRSIDETQQSSYQEYLRLKARAEVLLQSQRNLLGEDLGS  120

Query  626   LSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGI  805
             L +KELE LE+QLE+SLK IRS KTQSMLDQL  LQ REQ+L E+NK+L RKLEE    I
Sbjct  121   LDSKELEHLESQLESSLKNIRSTKTQSMLDQLFNLQNREQVLLETNKILSRKLEEVSPQI  180

Query  806   PLRLSWEDGNQEIHQQNRQ-----------LPPQSEGFFQPLGLNISGQIGYNSVGTDEV  952
             P +L+WE G Q     +              PPQSEGFF P+  N+S QIGYN    DE+
Sbjct  181   PFQLAWEVGGQGGGGGDGGGGGGGGIPFSLFPPQSEGFFNPMDGNLSLQIGYNPTCLDEM  240

Query  953   NVAASAHNISGFFPGWML  1006
             N + S+ N++GF PGWML
Sbjct  241   NASVSSQNVAGFIPGWML  258



>ref|XP_010681125.1| PREDICTED: MADS-box protein CMB1-like [Beta vulgaris subsp. vulgaris]
Length=243

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 198/247 (80%), Gaps = 6/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERYQRCSY  LEA+QP+ +T+N+Y EYL+LKA+V++LQR+QRNLLGEDL  LS
Sbjct  61    SSMAKTLERYQRCSYGALEASQPSKETENSYQEYLKLKAKVDVLQRNQRNLLGEDLSELS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QL+ SL+QIRS KTQ MLDQLA+LQ++E+ML ESN+ L+ KLEE  A   L
Sbjct  121   TKELEQLEHQLDKSLRQIRSIKTQYMLDQLADLQRKEEMLLESNRALKSKLEETCAS--L  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGL-NISGQIGYNSVGTDEVNVA-ASAHNISG  985
             R +WE   Q       + P  +EGFF+PL   N S  IGYN+V  D +N A  S HN + 
Sbjct  179   RQNWEAEPQNAPPTYVRQP--AEGFFEPLPCNNNSLHIGYNAVTQDHLNNATTSTHNENS  236

Query  986   FFPGWML  1006
             F P WML
Sbjct  237   FTPTWML  243



>gb|KHN18378.1| MADS-box protein CMB1 [Glycine soja]
Length=243

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 195/246 (79%), Gaps = 4/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLE+YQ+ SY+ LE  +P +D+Q NY EYLRLKARVE+LQ SQRNLLGEDL  ++
Sbjct  61    SSMMKTLEKYQKYSYSALETTRPINDSQ-NYQEYLRLKARVEVLQCSQRNLLGEDLAQMN  119

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGIP  808
             T ELEQLENQLEA+LK IRS KTQ MLDQL++L  RE +L E+N +LR KLEE N + + 
Sbjct  120   TNELEQLENQLEAALKNIRSTKTQFMLDQLSDLHHRETLLIETNNVLRSKLEETNNSQVQ  179

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             + L+ E G   I   N   PPQSEGFFQP+G+N + QIGYN     + NV AS+ ++ GF
Sbjct  180   VSLALEAGGPSIQYTN--FPPQSEGFFQPMGVNPTLQIGYNQTNPHDANVGASSLSMHGF  237

Query  989   FPGWML  1006
                WML
Sbjct  238   ASEWML  243



>ref|XP_010029406.1| PREDICTED: developmental protein SEPALLATA 1 [Eucalyptus grandis]
 gb|KCW56317.1| hypothetical protein EUGRSUZ_I02058 [Eucalyptus grandis]
Length=247

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 195/249 (78%), Gaps = 6/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM+KTL+RYQ+CSY  +E N+P+ + +N Y EYL+LK R E LQR+QRNL+GEDLGPL+
Sbjct  61    PSMLKTLDRYQKCSYGSVEVNKPSKELENAYREYLKLKGRFEALQRTQRNLMGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QLEASLK IRS KTQ MLDQL++LQ +EQ L E+N+ L  KL+E  A   L
Sbjct  121   SKELEQLERQLEASLKHIRSTKTQCMLDQLSDLQDKEQSLMEANRALTLKLDEVCARNNL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHN----I  979
             R  WE G+  +     Q  PQS+ FFQPL  N + QIGY++ G+D++N +A+  N     
Sbjct  181   RPPWEAGDPSMTYG--QPHPQSQEFFQPLECNPTLQIGYDAGGSDQLNTSAATPNAPQQA  238

Query  980   SGFFPGWML  1006
             SGF PGWML
Sbjct  239   SGFLPGWML  247



>ref|XP_008230289.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Prunus mume]
Length=246

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 200/247 (81%), Gaps = 3/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SS-MMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGP  625
             SS ++KTLERYQ+CSY  +E N+PA +  Q++Y EYL+LK R E LQR+QRNLLGE+LGP
Sbjct  61    SSSILKTLERYQKCSYGQVEVNKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEELGP  120

Query  626   LSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGI  805
             L+TKELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++  +  
Sbjct  121   LNTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
              +R SWE GNQ       Q   QS+GFFQPL  N + QIGY++VG+++++    A  ++G
Sbjct  181   QIRQSWEGGNQGGMAYGTQ-HAQSQGFFQPLDCNPTLQIGYSNVGSEQMSATTHAQQVNG  239

Query  986   FFPGWML  1006
             F PGWML
Sbjct  240   FIPGWML  246



>gb|ADJ67241.1| MADS box transcription factor 11 [Oncidium hybrid cultivar]
Length=248

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 199/250 (80%), Gaps = 8/250 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELK IENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRG+L+EFCSS
Sbjct  1     MGRGRVELKMIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SS+ KT+ERYQ+CSY   EA  P+ +TQN+Y EYL+LKARVE LQRSQRNLLGEDLG LS
Sbjct  61    SSITKTIERYQKCSYNSSEATIPSKETQNSYQEYLKLKARVEYLQRSQRNLLGEDLGQLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLE SLKQIRS K+Q MLDQL +L+++EQML E+N+ LR KL+E    IPL
Sbjct  121   TKELEQLEHQLETSLKQIRSTKSQLMLDQLCDLKRKEQMLQEANRALRMKLQEEEPEIPL  180

Query  812   RLSWEDGNQEIHQQ-----NRQLPPQSEGFFQPLGLNISGQIGYNSVGTD-EVNVAASAH  973
             +LSW        +       RQ  PQS+ FFQPL  + S QIGY+ V  + ++N  +S+H
Sbjct  181   QLSWPGSGGGGGRNGRGPCERQ--PQSDVFFQPLTCDPSLQIGYSPVCIEQQLNNGSSSH  238

Query  974   NISGFFPGWM  1003
             +++GF PGWM
Sbjct  239   SVNGFIPGWM  248



>ref|XP_004507288.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Cicer arietinum]
Length=247

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 195/249 (78%), Gaps = 6/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM+KTLERYQ+CSY  +E N+PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL 
Sbjct  61    PSMLKTLERYQKCSYGAVEVNKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE+QL++SLKQ+RS KTQ MLDQLA+LQ +E ML ++N+ L  KLEE  +    
Sbjct  121   TKDLEQLEHQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVDANRSLNMKLEEINSRNQY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASAHNI  979
             R +WE G+Q +    +   P S+ FFQPL  N + QIG    Y+ V +D++     A  +
Sbjct  181   RQTWEAGDQSMAYGTQN--PHSQSFFQPLDCNPTLQIGSDYRYSPVASDQLTATTQAQQV  238

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  239   NGFIPGWML  247



>gb|AHH28272.1| MADS-box transcription factor, partial [Rafflesia tuan-mudae]
Length=242

 Score =   323 bits (827),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 194/244 (80%), Gaps = 2/244 (1%)
 Frame = +2

Query  275   GRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSS  454
             GRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS
Sbjct  1     GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS  60

Query  455   SMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLST  634
             +M+KTLERYQ+CSY  +E N+PA + +++Y EY++LK+R E LQR+QRNLLGEDLGPL+T
Sbjct  61    NMLKTLERYQKCSYGAIEVNKPAKELESSYREYMKLKSRFESLQRTQRNLLGEDLGPLNT  120

Query  635   KELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLR  814
             KELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQ+L E+N+ L  KL+E  A   LR
Sbjct  121   KELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQLLLEANRALTIKLDEMGARNNLR  180

Query  815   LSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFP  994
              SWE   Q +   +    PQ++  FQPL  N + QIGYN V +D +     A  ++GF P
Sbjct  181   PSWEGPEQNMPYAHHH--PQNQELFQPLECNPTLQIGYNPVCSDHITATTHAQQVNGFIP  238

Query  995   GWML  1006
             GWML
Sbjct  239   GWML  242



>ref|XP_006585806.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
Length=250

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 194/250 (78%), Gaps = 5/250 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+CSY  +E  +PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCSYGAVEVTKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELE LE QL++SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KLEE  +    
Sbjct  121   TKELEHLERQLDSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNHY  180

Query  812   RLSWEDGNQEI-HQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASAHN  976
             R SWE G+Q + +    Q     +GFFQPL  N + QIG    YN V +D++        
Sbjct  181   RQSWEAGDQSMPYGGGPQNSHSHQGFFQPLECNPTLQIGPDYRYNDVASDQITATTQPQQ  240

Query  977   ISGFFPGWML  1006
             +SGF PGWML
Sbjct  241   VSGFIPGWML  250



>ref|XP_006856372.1| hypothetical protein AMTR_s00047p00190220 [Amborella trichopoda]
 gb|AAX15917.1| AGL2 [Amborella trichopoda]
 gb|AAY25578.1| AGL2 [Amborella trichopoda]
 gb|ERN17839.1| hypothetical protein AMTR_s00047p00190220 [Amborella trichopoda]
Length=243

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 170/245 (69%), Positives = 199/245 (81%), Gaps = 2/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y  LE N P  +TQ++Y EYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMVKTLERYQKCNYGALETNVPTRETQSSYQEYLKLKARVESLQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QLE SLKQIRS KTQ M DQLA+L++RE  L E+NK L+RKLE   A  P 
Sbjct  121   SKELEQLEQQLEMSLKQIRSTKTQCMFDQLADLRRRELALQETNKALKRKLEGASASNPP  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             +L+WE+  Q IH  NRQ P  +EGFF PL  + + QIGY+    D++ VAA   N++ F 
Sbjct  181   QLAWENNGQNIH-YNRQ-PAHTEGFFHPLECDSTLQIGYHPSCPDQMPVAAPVQNVNAFL  238

Query  992   PGWML  1006
             PGW++
Sbjct  239   PGWLV  243



>ref|NP_001267667.1| developmental protein SEPALLATA 2-like [Cucumis sativus]
 gb|AAF23363.1|AF135962_1 CAGL2 [Cucumis sativus]
Length=246

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 200/250 (80%), Gaps = 9/250 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY  +E  +PA + +++Y EYL+LK+R E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGAVEVTKPAKELESSYREYLKLKSRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QL +SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L+ KLEE  +   +
Sbjct  121   SKELEQLERQLVSSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQIKLEEISSRNNI  180

Query  812   RLSWEDGNQEIH--QQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS---AHN  976
             RL+W+ G+Q +    QN     Q++GFFQPL  N + QIGY S  +D++    +   A  
Sbjct  181   RLTWDGGDQSMSYGPQN----AQTQGFFQPLECNPTLQIGYTSAVSDQITSTTTPTHAQQ  236

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  237   VNGFLPGWML  246



>ref|XP_003549578.1| PREDICTED: MADS-box protein CMB1-like [Glycine max]
Length=243

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 194/246 (79%), Gaps = 4/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLE+YQ+ SY+ LE  +P +D+Q NY EYLRLKARVE+LQ SQRNLLGEDL  ++
Sbjct  61    SSMMKTLEKYQKYSYSALETTRPINDSQ-NYQEYLRLKARVEVLQCSQRNLLGEDLAQMN  119

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGIP  808
             T ELEQLENQLE +LK IRS KTQ MLDQL++L  RE +L E+N +LR KLEE N + + 
Sbjct  120   TNELEQLENQLETALKNIRSTKTQFMLDQLSDLHHRETLLIETNNVLRSKLEETNNSQVQ  179

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             + L+ E G   I   N   PPQSEGFFQP+G+N + QIGYN     + NV AS+ ++ GF
Sbjct  180   VSLALEAGGPSIQYTN--FPPQSEGFFQPMGVNPTLQIGYNQTNPHDANVGASSLSMHGF  237

Query  989   FPGWML  1006
                WML
Sbjct  238   ASEWML  243



>dbj|BAM34481.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=247

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 197/248 (79%), Gaps = 5/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRR+GLLKKAYELS+LCDAEVALIIFS RG+L+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRSGLLKKAYELSVLCDAEVALIIFSTRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERY++CSY+  EA  P+ +T+N+Y EYL+LK+RVE LQRSQRNLLGEDL  LS
Sbjct  61    SSMLKTLERYKKCSYSASEAVAPSKETENSYQEYLKLKSRVEFLQRSQRNLLGEDLSQLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QLE SLKQIRS KTQ MLDQL +L+++EQML E+NK LRRKL+   AG  L
Sbjct  121   TKELEQLERQLEMSLKQIRSTKTQLMLDQLCDLKRKEQMLQEANKALRRKLQGEDAGNAL  180

Query  812   RLSWED-GNQEIHQQNRQL---PPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNI  979
             +LSWE+ G  E    +      P QS+GFFQPL  +   QIGY  +  D++N   +A N+
Sbjct  181   QLSWENAGCSEPGAPSTSCDHQPAQSQGFFQPLQCD-PLQIGYQPICIDQLNNGVNAQNV  239

Query  980   SGFFPGWM  1003
             +GFF  WM
Sbjct  240   NGFFSAWM  247



>gb|ABQ85952.1| MADS-box transcription factor SEP-like 3 [Trochodendron aralioides]
Length=230

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 194/232 (84%), Gaps = 2/232 (1%)
 Frame = +2

Query  311   KINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRC  490
             KINRQVTFAKRRNG+LKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SSM+KTLERYQ+C
Sbjct  1     KINRQVTFAKRRNGMLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMLKTLERYQKC  60

Query  491   SYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEA  670
             SY  LEA+QPA +TQN+Y EYL+LK RVE+LQRSQRNLLGEDLGPL+TKELEQLE QLE 
Sbjct  61    SYGALEASQPAIETQNSYQEYLKLKGRVEVLQRSQRNLLGEDLGPLNTKELEQLEQQLEM  120

Query  671   SLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQ  850
             SLKQIRS KTQ MLDQL++LQ++EQML E+N+ L RKL E+ A   LRLSWE G Q I  
Sbjct  121   SLKQIRSTKTQFMLDQLSDLQRKEQMLQEANRALGRKLGESSAENTLRLSWEAGGQSIP-  179

Query  851   QNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFPGWML  1006
              +RQ P + EGFFQPL  N S  IGYN VG D++ VAA   N++GF PGWML
Sbjct  180   YSRQ-PAEPEGFFQPLECNSSMHIGYNPVGPDQITVAAPGQNVNGFIPGWML  230



>ref|XP_003552609.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=254

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/254 (64%), Positives = 195/254 (77%), Gaps = 9/254 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+CSY  +E ++PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCSYGAVEVSKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELE LE QL++SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KLEE  +    
Sbjct  121   IKELEHLERQLDSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNHY  180

Query  812   RLSWEDGNQEIH-----QQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAA  964
             R SWE G+Q +       +N      S+GFFQPL  N +  IG    YN+V +D++    
Sbjct  181   RQSWEAGDQSMPYGGGGPENSHSHSHSQGFFQPLECNPTLHIGPDYRYNAVASDQITATT  240

Query  965   SAHNISGFFPGWML  1006
                 +SGF PGWML
Sbjct  241   QPQQVSGFIPGWML  254



>ref|XP_007045799.1| MADS-box transcription factor [Theobroma cacao]
 gb|EOY01631.1| MADS-box transcription factor [Theobroma cacao]
Length=240

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 171/245 (70%), Positives = 196/245 (80%), Gaps = 5/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERY RC+Y  LE  Q  SDTQ++Y EYL+LKA+VE+LQRSQR+ LGEDLG L 
Sbjct  61    SSMAKTLERYHRCTYGTLEPGQTESDTQSSYQEYLKLKAKVEVLQRSQRHFLGEDLGDLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             + ELEQLE+QL+ SLKQ+RS K  SMLDQLAELQ++E++L E+N+ LRRKLEE+ +   L
Sbjct  121   STELEQLEHQLDFSLKQLRSTKMHSMLDQLAELQRKEEILLETNRNLRRKLEESTST--L  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             R SWE G Q  +  N   PPQ EGFF+PL  + S QIGYN    D+   AASA N  GF 
Sbjct  179   RSSWETGEQS-NPYNHHPPPQPEGFFEPLQCSSSMQIGYNPTAADQDAAAASAPN--GFI  235

Query  992   PGWML  1006
             PGWML
Sbjct  236   PGWML  240



>ref|XP_009373783.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009333662.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Pyrus x bretschneideri]
 dbj|BAK18787.2| MADS-box protein [Pyrus pyrifolia var. culta]
Length=246

 Score =   320 bits (821),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 198/246 (80%), Gaps = 1/246 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SS++KTL+RYQ+CSY  ++  N+PA + +++Y EY++LK R E LQR+QRNLLGEDLGPL
Sbjct  61    SSILKTLDRYQKCSYGAVDQVNRPAKELESSYREYMKLKGRYESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLE SLKQ+RS KTQ MLDQL++LQ +EQ+L E+N+ L  KL+E  +   
Sbjct  121   NTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LR SWE G+Q +    +    QS+GFFQPL  N + Q+GY++ G+++++   +   ++ F
Sbjct  181   LRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYSAAGSEQMSATTNGQQVNCF  240

Query  989   FPGWML  1006
              PGWML
Sbjct  241   IPGWML  246



>ref|XP_008464576.1| PREDICTED: developmental protein SEPALLATA 1-like [Cucumis melo]
Length=246

 Score =   320 bits (821),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 197/248 (79%), Gaps = 5/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGIVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY  +E  +PA + +++Y EY++LK+R E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGAVEVTKPAKELESSYREYVKLKSRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QLE+SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L+ KLEE  +   +
Sbjct  121   SKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQMKLEEISSRNNI  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS---AHNIS  982
             R  W+ G+Q +    +    Q++GFFQPL  N + QIGY S  +D++    +   A  ++
Sbjct  181   RHPWDGGDQSMSYGTQN--AQTQGFFQPLDCNPTLQIGYTSAVSDQITSTTTPTHAQQVN  238

Query  983   GFFPGWML  1006
             GF PGWML
Sbjct  239   GFLPGWML  246



>gb|AEX58639.1| AGL2-1 [Epimedium sagittatum]
Length=242

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 198/247 (80%), Gaps = 7/247 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVA+IIFS+RGKLYEFCS 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAVIIFSSRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERY +C+Y  LEAN P  +T+++YHEY++LK R+ELLQ++QRNLLGEDL  L+
Sbjct  61    SSMLKTLERYNQCNYNPLEANAPDKETESSYHEYMKLKGRLELLQQNQRNLLGEDLDSLT  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             T EL+QLENQLE SLKQIRS KTQ MLDQL++LQQ+EQML E+N  LR KL+   A IPL
Sbjct  121   TNELDQLENQLETSLKQIRSTKTQYMLDQLSDLQQKEQMLKEANATLRTKLDGASAEIPL  180

Query  812   RLSWEDGNQEI--HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
             +LSW+   Q++  + QN Q  P    FFQPL  N + Q+GY+ VG+ ++    S  N +G
Sbjct  181   QLSWQLAGQKVTYNCQNSQPEP----FFQPLECNPTNQMGYHQVGSHQLTNQPS-QNRNG  235

Query  986   FFPGWML  1006
             F PGWML
Sbjct  236   FIPGWML  242



>ref|NP_001280849.1| MADS-box protein CMB1-like [Malus domestica]
 gb|AEQ53932.1| MADS-box transcription factor [Malus domestica]
Length=248

 Score =   320 bits (821),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 198/250 (79%), Gaps = 7/250 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENK NRQVTF+KRRNGLLKKA+ELS+LCDAEVALIIFS RGKLYEF SS
Sbjct  1     MGRGKVELKRIENKSNRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSGRGKLYEFSSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SMMKTLERYQRCSY+ L+AN+PA++TQN+Y EYL+L+ RVE LQ+SQRNLLGEDL  L+
Sbjct  61    LSMMKTLERYQRCSYSSLDANRPANETQNSYQEYLQLETRVEALQQSQRNLLGEDLATLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LE+LE+QLE SL +IRS KTQ MLDQL++LQ REQML E+NK LRRKLEE     P 
Sbjct  121   TKKLEELEHQLETSLNKIRSTKTQFMLDQLSDLQNREQMLIEANKALRRKLEETSVQAPQ  180

Query  812   RLSWE---DGNQEIHQQNRQLPPQSEGFFQPLGLNIS-GQIGYNSVGT-DEVNVAASAHN  976
              ++WE   DG+  I Q    LP  SE FF PLG N S  QIGY  +G+ + ++V     +
Sbjct  181   FMAWEAAGDGHNNIQQT--WLPSNSEAFFHPLGGNNSTSQIGYAHLGSHNGMDVGNPGQH  238

Query  977   ISGFFPGWML  1006
             ++G+ PGWML
Sbjct  239   VNGYIPGWML  248



>ref|XP_004507289.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Cicer arietinum]
Length=247

 Score =   320 bits (820),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 195/249 (78%), Gaps = 6/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              SM+KTLERYQ+CSY  +E N+PA +  Q++Y EYL+LKAR E LQR+QRNLLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGAVEVNKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
              TK+LEQLE+QL++SLKQ+RS KTQ MLDQLA+LQ +E ML ++N+ L  KLEE  +   
Sbjct  121   GTKDLEQLEHQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVDANRSLNMKLEEINSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG---YNSVGTDEVNVAASAHNI  979
              R +WE G+Q +    +   P S+ FFQPL  N + QIG   Y+ V +D++     A  +
Sbjct  181   YRQTWEAGDQSMAYGTQN--PHSQSFFQPLDCNPTLQIGDYRYSPVASDQLTATTQAQQV  238

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  239   NGFIPGWML  247



>ref|XP_004507287.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Cicer arietinum]
Length=248

 Score =   320 bits (820),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 195/250 (78%), Gaps = 7/250 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              SM+KTLERYQ+CSY  +E N+PA +  Q++Y EYL+LKAR E LQR+QRNLLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGAVEVNKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
              TK+LEQLE+QL++SLKQ+RS KTQ MLDQLA+LQ +E ML ++N+ L  KLEE  +   
Sbjct  121   GTKDLEQLEHQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVDANRSLNMKLEEINSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASAHN  976
              R +WE G+Q +    +   P S+ FFQPL  N + QIG    Y+ V +D++     A  
Sbjct  181   YRQTWEAGDQSMAYGTQN--PHSQSFFQPLDCNPTLQIGSDYRYSPVASDQLTATTQAQQ  238

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  239   VNGFIPGWML  248



>gb|ABG78619.1| MADS4 [Populus tomentosa]
Length=245

 Score =   320 bits (820),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 194/246 (79%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY   E N+PA + +N+Y EYL++KAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGAEEVNKPAKELENSYREYLKVKARFEALQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QLE+SL Q+RS KTQ MLDQLA+LQ +E +L E+N+ L  KL+E  A   L
Sbjct  121   TKDLEQLERQLESSLNQVRSTKTQYMLDQLADLQNKEHLLLEANRGLTMKLDEISARNSL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASA-HNISGF  988
             R SWE  +Q+      Q   QS+G FQ L  N + QIGYN VG+D+++    A   + GF
Sbjct  181   RPSWEGDDQQNMSYGHQ-HAQSQGLFQALECNPTLQIGYNPVGSDQMSCTTHATQQVHGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>dbj|BAD38890.1| MADS box transcription factor [Gentiana triflora]
Length=244

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 190/244 (78%), Gaps = 1/244 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS 
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SS  +T+ERYQR +Y   +A  P+ D QN+Y EY++LKARVE+LQ   RN LGEDLG LS
Sbjct  61    SSTTETVERYQRYTYGLQDAGHPSDDPQNSYQEYVKLKARVEVLQGYHRNFLGEDLGSLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELE LE+Q+E SLKQ+RS KT  MLDQ+A+LQ++E+MLAE NK LR KL+E    +PL
Sbjct  121   CKELEHLEHQVETSLKQVRSTKTSFMLDQVADLQRKEEMLAEENKALRGKLDERANQVPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             RLSWE G Q+       +P  ++GFFQPLGLN + Q+GYN  G +      + +NI+GF 
Sbjct  181   RLSWE-GRQQAPTGYNNVPAHTQGFFQPLGLNSTLQMGYNQGGAEGNYNVHAGNNINGFM  239

Query  992   PGWM  1003
             PG+M
Sbjct  240   PGFM  243



>gb|AAL08423.2|AF185574_1 transcription factor MAGL4 [Populus tremuloides]
Length=245

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 195/246 (79%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY   E N+PA + +N+Y EYL++KAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGAEEVNKPAKELENSYREYLKVKARFEGLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QLE+SL Q+RS KTQ MLDQLA+LQ +E +L E+N+ L  KL+E  A   L
Sbjct  121   TKDLEQLERQLESSLNQVRSTKTQYMLDQLADLQNKEHLLQEANRGLTIKLDEISARNSL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVN-VAASAHNISGF  988
             R SWE  +Q+      Q   QS+G FQ L  N + QIGYN VG+D+V+ +  +   + GF
Sbjct  181   RPSWEGDDQQNMSYGHQ-HAQSQGLFQALECNPTLQIGYNPVGSDQVSAITHATQQVHGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>gb|KCW83763.1| hypothetical protein EUGRSUZ_B00633 [Eucalyptus grandis]
Length=255

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/257 (65%), Positives = 197/257 (77%), Gaps = 14/257 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+V+LKRIENKINRQVTF+KRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYE+CSS
Sbjct  1     MGRGRVQLKRIENKINRQVTFSKRRNGLLKKAYELSLLCDAEVALIIFSSRGKLYEYCSS  60

Query  452   SSMMKTLERYQRCSY-AHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSMMKTLERYQ+CSY A L  ++   +TQ++Y EYLRLKAR E+L +SQRNLLGEDLG L
Sbjct  61    SSMMKTLERYQKCSYGAQLNPSRSIDETQSSYQEYLRLKARAEVLLQSQRNLLGEDLGSL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
              +KELE LE+QLE+SLK IRS KTQSMLDQL  LQ R  +L E+NK+L RKLEE    IP
Sbjct  121   DSKELEHLESQLESSLKNIRSTKTQSMLDQLFNLQNR--VLLETNKILSRKLEEVSPQIP  178

Query  809   LRLSWEDGNQEIHQQNRQ-----------LPPQSEGFFQPLGLNISGQIGYNSVGTDEVN  955
              +L+WE G Q     +              PPQSEGFF P+  N+S QIGYN    DE+N
Sbjct  179   FQLAWEVGGQGGGGGDGGGGGGGGIPFSLFPPQSEGFFNPMDGNLSLQIGYNPTCLDEMN  238

Query  956   VAASAHNISGFFPGWML  1006
              + S+ N++GF PGWML
Sbjct  239   ASVSSQNVAGFIPGWML  255



>gb|AET98846.1| SEPALLATA1 [Passiflora edulis]
Length=242

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 195/248 (79%), Gaps = 9/248 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY   + N+PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGVEDVNKPAKELESSYREYLKLKARFETLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QLE SLK +RS KTQ MLDQLA+LQ +E +L E+N+ L  KL+E  A   L
Sbjct  121   TKDLEQLERQLEGSLKLVRSTKTQYMLDQLADLQNKEHLLLEANRTLTIKLDEISARNQL  180

Query  812   RLSWEDGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNIS  982
             R  WEDG Q +   HQQ       S+G F  L  N + QIGYNSVG+D++  ++ +  ++
Sbjct  181   R-QWEDGEQSVPYGHQQ-----AHSQGLFHALECNPTLQIGYNSVGSDQIPASSHSQQVN  234

Query  983   GFFPGWML  1006
             GF PGWML
Sbjct  235   GFIPGWML  242



>ref|XP_003531877.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
 gb|KHN30313.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=251

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 194/251 (77%), Gaps = 6/251 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSM+KTLERYQ+CSY  +E  +PA +  Q++Y EYL+LKAR E LQR+QRNLLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVTKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELE LE QL++SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KLEE  +   
Sbjct  121   NTKELEHLERQLDSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNH  180

Query  809   LRLSWEDGNQEI-HQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASAH  973
              R SWE G+Q + +    Q     +GFFQPL  N + QIG    YN V +D++       
Sbjct  181   YRQSWEAGDQSMPYGGGPQNSHSHQGFFQPLECNPTLQIGPDYRYNDVASDQITATTQPQ  240

Query  974   NISGFFPGWML  1006
              +SGF PGWML
Sbjct  241   QVSGFIPGWML  251



>ref|XP_002306051.2| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 ref|XP_006384290.1| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 ref|XP_011008140.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011008141.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 gb|EEE86562.2| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 gb|ERP62087.1| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
Length=245

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 193/246 (78%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTLERYQ+CSY   E N+PA + +++Y EYL++KAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SNMLKTLERYQKCSYGAEEVNKPAKELESSYREYLKVKARFEALQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QLE+SL Q+RS KTQ MLDQLA+LQ +E +L E+N+ L  KL+E  A   L
Sbjct  121   TKELEQLERQLESSLNQVRSTKTQYMLDQLADLQNKEHLLLEANRGLTIKLDEISARNSL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASA-HNISGF  988
             R SWE  +Q+      Q   QS+G FQ L  N + QIGYN VG+D++     A   + GF
Sbjct  181   RPSWEGDDQQNMSYGHQ-HAQSQGLFQALECNPTLQIGYNPVGSDQMTATTHATQQVHGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   IPGWML  245



>ref|XP_008341807.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Malus 
domestica]
Length=247

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 199/247 (81%), Gaps = 2/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF KRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFXKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGP  625
             SS++KTL+RYQ+CSY  ++  N+PA +  Q++Y EY++LK R E LQR+QRNLLGEDLGP
Sbjct  61    SSILKTLDRYQKCSYGAVDQVNRPAKELEQSSYREYMKLKGRYESLQRTQRNLLGEDLGP  120

Query  626   LSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGI  805
             L+TKELEQLE QLE SLKQ+RS KTQ MLDQL++LQ +EQ+L E+N+ L  KL+E  +  
Sbjct  121   LNTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
              LR SWE G+Q +    +    QS+GFFQPL  N + Q+GY++VG+++++   +A  ++ 
Sbjct  181   QLRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYSAVGSEQMSATTNAQQVNC  240

Query  986   FFPGWML  1006
             F PGWML
Sbjct  241   FIPGWML  247



>ref|XP_006602962.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
 gb|KHN37943.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=255

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 195/255 (76%), Gaps = 10/255 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSM+KTLERYQ+CSY  +E ++PA +  Q++Y EYL+LKAR E LQR+QRNLLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVSKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             + KELE LE QL++SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KLEE  +   
Sbjct  121   NIKELEHLERQLDSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNH  180

Query  809   LRLSWEDGNQEIH-----QQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVA  961
              R SWE G+Q +       +N      S+GFFQPL  N +  IG    YN+V +D++   
Sbjct  181   YRQSWEAGDQSMPYGGGGPENSHSHSHSQGFFQPLECNPTLHIGPDYRYNAVASDQITAT  240

Query  962   ASAHNISGFFPGWML  1006
                  +SGF PGWML
Sbjct  241   TQPQQVSGFIPGWML  255



>ref|XP_009373782.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009333661.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Pyrus x bretschneideri]
Length=247

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/247 (64%), Positives = 198/247 (80%), Gaps = 2/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGP  625
             SS++KTL+RYQ+CSY  ++  N+PA +  Q++Y EY++LK R E LQR+QRNLLGEDLGP
Sbjct  61    SSILKTLDRYQKCSYGAVDQVNRPAKELEQSSYREYMKLKGRYESLQRTQRNLLGEDLGP  120

Query  626   LSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGI  805
             L+TKELEQLE QLE SLKQ+RS KTQ MLDQL++LQ +EQ+L E+N+ L  KL+E  +  
Sbjct  121   LNTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
              LR SWE G+Q +    +    QS+GFFQPL  N + Q+GY++ G+++++   +   ++ 
Sbjct  181   QLRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYSAAGSEQMSATTNGQQVNC  240

Query  986   FFPGWML  1006
             F PGWML
Sbjct  241   FIPGWML  247



>ref|XP_007151389.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
 gb|ESW23383.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
Length=247

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 193/249 (78%), Gaps = 6/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+CSY  +E ++PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCSYGAVEVSKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +EQML E+N+ L  KL+E  +    
Sbjct  121   TKELEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRALTMKLDEINSRNQY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASAHNI  979
             R +WE G+Q +          S+GFFQPL  N + QIG    YN   +D++     A  +
Sbjct  181   RQTWEAGDQSMPYGTPN--AHSQGFFQPLECNPTLQIGSDYRYNPEASDQLTGTTQAQQV  238

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  239   NGFIPGWML  247



>gb|AFO68788.1| floral-binding protein 9, partial [Camellia japonica]
Length=218

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 180/219 (82%), Gaps = 2/219 (1%)
 Frame = +2

Query  350   GLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYAHLEANQPASD  529
             GLLKKAYELS+LCDAEVALI+FSNRGKLYEFCS SSM KTLERYQRCSY  L+  QPA +
Sbjct  2     GLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSGSSMAKTLERYQRCSYDLLDPRQPAIE  61

Query  530   TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLKQIRSRKTQSM  709
              QNNYHEYLRLKARVE+LQ+SQRNLLGEDLGPL+TKEL+QLE Q E SLK+IRS KTQ M
Sbjct  62    NQNNYHEYLRLKARVEILQQSQRNLLGEDLGPLNTKELDQLEYQSENSLKKIRSTKTQFM  121

Query  710   LDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQQNRQLPPQSEGFF  889
             LD+LA+LQ+REQMLAESNK LR KLEE  A   L+LSWE G Q +H  NR  P QSEGFF
Sbjct  122   LDELADLQRREQMLAESNKALRGKLEETTAENRLQLSWEAGGQTMH-YNR-FPAQSEGFF  179

Query  890   QPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFPGWML  1006
             QPLGLN + QIGYN +GT E+N AA     +GF PGWML
Sbjct  180   QPLGLNSTLQIGYNPMGTHEMNAAAPTQIANGFIPGWML  218



>sp|Q39685.1|CMB1_DIACA RecName: Full=MADS-box protein CMB1 [Dianthus caryophyllus]
 gb|AAA62761.1| MADS box protein [Dianthus caryophyllus]
Length=233

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 194/247 (79%), Gaps = 16/247 (6%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S M KTLERYQRCSY  LE +QP+ +T+++Y EYL+LKA+V++LQRS RNLLGEDLG LS
Sbjct  61    SCMNKTLERYQRCSYGSLETSQPSKETESSYQEYLKLKAKVDVLQRSHRNLLGEDLGELS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QL+ SL+QIRS KTQ MLDQLA+LQ++E+ML ESN+ L+ KLEE+ A    
Sbjct  121   TKELEQLEHQLDKSLRQIRSIKTQHMLDQLADLQKKEEMLFESNRALKTKLEESCAS--F  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGL--NISGQIGYNSVGTDEVNVAASAHNISG  985
             R +W+            +    +GFF+PL L  N + QIGYN    D++N   SA N+ G
Sbjct  179   RPNWD------------VRQPGDGFFEPLPLPCNNNLQIGYNEATQDQMNATTSAQNVHG  226

Query  986   FFPGWML  1006
             F  GWML
Sbjct  227   FAQGWML  233



>gb|AAX15924.1| AGL9.2 [Persea americana]
Length=242

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 192/245 (78%), Gaps = 5/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E      +TQ+++ EYL+LKARVE LQRSQRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCNYGAPETTVSTRETQSSHQEYLKLKARVEALQRSQRNLLGEDLGPLT  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KEL+ LE QL+ASLKQIRS +TQ MLDQLA+LQ+REQML+E+NK L+R+LEE +   P 
Sbjct  121   SKELDTLEKQLDASLKQIRSTRTQYMLDQLADLQRREQMLSEANKNLKRRLEEGMQANP-  179

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLG-LNISGQIGYNSVGTDEVNVAASAHNISGF  988
                W+     +    +Q PPQS+GFF PL     +  IGY     D++ +AA   +++ +
Sbjct  180   -QVWDPNGHPVTYGRQQAPPQSDGFFHPLDTCEPTLHIGYQPA--DQITIAAPGPSVNNY  236

Query  989   FPGWM  1003
              PGW+
Sbjct  237   MPGWL  241



>ref|XP_010678363.1| PREDICTED: MADS-box protein CMB1-like [Beta vulgaris subsp. vulgaris]
Length=252

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 197/255 (77%), Gaps = 13/255 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKL+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KT+E+YQRC+Y  LEAN   +D Q  YHEYL+LK RVE LQ+SQRNLLGEDL PL+
Sbjct  61    SSMLKTIEKYQRCNYGALEANGVLNDPQATYHEYLKLKTRVEFLQQSQRNLLGEDLAPLA  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLE+QLE SLKQIRS K+Q MLDQLAEL++REQ L E+N+ L +KLEE+    P 
Sbjct  121   IKELEQLEHQLELSLKQIRSTKSQHMLDQLAELRKREQALVENNRNLMKKLEESNPQFPQ  180

Query  812   RLSWEDGNQEIHQQNRQLP--------PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS  967
             +L+WE  N   HQ  + +P          SEGFFQPL  N   Q GY+ + + +++VA  
Sbjct  181   QLAWEGDN---HQDQQNIPFSRIPTHHQSSEGFFQPLCGNPPLQNGYHHLDSTQISVATP  237

Query  968   AHNISGF--FPGWML  1006
             + N++G+    GWML
Sbjct  238   SQNLNGYNNVHGWML  252



>gb|AFO68784.1| floral-binding protein 9, partial [Clethra tomentosa]
Length=220

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 187/230 (81%), Gaps = 11/230 (5%)
 Frame = +2

Query  320   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYA  499
             RQVT++KRRNGLLKKAYELS+LCDAEVALI+FSN GKLYEFCSSSSM+KTLE+YQRCSY 
Sbjct  1     RQVTYSKRRNGLLKKAYELSVLCDAEVALIMFSNHGKLYEFCSSSSMLKTLEKYQRCSYG  60

Query  500   HLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLK  679
              LEA+Q  ++TQN YHEY++LKARV++LQ+SQRNLLGEDL PLSTKELEQLE+QLE+SLK
Sbjct  61    SLEASQLVNETQNTYHEYMKLKARVDILQQSQRNLLGEDLEPLSTKELEQLEHQLESSLK  120

Query  680   QIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAG-IPLRLSWEDGNQEIHQQN  856
             QIRS KTQ+MLDQL++LQ+REQML ESNK L+RKLE +    +P R  +           
Sbjct  121   QIRSTKTQAMLDQLSDLQRREQMLVESNKALKRKLEASTTEFLPSRRDFFSV--------  172

Query  857   RQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFPGWML  1006
                PPQS+GF+QPL LN S QIGY+ + TDE+N  A   N++GF PGWML
Sbjct  173   --FPPQSDGFYQPLRLNSSLQIGYDPMSTDEINDGAHPQNVNGFIPGWML  220



>ref|NP_001234670.1| MADS-box transcription factor [Solanum lycopersicum]
 gb|AAM15775.1|AF448522_1 MADS-box transcription factor MADS-RIN [Solanum lycopersicum]
 gb|AAZ83587.1| MADS-box transcription factor MADS-RIN [Solanum lycopersicum]
 gb|AAZ83588.1| MADS-box transcription factor [Solanum lycopersicum]
Length=242

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 187/245 (76%), Gaps = 3/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAE+ALIIFS+RGKLYEFCS+
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEIALIIFSSRGKLYEFCSN  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERY R +Y  LE  Q +SD+QNNY EYL+LK RVE+LQ+SQR+LLGEDLG L 
Sbjct  61    SSMSKTLERYHRYNYGTLEGTQTSSDSQNNYQEYLKLKTRVEMLQQSQRHLLGEDLGQLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL++SL+QIRS KTQ +LDQLAELQQ+EQ L E NK LR KLEE   G+  
Sbjct  121   TKDLEQLERQLDSSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSLRIKLEE--LGVTF  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             + SW  G Q +  ++ Q P   EGFFQ +  N +  I Y        N A S H+ +G  
Sbjct  179   QTSWHCGEQSVQYRHEQ-PSHHEGFFQHVNCNNTLPISYGYDNVQPENAAPSTHDATGVV  237

Query  992   PGWML  1006
             PGWML
Sbjct  238   PGWML  242



>ref|XP_010694134.1| PREDICTED: developmental protein SEPALLATA 1 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=250

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 190/246 (77%), Gaps = 4/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM+KTLERYQ+CSY  +E N+P+ + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    PSMLKTLERYQKCSYGGVEVNKPSKELESSYREYLKLKARHESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP-  808
              KEL+QLE QLE+SLKQIRS KTQSMLDQL +LQ +E  L E+NK L+ +L+  +     
Sbjct  121   VKELDQLERQLESSLKQIRSTKTQSMLDQLTDLQNKEHALMEANKTLKTELDRIMVKDTQ  180

Query  809   -LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
               R +W+   Q +H   +    QS+G FQPL  N + QIGYN   ++++ VA S   + G
Sbjct  181   QFRQTWDGSEQNVHYGQQH--AQSQGLFQPLDCNPTLQIGYNPESSEQMTVATSHTQVPG  238

Query  986   FFPGWM  1003
             F PGWM
Sbjct  239   FLPGWM  244



>gb|AFO68790.1| agamous-like protein 234, partial [Pachysandra terminalis]
Length=228

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 185/230 (80%), Gaps = 3/230 (1%)
 Frame = +2

Query  320   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYA  499
             RQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSSM  TLERYQ+CSY 
Sbjct  1     RQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSARGKLYEFCSSSSMQNTLERYQKCSYG  60

Query  500   HLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLK  679
              LE +QPA +TQ++Y EY+RLKARVE LQRSQRNL GEDLGPLSTKELEQLE+QLE SL 
Sbjct  61    PLEPSQPAKETQSSYLEYMRLKARVEGLQRSQRNLFGEDLGPLSTKELEQLEHQLEMSLN  120

Query  680   QIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQQNR  859
             QIRS KTQ MLDQL++LQ++EQML E+N+ LRRKL+E+ A   LR SWE     +  Q  
Sbjct  121   QIRSTKTQFMLDQLSDLQRKEQMLQEANRALRRKLDESSAENHLRQSWEAAGHNM--QYS  178

Query  860   QLPPQSEGFFQPLGLNISGQIGYNSVGTDE-VNVAASAHNISGFFPGWML  1006
             Q   QSE FFQPL  N + QIGYN VG D+ + +AA A N++GF PGWML
Sbjct  179   QQHAQSEDFFQPLECNSTLQIGYNPVGPDDHMTIAAPAQNVNGFVPGWML  228



>gb|AAQ72498.1| MADS-box protein 12 [Petunia x hybrida]
Length=246

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 192/250 (77%), Gaps = 9/250 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             ++M K+LERYQ+CSY  LE NQ + D  QNNY EYL+LKA+ E LQR QR+LLGEDLGPL
Sbjct  61    NNMFKSLERYQKCSYGTLEVNQSSKDNEQNNYREYLKLKAKYESLQRYQRHLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +  +LE LE QL+ SLK IRS +TQ MLDQL++LQ +E++  E+NK+L RKLEE  A   
Sbjct  121   NIDDLENLEVQLDTSLKHIRSTRTQLMLDQLSDLQTKEKLWVEANKVLERKLEEIYAENS  180

Query  809   LRLSWEDGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTD-EVNVAASAHN  976
             L+ SW  G Q +   HQ N     QS+GFFQPL  N + QIGYN + T  ++    +A N
Sbjct  181   LQQSWGGGEQSVTYGHQHN----AQSQGFFQPLECNSTLQIGYNPITTSRQITAVTNAQN  236

Query  977   ISGFFPGWML  1006
             ++G  PGWML
Sbjct  237   VNGMVPGWML  246



>gb|KEH25149.1| MADS-box transcription factor [Medicago truncatula]
Length=250

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 195/252 (77%), Gaps = 9/252 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM+KTL+RYQ+CSY  +E N+PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL 
Sbjct  61    PSMLKTLDRYQKCSYGAVEVNKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NV-AGI  805
             TK+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE N+ +  
Sbjct  121   TKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSMKLEEININSRN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYN-----SVGTDEVNVAASA  970
               R +WE G+Q +   N+     S+ FFQPL  N + QIG +      V +D++     A
Sbjct  181   QYRQTWEAGDQSMAYGNQN--AHSQSFFQPLECNPTLQIGTDYRYSPPVASDQLTATTQA  238

Query  971   HNISGFFPGWML  1006
               ++GF PGWML
Sbjct  239   QQVNGFIPGWML  250



>ref|XP_006363565.1| PREDICTED: MADS-box protein CMB1-like [Solanum tuberosum]
Length=241

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 192/247 (78%), Gaps = 8/247 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILC+AEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCEAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM  TLERY RCSY  LE  Q + D+QNNY EY++LKARVE+LQ+SQR++LGEDL  L+
Sbjct  61    SSMSDTLERYHRCSYGDLETGQSSMDSQNNYQEYMKLKARVEVLQQSQRHILGEDLSQLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL++SL+QIRSR+TQ+MLDQL++LQQ+EQ L E N+ L+ KLEEN   +  
Sbjct  121   TKDLEQLERQLDSSLRQIRSRRTQNMLDQLSDLQQKEQSLLEINRSLKTKLEEN--SVAH  178

Query  812   RLSWE-DGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG-YNSVGTDEVNVAASAHNISG  985
             +  W   G Q I  Q RQ P QSEGFFQPL  N +     YN    D  N+  S HN +G
Sbjct  179   QAHWHTTGEQNI--QFRQQPAQSEGFFQPLQCNTNIVPNRYNLAPLD--NIEPSTHNATG  234

Query  986   FFPGWML  1006
               PGWML
Sbjct  235   ILPGWML  241



>emb|CAA04322.1| MADS-box protein [Malus domestica]
Length=245

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 194/247 (79%), Gaps = 7/247 (3%)
 Frame = +2

Query  281   GKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSM  460
             GKVELKRIENK NRQVTF+KRRNGLLKKA+ELS+LCDAEVALIIFS RGKLYEF SS SM
Sbjct  1     GKVELKRIENKSNRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSGRGKLYEFSSSLSM  60

Query  461   MKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKE  640
             MKTLERYQRCSY+ L+AN+PA++TQN+Y EYL+L+ RVE LQ+SQRNLLGEDL  L+TK+
Sbjct  61    MKTLERYQRCSYSSLDANRPANETQNSYQEYLQLETRVEALQQSQRNLLGEDLATLNTKK  120

Query  641   LEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLS  820
             LE+LE+QLE SL +IRS KTQ MLDQL++LQ REQML E+NK LRRKLEE     P  ++
Sbjct  121   LEELEHQLETSLNKIRSTKTQFMLDQLSDLQNREQMLVEANKALRRKLEETSVQAPQFMA  180

Query  821   WE---DGNQEIHQQNRQLPPQSEGFFQPLGLNIS-GQIGYNSVGT-DEVNVAASAHNISG  985
             WE   DG+  I Q    LP  SE FF P G N S  QIGY  +G+ + ++V     +++G
Sbjct  181   WEAAGDGHNNIQQT--WLPSNSEAFFHPFGGNNSTSQIGYAHLGSHNGMDVGNPGQHVNG  238

Query  986   FFPGWML  1006
             + PGWML
Sbjct  239   YIPGWML  245



>ref|XP_003621519.1| MADS-box protein [Medicago truncatula]
Length=245

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 195/246 (79%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPLS
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKQRFENLQRAQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +K+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE  +    
Sbjct  121   SKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLEEINSRNHY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASA-HNISGF  988
             R SWE  +Q +  + +Q    S+ FFQ L  N + QIGYN+V +D++   + A   ++GF
Sbjct  181   RQSWEASDQSMQYEAQQ-NAHSQSFFQQLECNPTLQIGYNNVASDQIASTSQAQQQVNGF  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   VPGWML  245



>ref|XP_011099041.1| PREDICTED: developmental protein SEPALLATA 1 isoform X2 [Sesamum 
indicum]
Length=246

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 188/247 (76%), Gaps = 3/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTLERYQ+CSY  LE N P  D  Q++Y EYL+LKA+ E LQR QR LLG+DLGPL
Sbjct  61    SNMLKTLERYQKCSYGSLEVNHPGKDIEQSSYREYLKLKAKYESLQRYQRQLLGDDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +  +LE +E+QLE SLK IRS +TQ MLDQLA+LQ +E+++ ++NK L RKLEE  A   
Sbjct  121   NINDLEHIEHQLETSLKHIRSTRTQVMLDQLADLQTKEKLMLDANKALERKLEEIYAANQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNS-VGTDEVNVAASAHNISG  985
             L+ SW  G ++         P S+GFFQPL  N + QIGYN  V + ++  A    N++G
Sbjct  181   LQQSWVGGGEQSSTYTHH-HPHSQGFFQPLDCNSTLQIGYNDPVSSSQMTAATDVQNVNG  239

Query  986   FFPGWML  1006
               PGWML
Sbjct  240   LIPGWML  246



>ref|NP_001234837.1| MADS-box transcription factor [Solanum lycopersicum]
 gb|ABB70186.1| MADS-box transcription factor [Solanum lycopersicum]
Length=242

 Score =   312 bits (800),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 185/245 (76%), Gaps = 3/245 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MG GKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAE+ALIIFS+RGKLYEFCS+
Sbjct  1     MGTGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEIALIIFSSRGKLYEFCSN  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERY R +Y  LE  Q +SD+QNNY EYL+LK RVE+LQ+SQR+LLGEDLG L 
Sbjct  61    SSMSKTLERYHRYNYGTLEGTQTSSDSQNNYQEYLKLKTRVEMLQQSQRHLLGEDLGQLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL +SL+QIRS KTQ +LDQLAELQQ+EQ L E NK LR KLEE   G+  
Sbjct  121   TKDLEQLERQLASSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSLRIKLEE--LGVTF  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             + SW  G Q +  ++ Q P   EGFFQ +  N +  I Y        N A S H+ +G  
Sbjct  179   QTSWHCGEQSVQYRHEQ-PSHHEGFFQHVNCNNTLPISYGYDNVQPENAAPSTHDATGVV  237

Query  992   PGWML  1006
             PGWML
Sbjct  238   PGWML  242



>ref|XP_011099040.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Sesamum 
indicum]
Length=247

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 188/248 (76%), Gaps = 4/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT--QNNYHEYLRLKARVELLQRSQRNLLGEDLGP  625
             S+M+KTLERYQ+CSY  LE N P  D   Q++Y EYL+LKA+ E LQR QR LLG+DLGP
Sbjct  61    SNMLKTLERYQKCSYGSLEVNHPGKDIEQQSSYREYLKLKAKYESLQRYQRQLLGDDLGP  120

Query  626   LSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGI  805
             L+  +LE +E+QLE SLK IRS +TQ MLDQLA+LQ +E+++ ++NK L RKLEE  A  
Sbjct  121   LNINDLEHIEHQLETSLKHIRSTRTQVMLDQLADLQTKEKLMLDANKALERKLEEIYAAN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNS-VGTDEVNVAASAHNIS  982
              L+ SW  G ++         P S+GFFQPL  N + QIGYN  V + ++  A    N++
Sbjct  181   QLQQSWVGGGEQSSTYTHH-HPHSQGFFQPLDCNSTLQIGYNDPVSSSQMTAATDVQNVN  239

Query  983   GFFPGWML  1006
             G  PGWML
Sbjct  240   GLIPGWML  247



>ref|XP_009378252.1| PREDICTED: developmental protein SEPALLATA 1-like [Pyrus x bretschneideri]
Length=246

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 194/246 (79%), Gaps = 1/246 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              S++KTL+RYQ+CSY  ++  N PA + +++  EY++LK R E LQR+QRNLLGEDLGPL
Sbjct  61    PSILKTLDRYQKCSYGAVDQVNIPAKELESSCREYMKLKGRCESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLEASLKQ+RS KTQ +LDQL++LQ +EQ+L E+N+ L  KL+E  +   
Sbjct  121   NTKELEQLERQLEASLKQVRSTKTQYLLDQLSDLQNKEQLLIEANRDLTMKLDEIGSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LR SWE G+Q +    +    QS+GFFQPL  N + QIGY + G++++     A  ++ F
Sbjct  181   LRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGYPAEGSEQMGATTHAQQVNCF  240

Query  989   FPGWML  1006
              PGWML
Sbjct  241   IPGWML  246



>ref|XP_009788435.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=239

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/245 (65%), Positives = 194/245 (79%), Gaps = 6/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SS+ KTLERY RCSY++LEA Q ++D+QN+Y EY +LKARVE+LQ+SQR++LGEDLG L+
Sbjct  61    SSISKTLERYHRCSYSNLEAGQSSTDSQNSYQEYTKLKARVEVLQQSQRHILGEDLGQLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLE QL++SL+QIRSR+TQ++LDQL++LQQ+EQ L E N+ L+ KL+EN   +  
Sbjct  121   IKELEQLERQLDSSLRQIRSRRTQNILDQLSDLQQKEQSLLEINRSLKIKLDENY--VAY  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             +  W+ G Q I  Q R  P Q + FFQPL  N +    YN    D  N+ +S  N +G  
Sbjct  179   QTHWDTGEQNI--QFRHRPAQPQEFFQPLQCNSTMPNRYNQAPWD--NIESSTQNATGVL  234

Query  992   PGWML  1006
             PGWML
Sbjct  235   PGWML  239



>ref|XP_010694125.1| PREDICTED: developmental protein SEPALLATA 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=251

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/247 (64%), Positives = 190/247 (77%), Gaps = 5/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              SM+KTLERYQ+CSY  +E N+P+ +  Q++Y EYL+LKAR E LQR+QRNLLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGGVEVNKPSKELEQSSYREYLKLKARHESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             + KEL+QLE QLE+SLKQIRS KTQSMLDQL +LQ +E  L E+NK L+ +L+  +    
Sbjct  121   NVKELDQLERQLESSLKQIRSTKTQSMLDQLTDLQNKEHALMEANKTLKTELDRIMVKDT  180

Query  809   --LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNIS  982
                R +W+   Q +H   +    QS+G FQPL  N + QIGYN   ++++ VA S   + 
Sbjct  181   QQFRQTWDGSEQNVHYGQQH--AQSQGLFQPLDCNPTLQIGYNPESSEQMTVATSHTQVP  238

Query  983   GFFPGWM  1003
             GF PGWM
Sbjct  239   GFLPGWM  245



>gb|ADL36751.1| MADS domain class transcription factor [Malus domestica]
Length=246

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 194/246 (79%), Gaps = 1/246 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              S+++T++RYQ+CSY  ++  N PA + +++Y EY++LK R E LQR+QRNLLGE+LGPL
Sbjct  61    PSILQTVDRYQKCSYGAVDQVNIPAKELESSYREYMKLKGRCESLQRTQRNLLGEELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLEASLKQ+RS KTQ MLDQL+ LQ +EQ+L E+N+ L  KL+E  +   
Sbjct  121   NTKELEQLERQLEASLKQVRSTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LR SWE G+Q +    +    QS+GFFQPL  N + QIGY + G++++     A  ++ F
Sbjct  181   LRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGYPAEGSEQMGATTHAQQVNCF  240

Query  989   FPGWML  1006
              PGWML
Sbjct  241   IPGWML  246



>ref|XP_002311352.1| MADS-box protein 4 [Populus trichocarpa]
 gb|EEE88719.1| MADS-box protein 4 [Populus trichocarpa]
Length=242

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/246 (65%), Positives = 191/246 (78%), Gaps = 5/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSN GKL+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNSGKLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M  T+E+YQR SY  LE  Q   +T QNNY EYL+LK RV++LQRSQRNLLGEDLG L
Sbjct  61    SNMATTIEKYQRFSYGALEGGQSEKETQQNNYQEYLKLKTRVDVLQRSQRNLLGEDLGNL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
              T EL+QLENQL++SLKQIRSRK Q +LD+L+ELQ++E++L E+N  L+RKLEE  A I 
Sbjct  121   GTMELDQLENQLDSSLKQIRSRKGQFVLDELSELQRKEELLLETNNALKRKLEETSAAI-  179

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
              RLSW+ G Q +    +  P Q     +PL  N + Q GYN   TD+  V +S+ N++GF
Sbjct  180   -RLSWKVGEQRVPYSFQ--PVQPYDPIEPLQYNSTFQFGYNPAETDQATVTSSSQNVNGF  236

Query  989   FPGWML  1006
              PGWML
Sbjct  237   IPGWML  242



>gb|AEF59025.1| MADS-1 [Fragaria x ananassa]
Length=249

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 193/249 (78%), Gaps = 4/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSM+KTLERYQ+CSY  +E  +PA +  +++Y EYL+LK R E LQ++QRNLLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAMEVQKPAKELEESSYREYLKLKTRCESLQQTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLE+SLK +RS KTQ M+D L++LQ +E ML E+N+ L+ KL+E  +   
Sbjct  121   NTKELEQLERQLESSLKHVRSTKTQHMIDLLSDLQSKEHMLIEANRDLKTKLDEIDSRTQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGF-FQPLGLNISGQIGYNSVGTDEVNVAASAHN--I  979
             LR +WE G+            Q++G  FQPL  N + QIGYN+V + E+  A  AH   +
Sbjct  181   LRQTWEHGHDHQTMLYGTQHAQTQGLMFQPLDCNPTLQIGYNAVVSQEMPTATPAHAQPV  240

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  241   NGFIPGWML  249



>ref|XP_004304204.1| PREDICTED: developmental protein SEPALLATA 2-like [Fragaria vesca 
subsp. vesca]
 gb|AAO49380.1| MADS-RIN-like protein [Fragaria x ananassa]
Length=249

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 193/249 (78%), Gaps = 4/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSM+KTLERYQ+CSY  +E  +PA +  +++Y EYL+LK R E LQ++QRNLLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAMEVQKPAKELEESSYREYLKLKTRCESLQQTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLE+SLK +RS KTQ M+D L++LQ +E ML E+N+ L+ KL+E  +   
Sbjct  121   NTKELEQLERQLESSLKHVRSTKTQHMIDLLSDLQSKEHMLIEANRDLKTKLDEIDSRTQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGF-FQPLGLNISGQIGYNSVGTDEVNVAASAHN--I  979
             LR +WE G+            Q++G  FQPL  N + QIGYN+V + E+  A  AH   +
Sbjct  181   LRQTWEHGHDHQTMLYGTQHAQTQGLMFQPLDCNPTLQIGYNAVVSQEMPAATPAHAQPV  240

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  241   NGFIPGWML  249



>gb|ABV23569.2| MADS-box protein [Populus deltoides]
Length=241

 Score =   310 bits (794),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 188/245 (77%), Gaps = 4/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELK+IENKINRQVTFAKRRNGLL KAYELS LCDAEVALIIFSN GKL+EFCSS
Sbjct  1     MGRGRVELKKIENKINRQVTFAKRRNGLLNKAYELSFLCDAEVALIIFSNSGKLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M  T+E+YQR SY  LE  Q   +TQNNY EYL+LK RV++LQRSQRNLLGEDLG L 
Sbjct  61    SNMATTIEKYQRFSYGALEGGQSEKETQNNYQEYLKLKTRVDVLQRSQRNLLGEDLGNLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             T EL+QLENQL++SLKQIRSRK Q +LD+L+ELQ++E++L E+N  L+RKLEE  A I  
Sbjct  121   TMELDQLENQLDSSLKQIRSRKGQFVLDELSELQRKEELLLETNNALKRKLEETSAAI--  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             RLSW+ G Q +    +  P Q     +PL  N + Q GYN   TD+  V +S  N++GF 
Sbjct  179   RLSWKVGEQRVPYSFQ--PVQPYDPVEPLQYNSTFQFGYNPAETDQATVTSSTQNVNGFI  236

Query  992   PGWML  1006
             PGWML
Sbjct  237   PGWML  241



>gb|AHY82574.1| MADS-box protein 7 [Lilium formosanum]
Length=246

 Score =   310 bits (794),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 191/246 (78%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF+KRRNGLLKKA+ELS+LCDAEVALIIFSN G+L EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSNHGRLSEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLERY +CSY   E   P+ +T+++YHEYL+LK RVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMMKTLERYHKCSYNATEDIIPSKETESSYHEYLKLKTRVEYLQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QLE SLK IRS KTQ MLD+L++L+ +E ML ++N+LLRRKL+E      L
Sbjct  121   TKELEQLEHQLEISLKHIRSTKTQLMLDELSDLKGKEHMLQDANQLLRRKLQEAGVDNAL  180

Query  812   RLSWEDGNQE--IHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
             R SWE+ +++      +   P + E FFQPL  + S QIG++ VG D++N   S  N   
Sbjct  181   RQSWENCSRDSGPSMPSDCQPARPERFFQPLACDSSLQIGFHPVGIDQLNNGVSPQNGDD  240

Query  986   FFPGWM  1003
             + P WM
Sbjct  241   YAPAWM  246



>gb|AAQ03227.1|AF411846_1 MADS box transcription factor [Elaeis guineensis]
Length=250

 Score =   310 bits (794),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 194/249 (78%), Gaps = 5/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKA+ELS+LCDAEVALIIFS+RG+L+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAFELSVLCDAEVALIIFSSRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQRC+Y+  EA  P+S+ QN Y EY+RLKARVE LQ SQRNLLGEDL PLS
Sbjct  61    SSMLKTLERYQRCNYSASEAAAPSSEIQNTYQEYVRLKARVEFLQHSQRNLLGEDLDPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             T EL+QLENQLE SLKQIRS KTQSMLDQL +L++REQ + E+N+ L RKL E  +  PL
Sbjct  121   TNELDQLENQLEKSLKQIRSAKTQSMLDQLCDLKRREQEMQETNRSLNRKLREAASQNPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQ-----SEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHN  976
             +L+W +G+ +    +   P       S GFFQPL  +   QIGY+ V  D+ N  A +H+
Sbjct  181   QLTWANGSGDHAAGSSNGPCNREAALSRGFFQPLACHPPEQIGYHPVNIDQPNGGAMSHD  240

Query  977   ISGFFPGWM  1003
              +G+ P WM
Sbjct  241   SNGYLPAWM  249



>gb|AFK42306.1| unknown [Medicago truncatula]
Length=250

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 194/252 (77%), Gaps = 9/252 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINR+VTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYE CSS
Sbjct  1     MGRGRVELKRIENKINRRVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYELCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM+KTL+RYQ+CSY  +E N+PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL 
Sbjct  61    PSMLKTLDRYQKCSYGAVEVNKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NV-AGI  805
             TK+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE N+ +  
Sbjct  121   TKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSMKLEEININSRN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYN-----SVGTDEVNVAASA  970
               R +WE G+Q +   N+     S+ FFQPL  N + QIG +      V +D++     A
Sbjct  181   QYRQTWEAGDQSMAYGNQN--AHSQSFFQPLECNPTLQIGTDYRYSPPVASDQLTATTQA  238

Query  971   HNISGFFPGWML  1006
               ++GF PGWML
Sbjct  239   QQVNGFIPGWML  250



>ref|XP_008811809.1| PREDICTED: MADS-box protein CMB1-like isoform X2 [Phoenix dactylifera]
Length=250

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 191/251 (76%), Gaps = 8/251 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS+RG L+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAELALIIFSSRGCLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KT++RYQRC+YA  EA    S+TQN Y EY++LKARV+ LQ S RNLLGEDL PLS
Sbjct  61    SSMLKTIQRYQRCNYAASEAVASPSETQNTYQEYVKLKARVDFLQSSHRNLLGEDLDPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             T ELEQLENQLE SLKQIRS KTQ MLDQL +++++EQ+L E+N+ L+R+L+E  +  P 
Sbjct  121   TNELEQLENQLEKSLKQIRSAKTQFMLDQLCDVKKKEQVLQEANRELKRRLQEATSHNPF  180

Query  812   RLSW-------EDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASA  970
             + SW         G  E    NR+    SEGFFQPLG +   QIGY+ +  D+ N  A  
Sbjct  181   QWSWINGGGNGAGGASEDDHCNRE-AALSEGFFQPLGCHPPLQIGYHPMHIDQSNRGAMT  239

Query  971   HNISGFFPGWM  1003
             HN +G+ P WM
Sbjct  240   HNSNGYLPAWM  250



>ref|XP_008365428.1| PREDICTED: developmental protein SEPALLATA 1-like [Malus domestica]
Length=246

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 193/246 (78%), Gaps = 1/246 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              S+++T++RYQ+CSY  ++  N PA + +++Y EY++LK R E LQR+QRNLLGE+LGPL
Sbjct  61    PSILQTVDRYQKCSYGAVDQVNIPAKELESSYREYMKLKGRCESLQRTQRNLLGEELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLEASLKQ+R  KTQ MLDQL+ LQ +EQ+L E+N+ L  KL+E  +   
Sbjct  121   NTKELEQLERQLEASLKQVRFTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LR SWE G+Q +    +    QS+GFFQPL  N + QIGY + G++++     A  ++ F
Sbjct  181   LRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGYPAEGSEQMGATTHAQQVNCF  240

Query  989   FPGWML  1006
              PGWML
Sbjct  241   IPGWML  246



>gb|AFU81295.1| SEPALLATA1 [Medicago polyceratia]
Length=249

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/250 (63%), Positives = 195/250 (78%), Gaps = 6/250 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPLS
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKQRFENLQRTQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +K+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE  +    
Sbjct  121   SKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLEEINSRNHY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASA-HN  976
             R SWE G Q + Q + Q    S+ FFQ L  N + QIG    YN+V +D++   + A   
Sbjct  181   RQSWEAGEQSM-QYSAQQNAHSQSFFQQLECNPTLQIGSDYRYNNVASDQIASTSQAQQQ  239

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  240   VNGFVPGWML  249



>ref|XP_011018962.1| PREDICTED: MADS-box protein CMB1-like [Populus euphratica]
Length=241

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 189/245 (77%), Gaps = 4/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSN GKL+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNSGKLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M  T+E+YQR SY  LE  Q   +TQN Y EYL+LK RV++LQRSQRN+LGEDLG L 
Sbjct  61    SNMAATIEKYQRFSYGALEGGQSEKETQNKYQEYLQLKTRVDVLQRSQRNVLGEDLGNLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             T EL+QLE+QL++SLKQIR+RK Q +LD+L+ELQ++E++L E+N  L+RKLEE  A I  
Sbjct  121   TMELDQLEDQLDSSLKQIRNRKAQFILDELSELQRKEELLLETNNALKRKLEETTAAI--  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             RLSW+ G Q +    +  P Q     +PL  N + Q GYN   TD+  V +S  N++GF 
Sbjct  179   RLSWKVGEQHVPYSFQ--PVQPYDSVEPLQYNSTFQFGYNPAETDQGTVTSSTQNVNGFI  236

Query  992   PGWML  1006
             PGWML
Sbjct  237   PGWML  241



>gb|ADL36750.1| MADS domain class transcription factor [Malus domestica]
Length=246

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 193/246 (78%), Gaps = 1/246 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQ TFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQDTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              S+++T++RYQ+CSY  ++  N PA + +++Y EY++LK R E LQR+QRNLLGE+LGPL
Sbjct  61    PSILQTVDRYQKCSYGAVDQVNIPAKELESSYREYMKLKGRCESLQRTQRNLLGEELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLEASLKQ+RS KTQ MLDQL+ LQ +EQ+L E+N+ L  KL+E  +   
Sbjct  121   NTKELEQLERQLEASLKQVRSTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LR SWE G+Q +    +    QS+GFFQPL  N + QIGY + G++++     A  ++ F
Sbjct  181   LRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGYPAEGSEQMGATTHAQQVNCF  240

Query  989   FPGWML  1006
              PGWML
Sbjct  241   IPGWML  246



>ref|XP_010694117.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=252

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 189/248 (76%), Gaps = 6/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              SM+KTLERYQ+CSY  +E N+P+ +  Q++Y EYL+LKAR E LQR+QRNLLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGGVEVNKPSKELEQSSYREYLKLKARHESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVA---  799
             + KEL+QLE QLE+SLKQIRS KTQSMLDQL +LQ +E  L E+NK L+ +  + +    
Sbjct  121   NVKELDQLERQLESSLKQIRSTKTQSMLDQLTDLQNKEHALMEANKTLKTEQLDRIMVKD  180

Query  800   GIPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNI  979
                 R +W+   Q +H   +    QS+G FQPL  N + QIGYN   ++++ VA S   +
Sbjct  181   TQQFRQTWDGSEQNVHYGQQH--AQSQGLFQPLDCNPTLQIGYNPESSEQMTVATSHTQV  238

Query  980   SGFFPGWM  1003
              GF PGWM
Sbjct  239   PGFLPGWM  246



>ref|XP_008801852.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Phoenix dactylifera]
Length=242

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 195/246 (79%), Gaps = 7/246 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + +TQ++  EYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLKTLERYQKCNYGAPETNIVSRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QL+ASLKQIRS +TQ MLDQLA+LQ+REQML E+NK L+R+LEE+      
Sbjct  121   SKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKRRLEESNQATQQ  180

Query  812   RLSWEDGNQEIHQQNRQLP-PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS-AHNISG  985
             ++ W D N       RQ P PQ +GF+QP+    +  IGY+    +++ +AA    ++S 
Sbjct  181   QV-W-DPNAHAVGYGRQPPQPQGDGFYQPIECEPTLHIGYHP---EQITIAAGPGPSVSN  235

Query  986   FFPGWM  1003
             + PGW+
Sbjct  236   YMPGWL  241



>gb|AHW52539.1| SEPALLATA-like MADS-box protein 4 [Phalaenopsis equestris]
Length=246

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 201/248 (81%), Gaps = 6/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELK IENKINRQVTFAKRRNGLLKKAYELS+LCDAEV LI+FSNRG+L+EFCSS
Sbjct  1     MGRGRVELKMIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVGLIVFSNRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKT+ERYQ+CSY   E   P+ +TQNNY EYL+LKA+VE LQRSQRNLLGEDL  L+
Sbjct  61    SSMMKTIERYQKCSYNTTETRIPSKETQNNYQEYLKLKAKVEYLQRSQRNLLGEDLALLT  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE++LE SLK+IRS K+Q MLDQL +L+++EQML E+NK LR KL+E+   +PL
Sbjct  121   TKELEQLEHELEMSLKKIRSTKSQLMLDQLCDLKRKEQMLQEANKALRMKLQEDEPEMPL  180

Query  812   RLSWEDGNQEIHQQN---RQLPPQSEGFFQPLGLNISGQIGYNSVGTDE-VNVAASAHNI  979
             +LSW  G    + ++   RQ  PQS+ FFQPL  + + QIGYN +  +E +N  +S+HNI
Sbjct  181   QLSWSGGRTAGNARSPCGRQ--PQSDVFFQPLPCDPTLQIGYNPICIEEQLNNGSSSHNI  238

Query  980   SGFFPGWM  1003
             +GF PGWM
Sbjct  239   NGFLPGWM  246



>ref|XP_008357795.1| PREDICTED: LOW QUALITY PROTEIN: developmental protein SEPALLATA 
1-like [Malus domestica]
Length=246

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 193/246 (78%), Gaps = 1/246 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+F +RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFXHRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLE-ANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              S+++T++RYQ+CSY  ++  N PA + +++Y EY++LK R E LQR+QRNLLGE+LGPL
Sbjct  61    PSILQTVDRYQKCSYGAVDQVNIPAKELESSYREYMKLKGRCESLQRTQRNLLGEELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKELEQLE QLEASLKQ+RS KTQ MLDQL+ LQ +EQ+L E+N+ L  KL+E  +   
Sbjct  121   NTKELEQLERQLEASLKQVRSTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             LR SWE G+Q +    +    QS+GFFQPL  N + QIGY + G++++     A  ++ F
Sbjct  181   LRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGYPAEGSEQMGATTHAQQVNCF  240

Query  989   FPGWML  1006
              PGWML
Sbjct  241   IPGWML  246



>ref|XP_003544012.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=248

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 193/250 (77%), Gaps = 7/250 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             +SM+KTLERYQ+CSY  +E ++P  + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE  +    
Sbjct  121   TKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAAS-AHN  976
             R +WE G Q +    +     S+GFFQPL  N + QIG    YN   +++   A + A  
Sbjct  181   RQTWEAGEQSMSYGTQN--AHSQGFFQPLECNPTLQIGSDYRYNPEASEQQLAATTQAQQ  238

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  239   VNGFIPGWML  248



>gb|AAX69068.1| MADS box protein M6 [Pisum sativum]
Length=249

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 194/250 (78%), Gaps = 6/250 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPLS
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKQRFENLQRTQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +K+LEQLE QL++SLK +RS KTQ MLDQLA+LQ +E ML E+N+ L  KL+E  +    
Sbjct  121   SKDLEQLERQLDSSLKHVRSTKTQFMLDQLADLQNKEHMLVEANRSLSMKLDEINSRNQY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASA-HN  976
             R SWE G+Q + Q   Q    S+ FFQ L  N + QIG    YN+V +D++   + A   
Sbjct  181   RQSWEAGDQSM-QYGDQQNAHSQSFFQQLDCNPTLQIGSDYRYNNVASDQIASTSQAQQQ  239

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  240   VNGFVPGWML  249



>gb|AES77737.2| MADS-box transcription factor [Medicago truncatula]
Length=249

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 195/250 (78%), Gaps = 6/250 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPLS
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKQRFENLQRAQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +K+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE  +    
Sbjct  121   SKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLEEINSRNHY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASA-HN  976
             R SWE  +Q +  + +Q    S+ FFQ L  N + QIG    YN+V +D++   + A   
Sbjct  181   RQSWEASDQSMQYEAQQ-NAHSQSFFQQLECNPTLQIGSDYRYNNVASDQIASTSQAQQQ  239

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  240   VNGFVPGWML  249



>ref|NP_001238296.1| MADS-box protein [Glycine max]
 gb|AAZ86071.1| MADS-box protein [Glycine max]
Length=248

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 193/250 (77%), Gaps = 7/250 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             +SM+KTLERYQ+CSY  +E ++P  + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE  +    
Sbjct  121   TKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAAS-AHN  976
             R +WE G Q +    +     S+GFFQPL  N + QIG    YN   +++   A + A  
Sbjct  181   RQTWEAGEQSMPYGTQN--AHSQGFFQPLECNPTLQIGSDYRYNPEASEQQLAATTQAQQ  238

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  239   VNGFIPGWML  248



>gb|KHG04329.1| MADS-box CMB1 [Gossypium arboreum]
Length=244

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/246 (66%), Positives = 191/246 (78%), Gaps = 3/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLE+Y   +Y  LE  Q   D Q+NY EYL+LK++VE+LQ+SQR+ LGE++  L 
Sbjct  61    SSMAKTLEKYNSYTYGALEPAQTEIDAQSNYQEYLKLKSKVEVLQQSQRHFLGEEIADLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QL+ SLK+IRS K Q M+DQL+ELQ +E++L E+N+ LR KL+E  +G  +
Sbjct  121   TKELEQLEHQLDFSLKKIRSTKMQLMIDQLSELQTKEEVLLETNRNLRMKLDE--SGPSM  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYN-SVGTDEVNVAASAHNISGF  988
             R SWE G Q I   +   PPQSEGFF+PL  N S QIGYN S  T E    ASA   SGF
Sbjct  179   RSSWETGEQSIPYNHPPPPPQSEGFFEPLHCNNSLQIGYNPSSVTVEDTATASALAPSGF  238

Query  989   FPGWML  1006
              PGWML
Sbjct  239   IPGWML  244



>ref|XP_009415892.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 192/246 (78%), Gaps = 6/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + + Q +  EYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLKTLERYQKCNYGAPETNIISREIQTSQQEYLKLKARVEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLE QL+ASL+QIRS +TQ MLDQLA+LQ+REQML E+NK L+ +++E       
Sbjct  121   IKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRMDEGNQANQQ  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASA--HNISG  985
             +L W+   Q +     Q  PQ +GFFQP+    + QIGY+    D++ +AA+A   ++S 
Sbjct  181   QL-WDPNAQAVAYCRHQPQPQGDGFFQPIECEPTLQIGYHP---DQMAIAAAAPGPSVSS  236

Query  986   FFPGWM  1003
             + PGW+
Sbjct  237   YVPGWL  242



>ref|XP_004237061.1| PREDICTED: MADS-box protein CMB1 isoform X1 [Solanum lycopersicum]
Length=238

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 189/247 (77%), Gaps = 11/247 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILC+AEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCEAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM  TLERY RCSY  LE  Q + D+QNNY EY++LKARVE+LQ+SQR++LGEDLG L+
Sbjct  61    SSMSDTLERYHRCSYGDLETGQSSKDSQNNYQEYMKLKARVEVLQQSQRHILGEDLGQLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL++SL+ IRSR+TQ+MLDQL++LQQ+EQ L E N+ L+ KLEEN      
Sbjct  121   TKDLEQLERQLDSSLRLIRSRRTQNMLDQLSDLQQKEQSLLEINRSLKTKLEENSVA---  177

Query  812   RLSWE-DGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG-YNSVGTDEVNVAASAHNISG  985
                W   G Q +  Q RQ P QSEGFFQPL  N +     YN    D  ++  S  N +G
Sbjct  178   --HWHITGEQNV--QFRQQPAQSEGFFQPLQCNTNIVPNRYNVAPLD--SIEPSTQNATG  231

Query  986   FFPGWML  1006
               PGWML
Sbjct  232   ILPGWML  238



>gb|AHM92082.1| MADS-box protein 6 [Erycina pusilla]
Length=240

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 189/248 (76%), Gaps = 12/248 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS RG+L+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLE+YQ+CSY   E+  P+ DTQ+ Y EYL+LK RVE LQRS RNLLGEDL  LS
Sbjct  61    SSMTKTLEKYQKCSYNASESMVPSKDTQSTYQEYLKLKGRVEFLQRSHRNLLGEDLVELS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +K+L+QLE QLE SLKQIRS KTQ MLDQL +L+++EQML E+N+ L++KLEE     PL
Sbjct  121   SKDLDQLELQLEMSLKQIRSTKTQLMLDQLCDLKRKEQMLHETNRALKKKLEEVGPETPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPL-GLNISGQIGYNSVGTD--EVNVAAS-AHNI  979
              LSW           RQ P   E FF PL  ++ S QIGY  + TD  ++N  +S AHNI
Sbjct  181   ELSWP--------AERQQPQSDELFFHPLPCVHPSLQIGYGPICTDQQQLNTGSSTAHNI  232

Query  980   SGFFPGWM  1003
             +GF  GWM
Sbjct  233   NGFISGWM  240



>ref|XP_010917559.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03225.1|AF411844_1 MADS box transcription factor [Elaeis guineensis]
 gb|AAY96424.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 196/247 (79%), Gaps = 9/247 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLERYQ+C+Y   E N  + +TQ++  EYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMMKTLERYQKCNYGAPETNIISRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGIP  808
             +KELEQLE QL+ASLKQIRS +TQ MLDQLA+LQ+REQML E+NK LRR+LEE N AG  
Sbjct  121   SKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLRRRLEESNQAG--  178

Query  809   LRLSWEDGNQEIHQQNRQLP-PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS-AHNIS  982
              +  W+     +    RQ P PQS+GF+Q +    + QI Y     +++ +AA+   ++S
Sbjct  179   QQQVWDPTAHAVG-YGRQPPQPQSDGFYQQIDGEPTLQIRYPP---EQITIAAAPGSSVS  234

Query  983   GFFPGWM  1003
              + PGW+
Sbjct  235   TYMPGWL  241



>ref|XP_008786031.1| PREDICTED: truncated transcription factor CAULIFLOWER A [Phoenix 
dactylifera]
Length=246

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 186/245 (76%), Gaps = 1/245 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTF+KRRNGLLKKA+ELS+LCDAEVALIIFSNRG+L+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSNRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQR +Y   E+  P+S+TQN Y EY+RLK RV  LQ SQRNLLGEDL PLS
Sbjct  61    SSMLKTLERYQRYNYTASESVAPSSETQNTYQEYVRLKTRVAFLQSSQRNLLGEDLDPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             T ELEQLENQLE SLKQIRS KTQ MLDQL+ L+ REQ + E+N+ L+RKL+E  +  PL
Sbjct  121   TNELEQLENQLEKSLKQIRSAKTQLMLDQLSHLKTREQEMQEANRSLKRKLQEAASQNPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF-  988
             ++ W +G+ +             GFFQPLG +   QIGY+ V  D+ N  A + N +G  
Sbjct  181   QMPWPNGSGDHAGGASNAGGAFRGFFQPLGCDPPLQIGYHPVHIDQSNGGAMSRNSNGCQ  240

Query  989   FPGWM  1003
              P WM
Sbjct  241   LPAWM  245



>gb|AGT21645.1| PFRIN [Physalis pubescens]
Length=240

 Score =   305 bits (781),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 188/248 (76%), Gaps = 11/248 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRI+NKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS RGKLYEFCSS
Sbjct  1     MGRGKVELKRIDNKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSTRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERY R SY  LE  Q   D+QNNY EYL+LK RV++LQ SQR++LGEDLG LS
Sbjct  61    SSMSKTLERYHRYSYGGLEGTQSLVDSQNNYQEYLKLKTRVQVLQESQRHMLGEDLGELS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL++SL+QIRS KT+ MLDQLAELQQ+EQ L E NK LR K+EE   G+  
Sbjct  121   TKDLEQLERQLDSSLRQIRSTKTKQMLDQLAELQQKEQSLTEMNKSLRMKMEE--LGVAF  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQI---GYNSVGTDEVNVAASAHNIS  982
             + SW  G Q +  Q R+ P  +EGFFQ    N +  I   GY +V  +  + A S H+ +
Sbjct  179   QTSWHGGEQSV--QYREQP--AEGFFQHADCNNTLPIISYGYGTVPPE--HAAPSTHDAT  232

Query  983   GFFPGWML  1006
             G  PGWML
Sbjct  233   GVVPGWML  240



>emb|CDP00462.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   305 bits (781),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 186/245 (76%), Gaps = 6/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERY RCSYA    NQ + D Q +Y EYL+LKA+VE+LQ+SQR+LLGEDL  L 
Sbjct  61    SSMSKTLERYHRCSYADAGMNQSSKDPQGDYQEYLKLKAKVEVLQQSQRHLLGEDLAQLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              K+L+QLE QL+ASL+QIRS KTQ MLDQL++LQQ+E+ L E NK LR KLEE  A    
Sbjct  121   AKQLDQLERQLDASLRQIRSTKTQHMLDQLSDLQQKEKSLMEVNKALRNKLEETTAA--F  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             +LSW D ++E + ++R      EGFFQPL  N S  + YN V  D    A    N SG  
Sbjct  179   QLSW-DVSEEHNLRHRSQTIHPEGFFQPLECN-SSIMNYNMVVADA--EAEPTQNPSGIL  234

Query  992   PGWML  1006
             PGWML
Sbjct  235   PGWML  239



>gb|AGV54737.1| developmental protein SEPALLATA 2-like protein [Phaseolus vulgaris]
Length=247

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 189/249 (76%), Gaps = 6/249 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAK  NGL KKAYELS+L DAEVALIIFS RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKGGNGLFKKAYELSVLWDAEVALIIFSTRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+CSY  +E ++PA + +++Y EYL+LK R E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCSYGAVEVSKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +EQML E+N+ L  KL+E  +    
Sbjct  121   TKELEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRALTMKLDEINSRNQY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASAHNI  979
             R +WE G+Q +          S+GFFQPL  N + QIG    YN   +D++     A  +
Sbjct  181   RQTWEAGDQSMPYGTPN--AHSQGFFQPLECNPTLQIGSDYRYNPEASDQLTGTTQAQQV  238

Query  980   SGFFPGWML  1006
             +GF PGWML
Sbjct  239   NGFIPGWML  247



>gb|AFU61112.1| MADS-box transcription factor MADS-RIN [Capsicum annuum]
Length=241

 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 192/249 (77%), Gaps = 12/249 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRI+NKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS+RGKLYEFCSS
Sbjct  1     MGRGKVELKRIDNKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERY R +Y  LE  QP++D+QNNY EYL+LK RVELLQ+SQR++LGEDLG L+
Sbjct  61    SSMSKTLERYHRYNYGALEGTQPSADSQNNYQEYLKLKTRVELLQQSQRHMLGEDLGELN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              K+LEQLE+QL++SL+QIRS KTQ MLDQLAEL Q+EQ L E N+ L+ KLEE   G+  
Sbjct  121   IKDLEQLEHQLDSSLRQIRSTKTQHMLDQLAELHQKEQSLTEMNESLKTKLEE--LGVAF  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLN---ISG-QIGYNSVGTDEVNVAASAHNI  979
             + SW  G Q +  Q RQ  P  EGFFQ +  N   +S  + GY++V     + A S  + 
Sbjct  179   QTSWHSGEQSV--QYRQQQP--EGFFQHVDYNNNTVSDIRYGYDAVLPK--HAAPSTQDA  232

Query  980   SGFFPGWML  1006
             SG  PGWML
Sbjct  233   SGVVPGWML  241



>gb|AIU94433.1| MADS-box transcription factor 2 isoform 1, partial [Musa balbisiana]
Length=243

 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 191/246 (78%), Gaps = 6/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + + Q +  EYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLKTLERYQKCNYGAPETNIISREIQTSQQEYLKLKARVEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLE QL+ASL+QIRS +TQ MLDQLA+LQ+REQML E+NK L+ +L+E       
Sbjct  121   IKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRLDEGNQANQQ  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASA--HNISG  985
             +L W+     +     Q  PQ +GFFQP+    + QIGY+    D++ +AA+A   ++S 
Sbjct  181   QL-WDPNAHAVAYCRHQPQPQGDGFFQPIECEPTLQIGYHP---DQMAIAAAAPGPSVSS  236

Query  986   FFPGWM  1003
             + PGW+
Sbjct  237   YVPGWL  242



>ref|XP_010917558.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03224.1|AF411843_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   305 bits (780),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 196/247 (79%), Gaps = 9/247 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLERYQ+C+Y   E N  + +TQ++  EYL+LKAR E LQRSQRNLLGEDLGPLS
Sbjct  61    SSMMKTLERYQKCNYGAPETNIISRETQSSQQEYLKLKARAEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGIP  808
             +KELEQLE QL+ASLKQIRS +TQ MLDQLA+LQ++EQML E+NK LRR+LEE N AG  
Sbjct  121   SKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSLRRRLEESNQAG--  178

Query  809   LRLSWEDGNQEIHQQNRQLP-PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS-AHNIS  982
              +  W+     +    RQ P PQS+GF+Q +    + QIGY     +++ +AA+   +++
Sbjct  179   QQQVWDPTAHAVG-YGRQPPQPQSDGFYQQIDSEPTLQIGYPP---EQITIAAAPGPSVN  234

Query  983   GFFPGWM  1003
              + PGW+
Sbjct  235   TYMPGWL  241



>gb|AEX58640.1| AGL2-2 [Epimedium sagittatum]
Length=244

 Score =   304 bits (779),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 196/246 (80%), Gaps = 3/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLL+KAYELS+LCDAEVALIIFS RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLEKAYELSVLCDAEVALIIFSARGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQ-NNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSM KTLERYQRC+Y   +A+  A++ + ++Y EYLRLKARV+ LQ+SQRNLLGE+LG L
Sbjct  61    SSMYKTLERYQRCTYVASQASSSANEPEPSSYQEYLRLKARVDFLQQSQRNLLGEELGSL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TKEL+QLE+QLE SL Q+RS KTQ MLDQL++LQ++E+ML E+N  L+++L+E+ A  P
Sbjct  121   NTKELDQLEHQLEISLTQVRSTKTQGMLDQLSDLQKKEEMLHEANNSLKKELDESRAENP  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
              R  WE G Q+ H  N Q   Q+E FF PL  N + ++G N V  +++ VAA   N +GF
Sbjct  181   HRPFWETG-QQSHPFNYQ-QTQTEEFFYPLQCNSNLRMGLNPVVPEQIQVAAPVQNANGF  238

Query  989   FPGWML  1006
              PGWML
Sbjct  239   IPGWML  244



>gb|AEL33631.1| SEPALLATA1 [Gossypium hirsutum]
Length=245

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 189/251 (75%), Gaps = 12/251 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKARYEELQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE+QLE+SLK +RS KTQ MLDQL ELQ +EQML E+N+ L  KLEE  A    
Sbjct  121   SKELEQLEHQLESSLKHVRSTKTQYMLDQLTELQNKEQMLMETNRALSIKLEEISARNQF  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLN------ISGQIGYNSVGTDEVNVAASAH  973
             R SWE G Q +   N+Q   QS G FQPL  N      +     +   G  ++ +  S  
Sbjct  181   RASWEGGEQSVAFTNQQ--AQSMGLFQPLECNPTFADRVLQSCCFRPDGLQQLMLRKSM-  237

Query  974   NISGFFPGWML  1006
                GF PGWML
Sbjct  238   ---GFIPGWML  245



>gb|ACJ64678.1| MADS-box protein MADS2 [Musa acuminata AAA Group]
 gb|AIU94429.1| MADS-box transcription factor 2 isoform 1 [Musa acuminata]
Length=243

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 191/246 (78%), Gaps = 6/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + + Q +  EYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLKTLERYQKCNYGAPETNIISREIQTSQQEYLKLKARVEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLE QL+ASL+QIRS +TQ MLDQLA+LQ+REQML E+NK L+ +++E       
Sbjct  121   IKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRMDEGNQANQQ  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASA--HNISG  985
             +L W+     +     Q  PQ +GFFQP+    + QIGY+    D++ +AA+A   ++S 
Sbjct  181   QL-WDPNAHAVAYCRHQPQPQGDGFFQPIECEPTLQIGYHP---DQMAIAAAAPGPSVSS  236

Query  986   FFPGWM  1003
             + PGW+
Sbjct  237   YVPGWL  242



>ref|XP_006593703.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
 gb|KHN08352.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=249

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 193/251 (77%), Gaps = 8/251 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             +SM+KTLERYQ+CSY  +E ++P  +  Q++Y EYL+LKAR E LQR+QRNLLGEDLGPL
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TK+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE  +   
Sbjct  121   NTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAAS-AH  973
              R +WE G Q +    +     S+GFFQPL  N + QIG    YN   +++   A + A 
Sbjct  181   YRQTWEAGEQSMSYGTQN--AHSQGFFQPLECNPTLQIGSDYRYNPEASEQQLAATTQAQ  238

Query  974   NISGFFPGWML  1006
              ++GF PGWML
Sbjct  239   QVNGFIPGWML  249



>gb|KDP41334.1| hypothetical protein JCGZ_15741 [Jatropha curcas]
Length=227

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 183/245 (75%), Gaps = 18/245 (7%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KT+E+YQR SY  LE NQ A DTQ  Y EYL+LKA VE+LQ SQRNLLGE+LG LS
Sbjct  61    SSMAKTIEKYQRYSYGALETNQSAQDTQRCYQEYLKLKANVEVLQSSQRNLLGENLGDLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL++SLKQIRSRK              E++L E+N  LR+KLEE  A   L
Sbjct  121   TKDLEQLEYQLDSSLKQIRSRK--------------EELLLETNTALRKKLEETNAA--L  164

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
               SWE  +Q +    +  PP SEGF  P   + + +IGYN+V TD+V VA +  N+ GF 
Sbjct  165   ESSWEGTDQSVPYNCQ--PPHSEGFVDPSLCDSNLRIGYNAVETDKVTVATTGQNVDGFI  222

Query  992   PGWML  1006
             PGWML
Sbjct  223   PGWML  227



>ref|XP_010099309.1| Developmental protein SEPALLATA 2 [Morus notabilis]
 gb|EXB77655.1| Developmental protein SEPALLATA 2 [Morus notabilis]
Length=248

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 192/252 (76%), Gaps = 11/252 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SM+KTLERYQ+CSY  +E ++P  + +++Y EYL+LK R E LQR+QRNLLGE+LGPL+
Sbjct  61    PSMVKTLERYQKCSYGAMEVSKPGKELESSYREYLKLKGRFESLQRTQRNLLGEELGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQ+E QLE SLKQ+RS KTQ MLDQL +LQ +E ML ESN+ L  KL+E  +    
Sbjct  121   TKELEQIERQLETSLKQVRSTKTQYMLDQLTDLQSKEHMLIESNRALTLKLDEISSRNNF  180

Query  812   RL-SWEDGNQEIHQQNRQLP-----PQSEGF-FQPLGLNISGQIGYNSVGTDEVNVAASA  970
             R  SWE G+   H Q + +P       S+G  F PL  N + QIGYN+  ++++   + A
Sbjct  181   RSQSWEVGD---HDQ-QAMPYGHNHAHSQGLIFHPLDCNPTLQIGYNAAVSEQITSTSQA  236

Query  971   HNISGFFPGWML  1006
               ++GF PGWML
Sbjct  237   QQVNGFIPGWML  248



>ref|XP_008811808.1| PREDICTED: MADS-box protein CMB1-like isoform X1 [Phoenix dactylifera]
Length=251

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 191/252 (76%), Gaps = 9/252 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS+RG L+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAELALIIFSSRGCLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             SSM+KT++RYQRC+YA  EA    S+T QN Y EY++LKARV+ LQ S RNLLGEDL PL
Sbjct  61    SSMLKTIQRYQRCNYAASEAVASPSETQQNTYQEYVKLKARVDFLQSSHRNLLGEDLDPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ST ELEQLENQLE SLKQIRS KTQ MLDQL +++++EQ+L E+N+ L+R+L+E  +  P
Sbjct  121   STNELEQLENQLEKSLKQIRSAKTQFMLDQLCDVKKKEQVLQEANRELKRRLQEATSHNP  180

Query  809   LRLSW-------EDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS  967
              + SW         G  E    NR+    SEGFFQPLG +   QIGY+ +  D+ N  A 
Sbjct  181   FQWSWINGGGNGAGGASEDDHCNRE-AALSEGFFQPLGCHPPLQIGYHPMHIDQSNRGAM  239

Query  968   AHNISGFFPGWM  1003
              HN +G+ P WM
Sbjct  240   THNSNGYLPAWM  251



>gb|AAX15923.1| AGL9.1 [Persea americana]
Length=237

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 189/244 (77%), Gaps = 8/244 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             +SM+KTLERYQ+C+Y   E    + + Q+++ EY++LKARVE LQRSQRNLLGEDLGPL+
Sbjct  61    ASMLKTLERYQKCNYGAPETTVSSRELQSSHQEYMKLKARVEALQRSQRNLLGEDLGPLT  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KEL+ LE QL+ SLK IRS +TQ MLDQL +LQ+RE ML+E+NK LRR+LEE +   P 
Sbjct  121   GKELDTLEKQLDVSLKHIRSTRTQYMLDQLGDLQRREHMLSEANKSLRRRLEEGMQENP-  179

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
               +W D N  + Q   Q PPQS+GFF P+    + QIGY S    ++ +AA   N++ + 
Sbjct  180   NHAW-DPNGYVRQ---QAPPQSDGFFHPIECEPTLQIGYQS---SQITIAAPGPNVNNYM  232

Query  992   PGWM  1003
             PGW+
Sbjct  233   PGWL  236



>gb|AAX15920.1| AGL9 [Liriodendron tulipifera]
Length=242

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 189/245 (77%), Gaps = 5/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERYQ+C+Y   EA     + Q+++ EYL+LKARVE LQRSQRNLLGEDLGPL+
Sbjct  61    SSMFKTLERYQKCNYGAPEAAVTTREIQSSHQEYLKLKARVEALQRSQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KEL+ LE QL+ SLKQIRS +TQ MLDQL +LQ+REQML+E+NK L+R+L+E +   P 
Sbjct  121   GKELDTLERQLDVSLKQIRSTRTQYMLDQLTDLQRREQMLSEANKALKRRLDEGMQANPH  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVA-ASAHNISGF  988
             +  W      +    +Q PPQ +GFF PL    + QIGY    TD++ ++ A   +++ +
Sbjct  181   Q-GWNHNPHAMEYVRQQGPPQGDGFFHPLDCEPTLQIGYQ---TDQITMSTAPGPSLNNY  236

Query  989   FPGWM  1003
              PGW+
Sbjct  237   MPGWL  241



>dbj|BAM34478.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=244

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 189/245 (77%), Gaps = 4/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEV LI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVGLIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLERYQ+C+Y   E N  + +TQ++  EYL+LKARVE LQR QRNLLGEDLGPLS
Sbjct  61    SSMMKTLERYQKCNYGAPETNVISRETQSSQQEYLKLKARVEALQRYQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QL+ASLKQIRS +TQ MLDQLA+LQ++EQML E+NK LRR+LEE+      
Sbjct  121   SKELEQLERQLDASLKQIRSTRTQFMLDQLADLQRKEQMLCEANKSLRRRLEESSHPNQQ  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVA-ASAHNISGF  988
             ++   + +        Q  PQ +GFF PL    + QIGY+    D++ +A A   + S +
Sbjct  181   QVWDHNAHSAAGYAREQAQPQGDGFFHPLECEPTLQIGYH---PDQITIASAPGPSASSY  237

Query  989   FPGWM  1003
              PGW+
Sbjct  238   MPGWL  242



>gb|AFO68783.1| floral-binding protein 9, partial [Clethra tomentosa]
Length=217

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 183/230 (80%), Gaps = 14/230 (6%)
 Frame = +2

Query  320   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYA  499
             RQVT++KRRNGLLKKAYELS+LCDAEVALI+FSN GKLYEFCSSSSM KTLE+YQRCSY 
Sbjct  1     RQVTYSKRRNGLLKKAYELSVLCDAEVALIMFSNHGKLYEFCSSSSMQKTLEKYQRCSYG  60

Query  500   HLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLK  679
              LEA+Q  ++TQN YHEY++LK RV++LQ+SQRNLLGEDL PLSTKEL+QLE+QLE+SLK
Sbjct  61    SLEASQSVNETQNTYHEYMKLKTRVDILQQSQRNLLGEDLEPLSTKELDQLEHQLESSLK  120

Query  680   QIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAG-IPLRLSWEDGNQEIHQQN  856
             QIRS KTQ+MLDQL++LQ+REQML ESNK L+RKLE +    +P R  +           
Sbjct  121   QIRSTKTQAMLDQLSDLQRREQMLVESNKALKRKLEASTTEFLPSRRDF----------F  170

Query  857   RQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFPGWML  1006
                PPQS+GF+QPL LN + QIGY+ + TD+    A   N++GF PGWML
Sbjct  171   SLFPPQSDGFYQPLRLNSTLQIGYDPMSTDD---GAPPQNVNGFIPGWML  217



>gb|AEL33632.1| SEPALLATA2 [Gossypium hirsutum]
Length=244

 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 189/246 (77%), Gaps = 3/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLE+Y   +Y  LE  Q   D Q+NY EYL+LK++VE+LQ+SQR+ LGE++  L 
Sbjct  61    SSMAKTLEKYNSYTYGALEPGQTEIDAQSNYQEYLKLKSKVEVLQQSQRHFLGEEIADLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QL+ SLK+IRS K Q M+DQL+ELQ +E++L E+N+ LR KL+   +G  +
Sbjct  121   TKELEQLEHQLDFSLKKIRSTKMQLMIDQLSELQTKEEVLLETNRNLRMKLDG--SGPSM  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVG-TDEVNVAASAHNISGF  988
             R SWE G   I   +   PPQSEGFF+PL  N S QIGYN +  T E    ASA   SGF
Sbjct  179   RSSWETGEHSIPYNHPPPPPQSEGFFEPLHCNNSLQIGYNPISVTVEDTATASALAPSGF  238

Query  989   FPGWML  1006
              PGWML
Sbjct  239   IPGWML  244



>ref|XP_006400104.1| hypothetical protein EUTSA_v10014493mg [Eutrema salsugineum]
 gb|ESQ41557.1| hypothetical protein EUTSA_v10014493mg [Eutrema salsugineum]
Length=250

 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 194/252 (77%), Gaps = 9/252 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTL+RYQ+CSY  +E  N+PA + +N+Y EYL+LK R E LQR QRNLLGEDLGPL
Sbjct  61    SNMIKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ++KELEQLE QL+ SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++ +    
Sbjct  121   NSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALSMKLDDMIGVRS  180

Query  809   LRL---SWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVA--ASA  970
               +    WE   Q +   + Q   QS+G +QPL  N + QIGY N VG++++     A A
Sbjct  181   HHMGGGGWEGNEQNVSYAHHQ--AQSQGLYQPLECNATLQIGYDNPVGSEQITATTQAQA  238

Query  971   HNISGFFPGWML  1006
              + +G+ PGWML
Sbjct  239   QHGNGYIPGWML  250



>emb|CAA04920.1| MdMADS9 [Malus domestica]
Length=242

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = +2

Query  284   KVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMM  463
             +VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS S++
Sbjct  1     RVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSPSIL  60

Query  464   KTLERYQRCSYAHLE-ANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKE  640
             +T++RYQ+CSY  ++  N PA + +++Y EY++LK R E LQR+QRNLLGE+LGPL+TKE
Sbjct  61    QTVDRYQKCSYGAVDQVNIPAKELESSYREYMKLKGRCESLQRTQRNLLGEELGPLNTKE  120

Query  641   LEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLS  820
             LEQLE QLEASLKQ+RS KTQ MLDQL+ LQ +EQ+L E+N+ L  KL+E  +   LR S
Sbjct  121   LEQLERQLEASLKQVRSTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRNQLRQS  180

Query  821   WEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFPGW  1000
             WE G+Q +    +    QS+GFFQPL  N + QIGY + G++++     A  ++ F PGW
Sbjct  181   WEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGYPAEGSEQMGATTHAQQVNCFIPGW  240

Query  1001  ML  1006
             ML
Sbjct  241   ML  242



>ref|XP_010549963.1| PREDICTED: developmental protein SEPALLATA 1 [Tarenaya hassleriana]
 gb|ABD96852.1| hypothetical protein [Cleome spinosa]
Length=248

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 190/254 (75%), Gaps = 15/254 (6%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              +M+KTLERYQ+CSY  +E  N+PA + +N+Y EYL+LK+R E LQR QRNLLGEDLGPL
Sbjct  61    PNMLKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKSRFEGLQRQQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ++KELEQ+E QL+ SLKQ+RS KTQ M+DQL+ELQ REQML E+N+ L  KL+E V    
Sbjct  121   NSKELEQIERQLDGSLKQVRSIKTQYMIDQLSELQSREQMLLEANRALSMKLDEMVGART  180

Query  809   LRL--SWEDGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVA---A  964
               +   WE   Q +   HQ      PQ +G FQPL  N + QIGYN+    E   A   A
Sbjct  181   HHIGGGWEGSEQNVTYGHQ------PQPQGLFQPLECNPTLQIGYNNPECPEQMTATTQA  234

Query  965   SAHNISGFFPGWML  1006
              A   +G+ PGWML
Sbjct  235   PAQAGNGYIPGWML  248



>gb|ABK41485.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 195/247 (79%), Gaps = 9/247 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             M RGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MVRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSMMKTLERYQ+C+Y   E N  + +TQ++  EYL+LKAR E LQRSQRNLLGEDLGPLS
Sbjct  61    SSMMKTLERYQKCNYGAPETNIISRETQSSQQEYLKLKARAEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGIP  808
             +KELEQLE QL+ASLKQIRS +TQ MLDQLA+LQ++EQML E+NK LRR+LEE N AG  
Sbjct  121   SKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSLRRRLEESNQAG--  178

Query  809   LRLSWEDGNQEIHQQNRQLP-PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS-AHNIS  982
              +  W+     +    RQ P PQS+GF+Q +    + QIGY     +++ +AA+   +++
Sbjct  179   QQQVWDPTAHAVG-YGRQPPQPQSDGFYQQIDSEPTLQIGYPP---EQITIAAAPGPSVN  234

Query  983   GFFPGWM  1003
              + PGW+
Sbjct  235   TYMPGWL  241



>gb|AHW58033.1| SEP4 [Coffea arabica]
Length=239

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 186/246 (76%), Gaps = 8/246 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERY RCSYA    NQ + D Q++Y EYL+LKARVE+LQ+SQR+LLGEDL  L 
Sbjct  61    SSMSKTLERYHRCSYADAGMNQSSKDPQSDYQEYLKLKARVEVLQQSQRHLLGEDLAQLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRK-LEENVAGIP  808
              K+L+QLE QL+ASL+QIRS KTQ MLDQL++LQQ+E+ L E NK LR K LEE  A   
Sbjct  121   AKQLDQLERQLDASLRQIRSTKTQHMLDQLSDLQQKERSLMEVNKALRNKQLEETTAAY-  179

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
              +LSW+     +  +++ + P  EGFFQPL  N S  + YN V  D    A    N SG 
Sbjct  180   -QLSWDSEEHNLRHRSQTIHP--EGFFQPLECN-SSIMNYNMVVADA--EAEPTQNPSGI  233

Query  989   FPGWML  1006
              PGWML
Sbjct  234   LPGWML  239



>gb|KHN29767.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=248

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 189/250 (76%), Gaps = 7/250 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRR+GLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRDGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             +SM+KTLERYQ+CSY  +E ++P  + +++Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE  +    
Sbjct  121   TKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYN-----SVGTDEVNVAASAHN  976
             R +WE G Q +    +     S+GFFQPL  N + QIG +          ++     A  
Sbjct  181   RQTWEAGEQSMPYGTQN--AHSQGFFQPLECNPTLQIGSDYRYIPEASEQQLAATTQAQQ  238

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  239   VNGFIPGWML  248



>ref|NP_001234201.1| TAGL2 transcription factor [Solanum lycopersicum]
 gb|AAM33104.2| TAGL2 transcription factor [Solanum lycopersicum]
Length=246

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/247 (61%), Positives = 193/247 (78%), Gaps = 3/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVAL++FSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTL+RYQ+CSY  LE N+   D  Q++Y EYL+LKA+ E LQR QR+LLG++LGPL
Sbjct  61    SNMLKTLDRYQKCSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +  +LE LE QL+ SLK IRS +TQ MLDQL++LQ +E++  E+NK+L RK+EE  A   
Sbjct  121   TIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKMEEIYAENN  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGT-DEVNVAASAHNISG  985
             ++ +W  G Q ++   +Q  PQS+GFFQPL  N S QIGY+ + T  ++    +A N++G
Sbjct  181   MQQAWGGGEQSLNYGQQQ-HPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNG  239

Query  986   FFPGWML  1006
               PGWML
Sbjct  240   MIPGWML  246



>emb|CDP02339.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 189/246 (77%), Gaps = 2/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M++TLERYQRCSY  +E +  A +  Q++Y EYL+LK + E LQR QR+LLG+DLGPL
Sbjct  61    SNMLRTLERYQRCSYGAVEVSHSAKEIEQSSYKEYLKLKGKYESLQRYQRHLLGDDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +  +LE LE+QLE+SLK +RS +TQ MLDQL++LQ +E++  E+NK L RKLEE  A   
Sbjct  121   NINDLEHLEHQLESSLKLVRSTRTQVMLDQLSDLQTKEKLWLEANKALERKLEEIYAENH  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             L  SW  G ++    ++Q   QS+GFFQPL  +   QIGYN   + ++    +A N+SG 
Sbjct  181   LHQSWGGGGEQSSTYSQQ-HSQSQGFFQPLECSSGLQIGYNPASSSQITAVTNAQNVSGL  239

Query  989   FPGWML  1006
              PGWML
Sbjct  240   VPGWML  245



>gb|AHW52537.1| SEPALLATA-like MADS-box protein 2 [Phalaenopsis equestris]
Length=241

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 197/246 (80%), Gaps = 7/246 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VE+KRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRG+L+EFCSS
Sbjct  1     MGRGRVEMKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERYQ+CSY   E+  P+ DTQN+Y EYL+LK +VE LQRSQRNLLGEDL  L 
Sbjct  61    SSMTKTLERYQKCSYNATESTVPSKDTQNSYQEYLKLKTKVEYLQRSQRNLLGEDLIELG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QLE SLKQIRS KTQ MLDQL +L+++EQML E+N+ LRRKL+E+   IPL
Sbjct  121   SKELEQLELQLEMSLKQIRSTKTQLMLDQLCDLKRKEQMLQEANRALRRKLQEDEPEIPL  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTD-EVNV-AASAHNISG  985
              LSW  G      + +Q  PQSE FFQPL    S QIG++ +  D ++N  ++SAHNI+G
Sbjct  181   ELSWTGGGGNGPCERQQ--PQSEDFFQPLP---SLQIGFSPICIDQQLNTGSSSAHNING  235

Query  986   FFPGWM  1003
             F  GWM
Sbjct  236   FISGWM  241



>gb|AEJ76842.1| MADS18 [Gossypium hirsutum]
Length=249

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 188/246 (76%), Gaps = 3/246 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGXVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLE+Y   +Y  LE  Q   D Q+NY EYL+LK++VE+LQ+SQR+ LGE++  L 
Sbjct  61    SSMAKTLEKYNSYTYGALEPGQTEIDAQSNYQEYLKLKSKVEVLQQSQRHFLGEEIADLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELEQLE+QL+ SLK+IRS K Q M+DQL+ELQ +E++L E+N+ LR KL+   +G  +
Sbjct  121   TKELEQLEHQLDFSLKKIRSTKMQLMIDQLSELQTKEEVLLETNRNLRMKLDG--SGPSM  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVG-TDEVNVAASAHNISGF  988
             R SWE G   I   +   PPQSEGFF+PL  N S QIGYN +  T E    ASA   SGF
Sbjct  179   RSSWETGEHSIPYNHPPPPPQSEGFFEPLHCNNSLQIGYNPISVTVEDTATASALAPSGF  238

Query  989   FPGWML  1006
              PGWML
Sbjct  239   IPGWML  244



>ref|XP_006338336.1| PREDICTED: developmental protein SEPALLATA 1-like [Solanum tuberosum]
Length=246

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/247 (61%), Positives = 193/247 (78%), Gaps = 3/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVAL++FSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             ++M+KTL+RYQ+CSY  LE N+   D  Q++Y EYL+LKA+ E LQR QR+LLG++LGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +  +LE LE QL+ SLK IRS +TQ MLDQL++LQ +E++  E+NK+L RK+EE  A   
Sbjct  121   TIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKMEEIYAENN  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGT-DEVNVAASAHNISG  985
             L+ +W  G Q ++   +Q  PQS+GFFQPL  N S QIGY+ + T  ++    +A N++G
Sbjct  181   LQQTWGGGEQSLNYGQQQ-HPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNG  239

Query  986   FFPGWML  1006
               PGWML
Sbjct  240   MIPGWML  246



>emb|CAA64741.1| DEFH49 [Antirrhinum majus]
Length=247

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 186/247 (75%), Gaps = 2/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQ-NNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KT+ERYQ+ SY  LE N  A D + ++Y EYL+LK++ E LQ  QR+LLG+DLGPL
Sbjct  61    SNMLKTIERYQKSSYGSLEVNHQAKDIEASSYKEYLKLKSKYESLQGYQRHLLGDDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +  +LE LE+QLE SLK IRS +TQ MLDQL++LQ +E+M+ ++NK L RKLEE  A   
Sbjct  121   NMNDLEHLEHQLETSLKHIRSTRTQVMLDQLSDLQTKEKMMVDANKALERKLEEIYAANH  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNS-VGTDEVNVAASAHNISG  985
             L+ SW  G    +  N     QS+GFFQPL  N + QIG+N  V + ++     A N+ G
Sbjct  181   LQQSWGGGGDHSNAYNDHQHAQSQGFFQPLECNSTLQIGFNDPVASSQMTAPTDAQNMHG  240

Query  986   FFPGWML  1006
               PGWML
Sbjct  241   LVPGWML  247



>ref|XP_009121545.1| PREDICTED: developmental protein SEPALLATA 1 [Brassica rapa]
Length=252

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 194/254 (76%), Gaps = 11/254 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTLERYQ+CSY  +E  N+PA + +N+Y EYL+LK R E LQR QRNLLGEDLGPL
Sbjct  61    SNMIKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYESLQRQQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVA---  799
             ++KELEQLE QL+ SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++ +    
Sbjct  121   NSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALTIKLDDMIGVRS  180

Query  800   -GIPLRLSWEDGNQEI-HQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVA--A  964
               +     WE   Q + ++ + Q  PQ  G FQPL  N + QIGY N VG++++     A
Sbjct  181   HHMGGGGGWEGNEQNVPYEHHHQAQPQ--GLFQPLECNPTLQIGYDNPVGSEQITATTQA  238

Query  965   SAHNISGFFPGWML  1006
              A   +G+ PGWML
Sbjct  239   QAQPGNGYIPGWML  252



>emb|CAN59955.1| hypothetical protein VITISV_006723 [Vitis vinifera]
Length=244

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 182/222 (82%), Gaps = 9/222 (4%)
 Frame = +2

Query  272  MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  452  SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
            SSM+KTLERYQ+CSY  +E ++P+ +  Q++Y EYL+LK++ E LQR+QRNLLGEDLGPL
Sbjct  61   SSMLKTLERYQKCSYGAVEVSRPSKELEQSSYREYLKLKSKFEXLQRTQRNLLGEDLGPL  120

Query  629  STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
            +TKELEQLE QLE SLKQ+RS KTQ MLDQL++LQ +EQ+L ESNK L RKL+E      
Sbjct  121  NTKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKALTRKLDEISVKNH  180

Query  809  LRLSWEDGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIG  925
            L+LSWE G Q +   HQQ      QS+GFFQPL  N + QIG
Sbjct  181  LQLSWESGEQSMPYGHQQ-----AQSQGFFQPLECNPTLQIG  217



>ref|XP_010558530.1| PREDICTED: developmental protein SEPALLATA 1 [Tarenaya hassleriana]
 gb|ABD96896.1| hypothetical protein [Cleome spinosa]
Length=248

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 193/254 (76%), Gaps = 15/254 (6%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTLERYQ+CSY  +E  N+PA + +N+Y EYL+LK+R E L R QRNLLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNRPAKELENSYREYLKLKSRYEGLHRQQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ++KELEQLE QL++SLKQ+RS KTQSMLD+L++LQ +EQML E+N+ L  KLEE V    
Sbjct  121   NSKELEQLERQLDSSLKQVRSIKTQSMLDELSDLQNKEQMLLEANRALSMKLEEMVGART  180

Query  809   LRL--SWEDGNQEI---HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAH  973
              +   +WE   Q +   HQ       QS+G FQPL  N + QIGYN+    E   A +  
Sbjct  181   HQFGGAWEGSEQNVSYGHQ------AQSQGLFQPLECNPTLQIGYNNPVCSEQMAATTQA  234

Query  974   NI---SGFFPGWML  1006
              +   +G+ PGWML
Sbjct  235   PVQAGNGYIPGWML  248



>ref|XP_004491904.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Cicer arietinum]
Length=249

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/250 (62%), Positives = 194/250 (78%), Gaps = 6/250 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             S+M+KTL+RYQ+CSY  +E ++PA + +++Y EYL+LK R E LQ++QRNLLGEDLGPL+
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELESSYREYLKLKQRFENLQKTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +K+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KL+E  +    
Sbjct  121   SKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLDEINSRNHY  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASA-HN  976
             R SWE G+Q +     Q    S+ FFQ L  N + QIG    YN+V +D++   + A   
Sbjct  181   RQSWEAGDQSMQYGGPQ-NAHSQSFFQQLECNPTLQIGPDYRYNNVTSDQIASTSQAQQQ  239

Query  977   ISGFFPGWML  1006
             ++GF PGWML
Sbjct  240   VNGFVPGWML  249



>gb|AAF12701.2| Apetala 1 protein [Populus tremuloides]
Length=237

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 185/235 (79%), Gaps = 2/235 (1%)
 Frame = +2

Query  305   ENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQ  484
             ENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+S+M+KTLERYQ
Sbjct  4     ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQ  63

Query  485   RCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQL  664
             +CSY   E N+PA + +N+Y EYL++KAR E LQR+QRNLLGEDLGPL+TK+LEQLE QL
Sbjct  64    KCSYGAEEVNKPAKELENSYREYLKVKARFEALQRTQRNLLGEDLGPLNTKDLEQLERQL  123

Query  665   EASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEI  844
             E+SL Q+RS KTQ MLDQLA+LQ +E +L E+N+ L  KL+E  A   LR SWE  +Q+ 
Sbjct  124   ESSLNQVRSTKTQYMLDQLADLQNKEHLLLEANRGLTIKLDEISARNSLRPSWEGDDQQN  183

Query  845   HQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVN-VAASAHNISGFFPGWML  1006
                  Q   QS+G FQ L  N + QIGYN+VG+D+V+ +  +   + GF PGWML
Sbjct  184   MSYGHQ-HAQSQGLFQALECNPTLQIGYNAVGSDQVSAITHATQQVHGFIPGWML  237



>ref|XP_006603756.1| PREDICTED: MADS-box protein isoform X1 [Glycine max]
Length=249

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/251 (62%), Positives = 189/251 (75%), Gaps = 8/251 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             +SM+KTLERYQ+CSY  +E ++P  +  Q++Y EYL+LKAR E LQR+QRNLLGEDLGPL
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +TK+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KLEE  +   
Sbjct  121   NTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQ  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYN-----SVGTDEVNVAASAH  973
              R +WE G Q +    +     S+GFFQPL  N + QIG +          ++     A 
Sbjct  181   YRQTWEAGEQSMPYGTQN--AHSQGFFQPLECNPTLQIGSDYRYIPEASEQQLAATTQAQ  238

Query  974   NISGFFPGWML  1006
              ++GF PGWML
Sbjct  239   QVNGFIPGWML  249



>emb|CAL36576.1| deficiens H49 homologue [Misopates orontium]
Length=247

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 186/247 (75%), Gaps = 2/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQ-NNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KT+ERYQ+ SY  LE N  A D + ++Y EYL+LK++ E LQ  QR+LLG+DLGPL
Sbjct  61    SNMLKTIERYQKSSYGSLEVNHQAKDIEASSYKEYLKLKSKYESLQGYQRHLLGDDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +  +LE LE+QLE SLK IRS +TQ MLDQL++LQ +E+M+ ++NK L RKLEE  A   
Sbjct  121   NMNDLEHLEHQLETSLKHIRSTRTQVMLDQLSDLQTKEKMMVDANKALERKLEEIYAANH  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNS-VGTDEVNVAASAHNISG  985
             ++ SW  G    +  N     QS+GFFQPL  N + QIG+N  V + ++     A N+ G
Sbjct  181   IQQSWGGGGDHSNAYNDHQHAQSQGFFQPLECNSTLQIGFNDPVASSQMTAPTDAQNMHG  240

Query  986   FFPGWML  1006
               PGWML
Sbjct  241   LVPGWML  247



>ref|XP_010913017.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Elaeis guineensis]
 gb|AAQ03226.1|AF411845_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 194/246 (79%), Gaps = 7/246 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + +TQ +  EYL+LKARVE LQRSQRNLLG+DLGPLS
Sbjct  61    SSMLKTLERYQKCNYGAPETNIVSRETQTSQQEYLKLKARVEALQRSQRNLLGDDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QL+ASLKQIRS +TQ MLDQLA+LQ+REQML E+NK L+++LEE+      
Sbjct  121   SKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKQRLEESNQATQQ  180

Query  812   RLSWEDGNQEIHQQNRQLP-PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS-AHNISG  985
             ++ W D N       RQ P PQ +GF+Q +  + +  IGY     +++ +AA+   ++S 
Sbjct  181   QV-W-DPNAPAVGYGRQPPQPQGDGFYQQIECDPTLHIGYPP---EQITIAAAPGPSVSN  235

Query  986   FFPGWM  1003
             + PGW+
Sbjct  236   YMPGWL  241



>gb|AEQ75500.1| MADS-domain transcription factor, partial [Davidia involucrata]
Length=205

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 172/207 (83%), Gaps = 2/207 (1%)
 Frame = +2

Query  386   CDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLK  565
             CDAEVALIIFSNRGKLYEF SSSSM KTLERYQRCSY  LEA+QP +D QN YH Y+RLK
Sbjct  1     CDAEVALIIFSNRGKLYEFSSSSSMQKTLERYQRCSYGSLEASQPVNDNQNGYHGYMRLK  60

Query  566   ARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQ  745
             ARVE+LQ+SQRNLLGEDLGPL+TK+LEQLE+QLE SLKQIRS KTQ MLDQL++LQ+REQ
Sbjct  61    ARVEVLQQSQRNLLGEDLGPLNTKDLEQLEHQLEMSLKQIRSTKTQFMLDQLSDLQRREQ  120

Query  746   MLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG  925
             +L ESNK LRRKL+E+   IPL+LSWE G   I   NR LP QSEGFFQPLGLN +   G
Sbjct  121   ILVESNKSLRRKLDESTVQIPLQLSWEAGGHTI-PYNR-LPVQSEGFFQPLGLNSTLPTG  178

Query  926   YNSVGTDEVNVAASAHNISGFFPGWML  1006
              N VG+DE+NVAA A N++G  PGWML
Sbjct  179   NNHVGSDEMNVAAPAQNVNGSIPGWML  205



>gb|AAX53103.1| AGL2-like protein [Magnolia grandiflora]
Length=228

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 182/224 (81%), Gaps = 3/224 (1%)
 Frame = +2

Query  338   KRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYAHLEANQ  517
             KRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS SM++TLERYQ+CSY+ LE + 
Sbjct  1     KRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSPSMLQTLERYQKCSYSTLEVSA  60

Query  518   PASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLKQIRSRK  697
             P ++TQ++Y EYL+LKARVE+LQR+QRNLLGEDLGPLSTKELEQLENQLE SLKQIRS K
Sbjct  61    PTNETQSSYQEYLKLKARVEILQRTQRNLLGEDLGPLSTKELEQLENQLEMSLKQIRSTK  120

Query  698   TQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQQNRQLPPQS  877
             TQ MLDQL++L+++EQML E+NK L+RKLEE+     L+LSW+ G Q +   NRQ P   
Sbjct  121   TQFMLDQLSDLKRKEQMLVEANKALKRKLEESGRENLLQLSWDTGAQNMSSYNRQ-PSNY  179

Query  878   EGFFQPLGLNISGQIGYNSVGTDEVNVAAS--AHNISGFFPGWM  1003
             EGFFQPL    + Q+GY+ V  D++ VA +   +N+ GF PGWM
Sbjct  180   EGFFQPLDCQPTLQMGYHPVYEDQMTVATNHGQNNVHGFMPGWM  223



>gb|ADU56820.1| MADS-box protein AGL2 subfamily [Coffea arabica]
Length=240

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/246 (66%), Positives = 187/246 (76%), Gaps = 7/246 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERY RCSYA    NQ + D Q++Y EYL+LKA+VE+LQ+SQR+LLGEDL  L 
Sbjct  61    SSMSKTLERYHRCSYADAGMNQSSKDPQSDYQEYLKLKAKVEVLQQSQRHLLGEDLAQLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRK-LEENVAGIP  808
              K+L+QLE QL+ASL+QIRS KTQ MLDQL++LQQ+E+ L E NK LR K LEE  A   
Sbjct  121   AKQLDQLERQLDASLRQIRSTKTQHMLDQLSDLQQKERSLMEVNKALRNKQLEETTAA--  178

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
              +LSW D ++E + ++R      EGFFQPL  N S  + YN V  D    A    N SG 
Sbjct  179   FQLSW-DVSEEHNLRHRSQTIHPEGFFQPLECN-SSIMNYNMVVADA--EAEPTQNPSGI  234

Query  989   FPGWML  1006
              PGWML
Sbjct  235   LPGWML  240



>ref|NP_001233911.1| MADS-box protein [Solanum lycopersicum]
 emb|CAC83066.1| MADS-box protein [Solanum lycopersicum]
Length=246

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 193/247 (78%), Gaps = 3/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVAL++FSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             ++M+KTL+RYQ+CSY  LE N+   D  Q++Y EYL+LKA+ E LQR QR+LLG++LGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +  +LE LE QL+ SLK IRS +TQ MLDQL++LQ +E++  E+NK+L RK+EE  A   
Sbjct  121   TIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKMEEIYAENN  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGT-DEVNVAASAHNISG  985
             ++ +W  G Q ++   +Q  PQS+GFFQPL  N S QIGY+ + T  ++    +A N++G
Sbjct  181   MQQAWGGGEQSLNYGQQQ-HPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNG  239

Query  986   FFPGWML  1006
               PGWML
Sbjct  240   MIPGWML  246



>emb|CDY26462.1| BnaC09g42060D [Brassica napus]
Length=254

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 194/256 (76%), Gaps = 13/256 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTLERYQ+CSY  +E  N+PA + +N+Y EYL+LK R E LQR QRNLLGEDLGPL
Sbjct  61    SNMIKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYESLQRQQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ++KELEQLE QL+ SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++ +    
Sbjct  121   NSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALAIKLDDMIGVRS  180

Query  809   LRL------SWEDGNQEI-HQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVA-  961
               +       WE   Q + ++ + Q  PQ  G FQPL  N + QIGY N VG++++    
Sbjct  181   HHMGGGGGGGWEGNEQNVSYEHHHQAQPQ--GLFQPLECNPTLQIGYDNPVGSEQITATT  238

Query  962   -ASAHNISGFFPGWML  1006
              A A   +G+ PGWML
Sbjct  239   QAQAQPGNGYIPGWML  254



>gb|AAA32732.1| transcription factor [Arabidopsis thaliana]
 gb|AAU81987.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81989.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81990.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81991.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81992.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81993.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81994.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81995.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81996.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81997.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81998.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81999.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82000.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82001.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82002.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82004.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82005.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82006.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82007.1| SEPALLATA1 [Arabidopsis thaliana]
Length=248

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 193/250 (77%), Gaps = 7/250 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTL+RYQ+CSY  +E  N+PA + +N+Y EYL+LK R E LQR QRNLLGEDLGPL
Sbjct  61    SNMLKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ++KELEQLE QL+ SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++ +    
Sbjct  121   NSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRS  180

Query  809   LRL-SWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVA--ASAHN  976
               +  WE G Q +   + Q   QS+G +QPL  N + Q+GY N V ++++     A A  
Sbjct  181   HHMGGWEGGEQNVTYAHHQ--AQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQP  238

Query  977   ISGFFPGWML  1006
              +G+ PGWML
Sbjct  239   GNGYIPGWML  248



>ref|XP_008801853.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Phoenix dactylifera]
Length=234

 Score =   299 bits (765),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 192/246 (78%), Gaps = 15/246 (6%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + +TQ++  EYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLKTLERYQKCNYGAPETNIVSRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QL+ASLKQIRS +TQ MLDQLA+LQ+REQML E+NK L+R+LEE+      
Sbjct  121   SKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKRRLEESNQATQQ  180

Query  812   RLSWEDGNQEIHQQNRQLP-PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS-AHNISG  985
             ++ W D N       RQ P PQ +GF+QP        I Y+    +++ +AA    ++S 
Sbjct  181   QV-W-DPNAHAVGYGRQPPQPQGDGFYQP--------IEYH---PEQITIAAGPGPSVSN  227

Query  986   FFPGWM  1003
             + PGW+
Sbjct  228   YMPGWL  233



>gb|ABJ98752.1| MADS-box transcription factor MADS-RIN [Capsicum annuum]
Length=243

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 188/249 (76%), Gaps = 10/249 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRI+NKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS+RGKLYEFCSS
Sbjct  1     MGRGKVELKRIDNKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERY + +Y  LE  QP++D+QNNY EYL+LK RVE+LQ+SQR++LGEDLG L+
Sbjct  61    SSMSKTLERYHKHNYGALEGTQPSADSQNNYQEYLKLKTRVEVLQQSQRHMLGEDLGELN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TK+LEQLE QL++SL+QIRS KTQ M DQLAEL Q+EQ L E NK L+ KLEE   G+  
Sbjct  121   TKDLEQLERQLDSSLRQIRSTKTQHMFDQLAELHQKEQSLTEMNKSLKTKLEE--LGVAF  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLN----ISGQIGYNSVGTDEVNVAASAHNI  979
             + SW  G  E   Q RQ  P  EGFFQ +  N     + + GY++V  +    A S  + 
Sbjct  179   QTSWHSGPGEQSVQYRQQQP--EGFFQHVDCNNHTVPNMRYGYDNVPPE--YAAPSTQDA  234

Query  980   SGFFPGWML  1006
              G  PGWML
Sbjct  235   LGVVPGWML  243



>gb|AFO68791.1| agamous-like protein 234, partial [Pachysandra terminalis]
Length=228

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 188/230 (82%), Gaps = 3/230 (1%)
 Frame = +2

Query  320   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYA  499
             RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS++KTLERYQ+CSY 
Sbjct  1     RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSILKTLERYQKCSYG  60

Query  500   HLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLK  679
              LE +QPA +TQ++Y EYL+LKA VE+LQ+SQRNLLGEDLGPL TKELE+LE+QLE SLK
Sbjct  61    ALEPSQPAKETQSSYQEYLKLKANVEVLQQSQRNLLGEDLGPLGTKELEELEHQLEMSLK  120

Query  680   QIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQQNR  859
             QIRS KTQ MLDQL +LQ++EQML E+N+ LRRKL+E+ A   LR SWE     +  Q  
Sbjct  121   QIRSTKTQFMLDQLYDLQRKEQMLQEANRALRRKLDESSAENHLRQSWEAAGHNM--QYS  178

Query  860   QLPPQSEGFFQPLGLNISGQIGYNSVGTDE-VNVAASAHNISGFFPGWML  1006
             Q   QSE FFQPL  N + QIGYN VG D+ + +AA A N++GF PGWML
Sbjct  179   QQHAQSEDFFQPLECNSTLQIGYNPVGPDDHMTIAAPAQNVNGFVPGWML  228



>gb|AFO68789.1| floral-binding protein 9, partial [Gunnera manicata]
Length=226

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 182/229 (79%), Gaps = 3/229 (1%)
 Frame = +2

Query  320   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYA  499
             RQVTF KRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+SSM KTLERY +CS  
Sbjct  1     RQVTFCKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSTSSMAKTLERYHKCSQG  60

Query  500   HLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLK  679
              LEA++P ++TQ NY EYL+LK RVE+LQ+SQRNLLGEDLGPL+TKELEQLE+QLEASLK
Sbjct  61    RLEASRPVNETQTNYQEYLKLKGRVEVLQQSQRNLLGEDLGPLNTKELEQLESQLEASLK  120

Query  680   QIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQQNR  859
             QIRS KTQ MLDQL EL+ +E+ML E+N+ L  KLEE     P  +SWE  +Q I   + 
Sbjct  121   QIRSTKTQLMLDQLFELRMKEEMLLEANRALWMKLEELSIENP--ISWEAESQNI-PFSC  177

Query  860   QLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFFPGWML  1006
              +   SEGFFQPL  N + Q+GYN + +DE+ +AA+  N++ F PGWML
Sbjct  178   NIHAHSEGFFQPLPCNSTQQLGYNPLCSDELRMAATTQNVNRFIPGWML  226



>ref|XP_004491903.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Cicer arietinum]
Length=250

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/251 (62%), Positives = 194/251 (77%), Gaps = 7/251 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASD-TQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTL+RYQ+CSY  +E ++PA +  Q++Y EYL+LK R E LQ++QRNLLGEDLGPL
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELEQSSYREYLKLKQRFENLQKTQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ++K+LEQLE QL++SLKQ+RS KTQ MLDQLA+LQ +E ML E+N+ L  KL+E  +   
Sbjct  121   NSKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLDEINSRNH  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIG----YNSVGTDEVNVAASA-H  973
              R SWE G+Q +     Q    S+ FFQ L  N + QIG    YN+V +D++   + A  
Sbjct  181   YRQSWEAGDQSMQYGGPQ-NAHSQSFFQQLECNPTLQIGPDYRYNNVTSDQIASTSQAQQ  239

Query  974   NISGFFPGWML  1006
              ++GF PGWML
Sbjct  240   QVNGFVPGWML  250



>ref|XP_010923638.1| PREDICTED: MADS-box protein CMB1-like [Elaeis guineensis]
Length=277

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 189/244 (77%), Gaps = 5/244 (2%)
 Frame = +2

Query  287   VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMK  466
             VELKRIENKINRQVTFAKRRNGLLKKA+ELS+LCDAEVALIIFS+RG+L+EFCSSSSM+K
Sbjct  33    VELKRIENKINRQVTFAKRRNGLLKKAFELSVLCDAEVALIIFSSRGRLFEFCSSSSMLK  92

Query  467   TLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELE  646
             TLERYQRC+Y+  EA  P+S+ QN Y EY+RLKARVE LQ SQRNLLGEDL PLST EL+
Sbjct  93    TLERYQRCNYSASEAAAPSSEIQNTYQEYVRLKARVEFLQHSQRNLLGEDLDPLSTNELD  152

Query  647   QLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWE  826
             QLENQLE SLKQIRS KTQSMLDQL +L++REQ + E+N+ L RKL E  +  PL+L+W 
Sbjct  153   QLENQLEKSLKQIRSAKTQSMLDQLCDLKRREQEMQETNRSLNRKLREAASQNPLQLTWA  212

Query  827   DGNQEIHQQNRQLPPQ-----SEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
             +G+ +    +   P       S GFFQPL  +   QIGY+ V  D+ N  A +H+ +G+ 
Sbjct  213   NGSGDHAAGSSNGPCNREAALSRGFFQPLACHPPEQIGYHPVNIDQPNGGAMSHDSNGYL  272

Query  992   PGWM  1003
             P WM
Sbjct  273   PAWM  276



>gb|AFO68781.1| floral-binding protein 9, partial [Nyssa sylvatica]
Length=204

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 170/206 (83%), Gaps = 2/206 (1%)
 Frame = +2

Query  389   DAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKA  568
             DAEVALI+FS RGKL EFCSSSSM++TLE+YQRCSY  LEA+QP +D  N YHEYLRLK 
Sbjct  1     DAEVALIMFSTRGKLSEFCSSSSMLETLEKYQRCSYGSLEASQPVNDNPNGYHEYLRLKG  60

Query  569   RVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQM  748
             R ++LQ+SQRNLLGEDL  L+T+EL+QLE+QLE SLKQ+RS KTQ MLDQLA+LQ+REQM
Sbjct  61    RAQVLQQSQRNLLGEDLEQLNTRELDQLEHQLEMSLKQVRSTKTQFMLDQLADLQRREQM  120

Query  749   LAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY  928
             LAESN+ LR KLEEN+ GIPLRLSWE G Q I   +   P QSEGFFQPLGLN + Q GY
Sbjct  121   LAESNRALRTKLEENIMGIPLRLSWEAGGQTIPYNH--FPAQSEGFFQPLGLNSALQTGY  178

Query  929   NSVGTDEVNVAASAHNISGFFPGWML  1006
             N V +DE+NVAA A N++GF PGWML
Sbjct  179   NHVDSDEINVAAPAQNVNGFIPGWML  204



>gb|AAK21247.1|AF335234_1 MADS-box transcription factor FBP4 [Petunia x hybrida]
Length=240

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 188/246 (76%), Gaps = 7/246 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM  TLE+Y R  Y  LE +QP++D+QN Y EYL+LK RVE LQ+SQR++LG DLG L 
Sbjct  61    SSMSTTLEKYHRYCYGALEGSQPSTDSQNIYQEYLKLKTRVEALQQSQRHMLGADLGQLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQR-EQMLAESNKLLRRKLEENVAGIP  808
             TK+LEQLE QL++SL+QIRS +TQ+MLDQL+ELQ++ EQ L E NK LR KLEE   G+ 
Sbjct  121   TKDLEQLERQLDSSLRQIRSTRTQNMLDQLSELQEKQEQSLIEMNKSLRMKLEE--LGVA  178

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
              + S   G + +  Q RQ P + EG F P+  N S  I YN++  +  +V  SA + +G 
Sbjct  179   FQTSMHSGEESV--QYRQQPAEPEGLFHPVECNNSLPIRYNTLPRE--HVVPSAQDSTGV  234

Query  989   FPGWML  1006
              PGWML
Sbjct  235   LPGWML  240



>gb|AHW58036.1| SEP1/2 [Coffea arabica]
Length=247

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 187/247 (76%), Gaps = 2/247 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M++TLERYQRCSY  +E +  A +  Q++Y EYL+LK + E LQR QR+LLG+DLGPL
Sbjct  61    SNMLRTLERYQRCSYGAVEVSHSAKEIEQSSYKEYLKLKGKYESLQRYQRHLLGDDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENV-AGI  805
             +  +LE LE+QLE+SLK +RS +T+ MLDQL++LQ +E++  E+NK L RKL   + A  
Sbjct  121   NINDLEHLEHQLESSLKLVRSTRTKVMLDQLSDLQTKEKLWLEANKALERKLGRYIYAEN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
                 SW DG ++    ++Q    S+GFFQPLG +   QIGYN   +  +    +A N+SG
Sbjct  181   SPSSSWGDGGEQSITYSQQHSQYSQGFFQPLGCSSGLQIGYNPASSSHITAVTNAQNVSG  240

Query  986   FFPGWML  1006
               PGWML
Sbjct  241   LVPGWML  247



>gb|AAZ95252.1| MADS box protein SEP1 [Dendrobium crumenatum]
Length=243

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 189/248 (76%), Gaps = 8/248 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + +TQ++  EYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLKTLERYQKCNYEGPETNIISRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELE LE QL+ASLKQIRS +TQ MLDQLA+LQ+REQML E+NK L+R+ EE+      
Sbjct  121   SKELEHLERQLDASLKQIRSTRTQFMLDQLADLQRREQMLCEANKALKRRFEESNQTAHQ  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEG--FFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
             ++ W+          RQ P Q  G  F+ PL    + QIGY+S   D      +A N+S 
Sbjct  181   QV-WDPSTTHAVGYGRQ-PAQHHGDAFYHPLECEPTLQIGYHS---DITMAPTTAPNVSN  235

Query  986   FF-PGWML  1006
             +  PGW++
Sbjct  236   YMPPGWLV  243



>gb|AIU94430.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
 gb|AIU94431.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
Length=244

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 192/248 (77%), Gaps = 9/248 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKL+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + +TQN+  EYL+LKARVE LQRSQRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCNYGAPETNVMSRETQNSQQEYLKLKARVEALQRSQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLE QL+ASL+QIRS +TQ MLDQL +LQ+REQML E+NK L+R+LEE+      
Sbjct  121   IKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKALKRRLEESNQANQQ  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNS----VGTDEVNVAASAHNI  979
             +L W D N    QQ +   PQ +GFFQP+    + QIGY+     +       AA+  ++
Sbjct  181   QL-W-DPNTYGRQQPQ---PQGDGFFQPIDCEPTLQIGYHPDKMAIAAAAAAAAAAGPSV  235

Query  980   SGFFPGWM  1003
             S + PGW+
Sbjct  236   SNYVPGWL  243



>emb|CAC81072.1| MADS box transcription factor [Daucus carota subsp. sativus]
Length=246

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 183/246 (74%), Gaps = 1/246 (0%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTL RY RCSY  LE  Q   DTQ++Y EY++LKA+VE LQ+SQR+LLGE+LG L 
Sbjct  61    SSMNKTLGRYHRCSYGALETGQTDRDTQSSYQEYIKLKAKVEALQQSQRHLLGEELGQLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKELE+LE QL+++L+Q+RS KTQ MLDQL++LQQ+EQ L E NK LR KLEEN   I  
Sbjct  121   TKELEELERQLDSTLRQVRSTKTQYMLDQLSDLQQKEQELVEINKALRNKLEENDVRIQS  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTD-EVNVAASAHNISGF  988
             +    + N   ++ +    P   G F+ L  N +  +GYNS   D ++  A    N SG 
Sbjct  181   QWEAAERNNVAYRSHPAEHPPDHGVFESLECNNTMHMGYNSAMNDHQMASATPTQNASGV  240

Query  989   FPGWML  1006
              PGWML
Sbjct  241   IPGWML  246



>gb|AIU94434.1| MADS-box transcription factor 2 isoform 2, partial [Musa balbisiana]
Length=247

 Score =   297 bits (760),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 155/247 (63%), Positives = 187/247 (76%), Gaps = 4/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + + Q +  EYL+LKARVE LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLKTLERYQKCNYGAPETNIISREIQTSQQEYLKLKARVEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLE QL+ASL+QIRS +TQ MLDQLA+LQ+REQML E+NK L+ +++E       
Sbjct  121   IKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRMDEGNQANQQ  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNS---VGTDEVNVAASAHNIS  982
             +L W+   Q +     Q  PQ +GFFQP+    + QIGY+            AA+  ++S
Sbjct  181   QL-WDPNAQAVAYCRHQPQPQGDGFFQPIDCEPTLQIGYHPDQMAIAAAAAAAAAGPSVS  239

Query  983   GFFPGWM  1003
              + PGW+
Sbjct  240   NYVPGWL  246



>ref|XP_009608616.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=245

 Score =   297 bits (760),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 187/247 (76%), Gaps = 4/247 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LC+AEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             ++M+KTL+RYQ+CSY  LE N+   D  QN+Y EYL+LKA+ E LQR QR+LLGEDLGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQNSYREYLKLKAKYESLQRYQRHLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             +  +L+ LE QL+ SLK IRS +TQ MLDQL +LQ +E++  E+NK+L RKLEE  A   
Sbjct  121   NIDDLDHLEVQLDNSLKHIRSTRTQLMLDQLTDLQSKEKLWLEANKVLERKLEEIYAENN  180

Query  809   LRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGT-DEVNVAASAHNISG  985
             L+  W  G Q I     Q   QS+GFFQPL  N   QIGY+ + T  ++    +A N++G
Sbjct  181   LQQPWGGGEQSITYG--QQHAQSQGFFQPLDCNSILQIGYDPITTSSQITAVTNAQNVNG  238

Query  986   FFPGWML  1006
               PGWML
Sbjct  239   MVPGWML  245



>gb|AHM92084.1| MADS-box protein 8 [Erycina pusilla]
Length=243

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 187/245 (76%), Gaps = 4/245 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LC+AEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             +SM+KTLERYQ+C+Y   E N  + +TQ++  EYL+LK RVE LQRSQRNLLGEDLGPL+
Sbjct  61    NSMLKTLERYQKCNYGAPETNVISRETQSSQQEYLKLKGRVENLQRSQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QL+ SLKQIRS +TQ MLDQLA+LQ+REQML E+NK L+R+LEE+    P 
Sbjct  121   SKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRLEESNQANPP  180

Query  812   RLSWEDGNQEIHQQNRQLP-PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             ++ W+         +RQ P P  + F+ PL    + QIGY S  T     A + HN    
Sbjct  181   QM-WDPSTAHAMGYDRQPPQPHGDAFYHPLECEPTLQIGYQSDLTIAPMAAPNVHNY--M  237

Query  989   FPGWM  1003
              PGW+
Sbjct  238   PPGWL  242



>ref|XP_010315869.1| PREDICTED: MADS-box protein isoform X1 [Solanum lycopersicum]
Length=247

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 193/248 (78%), Gaps = 4/248 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVAL++FSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT-QNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             ++M+KTL+RYQ+CSY  LE N+   D  Q++Y EYL+LKA+ E LQR QR+LLG++LGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRK-LEENVAGI  805
             +  +LE LE QL+ SLK IRS +TQ MLDQL++LQ +E++  E+NK+L RK +EE  A  
Sbjct  121   TIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKQMEEIYAEN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGT-DEVNVAASAHNIS  982
              ++ +W  G Q ++   +Q  PQS+GFFQPL  N S QIGY+ + T  ++    +A N++
Sbjct  181   NMQQAWGGGEQSLNYGQQQ-HPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVN  239

Query  983   GFFPGWML  1006
             G  PGWML
Sbjct  240   GMIPGWML  247



>ref|XP_009615088.1| PREDICTED: MADS-box protein CMB1-like isoform X1 [Nicotiana tomentosiformis]
Length=235

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 181/243 (74%), Gaps = 15/243 (6%)
 Frame = +2

Query  272  MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
            MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSN GKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNTGKLYEFCSS  60

Query  452  SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
            SSM  TLERY R +YA +E +QP++D+QN Y EYL LK RVE+LQ+SQR++LGEDLG LS
Sbjct  61   SSMPTTLERYHRYNYAAVEGSQPSTDSQNTYQEYLNLKTRVEMLQQSQRHVLGEDLGQLS  120

Query  632  TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             K+LEQLE QL++SL+QIRS +TQ MLDQL ELQQ E+ L E NK LR K EE   G+ L
Sbjct  121  NKDLEQLERQLDSSLRQIRSTRTQHMLDQLTELQQTEESLTEMNKSLRMKFEE--LGVAL  178

Query  812  RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
            + SW+ G Q           Q +GFF P+  N S  I YN+V  +  N   S  + +G  
Sbjct  179  QTSWQSGQQ-----------QPDGFFHPVASNNSMPIRYNTVLPE--NAEPSTQHATGVV  225

Query  992  PGW  1000
            PG+
Sbjct  226  PGY  228



>ref|XP_009131500.1| PREDICTED: developmental protein SEPALLATA 1-like [Brassica rapa]
 emb|CAD48303.1| MADS-box protein SEP1-a [Brassica oleracea var. botrytis]
 gb|AGT20510.1| SEP1.a [Brassica oleracea var. viridis]
Length=250

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 188/252 (75%), Gaps = 9/252 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTLERYQ+CSY  +E  N+PA + +N+Y EYL+LK R E LQR QRNLLGEDLGPL
Sbjct  61    SNMIKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYEGLQRQQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIP  808
             ++KELEQ+E QL+ SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++ +    
Sbjct  121   NSKELEQIERQLDGSLKQVRSIKTQYMLDQLSDLQTKEQMLLETNRALAMKLDDMIGVRS  180

Query  809   LRL-----SWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVAASA  970
               +      WE     +   + Q   QS+G FQPL  N + Q+GY N V ++++     A
Sbjct  181   HHMGGGGGGWEGNEHNVSYAHHQ--AQSQGLFQPLECNPTLQMGYDNPVCSEQITATTQA  238

Query  971   HNISGFFPGWML  1006
                 G+ P WML
Sbjct  239   QAQPGYIPDWML  250



>gb|AFO68785.1| floral-binding protein 9, partial [Erica x hiemalis]
Length=224

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 181/229 (79%), Gaps = 7/229 (3%)
 Frame = +2

Query  320   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQRCSYA  499
             RQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSN GKLYEFCSSSSM+KT+E+YQR SY 
Sbjct  1     RQVTFAKRRNGLLKKAYELSVLCDAEVALILFSNHGKLYEFCSSSSMLKTIEKYQRSSYG  60

Query  500   HLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLSTKELEQLENQLEASLK  679
              L+A Q  ++ QN Y EY+RLK RV++LQ+SQRNLLGEDLGPLST+ELEQLE+QLE SLK
Sbjct  61    PLDATQSVNENQNTYQEYVRLKTRVDILQQSQRNLLGEDLGPLSTRELEQLEHQLENSLK  120

Query  680   QIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPLRLSWEDGNQEIHQQNR  859
             +IRS KTQ MLDQLA+LQ++E+ML E+NK+L RKL+E         SWE G Q I   NR
Sbjct  121   KIRSTKTQGMLDQLADLQRKEEMLMEANKVLSRKLQEFANEASFGRSWEAGGQAI-SYNR  179

Query  860   QLPPQSEGFFQPLGLNISGQIGYNS-VGTDEVNVAASAHNISGFFPGWM  1003
              LPP +EG FQ   L+     GYN+ +GTDE N AA A N++GF PGWM
Sbjct  180   -LPPPAEGIFQTPTLH----NGYNNPMGTDEANGAAPAQNVNGFIPGWM  223



>gb|AIU94432.1| MADS-box transcription factor 2 isoform 3, partial [Musa acuminata]
Length=243

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 191/247 (77%), Gaps = 8/247 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKL+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + +TQ++  EYL+LKARVE LQRSQRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCNYGAPETNVISRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLE QL+ASL+QIRS +TQ MLDQL +LQ+REQML E+NK L+R+LEE+      
Sbjct  121   IKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKALKRRLEESNQANQQ  180

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNS---VGTDEVNVAASAHNIS  982
             +L W D N    QQ +   PQ +GFFQP+    + QIGY+            AA+  ++S
Sbjct  181   QL-W-DPNTYGRQQPQ---PQGDGFFQPIDCEPTLQIGYHPDQMAIAAAAAAAAAGPSVS  235

Query  983   GFFPGWM  1003
              + PGW+
Sbjct  236   NYVPGWL  242



>ref|XP_010913018.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Elaeis guineensis]
Length=234

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 191/246 (78%), Gaps = 15/246 (6%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E N  + +TQ +  EYL+LKARVE LQRSQRNLLG+DLGPLS
Sbjct  61    SSMLKTLERYQKCNYGAPETNIVSRETQTSQQEYLKLKARVEALQRSQRNLLGDDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QL+ASLKQIRS +TQ MLDQLA+LQ+REQML E+NK L+++LEE+      
Sbjct  121   SKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKQRLEESNQATQQ  180

Query  812   RLSWEDGNQEIHQQNRQLP-PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAAS-AHNISG  985
             ++ W D N       RQ P PQ +GF+Q        QI Y     +++ +AA+   ++S 
Sbjct  181   QV-W-DPNAPAVGYGRQPPQPQGDGFYQ--------QIEY---PPEQITIAAAPGPSVSN  227

Query  986   FFPGWM  1003
             + PGW+
Sbjct  228   YMPGWL  233



>ref|XP_003518786.1| PREDICTED: developmental protein SEPALLATA 1-like [Glycine max]
 gb|KHN29958.1| MADS-box protein CMB1 [Glycine soja]
Length=244

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 186/248 (75%), Gaps = 9/248 (4%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS 
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
              SM KTLERY RCSY  LE  +QP  +TQ  Y EYL+LK+RVE LQ++QRNLLGE+L  L
Sbjct  61    HSMAKTLERYHRCSYGALEVQHQPEIETQRRYQEYLKLKSRVEALQQTQRNLLGEELEHL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE-NVAGI  805
               K+LEQLE QL++SLKQIRS KTQ MLDQLA+L ++E+ML E+N +LR KLEE NVA  
Sbjct  121   DVKDLEQLERQLDSSLKQIRSNKTQQMLDQLADLHRKEEMLLETNNILRNKLEEINVALQ  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAA--SAHNI  979
             P   +WE   Q         P QSEG+++    N + +IGY+S G +E   AA  SA N 
Sbjct  181   P---TWETREQNAPYNYH--PSQSEGYYETAHCNSTLRIGYDSSGLNEAGGAAGTSAQNA  235

Query  980   SGFFPGWM  1003
             S F  GWM
Sbjct  236   SEFMNGWM  243



>gb|AEX92975.1| MADS box protein 2 [Agave tequilana]
Length=250

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 190/253 (75%), Gaps = 12/253 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQV+FAKRRNGLLKKAYELS+LCDAEVALIIFS+RG+L+EFCSS
Sbjct  1     MGRGRVELKRIENKINRQVSFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLFEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM KTLERYQ  S   L+A   + +TQN+Y EYL+LKAR ELLQ SQRNLLGEDLG LS
Sbjct  61    SSMFKTLERYQNSSNNTLKAMASSKETQNSYEEYLKLKARFELLQLSQRNLLGEDLGQLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             + ELEQLE+QLE SLKQIRS KTQ+ML QL +L++ EQML ++N+ LR KL+E     PL
Sbjct  121   SNELEQLESQLEMSLKQIRSSKTQNMLGQLCDLKREEQMLQDANRALRSKLQEIGPENPL  180

Query  812   RLSWEDGNQEIHQQ---------NRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAA  964
             +LSW++G                NRQ  PQ EGFFQPLG + S Q G++ V  D +N A 
Sbjct  181   QLSWQNGGGGGGGGGCAGTSAHCNRQ--PQPEGFFQPLGRDPSSQTGFSRVSMDHLNSAV  238

Query  965   SAHNISGFFPGWM  1003
             +  N++  F  WM
Sbjct  239   TNQNVNS-FRHWM  250



>ref|XP_002873742.1| hypothetical protein ARALYDRAFT_909555 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AAU82008.1| SEPALLATA1 [Arabidopsis lyrata subsp. petraea]
 gb|EFH50001.1| hypothetical protein ARALYDRAFT_909555 [Arabidopsis lyrata subsp. 
lyrata]
Length=249

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 156/251 (62%), Positives = 192/251 (76%), Gaps = 8/251 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTL+RYQ+CSY  +E  N+PA + +N+Y EYL+LK R E LQR QRNLLGEDLGPL
Sbjct  61    SNMLKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEE--NVAG  802
             ++KELEQLE QL+ SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++   V  
Sbjct  121   NSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRS  180

Query  803   IPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-NSVGTDEVNVAASAHNI  979
               +   WE G Q +   + Q   QS+G +QPL  N + Q+GY N V ++++     A   
Sbjct  181   HHMGGGWEGGEQNVTYAHHQ--AQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQ  238

Query  980   --SGFFPGWML  1006
               +G+ PGWML
Sbjct  239   QGNGYIPGWML  249



>emb|CDX69499.1| BnaA10g18480D [Brassica napus]
Length=264

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 193/265 (73%), Gaps = 21/265 (8%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEA-NQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPL  628
             S+M+KTLERYQ+CSY  +E  N+PA + +N+Y EYL+LK R E LQR QRNLLGEDLGPL
Sbjct  61    SNMIKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYESLQRQQRNLLGEDLGPL  120

Query  629   STKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVA---  799
             ++KELEQLE QL+ SLKQ+RS KTQ MLDQL++LQ +EQML E+N+ L  KL++ +    
Sbjct  121   NSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALAIKLDDMIGVRS  180

Query  800   -GIPLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGY-------------NSV  937
               +     WE   Q +  ++     QS+G FQPL  N + QIG+             N V
Sbjct  181   HHMGGGGGWEGNEQNVPYEHHH-QAQSQGLFQPLECNPTLQIGFLVLRGPYNLRWYDNPV  239

Query  938   GTDEVNVA--ASAHNISGFFPGWML  1006
             G++++     A A   +G+ PGWML
Sbjct  240   GSEQITTTTQAQAQPGNGYIPGWML  264



>gb|AAZ77748.1| AGL2-like MADS box 3 [Castanea mollissima]
Length=243

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 190/248 (77%), Gaps = 8/248 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VE+KRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVEVKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+CSY  +E N+P  + + +Y EYL+LKAR E LQR+QRNLLGEDLGPL+
Sbjct  61    SSMLKTLERYQKCSYGAVEVNKPGKELEISYREYLKLKARFESLQRTQRNLLGEDLGPLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             T +LE+LE QL++SLK+    + Q MLDQL++LQ +E +L E+N+ L  KL+E      L
Sbjct  121   TNDLERLERQLDSSLKKSGPLR-QYMLDQLSDLQNKEHLLVEANRALAIKLDEISPRNNL  179

Query  812   RLSWEDGNQEIH--QQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTD-EVNVAASAHNIS  982
             R SWE G Q +    QN      S+ FFQPL  N + QIGYN+ G+D +++    A  ++
Sbjct  180   RQSWEGGEQSMSYGPQN----AHSQSFFQPLDCNPTLQIGYNASGSDQQLSGTTHAQQVN  235

Query  983   GFFPGWML  1006
             GF PGWML
Sbjct  236   GFIPGWML  243



>emb|CBI27678.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 184/246 (75%), Gaps = 7/246 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT--QNNYHEYLRLKARVELLQRSQRNLLGEDLGP  625
             SSM+KTLERYQ+C+Y   E N    +    ++  EYL+LKAR E LQRSQRNLLGEDLGP
Sbjct  61    SSMLKTLERYQKCNYGAPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  626   LSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGI  805
             LSTKELE LE QL+ SLKQIRS +TQ MLDQL +LQ++E ML E+NK L+++L E     
Sbjct  121   LSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTLKQRLLEGTQVN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
               +L W    Q++    +Q  PQ +GFF PL    + QIGY     D + VAA+  +++ 
Sbjct  181   --QLQWNPNAQDVGYGRQQAQPQGDGFFHPLECEPTLQIGYQP---DPITVAAAGPSVNN  235

Query  986   FFPGWM  1003
             + PGW+
Sbjct  236   YMPGWL  241



>ref|XP_006848294.1| hypothetical protein AMTR_s00013p00103080 [Amborella trichopoda]
 gb|ERN09875.1| hypothetical protein AMTR_s00013p00103080 [Amborella trichopoda]
 gb|AIE44770.1| putative MADS-domain transcription factor AGL9 [Amborella trichopoda]
Length=241

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 182/244 (75%), Gaps = 8/244 (3%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGK YEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKQYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             SSM+KTLERYQ+C+Y   E      +TQ++  EYLRLKA  E LQRSQRNLLGEDLGPLS
Sbjct  61    SSMLKTLERYQKCNYGTQETTVSTKETQSSQQEYLRLKAHFEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELEQLE QL+ SLKQIRS KTQ M+DQLA+LQ++EQ L+ESN  L+RKLE   AG   
Sbjct  121   GKELEQLEQQLDMSLKQIRSIKTQYMIDQLADLQRKEQALSESNNALKRKLE--AAG---  175

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGFF  991
                W+    ++    +    Q++ FF PL  + + QIGY S   + + VAA   +++ F 
Sbjct  176   --GWDSTGHQMEYNRQPAQAQADNFFHPLECDPTLQIGYPSGYPNPITVAAPGPSVTNFM  233

Query  992   PGWM  1003
             P WM
Sbjct  234   P-WM  236



>ref|XP_010320555.1| PREDICTED: MADS-box transcription factor isoform X1 [Solanum 
lycopersicum]
Length=219

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 172/212 (81%), Gaps = 3/212 (1%)
 Frame = +2

Query  272  MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
            MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAE+ALIIFS+RGKLYEFCS+
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEIALIIFSSRGKLYEFCSN  60

Query  452  SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
            SSM KTLERY R +Y  LE  Q +SD+QNNY EYL+LK RVE+LQ+SQR+LLGEDLG L 
Sbjct  61   SSMSKTLERYHRYNYGTLEGTQTSSDSQNNYQEYLKLKTRVEMLQQSQRHLLGEDLGQLG  120

Query  632  TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
            TK+LEQLE QL++SL+QIRS KTQ +LDQLAELQQ+EQ L E NK LR KLEE   G+  
Sbjct  121  TKDLEQLERQLDSSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSLRIKLEE--LGVTF  178

Query  812  RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLN  907
            + SW  G Q +  ++ Q P   EGFFQ +  N
Sbjct  179  QTSWHCGEQSVQYRHEQ-PSHHEGFFQHVNCN  209



>gb|AAX15919.1| AGL2 [Eschscholzia californica]
Length=248

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 190/245 (78%), Gaps = 3/245 (1%)
 Frame = +2

Query  272  MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
            MGRG+VELKRIENKINRQVTFAKRRNG+LKKA+ELS+LCDAEVALIIFS+RGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGILKKAFELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  452  SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
            SS++KTLERYQRCS    +A++   D    Y  YL+LK+RVE+LQ++QRNLLG DL PLS
Sbjct  61   SSILKTLERYQRCSSNASQASRSIKDNDETYQNYLKLKSRVEVLQQNQRNLLGLDLEPLS  120

Query  632  TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             KEL+QLE+QLE SLKQ+ S KTQ MLD L++LQ +E++L E+N+ L RK+EEN+A IP 
Sbjct  121  LKELDQLESQLEVSLKQVTSTKTQFMLDNLSDLQTKEEVLQEANRSLNRKMEENMAEIPQ  180

Query  812  RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDE--VNVAASAHNISG  985
            +L WE G+      NR +P  ++GF+QPL  N + QIG +S+ + +   +   +  N+ G
Sbjct  181  QLRWEAGDGHNIPYNRHIPI-TDGFYQPLECNPTFQIGSSSMKSFDHLTDPPPTVQNLLG  239

Query  986  FFPGW  1000
            +FP W
Sbjct  240  YFPSW  244



>ref|XP_008360083.1| PREDICTED: MADS-box protein CMB1-like [Malus domestica]
Length=235

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 187/246 (76%), Gaps = 12/246 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS  GKLYEFCS 
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTSGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              S+ KTLER+QRC+Y  L A+Q A D Q+ Y EYL+LK +VE LQR+QR+LLGEDL  L 
Sbjct  61    PSIAKTLERHQRCTYGELGASQSAEDEQSRYQEYLKLKTKVEALQRTQRHLLGEDLVHLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKEL+QLENQL+ S+K+IRS KTQ M  Q++ELQ++E+ML E+N  LRRKLEE  AG   
Sbjct  121   TKELQQLENQLDVSMKKIRSTKTQFMHVQISELQRKEEMLLEANTGLRRKLEEITAG--H  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVA-ASAHNISGF  988
             + SW +GN   HQ       Q EGF + L  N + QIG   V  DE NVA +SA N +GF
Sbjct  179   QRSW-NGN---HQ-----AAQLEGFPEHLQYNNALQIGTPVVXNDEANVATSSAQNGTGF  229

Query  989   FPGWML  1006
             FPGWML
Sbjct  230   FPGWML  235



>ref|XP_008350888.1| PREDICTED: MADS-box protein CMB1-like [Malus domestica]
 gb|AAD51423.1|U78950_1 MADS-box protein 4 [Malus domestica]
Length=235

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 187/246 (76%), Gaps = 12/246 (5%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS  GKLYEFCS 
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTSGKLYEFCSG  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              S+ KTLER+QRC+Y  L A+Q A D Q+ Y EYL+LK +VE LQR+QR+LLGEDL  L 
Sbjct  61    PSIAKTLERHQRCTYGELGASQSAEDEQSRYQEYLKLKTKVEALQRTQRHLLGEDLVHLG  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             TKEL+QLENQL+ S+K+IRS KTQ M  Q++ELQ++E+ML E+N  LRRKLEE  AG   
Sbjct  121   TKELQQLENQLDVSMKKIRSTKTQFMHVQISELQRKEEMLLEANTGLRRKLEEITAG--H  178

Query  812   RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVA-ASAHNISGF  988
             + SW +GN   HQ       Q EGF + L  N + QIG   V  DE NVA +SA N +GF
Sbjct  179   QRSW-NGN---HQ-----AAQLEGFPEHLQYNNALQIGTPVVTNDEANVATSSAQNGTGF  229

Query  989   FPGWML  1006
             FPGWML
Sbjct  230   FPGWML  235



>gb|AHJ80843.1| SEPALLATA3 [Cymbidium goeringii]
Length=243

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 189/246 (77%), Gaps = 6/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSN  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
             +SMMKT+E+YQ+ +Y   E N  + +TQ++  EYL+LK+RVE LQRSQRNLLGEDLGPLS
Sbjct  61    NSMMKTIEKYQKSNYGAPETNVISRETQSSQQEYLKLKSRVEALQRSQRNLLGEDLGPLS  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
             +KELEQLE QL++SLKQIRS +TQ MLDQLA+LQ+REQML E+NK L+R+LEE+    P 
Sbjct  121   SKELEQLERQLDSSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRLEESNQANPQ  180

Query  812   RLSWEDGNQEIHQQNRQLP-PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISGF  988
             ++ W+         +RQ   P  + F+ PL    + QIGY S   D      +A N++ +
Sbjct  181   QI-WDPSTAHAMGYDRQPAQPHGDAFYHPLECEPTLQIGYQS---DLTIAPMAAANVNNY  236

Query  989   F-PGWM  1003
               PGW+
Sbjct  237   MPPGWL  242



>gb|AAF13262.1|AF198176_1 MADS box protein DOMADS3 [Dendrobium grex Madame Thong-In]
Length=220

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 178/221 (81%), Gaps = 3/221 (1%)
 Frame = +2

Query  272  MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRG+L+EFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLFEFCSS  60

Query  452  SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
            +SM KTLERYQ+CSY   E+  P+ D QN+YHEYL LKA+VE LQRSQ NLLGEDL  LS
Sbjct  61   TSMTKTLERYQKCSYNASESAVPSKDAQNSYHEYLTLKAKVEYLQRSQGNLLGEDLIELS  120

Query  632  TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
            +KEL+QLE QLE SLKQIRS KTQ MLDQL +++++EQML E+N+ L  KL+E+   IPL
Sbjct  121  SKELDQLELQLEMSLKQIRSTKTQLMLDQLCDIKRKEQMLHEANRALSMKLKEDGPEIPL  180

Query  812  RLSWEDGNQEIHQQNRQLPPQSEGFFQPLGL-NISGQIGYN  931
             LSW  G      + +Q  PQS+ FFQPL   N S QIGY+
Sbjct  181  ELSWPGGETNGSSERQQ--PQSDKFFQPLPCSNPSLQIGYS  219



>gb|ABC70706.1| MADS-box transcription factor [Asparagus virgatus]
Length=239

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 193/249 (78%), Gaps = 16/249 (6%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT---QNNYHEYLRLKARVELLQRSQRNLLGEDLG  622
             SSM+KTLERYQ+CSY   + +    ++   Q+++ EYLRLKARVE LQRSQRNLLGEDLG
Sbjct  61    SSMLKTLERYQKCSYGAPDTSVQIRESQMLQSSHQEYLRLKARVEALQRSQRNLLGEDLG  120

Query  623   PLSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAG  802
             PLS+KELEQLE QL++SLKQIRS +TQ MLDQLA+LQ+REQML E+N+ LR++LEE+   
Sbjct  121   PLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSLRKRLEESSQA  180

Query  803   IPLRLSWEDGNQEIHQQNRQLP--PQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHN  976
                ++ WED N   +  NRQ P  PQ + FF PL    + QIG+     D++       +
Sbjct  181   NQQQV-WEDANAMGY--NRQ-PNQPQGDQFFHPLECQPTLQIGFQ---PDQM----PGPS  229

Query  977   ISGFFPGWM  1003
             +S + PGW+
Sbjct  230   VSNYMPGWL  238



>ref|XP_009346321.1| PREDICTED: MADS-box protein CMB1-like [Pyrus x bretschneideri]
Length=248

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 194/248 (78%), Gaps = 3/248 (1%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRGKVE+KRIENK NRQVTF+KRRNGLLKKA+ELS+LCDAEVALIIFS RGKLYEF SS
Sbjct  1     MGRGKVEMKRIENKSNRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSGRGKLYEFSSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGPLS  631
              SMMKTLE+YQRCSY  L+AN+PA++TQN Y EYL+L+ RVE+LQ+SQRNLLGEDL  L+
Sbjct  61    LSMMKTLEKYQRCSYRSLDANRPANETQNGYQEYLQLETRVEVLQQSQRNLLGEDLATLN  120

Query  632   TKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGIPL  811
              KELE+LE+QLE SL +IRS KTQ MLDQL++LQ REQML E+NK LRRKLEE +   P 
Sbjct  121   KKELEELEHQLETSLNKIRSTKTQFMLDQLSDLQNREQMLVEANKALRRKLEETIEQAPQ  180

Query  812   RLSWE-DGNQEIHQQNRQLPPQSEGFFQPLGLNISG-QIGYNSVGT-DEVNVAASAHNIS  982
              ++WE  G+   + Q   LP  SE FF PLG N S  QIG   +G+ + +NV     + +
Sbjct  181   FMAWEAAGHGHNNIQQTWLPSNSEAFFHPLGGNNSTYQIGCTHLGSHNGMNVGNPGQHDN  240

Query  983   GFFPGWML  1006
             G+ PGWML
Sbjct  241   GYIPGWML  248



>gb|ABQ85951.1| MADS-box transcription factor SEP-like 2 [Trochodendron aralioides]
Length=244

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 180/246 (73%), Gaps = 5/246 (2%)
 Frame = +2

Query  272   MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  451
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS RGKLYEFCSS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCSS  60

Query  452   SSMMKTLERYQRCSYAHLEANQPASDT--QNNYHEYLRLKARVELLQRSQRNLLGEDLGP  625
             SSM KTLERYQ+C+Y   E +  A +T  Q++Y EYL+LKAR E LQRSQRNLLGEDLGP
Sbjct  61    SSMFKTLERYQKCNYTAPETDISARETLEQSSYQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  626   LSTKELEQLENQLEASLKQIRSRKTQSMLDQLAELQQREQMLAESNKLLRRKLEENVAGI  805
             LS KELE LE QL+ SLKQIRS +TQ MLDQL +LQ+ EQML+ESNK L R+LEE     
Sbjct  121   LSGKELESLERQLDVSLKQIRSIRTQCMLDQLTDLQRTEQMLSESNKNLARRLEEGSQAN  180

Query  806   PLRLSWEDGNQEIHQQNRQLPPQSEGFFQPLGLNISGQIGYNSVGTDEVNVAASAHNISG  985
               +           QQ     PQ +GFF PL    + QIGY     D++ V A   +++ 
Sbjct  181   AHQWDPNAHGMRYGQQPAHAHPQGDGFFHPLECEPTLQIGYQP---DQIAVMAPGPSVNN  237

Query  986   FFPGWM  1003
             + PGW+
Sbjct  238   YMPGWL  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3273381520216