BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18758_g1_i3 len=1983 path=[1961:0-522 2484:523-617 2579:618-1148
4609:1149-1150 3112:1151-1982]

Length=1983
                                                                      Score     E

ref|XP_009618078.1|  PREDICTED: xylosyltransferase 1-like isoform X1    558   0.0      
ref|XP_009771270.1|  PREDICTED: xylosyltransferase 1-like               557   0.0      
ref|XP_009758427.1|  PREDICTED: xylosyltransferase 1                    541   0.0      
ref|XP_006340918.1|  PREDICTED: xylosyltransferase 1-like               544   0.0      
ref|XP_002282998.1|  PREDICTED: xylosyltransferase 1                    543   0.0      Vitis vinifera
ref|XP_006355740.1|  PREDICTED: xylosyltransferase 1-like               542   0.0      
ref|XP_009606894.1|  PREDICTED: xylosyltransferase 1                    535   0.0      
ref|XP_004239872.1|  PREDICTED: xylosyltransferase 1-like               538   0.0      
ref|XP_004247943.1|  PREDICTED: xylosyltransferase 1                    532   0.0      
ref|XP_011073866.1|  PREDICTED: xylosyltransferase 1                    525   9e-178   
ref|XP_007034494.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    525   1e-177   
emb|CAN80510.1|  hypothetical protein VITISV_043589                     523   2e-176   Vitis vinifera
ref|XP_002518166.1|  transferase, transferring glycosyl groups, p...    518   8e-175   Ricinus communis
ref|XP_002299292.1|  glycosyltransferase family 14 family protein       509   2e-171   Populus trichocarpa [western balsam poplar]
ref|XP_011002162.1|  PREDICTED: xylosyltransferase 1-like               508   2e-171   
gb|EYU32613.1|  hypothetical protein MIMGU_mgv1a006803mg                504   7e-170   
emb|CDO99390.1|  unnamed protein product                                502   7e-169   
gb|KDP20340.1|  hypothetical protein JCGZ_06426                         502   8e-169   
ref|XP_006420517.1|  hypothetical protein CICLE_v10004926mg             502   3e-168   
ref|XP_004134387.1|  PREDICTED: xylosyltransferase-like                 499   3e-167   
ref|XP_006492148.1|  PREDICTED: uncharacterized protein LOC102619366    496   7e-166   
gb|KDO43049.1|  hypothetical protein CISIN_1g012284mg                   494   2e-165   
gb|KEH41216.1|  core-2/I-branching enzyme                               493   2e-165   
ref|XP_008438407.1|  PREDICTED: uncharacterized protein LOC103483514    494   3e-165   
ref|XP_010264011.1|  PREDICTED: xylosyltransferase 1                    493   3e-165   
ref|XP_010245653.1|  PREDICTED: xylosyltransferase 1-like               492   3e-164   
ref|XP_004157711.1|  PREDICTED: xylosyltransferase 1-like               488   3e-163   
ref|XP_004497742.1|  PREDICTED: xylosyltransferase 1-like               488   3e-163   
ref|XP_010025822.1|  PREDICTED: xylosyltransferase 1                    483   3e-162   
ref|XP_008223996.1|  PREDICTED: xylosyltransferase 1                    485   4e-162   
ref|XP_009362054.1|  PREDICTED: xylosyltransferase 1-like               486   4e-162   
gb|KHG13957.1|  Xylosyltransferase 1                                    484   7e-162   
ref|XP_009365478.1|  PREDICTED: xylosyltransferase 1-like               485   7e-162   
ref|XP_008352918.1|  PREDICTED: xylosyltransferase 1-like               484   1e-161   
ref|XP_010097995.1|  Xylosyltransferase 1                               481   1e-160   
ref|XP_006589051.1|  PREDICTED: xylosyltransferase 2-like               479   7e-160   
ref|XP_004309761.1|  PREDICTED: xylosyltransferase 1-like               476   2e-158   
ref|XP_010666470.1|  PREDICTED: xylosyltransferase                      473   2e-157   
ref|XP_002883496.1|  glycosyltransferase family 14 protein              469   2e-156   
ref|XP_007145422.1|  hypothetical protein PHAVU_007G237800g             466   7e-155   
ref|XP_010466793.1|  PREDICTED: xylosyltransferase 2-like isoform X1    465   9e-155   
emb|CDY46346.1|  BnaC01g30240D                                          464   4e-154   
ref|XP_010488505.1|  PREDICTED: xylosyltransferase 2-like               463   6e-154   
gb|KFK39705.1|  glycosyltransferase family 14 protein                   462   1e-153   
ref|XP_009106072.1|  PREDICTED: uncharacterized protein LOC103831886    462   1e-153   
ref|NP_189046.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    462   2e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006420516.1|  hypothetical protein CICLE_v10004926mg             463   2e-153   
gb|AAS99698.1|  At3g24040                                               462   2e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297731.1|  hypothetical protein CARUB_v10013765mg             462   2e-153   
emb|CDY18061.1|  BnaA01g23220D                                          461   7e-153   
ref|XP_006418794.1|  hypothetical protein EUTSA_v10002511mg             462   1e-152   
ref|XP_010513276.1|  PREDICTED: xylosyltransferase 2-like isoform X2    458   5e-152   
ref|XP_007221796.1|  hypothetical protein PRUPE_ppa006063mg             458   1e-151   
ref|XP_009396136.1|  PREDICTED: xylosyltransferase 1                    446   6e-147   
ref|XP_008804738.1|  PREDICTED: xylosyltransferase 1-like               442   7e-146   
ref|XP_010933192.1|  PREDICTED: beta-1,3-galactosyl-O-glycosyl-gl...    431   7e-141   
gb|KCW57309.1|  hypothetical protein EUGRSUZ_H00106                     422   1e-139   
ref|XP_008808451.1|  PREDICTED: xylosyltransferase 1-like               419   9e-137   
ref|XP_004987178.1|  PREDICTED: xylosyltransferase 1-like               410   4e-134   
ref|XP_006854275.1|  hypothetical protein AMTR_s00039p00066770          407   3e-131   
gb|ADE76377.1|  unknown                                                 399   5e-129   
ref|XP_010918856.1|  PREDICTED: xylosyltransferase 1-like               396   1e-127   
ref|XP_002965647.1|  glycosyltransferase CAZy family 14                 395   3e-127   
ref|XP_002468516.1|  hypothetical protein SORBIDRAFT_01g047240          392   3e-126   Sorghum bicolor [broomcorn]
ref|XP_010253319.1|  PREDICTED: xylosyltransferase-like isoform X1      385   2e-123   
gb|ABR16364.1|  unknown                                                 382   2e-122   Picea sitchensis
gb|ABK26987.1|  unknown                                                 380   2e-121   Picea sitchensis
ref|XP_001778780.1|  predicted protein                                  379   2e-121   
ref|XP_001782405.1|  predicted protein                                  379   3e-121   
gb|ABK24335.1|  unknown                                                 380   4e-121   Picea sitchensis
ref|XP_002284096.1|  PREDICTED: xylosyltransferase 1                    378   7e-121   Vitis vinifera
ref|XP_009618079.1|  PREDICTED: uncharacterized protein LOC104110...    372   2e-120   
gb|EPS68967.1|  hypothetical protein M569_05800                         370   6e-119   
emb|CDY30282.1|  BnaC04g31930D                                          372   3e-118   
ref|XP_009125126.1|  PREDICTED: xylosyltransferase 1-like               372   3e-118   
ref|XP_008446701.1|  PREDICTED: xylosyltransferase 1                    369   1e-117   
ref|XP_008644297.1|  PREDICTED: uncharacterized protein LOC100383...    370   1e-117   
ref|XP_001774021.1|  predicted protein                                  370   1e-117   
ref|XP_004135058.1|  PREDICTED: xylosyltransferase 1-like               369   1e-117   
ref|NP_198815.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    370   3e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007027048.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    369   4e-117   
ref|XP_004159283.1|  PREDICTED: xylosyltransferase 1-like               368   4e-117   
ref|XP_007151184.1|  hypothetical protein PHAVU_004G025100g             369   5e-117   
ref|XP_006405565.1|  hypothetical protein EUTSA_v10027776mg             369   7e-117   
ref|XP_002870736.1|  glycosyltransferase family 14 protein              368   1e-116   
ref|XP_010230278.1|  PREDICTED: xylosyltransferase 1                    365   2e-116   
emb|CDX67446.1|  BnaA07g14860D                                          367   2e-116   
emb|CDX74413.1|  BnaA04g09760D                                          367   2e-116   
ref|XP_010527488.1|  PREDICTED: xylosyltransferase 2                    360   4e-116   
ref|XP_010066647.1|  PREDICTED: xylosyltransferase 1                    365   5e-116   
ref|XP_010496515.1|  PREDICTED: xylosyltransferase 1-like isoform X1    366   9e-116   
emb|CDY11668.1|  BnaC06g12760D                                          365   1e-115   
ref|XP_006285970.1|  hypothetical protein CARUB_v10007491mg             365   2e-115   
ref|XP_010666906.1|  PREDICTED: xylosyltransferase 2                    364   2e-115   
ref|XP_010466794.1|  PREDICTED: xylosyltransferase 2-like isoform X2    358   2e-115   
ref|XP_010496516.1|  PREDICTED: xylosyltransferase 1-like isoform X2    364   3e-115   
gb|KFK33164.1|  hypothetical protein AALP_AA6G338800                    364   4e-115   
ref|XP_004302748.1|  PREDICTED: xylosyltransferase 2-like               363   6e-115   
ref|XP_011094845.1|  PREDICTED: xylosyltransferase 2                    361   2e-114   
ref|XP_010450743.1|  PREDICTED: xylosyltransferase 1-like               362   2e-114   
ref|XP_010435960.1|  PREDICTED: xylosyltransferase 1-like               362   2e-114   
ref|XP_002531062.1|  acetylglucosaminyltransferase, putative            360   2e-114   Ricinus communis
ref|XP_009374686.1|  PREDICTED: xylosyltransferase 2-like isoform X4    361   3e-114   
gb|EYU34686.1|  hypothetical protein MIMGU_mgv1a006669mg                362   3e-114   
ref|XP_010531794.1|  PREDICTED: xylosyltransferase 1                    362   3e-114   
ref|XP_006482519.1|  PREDICTED: xylosyltransferase 1-like               361   3e-114   
ref|XP_002960850.1|  glycosyltransferase CAZy family GT14               360   4e-114   
dbj|BAD43851.1|  unknown protein                                        355   5e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004147458.1|  PREDICTED: xylosyltransferase 1-like               361   5e-114   
ref|XP_007222964.1|  hypothetical protein PRUPE_ppa006761mg             360   6e-114   
gb|KDP35617.1|  hypothetical protein JCGZ_09055                         360   7e-114   
ref|XP_008243337.1|  PREDICTED: xylosyltransferase 1                    359   7e-114   
ref|XP_009139946.1|  PREDICTED: xylosyltransferase 1                    360   1e-113   
ref|XP_010272183.1|  PREDICTED: xylosyltransferase 2                    359   2e-113   
ref|XP_008230710.1|  PREDICTED: xylosyltransferase 1                    359   2e-113   
ref|XP_008452258.1|  PREDICTED: xylosyltransferase 1-like               358   2e-113   
ref|XP_008443440.1|  PREDICTED: xylosyltransferase 1-like               359   2e-113   
ref|XP_001767086.1|  predicted protein                                  357   2e-113   
gb|KDP38031.1|  hypothetical protein JCGZ_04674                         358   3e-113   
ref|XP_007215424.1|  hypothetical protein PRUPE_ppa006088mg             359   3e-113   
ref|XP_010033225.1|  PREDICTED: xylosyltransferase 1                    359   3e-113   
ref|XP_010654300.1|  PREDICTED: xylosyltransferase                      358   3e-113   
gb|KHG30757.1|  Xylosyltransferase 2                                    358   4e-113   
ref|XP_006856751.1|  hypothetical protein AMTR_s00055p00031110          358   5e-113   
ref|XP_009614444.1|  PREDICTED: xylosyltransferase 1-like               358   5e-113   
ref|XP_010513272.1|  PREDICTED: xylosyltransferase 2-like isoform X1    352   6e-113   
ref|NP_001077453.1|  core-2/I-branching beta-1,6-N-acetylglucosam...    355   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009795975.1|  PREDICTED: xylosyltransferase 1-like               357   1e-112   
ref|XP_010091911.1|  Xylosyltransferase 1                               357   1e-112   
ref|XP_007205349.1|  hypothetical protein PRUPE_ppa007142mg             356   1e-112   
ref|XP_006846117.1|  hypothetical protein AMTR_s00012p00140940          355   1e-112   
ref|XP_004302366.1|  PREDICTED: xylosyltransferase 1-like               357   1e-112   
ref|XP_011008364.1|  PREDICTED: xylosyltransferase 1                    357   1e-112   
ref|XP_004238858.1|  PREDICTED: xylosyltransferase 1                    356   1e-112   
ref|XP_002324028.1|  hypothetical protein POPTR_0017s11200g             357   2e-112   Populus trichocarpa [western balsam poplar]
gb|ABK25159.1|  unknown                                                 357   2e-112   Picea sitchensis
ref|XP_009764786.1|  PREDICTED: xylosyltransferase 1                    355   2e-112   
ref|XP_002273459.1|  PREDICTED: xylosyltransferase                      356   2e-112   Vitis vinifera
ref|XP_006841769.1|  hypothetical protein AMTR_s00003p00265190          357   2e-112   
ref|XP_003543654.1|  PREDICTED: xylosyltransferase 1-like isoform X1    356   3e-112   
ref|XP_006468827.1|  PREDICTED: xylosyltransferase 1-like isoform X2    355   3e-112   
ref|XP_010268807.1|  PREDICTED: xylosyltransferase 1-like               357   3e-112   
ref|XP_008241149.1|  PREDICTED: xylosyltransferase                      356   3e-112   
ref|XP_011023083.1|  PREDICTED: xylosyltransferase 1-like               355   3e-112   
ref|XP_004489366.1|  PREDICTED: xylosyltransferase-like                 356   3e-112   
ref|XP_009602042.1|  PREDICTED: xylosyltransferase 1-like isoform X3    356   3e-112   
ref|XP_007045076.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    355   4e-112   
ref|XP_004232249.1|  PREDICTED: xylosyltransferase 1-like               355   5e-112   
gb|AES74697.2|  BGGP beta-1-3-galactosyl-O-glycosyl-glycoprotein        355   6e-112   
gb|KDO47185.1|  hypothetical protein CISIN_1g015219mg                   354   8e-112   
ref|XP_009357743.1|  PREDICTED: xylosyltransferase 1-like               354   9e-112   
ref|XP_002282083.1|  PREDICTED: xylosyltransferase 1                    355   1e-111   Vitis vinifera
ref|XP_008379320.1|  PREDICTED: xylosyltransferase 1                    355   1e-111   
gb|KGN56245.1|  hypothetical protein Csa_3G105970                       353   1e-111   
ref|XP_004155231.1|  PREDICTED: xylosyltransferase 1-like               353   1e-111   
ref|XP_008368205.1|  PREDICTED: xylosyltransferase 1-like               353   1e-111   
gb|KDO72430.1|  hypothetical protein CISIN_1g037238mg                   353   2e-111   
ref|XP_008389227.1|  PREDICTED: xylosyltransferase 1                    352   3e-111   
ref|XP_006344216.1|  PREDICTED: xylosyltransferase 1-like               353   3e-111   
ref|NP_171851.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    354   3e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006448296.1|  hypothetical protein CICLE_v10015447mg             352   3e-111   
ref|XP_006400024.1|  hypothetical protein EUTSA_v10013590mg             353   4e-111   
ref|XP_009126027.1|  PREDICTED: xylosyltransferase 1                    353   4e-111   
ref|XP_006338492.1|  PREDICTED: xylosyltransferase 1-like               353   4e-111   
ref|XP_010681688.1|  PREDICTED: xylosyltransferase 1                    352   4e-111   
ref|XP_002873705.1|  glycosyltransferase family 14 protein              353   4e-111   
gb|KDP45456.1|  hypothetical protein JCGZ_09705                         353   4e-111   
ref|XP_006431054.1|  hypothetical protein CICLE_v10011781mg             353   5e-111   
ref|NP_197009.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    353   5e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517446.1|  acetylglucosaminyltransferase, putative            353   6e-111   Ricinus communis
ref|XP_007032419.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    353   6e-111   
ref|XP_009356160.1|  PREDICTED: xylosyltransferase 1-like               352   7e-111   
ref|XP_009622073.1|  PREDICTED: xylosyltransferase 1                    352   7e-111   
ref|XP_001772325.1|  predicted protein                                  350   8e-111   
ref|XP_009335809.1|  PREDICTED: xylosyltransferase 1                    352   9e-111   
ref|XP_009402140.1|  PREDICTED: xylosyltransferase 1-like               353   1e-110   
ref|XP_010492328.1|  PREDICTED: xylosyltransferase 1-like               352   1e-110   
ref|XP_006480797.1|  PREDICTED: xylosyltransferase 2-like               351   2e-110   
ref|XP_006602896.1|  PREDICTED: xylosyltransferase 1-like               352   2e-110   
ref|XP_010670346.1|  PREDICTED: xylosyltransferase 1-like               352   2e-110   
ref|XP_002305329.1|  hypothetical protein POPTR_0004s13530g             351   4e-110   Populus trichocarpa [western balsam poplar]
ref|XP_006307501.1|  hypothetical protein CARUB_v10009126mg             351   5e-110   
ref|XP_004297352.1|  PREDICTED: xylosyltransferase 1-like               349   5e-110   
ref|XP_011010552.1|  PREDICTED: xylosyltransferase 1-like               350   5e-110   
ref|XP_010253215.1|  PREDICTED: xylosyltransferase 2                    350   6e-110   
ref|XP_010550094.1|  PREDICTED: xylosyltransferase 1                    350   6e-110   
ref|XP_009768779.1|  PREDICTED: xylosyltransferase 1-like               350   7e-110   
ref|XP_009628555.1|  PREDICTED: xylosyltransferase 2                    349   8e-110   
ref|XP_010457360.1|  PREDICTED: xylosyltransferase 1-like               350   9e-110   
ref|XP_008808722.1|  PREDICTED: xylosyltransferase 1-like               350   9e-110   
ref|XP_006287781.1|  hypothetical protein CARUB_v10000991mg             350   1e-109   
ref|XP_003536629.1|  PREDICTED: xylosyltransferase 1-like               348   1e-109   
ref|XP_009419944.1|  PREDICTED: xylosyltransferase 1-like               348   1e-109   
ref|XP_010453634.1|  PREDICTED: xylosyltransferase 1-like isoform X1    349   2e-109   
ref|XP_011098560.1|  PREDICTED: xylosyltransferase 1-like               349   2e-109   
ref|XP_006593666.1|  PREDICTED: xylosyltransferase 1-like isoform X2    348   2e-109   
ref|XP_010474977.1|  PREDICTED: xylosyltransferase 1-like               349   3e-109   
gb|KFK25741.1|  hypothetical protein AALP_AA8G153800                    348   3e-109   
ref|XP_009602040.1|  PREDICTED: xylosyltransferase 1-like isoform X1    348   4e-109   
ref|XP_009409889.1|  PREDICTED: xylosyltransferase 1-like               349   4e-109   
ref|XP_007134036.1|  hypothetical protein PHAVU_010G014000g             348   4e-109   
ref|XP_010482174.1|  PREDICTED: xylosyltransferase 1-like               349   4e-109   
ref|XP_006468826.1|  PREDICTED: xylosyltransferase 1-like isoform X1    347   5e-109   
emb|CDP00744.1|  unnamed protein product                                347   5e-109   
ref|XP_010062325.1|  PREDICTED: xylosyltransferase                      347   6e-109   
ref|NP_001242791.1|  uncharacterized protein LOC100813028 precursor     347   6e-109   
ref|XP_006605954.1|  PREDICTED: xylosyltransferase 1-like               347   6e-109   
ref|XP_010934023.1|  PREDICTED: xylosyltransferase 1-like               348   6e-109   
ref|XP_004246431.1|  PREDICTED: xylosyltransferase 2                    347   7e-109   
ref|XP_003577681.1|  PREDICTED: xylosyltransferase 2-like               347   7e-109   
ref|XP_010658623.1|  PREDICTED: xylosyltransferase 1-like               346   8e-109   
emb|CDY63764.1|  BnaCnng42580D                                          347   1e-108   
ref|XP_009604692.1|  PREDICTED: xylosyltransferase 2-like               347   1e-108   
ref|XP_002527729.1|  acetylglucosaminyltransferase, putative            345   2e-108   Ricinus communis
ref|XP_008341525.1|  PREDICTED: xylosyltransferase 1-like               346   2e-108   
ref|XP_009758526.1|  PREDICTED: xylosyltransferase 2                    346   2e-108   
emb|CDP02181.1|  unnamed protein product                                346   2e-108   
gb|EYU24912.1|  hypothetical protein MIMGU_mgv1a022320mg                346   3e-108   
ref|XP_003633289.2|  PREDICTED: xylosyltransferase 1                    346   3e-108   
ref|XP_002319376.2|  glycosyltransferase family 14 family protein       346   3e-108   Populus trichocarpa [western balsam poplar]
ref|XP_004235090.2|  PREDICTED: xylosyltransferase 1-like               346   3e-108   
ref|XP_007153286.1|  hypothetical protein PHAVU_003G022600g             345   3e-108   
ref|XP_003604961.1|  Xylosyltransferase                                 345   4e-108   
ref|XP_011045463.1|  PREDICTED: xylosyltransferase 1-like               346   4e-108   
ref|XP_008662662.1|  PREDICTED: xylosyltransferase 1                    347   4e-108   
ref|XP_009104929.1|  PREDICTED: xylosyltransferase 1-like               344   5e-108   
gb|KHN19785.1|  Xylosyltransferase 2                                    345   6e-108   
gb|KDO64720.1|  hypothetical protein CISIN_1g039162mg                   344   6e-108   
gb|EPS61904.1|  hypothetical protein M569_12889                         345   6e-108   
ref|XP_006448297.1|  hypothetical protein CICLE_v10015447mg             344   6e-108   
emb|CAN64646.1|  hypothetical protein VITISV_030959                     344   8e-108   Vitis vinifera
ref|XP_010255890.1|  PREDICTED: xylosyltransferase 1-like               345   9e-108   
ref|XP_004963343.1|  PREDICTED: xylosyltransferase 1-like               344   1e-107   
ref|XP_002892166.1|  glycosyltransferase family 14 protein              345   1e-107   
ref|XP_007143027.1|  hypothetical protein PHAVU_007G037400g             343   1e-107   
ref|XP_010256416.1|  PREDICTED: xylosyltransferase 1-like               343   1e-107   
ref|XP_010278355.1|  PREDICTED: xylosyltransferase 1-like               345   1e-107   
ref|XP_009784590.1|  PREDICTED: xylosyltransferase 2-like               343   2e-107   
gb|ABF70128.1|  glycosyl transferase family 14 protein                  343   2e-107   Musa balbisiana [starchy banana]
ref|XP_004496976.1|  PREDICTED: xylosyltransferase 1-like               342   2e-107   
ref|XP_010427921.1|  PREDICTED: xylosyltransferase 1-like               342   3e-107   
ref|XP_009389364.1|  PREDICTED: xylosyltransferase oxt-like             343   3e-107   
emb|CDX72774.1|  BnaC06g32220D                                          342   4e-107   
gb|AAS88559.1|  glycosylation enzyme-like protein                       343   5e-107   Triticum monococcum [einkorn wheat]
ref|XP_010556817.1|  PREDICTED: xylosyltransferase 1                    343   6e-107   
ref|XP_006447365.1|  hypothetical protein CICLE_v10015218mg             343   6e-107   
emb|CAH10066.1|  BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein       342   6e-107   Triticum turgidum [cone wheat]
ref|XP_010552730.1|  PREDICTED: xylosyltransferase 1                    341   7e-107   
ref|XP_011100343.1|  PREDICTED: xylosyltransferase 1-like               342   9e-107   
gb|ACO87683.1|  b-1-3-galactosyl-o-glycosyl-glycoprotein                342   1e-106   Brachypodium sylvaticum
ref|XP_004506594.1|  PREDICTED: xylosyltransferase 2-like               341   1e-106   
ref|XP_008784524.1|  PREDICTED: xylosyltransferase 1-like               341   1e-106   
ref|XP_010920618.1|  PREDICTED: xylosyltransferase 1-like isoform X1    341   1e-106   
ref|XP_009105776.1|  PREDICTED: xylosyltransferase 1                    340   2e-106   
gb|KHF98898.1|  Xylosyltransferase 1                                    342   2e-106   
emb|CDY49224.1|  BnaCnng17130D                                          340   2e-106   
emb|CDX68326.1|  BnaA07g23660D                                          340   2e-106   
ref|XP_002311492.1|  glycosyltransferase family 14 family protein       340   2e-106   Populus trichocarpa [western balsam poplar]
emb|CAH10058.1|  BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein       341   2e-106   Triticum turgidum [cone wheat]
gb|EYU34119.1|  hypothetical protein MIMGU_mgv1a006718mg                341   3e-106   
gb|AAV49991.1|  putative N-acetylglucosaminyltransferase                341   3e-106   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009119535.1|  PREDICTED: xylosyltransferase 1                    341   3e-106   
ref|XP_010471112.1|  PREDICTED: xylosyltransferase 1-like               339   3e-106   
ref|XP_010415803.1|  PREDICTED: xylosyltransferase 1-like               339   3e-106   
ref|XP_002888820.1|  glycosyltransferase family 14 protein              339   3e-106   
ref|NP_001067391.1|  Os12g0639700                                       340   3e-106   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001241920.1|  uncharacterized protein LOC100795146               340   3e-106   
ref|XP_002872787.1|  glycosyltransferase family 14 protein              341   4e-106   
ref|XP_006342309.1|  PREDICTED: xylosyltransferase 1-like               340   4e-106   
ref|XP_003533110.1|  PREDICTED: xylosyltransferase 1-like               339   5e-106   
ref|XP_010916335.1|  PREDICTED: xylosyltransferase 1-like               340   5e-106   
ref|XP_009389597.1|  PREDICTED: xylosyltransferase 1-like               340   6e-106   
emb|CAH10050.1|  BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein       340   7e-106   Triticum aestivum [Canadian hard winter wheat]
emb|CDY64128.1|  BnaCnng43180D                                          340   7e-106   
ref|XP_003592541.1|  Xylosyltransferase                                 338   8e-106   
ref|XP_010921995.1|  PREDICTED: xylosyltransferase 1-like               340   1e-105   
gb|KDO43793.1|  hypothetical protein CISIN_1g013052mg                   340   1e-105   
gb|KDP24182.1|  hypothetical protein JCGZ_25839                         339   1e-105   
ref|XP_009595236.1|  PREDICTED: xylosyltransferase 1-like               338   3e-105   
emb|CAH05144.1|  BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein       338   4e-105   
gb|EPS70081.1|  hypothetical protein M569_04677                         337   5e-105   
tpg|DAA43344.1|  TPA: hypothetical protein ZEAMMB73_099523              336   5e-105   
gb|KFK41531.1|  hypothetical protein AALP_AA2G141600                    336   6e-105   
ref|XP_004137771.1|  PREDICTED: xylosyltransferase-like                 337   6e-105   
ref|XP_008811440.1|  PREDICTED: xylosyltransferase 1-like               337   6e-105   
ref|NP_565009.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    336   6e-105   
ref|XP_006396561.1|  hypothetical protein EUTSA_v10028669mg             337   6e-105   
ref|XP_007043504.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    338   7e-105   
ref|XP_010260213.1|  PREDICTED: xylosyltransferase 2-like               337   7e-105   
ref|XP_004172915.1|  PREDICTED: LOW QUALITY PROTEIN: xylosyltrans...    337   7e-105   
ref|XP_009380312.1|  PREDICTED: xylosyltransferase 1-like               336   8e-105   
ref|XP_009134360.1|  PREDICTED: xylosyltransferase 1 isoform X1         337   8e-105   
ref|XP_002442623.1|  hypothetical protein SORBIDRAFT_08g023170          337   8e-105   
ref|XP_008230227.1|  PREDICTED: xylosyltransferase 1                    337   9e-105   
ref|XP_007217728.1|  hypothetical protein PRUPE_ppa005952mg             337   1e-104   
gb|KHN41152.1|  Xylosyltransferase 1                                    335   2e-104   
ref|XP_010095819.1|  Xylosyltransferase 1                               336   2e-104   
ref|XP_008813401.1|  PREDICTED: xylosyltransferase 1-like               337   2e-104   
ref|XP_004507207.1|  PREDICTED: xylosyltransferase 1-like isoform X1    336   2e-104   
ref|XP_011038682.1|  PREDICTED: xylosyltransferase 1                    335   2e-104   
gb|ACN27730.1|  unknown                                                 333   2e-104   
gb|KFK42703.1|  hypothetical protein AALP_AA1G029100                    336   3e-104   
ref|XP_006378457.1|  hypothetical protein POPTR_0010s12510g             334   3e-104   
gb|KHN03145.1|  Xylosyltransferase 1                                    333   4e-104   
ref|XP_003527451.1|  PREDICTED: xylosyltransferase 1-like isoform X1    335   5e-104   
ref|XP_010924638.1|  PREDICTED: xylosyltransferase oxt-like             335   5e-104   
ref|XP_003636628.1|  Beta-1,3-galactosyl-O-glycosyl-glycoprotein ...    335   6e-104   
ref|XP_010420154.1|  PREDICTED: xylosyltransferase 1-like               335   8e-104   
ref|XP_006299496.1|  hypothetical protein CARUB_v10015665mg             334   9e-104   
ref|XP_008799485.1|  PREDICTED: xylosyltransferase 1-like isoform X1    333   1e-103   
ref|XP_008442560.1|  PREDICTED: xylosyltransferase                      333   1e-103   
ref|NP_001130420.1|  uncharacterized protein LOC100191516               334   1e-103   
ref|XP_009758356.1|  PREDICTED: xylosyltransferase 1-like               335   1e-103   
ref|XP_006413070.1|  hypothetical protein EUTSA_v10025300mg             333   1e-103   
emb|CDY67975.1|  BnaC04g53600D                                          332   2e-103   
emb|CDP00036.1|  unnamed protein product                                332   2e-103   
ref|XP_010676853.1|  PREDICTED: xylosyltransferase 1-like               333   2e-103   
gb|AFI41914.1|  glycosyltransferase family 14 protein                   333   3e-103   
ref|XP_009411989.1|  PREDICTED: xylosyltransferase 1-like               333   4e-103   
ref|XP_006357515.1|  PREDICTED: xylosyltransferase 1-like               333   4e-103   
ref|XP_002309670.2|  hypothetical protein POPTR_0006s27890g             333   4e-103   
ref|XP_011039578.1|  PREDICTED: xylosyltransferase-like                 332   4e-103   
ref|NP_192243.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    333   5e-103   
ref|XP_011031470.1|  PREDICTED: xylosyltransferase-like                 332   5e-103   
ref|XP_010035683.1|  PREDICTED: xylosyltransferase 1                    332   5e-103   
emb|CDP14718.1|  unnamed protein product                                329   6e-103   
ref|XP_008811974.1|  PREDICTED: xylosyltransferase 1-like isoform X2    332   7e-103   
ref|XP_009115628.1|  PREDICTED: xylosyltransferase 2-like               332   7e-103   
ref|XP_006287734.1|  hypothetical protein CARUB_v10000946mg             333   7e-103   
ref|XP_010430941.1|  PREDICTED: xylosyltransferase 1-like               333   8e-103   
ref|XP_003529207.1|  PREDICTED: xylosyltransferase 1-like               331   8e-103   
ref|XP_009127844.1|  PREDICTED: xylosyltransferase 1-like               330   8e-103   
ref|XP_010502768.1|  PREDICTED: xylosyltransferase 2-like               332   8e-103   
ref|XP_008792272.1|  PREDICTED: xylosyltransferase oxt-like             332   9e-103   
gb|AEG66933.1|  N-acetylglucosaminyltransferase                         332   1e-102   
emb|CDY20123.1|  BnaA01g28790D                                          331   1e-102   
ref|XP_002517977.1|  acetylglucosaminyltransferase, putative            332   1e-102   
emb|CDY17949.1|  BnaC03g30210D                                          338   1e-102   
ref|XP_010929350.1|  PREDICTED: xylosyltransferase 1-like isoform X1    330   1e-102   
ref|XP_009393513.1|  PREDICTED: xylosyltransferase 1-like               332   2e-102   
emb|CDX74948.1|  BnaA05g06940D                                          329   2e-102   
emb|CDX96300.1|  BnaA07g29110D                                          330   2e-102   
emb|CDY21833.1|  BnaC01g36150D                                          330   2e-102   
ref|XP_006341039.1|  PREDICTED: xylosyltransferase 2-like               330   2e-102   
emb|CDX90889.1|  BnaA03g25690D                                          342   3e-102   
emb|CDY69722.1|  BnaCnng64970D                                          330   3e-102   
ref|XP_010455902.1|  PREDICTED: xylosyltransferase 1-like               331   3e-102   
emb|CDY03703.1|  BnaA02g15340D                                          329   3e-102   
ref|XP_010487354.1|  PREDICTED: xylosyltransferase 2-like               330   3e-102   
ref|XP_010051619.1|  PREDICTED: xylosyltransferase 1-like               330   3e-102   
ref|XP_002315896.2|  glycosyltransferase family 14 family protein       329   3e-102   
ref|XP_009625380.1|  PREDICTED: xylosyltransferase 2-like isoform X1    330   4e-102   
ref|XP_010465488.1|  PREDICTED: xylosyltransferase 2                    330   4e-102   
ref|XP_004243326.1|  PREDICTED: xylosyltransferase 1                    330   4e-102   
emb|CDX97386.1|  BnaC08g12510D                                          329   4e-102   
gb|KDP39639.1|  hypothetical protein JCGZ_02659                         329   4e-102   
ref|XP_010924137.1|  PREDICTED: xylosyltransferase 1-like               329   5e-102   
ref|XP_009610027.1|  PREDICTED: xylosyltransferase 1-like               330   5e-102   
ref|XP_007132639.1|  hypothetical protein PHAVU_011G112200g             330   5e-102   
ref|XP_004304115.1|  PREDICTED: xylosyltransferase 1-like               330   5e-102   
ref|XP_010243795.1|  PREDICTED: xylosyltransferase 1                    328   6e-102   
ref|XP_009143475.1|  PREDICTED: xylosyltransferase 1 isoform X1         328   6e-102   
ref|XP_011070643.1|  PREDICTED: xylosyltransferase 1                    328   7e-102   
ref|XP_006837784.1|  hypothetical protein AMTR_s00104p00076850          329   7e-102   
ref|XP_010422474.1|  PREDICTED: xylosyltransferase 1-like               330   7e-102   
dbj|BAJ85266.1|  predicted protein                                      330   8e-102   
ref|XP_011098301.1|  PREDICTED: xylosyltransferase 1-like               328   1e-101   
emb|CBI28920.3|  unnamed protein product                                325   1e-101   
emb|CDY09512.1|  BnaC02g20540D                                          327   1e-101   
ref|XP_008379558.1|  PREDICTED: xylosyltransferase 1                    328   2e-101   
ref|XP_006371602.1|  hypothetical protein POPTR_0019s13560g             328   2e-101   
ref|XP_009381594.1|  PREDICTED: xylosyltransferase 1-like               328   2e-101   
ref|XP_002882930.1|  glycosyltransferase family 14 protein              328   3e-101   
emb|CBI32043.3|  unnamed protein product                                327   3e-101   
ref|XP_008442042.1|  PREDICTED: xylosyltransferase 1                    327   3e-101   
ref|XP_010097414.1|  Xylosyltransferase 1                               327   3e-101   
ref|XP_010448127.1|  PREDICTED: xylosyltransferase 2-like               327   3e-101   
emb|CDX97653.1|  BnaA05g24260D                                          327   3e-101   
emb|CDY14277.1|  BnaA08g14080D                                          327   3e-101   
ref|XP_009357094.1|  PREDICTED: xylosyltransferase 1-like               328   4e-101   
ref|XP_008786554.1|  PREDICTED: xylosyltransferase 1                    326   4e-101   
ref|XP_009146266.1|  PREDICTED: xylosyltransferase 2                    327   5e-101   
ref|XP_008226623.1|  PREDICTED: xylosyltransferase 2                    327   5e-101   
ref|XP_004144651.1|  PREDICTED: xylosyltransferase 1-like               326   5e-101   
ref|XP_009793444.1|  PREDICTED: xylosyltransferase 2 isoform X1         326   6e-101   
ref|XP_007013429.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    328   6e-101   
gb|KHG22912.1|  Xylosyltransferase 2                                    327   7e-101   
ref|XP_008386181.1|  PREDICTED: xylosyltransferase 2-like               326   7e-101   
ref|XP_009350699.1|  PREDICTED: xylosyltransferase 1-like               327   9e-101   
ref|XP_009616406.1|  PREDICTED: xylosyltransferase 2 isoform X1         325   9e-101   
ref|XP_009759964.1|  PREDICTED: xylosyltransferase 2-like               326   1e-100   
ref|XP_010433361.1|  PREDICTED: xylosyltransferase 2-like               326   1e-100   
ref|XP_004975238.1|  PREDICTED: xylosyltransferase 1-like               326   1e-100   
ref|XP_006410948.1|  hypothetical protein EUTSA_v10016783mg             325   1e-100   
ref|XP_010438605.1|  PREDICTED: xylosyltransferase 2-like               326   1e-100   
ref|XP_006475831.1|  PREDICTED: xylosyltransferase 1-like isoform X2    325   1e-100   
ref|XP_004982122.1|  PREDICTED: xylosyltransferase 2-like               327   2e-100   
ref|XP_008341918.1|  PREDICTED: xylosyltransferase 1-like               326   2e-100   
ref|XP_006358997.1|  PREDICTED: xylosyltransferase 2-like               326   2e-100   
gb|KHN22905.1|  Xylosyltransferase 1                                    322   2e-100   
ref|XP_004296509.1|  PREDICTED: xylosyltransferase oxt-like             325   2e-100   
emb|CDX98547.1|  BnaC05g38280D                                          325   2e-100   
ref|XP_006859025.1|  hypothetical protein AMTR_s00068p00173020          326   2e-100   
ref|NP_194478.3|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    325   2e-100   
ref|XP_006450945.1|  hypothetical protein CICLE_v10008397mg             325   3e-100   
ref|XP_007211739.1|  hypothetical protein PRUPE_ppa006230mg             325   3e-100   
ref|XP_010313899.1|  PREDICTED: xylosyltransferase 1-like               325   3e-100   
gb|KDP27062.1|  hypothetical protein JCGZ_20997                         323   3e-100   
ref|XP_011039767.1|  PREDICTED: xylosyltransferase 1-like               325   4e-100   
ref|XP_002867502.1|  glycosyltransferase family 14 protein              325   4e-100   
ref|XP_007161882.1|  hypothetical protein PHAVU_001G105800g             323   4e-100   
ref|XP_008456029.1|  PREDICTED: xylosyltransferase 2-like               324   6e-100   
gb|EYU30047.1|  hypothetical protein MIMGU_mgv1a007531mg                323   6e-100   
ref|XP_006451835.1|  hypothetical protein CICLE_v10008455mg             323   7e-100   
ref|XP_010925224.1|  PREDICTED: xylosyltransferase 1-like               324   8e-100   
ref|XP_009356803.1|  PREDICTED: xylosyltransferase 2-like               323   1e-99    
ref|XP_010533167.1|  PREDICTED: xylosyltransferase 2-like               324   1e-99    
gb|AAO17353.1|  Hypothetical protein                                    323   2e-99    
ref|XP_009416447.1|  PREDICTED: xylosyltransferase oxt-like             323   2e-99    
ref|XP_008809636.1|  PREDICTED: xylosyltransferase oxt-like             322   2e-99    
ref|XP_006406986.1|  hypothetical protein EUTSA_v10020797mg             323   2e-99    
ref|XP_009109140.1|  PREDICTED: xylosyltransferase 2-like               322   3e-99    
ref|NP_566506.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    322   3e-99    
ref|XP_008363608.1|  PREDICTED: xylosyltransferase 2-like               322   3e-99    
ref|XP_007021489.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    322   4e-99    
ref|XP_011069974.1|  PREDICTED: xylosyltransferase 1                    321   4e-99    
ref|XP_006659106.1|  PREDICTED: xylosyltransferase 2-like               323   5e-99    
ref|XP_004146249.1|  PREDICTED: xylosyltransferase 2-like               322   5e-99    
ref|XP_011029478.1|  PREDICTED: xylosyltransferase 2                    321   6e-99    
ref|XP_007043505.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    318   8e-99    
ref|XP_002533550.1|  acetylglucosaminyltransferase, putative            321   9e-99    
gb|EAZ01579.1|  hypothetical protein OsI_23613                          322   9e-99    
ref|XP_009143476.1|  PREDICTED: xylosyltransferase 1 isoform X2         319   1e-98    
gb|AAK83637.1|  AT3g15350/K7L4_15                                       321   1e-98    
ref|XP_004248261.1|  PREDICTED: xylosyltransferase 1-like               321   2e-98    
gb|EPS58286.1|  hypothetical protein M569_16527                         320   2e-98    
gb|KFK36648.1|  hypothetical protein AALP_AA4G152000                    319   2e-98    
ref|XP_004302805.1|  PREDICTED: xylosyltransferase 1-like isoform 1     319   2e-98    
ref|XP_010914871.1|  PREDICTED: xylosyltransferase 1-like               320   2e-98    
gb|KHG07600.1|  Xylosyltransferase 1                                    321   2e-98    
ref|XP_010927248.1|  PREDICTED: xylosyltransferase 1-like               320   2e-98    
emb|CDP05925.1|  unnamed protein product                                320   3e-98    
ref|XP_002317501.1|  glycosyltransferase family 14 family protein       319   3e-98    
dbj|BAJ94460.1|  predicted protein                                      321   4e-98    
ref|XP_006362960.1|  PREDICTED: xylosyltransferase 2-like               320   4e-98    
ref|XP_006294388.1|  hypothetical protein CARUB_v10023410mg             318   4e-98    
gb|KHG18478.1|  Xylosyltransferase 1                                    319   5e-98    
emb|CDY29841.1|  BnaA03g48620D                                          319   5e-98    
ref|NP_001060977.1|  Os08g0143500                                       320   5e-98    
ref|XP_009793446.1|  PREDICTED: xylosyltransferase 2 isoform X2         318   6e-98    
ref|XP_006283803.1|  hypothetical protein CARUB_v10004902mg             319   6e-98    
ref|XP_010509315.1|  PREDICTED: xylosyltransferase-like                 318   6e-98    
ref|XP_006300413.1|  hypothetical protein CARUB_v10021335mg             318   7e-98    
ref|XP_009616407.1|  PREDICTED: xylosyltransferase 2 isoform X2         318   7e-98    
ref|XP_008672839.1|  PREDICTED: xylosyltransferase oxt isoform X1       320   9e-98    
ref|XP_009137663.1|  PREDICTED: xylosyltransferase 2-like               318   9e-98    
ref|XP_004136811.1|  PREDICTED: xylosyltransferase 1-like               319   1e-97    
ref|XP_008455350.1|  PREDICTED: xylosyltransferase 1-like               319   1e-97    
ref|XP_009364041.1|  PREDICTED: xylosyltransferase 2-like               318   1e-97    
ref|XP_009403460.1|  PREDICTED: xylosyltransferase 1-like               319   1e-97    
ref|XP_008792047.1|  PREDICTED: xylosyltransferase 1-like               318   1e-97    
gb|ACN29023.1|  unknown                                                 318   1e-97    
ref|XP_008784894.1|  PREDICTED: xylosyltransferase 1-like               318   1e-97    
gb|KDO66039.1|  hypothetical protein CISIN_1g015224mg                   317   1e-97    
ref|XP_009381119.1|  PREDICTED: xylosyltransferase 1-like               319   1e-97    
gb|EPS63808.1|  hypothetical protein M569_10975                         317   1e-97    
ref|XP_004253326.1|  PREDICTED: xylosyltransferase-like                 317   2e-97    
ref|XP_009344847.1|  PREDICTED: xylosyltransferase 2-like               318   2e-97    
ref|XP_008385694.1|  PREDICTED: xylosyltransferase 2-like               317   2e-97    
ref|XP_010112971.1|  Xylosyltransferase 1                               317   2e-97    
ref|XP_006370249.1|  glycosyltransferase family 14 family protein       317   3e-97    
ref|XP_004965950.1|  PREDICTED: xylosyltransferase 2-like               317   3e-97    
dbj|BAJ95328.1|  predicted protein                                      317   3e-97    
ref|XP_010915998.1|  PREDICTED: xylosyltransferase oxt                  317   3e-97    
ref|XP_004968552.1|  PREDICTED: xylosyltransferase oxt-like             318   4e-97    
ref|XP_004302807.1|  PREDICTED: xylosyltransferase 1-like isoform 3     314   4e-97    
ref|NP_001241700.1|  acetylglucosaminyltransferase                      317   5e-97    
ref|XP_008811973.1|  PREDICTED: xylosyltransferase 1-like isoform X1    317   5e-97    
ref|XP_006443515.1|  hypothetical protein CICLE_v10020438mg             316   5e-97    
ref|XP_010505350.1|  PREDICTED: xylosyltransferase-like                 315   5e-97    
gb|EMS46875.1|  Xylosyltransferase 2                                    318   5e-97    
ref|XP_009625381.1|  PREDICTED: xylosyltransferase 2-like isoform X2    316   5e-97    
dbj|BAJ93424.1|  predicted protein                                      317   6e-97    
ref|NP_565866.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    315   6e-97    
ref|XP_010517029.1|  PREDICTED: xylosyltransferase-like                 315   7e-97    
ref|XP_010932661.1|  PREDICTED: xylosyltransferase 1                    315   7e-97    
ref|XP_011014110.1|  PREDICTED: xylosyltransferase 2-like               316   8e-97    
ref|XP_002270685.2|  PREDICTED: xylosyltransferase 2                    315   9e-97    
emb|CDX89884.1|  BnaA10g01980D                                          335   9e-97    
ref|XP_004244234.1|  PREDICTED: xylosyltransferase 2-like               315   1e-96    
emb|CBI20295.3|  unnamed protein product                                315   1e-96    
ref|XP_002285024.2|  PREDICTED: xylosyltransferase 2                    315   1e-96    
gb|EYU26379.1|  hypothetical protein MIMGU_mgv1a006985mg                315   2e-96    
ref|XP_010688011.1|  PREDICTED: xylosyltransferase 1-like               316   2e-96    
ref|XP_002437247.1|  hypothetical protein SORBIDRAFT_10g023480          315   2e-96    
ref|XP_009415299.1|  PREDICTED: xylosyltransferase 1 isoform X1         314   2e-96    
gb|AFW76419.1|  acetylglucosaminyltransferase                           318   2e-96    
gb|KHG25299.1|  Xylosyltransferase 2                                    314   3e-96    
ref|XP_002285159.1|  PREDICTED: xylosyltransferase 1-like               315   3e-96    
ref|XP_006348255.1|  PREDICTED: xylosyltransferase 2-like               314   3e-96    



>ref|XP_009618078.1| PREDICTED: xylosyltransferase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=432

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/374 (69%), Positives = 318/374 (85%), Gaps = 7/374 (2%)
 Frame = -2

Query  1745  PSH-PHRVLIHGDLSSPP------PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLL  1587
             P+H PHR+L H + ++P       P PPSIAY ISGS  DS RI+RLLF++YHPRN YLL
Sbjct  59    PNHQPHRLLFHHNPTNPNDQNALLPTPPSIAYLISGSTKDSSRIIRLLFSIYHPRNQYLL  118

Query  1586  HLDRSAPKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRI  1407
             HLD+ A +S+RD LAL + +VPLF+AA+NV+ +G ADFVY  GSS++S+TLHGASILLR+
Sbjct  119   HLDKKASQSERDNLALYIQSVPLFKAAQNVNFIGKADFVYPIGSSALSATLHGASILLRV  178

Query  1406  SSNWDWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGL  1227
             SS+WDWFINLS+ADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRES+KLKPI+VDPGL
Sbjct  179   SSHWDWFINLSAADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESRKLKPIVVDPGL  238

Query  1226  YLAEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPS  1047
             YL E+ +VF+A+Q+R LPD++++F GSS +ILSRKF++FCILGT+N PRTLLMYLSN+PS
Sbjct  239   YLEEEDEVFFASQKRELPDAYQLFSGSSSAILSRKFIEFCILGTDNLPRTLLMYLSNSPS  298

Query  1046  SDAVYFPTVLCNSRQFNRTIINHNLQYVSLNSRKEARVLNSSDFLDMIRSGAAFASPFKE  867
             S +VYFPT+LCNSR+FN+T INHN+QY S NSR+E R LNSSDF D++ SGAAFA+PF+ 
Sbjct  299   SASVYFPTILCNSRKFNKTTINHNMQYASFNSRQETRKLNSSDFNDLVMSGAAFATPFEA  358

Query  866   RDPILDQIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIEL  687
              DPILDQID E+LH    +PVPGGWCLG+ E+ +C +WGDA+VLRPG GAKRLEKHF+EL
Sbjct  359   NDPILDQIDRELLHHKYDEPVPGGWCLGDNETDKCTLWGDAEVLRPGRGAKRLEKHFVEL  418

Query  686   FAGGRFQSQQCIEE  645
             F  G F+S +C+ E
Sbjct  419   FTNGTFRSSRCVYE  432



>ref|XP_009771270.1| PREDICTED: xylosyltransferase 1-like [Nicotiana sylvestris]
Length=432

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/374 (70%), Positives = 319/374 (85%), Gaps = 7/374 (2%)
 Frame = -2

Query  1745  PSH-PHRVLIHGDLSSPP------PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLL  1587
             P+H PHR+L H + ++P       P PPSIAY ISGS  DS RI+RLLF++YHPRN YLL
Sbjct  59    PNHQPHRLLFHHNPTNPNDQNALLPTPPSIAYLISGSTQDSSRIIRLLFSIYHPRNQYLL  118

Query  1586  HLDRSAPKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRI  1407
             HL++ A +S+RD LAL + +VPLF+AA+NV+ +G ADFVY  GSS++S+TLHGASILLR+
Sbjct  119   HLNKKASQSERDNLALYIQSVPLFKAAQNVNFIGKADFVYPIGSSALSATLHGASILLRV  178

Query  1406  SSNWDWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGL  1227
             S++WDWFINLS+ADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRES+KLKPI+VDPGL
Sbjct  179   STHWDWFINLSAADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESRKLKPIVVDPGL  238

Query  1226  YLAEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPS  1047
             YLAE+ +VF+ATQ+R LPD++++F GSS +ILSRKF++FCILGT+N PRTLLMYLSN+PS
Sbjct  239   YLAEEDEVFFATQKRELPDAYQLFSGSSSAILSRKFIEFCILGTDNLPRTLLMYLSNSPS  298

Query  1046  SDAVYFPTVLCNSRQFNRTIINHNLQYVSLNSRKEARVLNSSDFLDMIRSGAAFASPFKE  867
             S +VYFPT+LCNSR+FN+T INHN+QY S NSR+EAR LNSSDF D++ SGAAFA+  K 
Sbjct  299   SASVYFPTILCNSRKFNKTTINHNMQYASFNSRQEARELNSSDFDDLVMSGAAFATLIKA  358

Query  866   RDPILDQIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIEL  687
              DPILDQID E+LH    +PVPGGWCLG+ E+ +C +WGDA+VLRPG GAKRLEKHFIEL
Sbjct  359   NDPILDQIDRELLHHKYDEPVPGGWCLGDNETDKCTLWGDAEVLRPGPGAKRLEKHFIEL  418

Query  686   FAGGRFQSQQCIEE  645
             F+ G FQS +C+ E
Sbjct  419   FSNGTFQSSRCVYE  432



>ref|XP_009758427.1| PREDICTED: xylosyltransferase 1, partial [Nicotiana sylvestris]
Length=353

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/348 (70%), Positives = 305/348 (88%), Gaps = 0/348 (0%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS  DS RI+RLLF++YHP+N YL+HLD+   KS+ + LALSV +VP+F+A
Sbjct  2     PPSIAYLISGSTKDSSRILRLLFSIYHPKNQYLIHLDKKTSKSELNNLALSVQSVPVFKA  61

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             A+NV+V+G ADF Y  GSS++++TLHGASILL++S +WDWFINLS+ADYPLVTQDDLLHI
Sbjct  62    AQNVNVIGKADFRYKIGSSALAATLHGASILLKLSKSWDWFINLSAADYPLVTQDDLLHI  121

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             LSYLPKDLNFVNH+SYIGWRES+KLKPI+VDPGLYLAE+S+V+YATQ+R LPD++R+F G
Sbjct  122   LSYLPKDLNFVNHSSYIGWRESKKLKPIVVDPGLYLAEESEVYYATQKRELPDAYRLFTG  181

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             SS +IL+RKF+++CILG+EN PRTLLMYLSN+PSS++VYFPT+LCNSR+FNRT INHN+ 
Sbjct  182   SSSAILTRKFIEYCILGSENLPRTLLMYLSNSPSSESVYFPTILCNSRKFNRTAINHNML  241

Query  968   YVSLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWC  789
             Y S NSR +AR LNSSDF D++ SGAAFASPFK  DP+LDQID E+LH +  +PVPGGWC
Sbjct  242   YASFNSRSQARRLNSSDFNDLLTSGAAFASPFKVDDPVLDQIDHELLHHNRDEPVPGGWC  301

Query  788   LGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             LG+ E+ +C+VWGDA++LRPG GAKRLEKHF+ELF+ G + S QC  E
Sbjct  302   LGDSETNKCSVWGDAEILRPGPGAKRLEKHFLELFSNGSYLSDQCQYE  349



>ref|XP_006340918.1| PREDICTED: xylosyltransferase 1-like [Solanum tuberosum]
Length=432

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/411 (66%), Positives = 329/411 (80%), Gaps = 3/411 (1%)
 Frame = -2

Query  1868  LSTPFIFVTTTFFSLLLIVslftlpstppptqpdpslfPNHPSHPHRVLIH---GDLSSP  1698
             +STPFI + TT FSLLLI++       P P    P         PHR+L H    D ++ 
Sbjct  22    ISTPFIILATTIFSLLLILTFSFSSPPPHPHPNQPHPSLFPNHQPHRLLFHHNPNDQNTF  81

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
              P PP+IAY ISGS  D+ RI+RLLFAVYHPRN YLLHLDR A + +RD LAL V +VPL
Sbjct  82    LPPPPAIAYLISGSTKDTSRIIRLLFAVYHPRNQYLLHLDRKASQYERDDLALYVQSVPL  141

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
             F+AA+NV+ +G ADFVY  GSS++S+TLHGASILLR+S++WDWFINLS+ DYPLVTQDDL
Sbjct  142   FKAAQNVNFIGKADFVYPMGSSALSATLHGASILLRVSAHWDWFINLSADDYPLVTQDDL  201

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LHILSY+PKDLNFVNHTSYIGWRES+KLKPI+VDPGLYL E+ DVFYATQ+R LPD+FR+
Sbjct  202   LHILSYMPKDLNFVNHTSYIGWRESRKLKPIVVDPGLYLEEEDDVFYATQKRELPDAFRL  261

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GSS SILSRKF++FCILGT+N PRTLLMYLSN+PSS +VYFPT+LCNSR++NRT INH
Sbjct  262   FSGSSSSILSRKFIEFCILGTDNLPRTLLMYLSNSPSSASVYFPTILCNSRKYNRTTINH  321

Query  977   NLQYVSLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPG  798
             NL+Y S NSR+E   LN+SDF D++ SGA FA+PF+  +PILDQID E+LH    +PVPG
Sbjct  322   NLRYASFNSRQEVLPLNTSDFNDLVMSGAVFAAPFEANNPILDQIDHELLHHKHDEPVPG  381

Query  797   GWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             GWCLG  E+ +C VWGDA+VLRPG GA+RLEK F+++F+ G F+S +CI E
Sbjct  382   GWCLGENETDKCTVWGDAEVLRPGPGAQRLEKRFVQIFSNGTFRSSRCIYE  432



>ref|XP_002282998.1| PREDICTED: xylosyltransferase 1 [Vitis vinifera]
 emb|CBI33336.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/426 (63%), Positives = 333/426 (78%), Gaps = 2/426 (0%)
 Frame = -2

Query  1916  PPsttavsatsAITRLLSTPFIFVTTTFFSLLLIVslftlpstppptqpdpslfPNHPSH  1737
             PP   + +  +A+T+   + ++ + T+F SLL I+SL       P              H
Sbjct  7     PPFPISGTTAAALTKDNRSFYLIIATSFVSLLFILSLSATSPPAPSAPATDPYLFPTSHH  66

Query  1736  PHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSD  1557
              H + ++ + S   P PPS+AY+ISGSAGDS +I+RLLFA YHPRNHYLLHLD +AP+SD
Sbjct  67    RHPIFLNPNPSDSTPTPPSLAYFISGSAGDSHKILRLLFAAYHPRNHYLLHLDLTAPQSD  126

Query  1556  RDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINL  1377
             RD LAL+V +VP+FRAARNV+VMG ADF Y KGSSS+SSTLHGASILLR+SS+WDWFINL
Sbjct  127   RDRLALAVQSVPVFRAARNVNVMGKADFAYGKGSSSISSTLHGASILLRLSSSWDWFINL  186

Query  1376  SSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFY  1197
             S++DYPLVTQDDLLHILS++P+DLNFVNHTSYIGWRES+KLKPIIVDPGLYL + +++FY
Sbjct  187   SASDYPLVTQDDLLHILSFVPRDLNFVNHTSYIGWRESRKLKPIIVDPGLYLTQKTEIFY  246

Query  1196  ATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVL  1017
             ATQ+R LP+SF++F GSS +IL+R F++FCI+GT+N PRTLLMYL+NTPSS   YFPT+L
Sbjct  247   ATQKRGLPNSFQLFTGSSSAILNRAFIEFCIVGTDNLPRTLLMYLANTPSSLPNYFPTIL  306

Query  1016  CNSRQFNRTIINHNLQYVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQI  843
             CNSRQFN+TI+NHNLQY S +  +++E R L S DF DMI+SGAAFA+ F+  D  LD+I
Sbjct  307   CNSRQFNKTIVNHNLQYASFDKPAKEEPRRLGSKDFDDMIQSGAAFATQFRLNDVALDRI  366

Query  842   DSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQS  663
             D EIL RSPGK +PGGWCLG   +  C+VWGDADVLRPG GAKRLEK   EL + G FQ+
Sbjct  367   DQEILGRSPGKILPGGWCLGEAGNDTCSVWGDADVLRPGPGAKRLEKRIAELLSDGTFQA  426

Query  662   QQCIEE  645
              QCI E
Sbjct  427   HQCIVE  432



>ref|XP_006355740.1| PREDICTED: xylosyltransferase 1-like [Solanum tuberosum]
Length=448

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/345 (72%), Positives = 302/345 (88%), Gaps = 0/345 (0%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             IAY ISGS  DS RI+RLLFAVYHPRN YLLHLDR A + +RD LAL+V +VP+F+AA+N
Sbjct  98    IAYLISGSTKDSSRILRLLFAVYHPRNQYLLHLDRKATQKERDELALAVQSVPVFKAAQN  157

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V+V+G ADF YS GSS++S+TLHGASILLR+S++WDWFINLS+ADYPLVTQDDLLHILSY
Sbjct  158   VNVIGKADFRYSIGSSALSATLHGASILLRLSNSWDWFINLSAADYPLVTQDDLLHILSY  217

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LPKDLNFVNH+SYIGWRES+KLKPI+VDPGLYLAE+S+V+YATQ+R LPD++R+F GSS 
Sbjct  218   LPKDLNFVNHSSYIGWRESKKLKPIVVDPGLYLAEESEVYYATQKRELPDAYRLFTGSSS  277

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
             +ILSRKF +FCILG++N PRTLLMYLSN+PSS++VYFPTVLCNSR+FN T INHN+QY S
Sbjct  278   AILSRKFTEFCILGSDNLPRTLLMYLSNSPSSESVYFPTVLCNSRKFNGTTINHNMQYAS  337

Query  959   LNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGN  780
              NSR + R LNSSDF D++ SGAAFASPFK  DP+LD+ID E+LH +  +PVPGGWCLG+
Sbjct  338   FNSRSQVRRLNSSDFNDLVMSGAAFASPFKAGDPVLDKIDHELLHHNRDEPVPGGWCLGD  397

Query  779   GESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
              E+ +C VWGDA+++RPG GAKRLEKHF+ELF+ G + S QC  E
Sbjct  398   TETNKCTVWGDAEIIRPGFGAKRLEKHFLELFSNGSYLSDQCQYE  442



>ref|XP_009606894.1| PREDICTED: xylosyltransferase 1, partial [Nicotiana tomentosiformis]
Length=355

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/348 (70%), Positives = 303/348 (87%), Gaps = 0/348 (0%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS  DS RI+RLLF++YHPRN YL+HLD+   KS+ + LAL+V +VP+F+A
Sbjct  2     PPSIAYLISGSTKDSSRILRLLFSIYHPRNQYLIHLDKKTSKSELNNLALTVQSVPVFKA  61

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             A+N++V+G ADF Y  GS S+++ LHGASILL++S +WDWFINLS+ADYPLVTQDDLLHI
Sbjct  62    AQNINVIGKADFRYKIGSCSLAAKLHGASILLKLSKSWDWFINLSAADYPLVTQDDLLHI  121

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             LSYLPKDLNFVNH+SYIGWRES+KLKPI+VDPGLYLAE+S+V+YATQ+R LPD++R+F G
Sbjct  122   LSYLPKDLNFVNHSSYIGWRESKKLKPIVVDPGLYLAEESEVYYATQKRVLPDAYRLFTG  181

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             SS +IL+RKF+++CILG+EN PRTLLMYLSN+PSS++VYFPT+LCNS++FNRT INHN+ 
Sbjct  182   SSSAILTRKFIEYCILGSENLPRTLLMYLSNSPSSESVYFPTILCNSQKFNRTTINHNML  241

Query  968   YVSLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWC  789
             Y SLNSR +AR LNSSDF D++ SGAAFASPFK  DP+LDQID E+LH +  +PVPGGWC
Sbjct  242   YASLNSRSQARQLNSSDFNDLLMSGAAFASPFKVDDPVLDQIDHELLHHNRDEPVPGGWC  301

Query  788   LGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             LG+ E+ +C+VWGDA++LRPG GAKRLEKHF+ELF+   + S QC  E
Sbjct  302   LGDTETNKCSVWGDAEILRPGPGAKRLEKHFLELFSNESYLSDQCQYE  349



>ref|XP_004239872.1| PREDICTED: xylosyltransferase 1-like [Solanum lycopersicum]
Length=448

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/345 (72%), Positives = 302/345 (88%), Gaps = 0/345 (0%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             IAY ISGS  DS RI+RLLFAVYHPRN YLLHLDR A + +RD LA++V +VP+F+AA+N
Sbjct  98    IAYLISGSTKDSSRILRLLFAVYHPRNQYLLHLDRKATQKERDDLAVAVQSVPVFKAAQN  157

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V+V+G ADF YS GSS++S+TLHGASILLR+S++WDWFINLS+ADYPLVTQDDLLHILSY
Sbjct  158   VNVIGKADFRYSIGSSALSATLHGASILLRLSNSWDWFINLSAADYPLVTQDDLLHILSY  217

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LPKDLNFVNH+SYIGWRES+KLKPI+VDPGLYLAE+S+V+YATQ+R LPD++R+F GSS 
Sbjct  218   LPKDLNFVNHSSYIGWRESKKLKPIVVDPGLYLAEESEVYYATQKRELPDAYRLFTGSSS  277

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
             +ILSRKF +FCILG++N PRTLLMYLSN+PSS++VYFPT+LCNSR+FN T INHN+QY S
Sbjct  278   AILSRKFTEFCILGSDNLPRTLLMYLSNSPSSESVYFPTILCNSREFNGTTINHNMQYAS  337

Query  959   LNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGN  780
              NSR +AR LNSSDF D++ S AAFASPFK  DP+LD+ID E+LH +  +PVPGGWCLG+
Sbjct  338   FNSRAQARRLNSSDFNDLVMSRAAFASPFKAGDPVLDKIDHELLHHNRDEPVPGGWCLGD  397

Query  779   GESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
              E+ +C VWGDA+++RPG GAKRLEKHF+ELF+ G + S QC  E
Sbjct  398   TETNKCTVWGDAEIIRPGFGAKRLEKHFLELFSNGSYLSDQCQYE  442



>ref|XP_004247943.1| PREDICTED: xylosyltransferase 1 [Solanum lycopersicum]
Length=427

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/411 (65%), Positives = 331/411 (81%), Gaps = 3/411 (1%)
 Frame = -2

Query  1868  LSTPFIFVTTTFFSLLLIVslftlpstppptqpdpslfPNHPSHPHRVLIH---GDLSSP  1698
             +STPFI + TT FSLLLI++       P P    P         PHR+L H    D ++ 
Sbjct  17    ISTPFIILATTIFSLLLILTFSFTSPPPHPHPNQPHPSLFPNHQPHRLLFHQNPNDQNTL  76

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
              P PP+IAY ISGS  D+ RI+RLLFAVYHPRN YLLHLD+ A + +RD LAL V +VPL
Sbjct  77    LPPPPAIAYLISGSTKDTSRIIRLLFAVYHPRNQYLLHLDKKASQYERDDLALYVQSVPL  136

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
             F+AA+NV+ +G ADFVY  G+S++S+TLHGASILLR+S++WDWFINLS+ DYPLVTQDDL
Sbjct  137   FKAAQNVNFIGKADFVYPMGASALSATLHGASILLRVSAHWDWFINLSADDYPLVTQDDL  196

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LHILSYLPKDLNFVNHTSYIGWRES+KLKPI+VDPGLYL E+ +VFYATQ+R LPD++R+
Sbjct  197   LHILSYLPKDLNFVNHTSYIGWRESRKLKPIVVDPGLYLEEEDEVFYATQKRELPDAYRL  256

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GSS SILSRKF++FCILGT+N PRTLLMYLSN+PSS +VYFPT+LCNSR+FNRT INH
Sbjct  257   FSGSSSSILSRKFIEFCILGTDNLPRTLLMYLSNSPSSSSVYFPTILCNSRKFNRTTINH  316

Query  977   NLQYVSLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPG  798
             NL+Y S NSRKEA  LN+S+F D++ SGA FA+PF+  +PILDQIDSE+LH    +PVPG
Sbjct  317   NLRYASFNSRKEALPLNTSNFNDLVMSGAVFAAPFEANNPILDQIDSELLHHKYDEPVPG  376

Query  797   GWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             GWCLG  E+ +C VWGDA+VLRPG GA+RLE+ F+++F+ G F+S +C+ E
Sbjct  377   GWCLGENETDKCTVWGDAEVLRPGPGAQRLEERFVQIFSNGTFRSSRCVYE  427



>ref|XP_011073866.1| PREDICTED: xylosyltransferase 1 [Sesamum indicum]
Length=421

 Score =   525 bits (1351),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 244/346 (71%), Positives = 298/346 (86%), Gaps = 3/346 (1%)
 Frame = -2

Query  1682  SIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAAR  1503
             S+AY ISGS  DSGRI+RLL++VYHPRN YLLHLDRSA +++RD LA++V +V LFRAA+
Sbjct  79    SLAYLISGSVNDSGRILRLLYSVYHPRNQYLLHLDRSAGQTERDTLAVTVQSVALFRAAQ  138

Query  1502  NVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILS  1323
             NVHV+G AD+V+S G S++SSTLHGAS+LLRISSNWDWFINLS+ADYPL+TQDDLLHI S
Sbjct  139   NVHVVGKADYVFSSGPSALSSTLHGASLLLRISSNWDWFINLSAADYPLITQDDLLHIFS  198

Query  1322  YLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSS  1143
             YLP+DLNFVNHTSYIGWRES+KLKPIIVDP L+LAE+S++F+ATQ+RPLPD++R+F GSS
Sbjct  199   YLPRDLNFVNHTSYIGWRESKKLKPIIVDPALFLAENSEMFFATQERPLPDAYRLFTGSS  258

Query  1142  YSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYV  963
               +LSRKF++FCILGT+N PRTLLMYLSNTP+S +VYFPTVLCNS +FNRT INH+  Y 
Sbjct  259   TPVLSRKFVEFCILGTDNLPRTLLMYLSNTPASTSVYFPTVLCNSPRFNRTTINHSFCYA  318

Query  962   SLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLG  783
             SL++R+    LNSS+F ++I+SGAAFASPF+  DP+LD ID E+L RSPGKPVP GWCLG
Sbjct  319   SLDARRRPSFLNSSNFDELIQSGAAFASPFQVNDPVLDHIDQEVLQRSPGKPVPSGWCLG  378

Query  782   NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             +     C+VWGDADVL+PG GAKRLE+  IEL + GR    QCI+E
Sbjct  379   DSGEDECSVWGDADVLKPGPGAKRLERRLIELLSKGR---TQCIDE  421



>ref|XP_007034494.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein, putative [Theobroma cacao]
 gb|EOY05420.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein, putative [Theobroma cacao]
Length=436

 Score =   525 bits (1351),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 242/352 (69%), Positives = 299/352 (85%), Gaps = 2/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PPSIAY ISGSAGDS RI+RLLFA YHPRNHYLLHLD SAP+++RD LA++V +VP+F
Sbjct  85    PAPPSIAYLISGSAGDSARILRLLFASYHPRNHYLLHLDLSAPQTERDRLAVTVQSVPIF  144

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +AA+NV V+G AD+ Y +GSS++SSTLHGAS+LLR++SNWDWFI+L++ DYPLVTQDDLL
Sbjct  145   KAAQNVDVIGKADYAYPRGSSTISSTLHGASVLLRLASNWDWFISLNAGDYPLVTQDDLL  204

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HILSYLPKDLNFVNHT YIGW+ES++LKPIIVD GLYL E  ++FYA+Q+R LP++FR+F
Sbjct  205   HILSYLPKDLNFVNHTGYIGWKESKRLKPIIVDTGLYLLEKHEIFYASQKRELPNAFRLF  264

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GSS+++L+R F++FCILGT+N PRTLLMY +NTP S   YFPTVLCNS QF RT+INHN
Sbjct  265   SGSSFTMLTRSFMEFCILGTDNLPRTLLMYFANTPYSFTNYFPTVLCNSDQFKRTVINHN  324

Query  974   LQYVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             LQY++ N  S K+   +NS+DF  MI+SGAAFA+ F+  DP+LD+ID EIL RSPGK VP
Sbjct  325   LQYIAFNKSSTKKPPQMNSADFDAMIQSGAAFATQFRFDDPVLDRIDQEILKRSPGKAVP  384

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             GGWCLG  ++G C+VWGDAD+LRPG GA+RLEK  +E  + GRFQSQQC EE
Sbjct  385   GGWCLGEPDNGTCSVWGDADILRPGPGARRLEKRIVESLSDGRFQSQQCQEE  436



>emb|CAN80510.1| hypothetical protein VITISV_043589 [Vitis vinifera]
Length=459

 Score =   523 bits (1346),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 267/456 (59%), Positives = 334/456 (73%), Gaps = 29/456 (6%)
 Frame = -2

Query  1925  NQTPPsttavsatsAITRLLSTPFIFVTTTFFSLLLIVslftlpstppptqpdpslfPNH  1746
             +  PP   + + T+A+T+   + ++ + T+F SLL I+SL       P            
Sbjct  4     SHQPPFPISGTTTAALTKDNRSFYLIIATSFVSLLFILSLSATSPPVPSAPATDPYLFPT  63

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
               H H + ++ + S   P PPS+AY+ISGSAGDS +I+RLLFA YHPRNHYLLHLD +AP
Sbjct  64    SHHRHPIFLNPNPSDSTPTPPSLAYFISGSAGDSHKILRLLFAAYHPRNHYLLHLDLTAP  123

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
             +SDRD LAL+V +VP+FRAARNV+VMG ADF Y KGSSS+SSTLHGASILLR+SS+WDWF
Sbjct  124   QSDRDRLALAVQSVPVFRAARNVNVMGKADFAYRKGSSSISSTLHGASILLRLSSSWDWF  183

Query  1385  INLSSADYPLVTQD---------------------------DLLHILSYLPKDLNFVNHT  1287
             INLS++DYPLVTQD                           DLLHILS++P+DLNFVNHT
Sbjct  184   INLSASDYPLVTQDGTWSDPVCSFDEWILCWFSDLGFVGFADLLHILSFVPRDLNFVNHT  243

Query  1286  SYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFC  1107
             SYIGW+ES+KLKPIIVDPGLYL + +++FYATQ+R LP+SF++F GSS +IL+R F++FC
Sbjct  244   SYIGWKESRKLKPIIVDPGLYLTQKTEIFYATQKRGLPNSFQLFTGSSSAILNRAFIEFC  303

Query  1106  ILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSLN--SRKEARV  933
             I+GT+N PRTLLMYL+N PSS   YFPT+LCNSRQFN+TI+NHNLQY S +  +++E R 
Sbjct  304   IVGTDNLPRTLLMYLANMPSSLPNYFPTILCNSRQFNKTIVNHNLQYASFDKPAKEEPRR  363

Query  932   LNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGNGESGRCAVW  753
             L S DF DMI+SGAAFA+ F+  D  LD+ID EIL RSPGK +PGGWCLG   +  C+VW
Sbjct  364   LGSKDFDDMIQSGAAFATQFRLNDVALDRIDQEILGRSPGKILPGGWCLGEAGNDTCSVW  423

Query  752   GDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             GDADVLRPG GAKRLEK   EL + G FQ+ QCI E
Sbjct  424   GDADVLRPGPGAKRLEKRIAELLSDGTFQAHQCIVE  459



>ref|XP_002518166.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF44299.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=438

 Score =   518 bits (1333),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 239/350 (68%), Positives = 294/350 (84%), Gaps = 2/350 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS  D+GRI+RLL+A YHP+N YLLHLDR AP+S+RD LAL++ +VP+F+A
Sbjct  89    PPSIAYLISGSKSDTGRILRLLYATYHPKNQYLLHLDRFAPQSERDKLALAIQSVPIFKA  148

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             A NV+V+G ADF Y KGSSS+S+TLHGA+ILLR+S NWDWFINL++ DYPLVTQDDLLHI
Sbjct  149   ALNVNVIGKADFAYPKGSSSISATLHGAAILLRLSKNWDWFINLNAGDYPLVTQDDLLHI  208

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              SYLP+D NFVNHTSYIGWRE+++LKPIIVDPGLYL+E S++FYATQ+R LP++FR+F G
Sbjct  209   FSYLPRDFNFVNHTSYIGWREAKRLKPIIVDPGLYLSERSEIFYATQKRELPNAFRIFTG  268

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             SS+SI+SR  +D CILGT+N PR LLMY SNTPSS   YFP+++CNSRQFNRT++NHNLQ
Sbjct  269   SSFSIVSRNLIDHCILGTDNLPRILLMYFSNTPSSLTNYFPSIICNSRQFNRTVVNHNLQ  328

Query  968   YVSL--NSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             YV+   +S +E R+LNSS+F  MI+SGAAFA+ FK  DP+LD+ID EIL R+ G+ VPGG
Sbjct  329   YVAFEKSSMQEQRMLNSSEFHTMIQSGAAFATGFKFNDPVLDRIDQEILGRNAGQVVPGG  388

Query  794   WCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG   +  C+VWGDADVLRPG GA RLEK  +EL + G F+S QCI E
Sbjct  389   WCLGEPRNSTCSVWGDADVLRPGPGAARLEKTIVELLSKGVFRSNQCIIE  438



>ref|XP_002299292.1| glycosyltransferase family 14 family protein [Populus trichocarpa]
 gb|EEE84097.1| glycosyltransferase family 14 family protein [Populus trichocarpa]
Length=428

 Score =   509 bits (1310),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 255/414 (62%), Positives = 314/414 (76%), Gaps = 14/414 (3%)
 Frame = -2

Query  1865  STPFIFVTTTFFSLLLIVslftlpstppptqpdpslfPNHPS---HPHRVLIHGDLSSPP  1695
             +T FI +TT+FFSLL I +L +                  P     P+R      + S P
Sbjct  22    TTLFIILTTSFFSLLFIFTLSSYSFNTSSLSTH-----GRPDPYLFPNRQPTFTKIPSDP  76

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
               PPSIAY ISGS GD  R++RLL+A YHP+N YLLHLD SAP++DRD LALSV +VP+F
Sbjct  77    -TPPSIAYLISGSKGDLDRVLRLLYATYHPKNQYLLHLDLSAPQTDRDQLALSVQSVPIF  135

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +AA+NV+V+G ADF Y KGSS++S+TLHGA+ILLR+   WDWF+NL +ADYPLVT DDLL
Sbjct  136   KAAQNVNVIGKADFAYPKGSSTISATLHGAAILLRLPKKWDWFVNLGAADYPLVTPDDLL  195

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HILSYLPKDLNFVNH+SYIGWRES++LKPIIVDPGLYL+E S++FYATQ+R LP+SFR+F
Sbjct  196   HILSYLPKDLNFVNHSSYIGWRESRQLKPIIVDPGLYLSEKSEMFYATQKRDLPNSFRLF  255

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              G+S+S  SR  ++ CILG +N PR L+MYLSNTPSS   YFPTV+CNSRQFNRT+INHN
Sbjct  256   TGTSFSFASRNLIEHCILGVDNLPRILMMYLSNTPSSLINYFPTVICNSRQFNRTVINHN  315

Query  974   LQYVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             LQYV+    S+K  R LNSS+F  MI+SGAAFA+ FK  DP+LD+ID ++L R+PG+ VP
Sbjct  316   LQYVAFEKPSKKVPRALNSSEFDAMIQSGAAFATQFKLDDPVLDRIDQDVLGRNPGEVVP  375

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             GGWCLG GE G   C+ WGDAD+LRPG GA RLEK  + L + G F S+QCI E
Sbjct  376   GGWCLG-GEPGNITCSAWGDADILRPGTGAARLEKLIVRLLSNGEFHSRQCIVE  428



>ref|XP_011002162.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica]
 ref|XP_011012219.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica]
Length=428

 Score =   508 bits (1309),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 253/411 (62%), Positives = 314/411 (76%), Gaps = 8/411 (2%)
 Frame = -2

Query  1865  STPFIFVTTTFFSLLLIVslftlpstppptqpdpslfPNHPSHPHRVLIHGDLSSPPPRP  1686
             +T FI +TT+FFSLL I +L +                +    P+R      + S P  P
Sbjct  22    TTLFIILTTSFFSLLFIFTLSSHSFNTSSLSTHGLP--DPYLFPNRQPTFTKIPSDP-TP  78

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             PSIAY ISGS GD  R++RLL+A YHP+N YLLHLD SAP++DRD LALS+ +VP+F+AA
Sbjct  79    PSIAYLISGSKGDLDRVLRLLYATYHPKNQYLLHLDLSAPQTDRDQLALSIQSVPIFKAA  138

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHIL  1326
             +NV+V+G ADF Y KGSS++S+TLHGA+ILLR+   WDWF+NL +ADYPLVT DDLLHIL
Sbjct  139   QNVNVIGKADFAYPKGSSTISATLHGAAILLRLPKKWDWFVNLGAADYPLVTPDDLLHIL  198

Query  1325  SYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGS  1146
             SYLPKDLNFVNH+SYIGWRES++LKPIIVDPGLYL+E S++FYATQ+R LP+SFR+F G+
Sbjct  199   SYLPKDLNFVNHSSYIGWRESRQLKPIIVDPGLYLSEKSEMFYATQKRDLPNSFRLFTGT  258

Query  1145  SYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQY  966
             S+S +SR  ++ CILG +N PR L+MYLSNTPSS   YFPTV+CNSRQFNRT+INHNLQY
Sbjct  259   SFSFVSRNLIEHCILGVDNLPRILMMYLSNTPSSLINYFPTVICNSRQFNRTVINHNLQY  318

Query  965   VSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGW  792
             V+    S+K  R LNSS+F  MI SGAAFA+ FK  DP+LD+ID ++L R+PG+ VPGGW
Sbjct  319   VAFEKPSKKVPRALNSSEFDAMIESGAAFATQFKLDDPVLDRIDQDVLGRNPGEVVPGGW  378

Query  791   CLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             CLG GE G   C+ WGDAD+LRPG GA RLEK  + L + G F S+QCI E
Sbjct  379   CLG-GEPGNITCSAWGDADILRPGTGAARLEKLIVRLLSNGEFHSRQCIVE  428



>gb|EYU32613.1| hypothetical protein MIMGU_mgv1a006803mg [Erythranthe guttata]
Length=430

 Score =   504 bits (1299),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 306/368 (83%), Gaps = 8/368 (2%)
 Frame = -2

Query  1739  HPHRVLIHGDLSSP-----PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDR  1575
             H HR+L H + ++P     PPRPPS+AY ISGSA DSGRI+RLL +VYHPRN YLLHLDR
Sbjct  60    HHHRLLFHDNQNTPGDSSPPPRPPSLAYLISGSANDSGRILRLLHSVYHPRNQYLLHLDR  119

Query  1574  SAPKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNW  1395
             S  +S RD LA++V +VPLF AA+NVHV+G ADFV+S G S++SSTLHGAS+LLR+S NW
Sbjct  120   STTQSHRDELAVTVQSVPLFSAAQNVHVIGKADFVFSNGPSALSSTLHGASVLLRLSPNW  179

Query  1394  DWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAE  1215
             DWFINLS+ADYPL+TQDDLLHILSYLPKDLNFVNHTSYIGWRES+KLKPIIVDP L+LAE
Sbjct  180   DWFINLSAADYPLLTQDDLLHILSYLPKDLNFVNHTSYIGWRESRKLKPIIVDPALFLAE  239

Query  1214  DSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAV  1035
             ++D+F+ATQ+RPLPD++R+F GSS +ILSRKF++FCILGT+N PRTLLMYLSNTPSS +V
Sbjct  240   NTDMFFATQKRPLPDAYRLFTGSSSAILSRKFIEFCILGTDNLPRTLLMYLSNTPSSTSV  299

Query  1034  YFPTVLCNSRQFNRTIINHNLQY-VSLNSRKE--ARVLNSSDFLDMIRSGAAFASPFKER  864
             YFPTVLCNSR+FNRT INH+L Y  SL+SR +     LNSS F D+I+SGAAFASPF+  
Sbjct  300   YFPTVLCNSRKFNRTTINHSLHYSASLDSRNKRGPHFLNSSHFDDLIQSGAAFASPFQPN  359

Query  863   DPILDQIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELF  684
             DP+LD+ID E+L R+P   VPGGWCLG+     C+VWGDA+VL+PG GAKRLE+  +++ 
Sbjct  360   DPVLDRIDQEVLRRNPTGAVPGGWCLGDSGEDICSVWGDAEVLKPGEGAKRLERRLVQIL  419

Query  683   AGGRFQSQ  660
             +      Q
Sbjct  420   SNETVNPQ  427



>emb|CDO99390.1| unnamed protein product [Coffea canephora]
Length=436

 Score =   502 bits (1293),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 237/343 (69%), Positives = 294/343 (86%), Gaps = 0/343 (0%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             IAY ISGS+ ++GRI+RLLF++YHP+N YLLHLD  A +++RD LA+ + + PLF+AA+N
Sbjct  92    IAYLISGSSNETGRILRLLFSIYHPKNIYLLHLDSRASQAERDNLAVKIQSFPLFKAAQN  151

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V+V+G AD VY +GSS++S+ LHGAS  LRIS NWDWFINLS  DYPLVTQDDLLHILSY
Sbjct  152   VNVVGKADIVYQQGSSTISAILHGASTFLRISKNWDWFINLSVDDYPLVTQDDLLHILSY  211

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LPKDLNFVNHTSYIGW ES+KLKPIIVDPGLY+ E+++VF+ATQ+RPLPD+FR+F GSS 
Sbjct  212   LPKDLNFVNHTSYIGWIESRKLKPIIVDPGLYILEENEVFFATQKRPLPDAFRLFTGSSS  271

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
             +ILSRKF++FCILGT+N PRT+LMYL+NTPS+++VYFPT+LCN+++FNRTIINHNLQYVS
Sbjct  272   AILSRKFIEFCILGTDNLPRTVLMYLANTPSANSVYFPTILCNTQKFNRTIINHNLQYVS  331

Query  959   LNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGN  780
             LN RKE  +LNSS + D+++SGAAFAS F+  DPILD+ID EILHR+P KPVPGGWCLG 
Sbjct  332   LNLRKEPHLLNSSYYTDLVQSGAAFASRFRPDDPILDRIDKEILHRAPRKPVPGGWCLGE  391

Query  779   GESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
                  C VWGDAD+L+PG+GAKRLE   +EL +   F SQQC+
Sbjct  392   SGLDSCKVWGDADILKPGLGAKRLENRLLELLSKETFLSQQCV  434



>gb|KDP20340.1| hypothetical protein JCGZ_06426 [Jatropha curcas]
Length=435

 Score =   502 bits (1292),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 289/349 (83%), Gaps = 2/349 (1%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             PSIAY ISGS GDS RI+RLL+A YHP+N YLLHLDR A ++DR+ LA++V +VP+FRAA
Sbjct  87    PSIAYLISGSKGDSNRILRLLYAAYHPKNQYLLHLDRFASQADRERLAITVQSVPIFRAA  146

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHIL  1326
             +NV+V+G ADF Y KGSS++S+TLHGA+ILLR+S NWDWF+NLS+ DYPL+TQDDLLHI 
Sbjct  147   KNVNVIGKADFAYPKGSSTISATLHGAAILLRLSKNWDWFVNLSAGDYPLITQDDLLHIF  206

Query  1325  SYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGS  1146
             SYLPKD NF+NHTSY+GWRES+K+KPIIVDPGLYL++ +D+FYA+Q+R LP++FR+F GS
Sbjct  207   SYLPKDFNFLNHTSYLGWRESRKMKPIIVDPGLYLSDRTDMFYASQKRELPNAFRIFTGS  266

Query  1145  SYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQY  966
               SILSR F++ CILGT+N PRTLLMY SNT SS   YFPTVLCNS QFNRTIIN+NL+Y
Sbjct  267   RLSILSRNFMEHCILGTDNLPRTLLMYFSNTRSSLTNYFPTVLCNSHQFNRTIINNNLEY  326

Query  965   VSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGW  792
             V+    S++    LN  +F  MI+SGAAFAS F+  DP+L++ID EIL R+PG+ VPGGW
Sbjct  327   VAFEKTSKQANHTLNIREFDAMIQSGAAFASQFQHDDPVLERIDQEILGRNPGQVVPGGW  386

Query  791   CLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             CLG+ E+G C+VWGDA VLRPG GA RLEK  +EL + G F+S QCI E
Sbjct  387   CLGDPENGTCSVWGDAYVLRPGQGAARLEKRIVELLSKGAFRSHQCIVE  435



>ref|XP_006420517.1| hypothetical protein CICLE_v10004926mg [Citrus clementina]
 gb|ESR33757.1| hypothetical protein CICLE_v10004926mg [Citrus clementina]
Length=465

 Score =   502 bits (1292),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 299/368 (81%), Gaps = 8/368 (2%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
             P+ P ++  H       P PPS+AY ISGSAGD+ RIVRLL AVYHP+N YLLHLDRSAP
Sbjct  105   PAFPSKIPSH-------PAPPSLAYLISGSAGDAARIVRLLHAVYHPKNQYLLHLDRSAP  157

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
             +++RD LA+++ +VP+FRAA+NV V+G ADF Y  GS+S+SSTLHGASILL++S NWDWF
Sbjct  158   QAERDSLAVTIESVPVFRAAQNVDVIGKADFSYPAGSTSISSTLHGASILLKLSKNWDWF  217

Query  1385  INLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD  1206
             INL++ADYPL+ QDDLLHILSY+PK+LNFVNHTSY+ WR+S ++K IIVDPGLYL+E + 
Sbjct  218   INLNAADYPLIKQDDLLHILSYMPKELNFVNHTSYLDWRDSSRMKRIIVDPGLYLSEQNP  277

Query  1205  VFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFP  1026
             +FY +Q+R LP++FR+F GS+  ILSR F++FCILGT+N PRTLLMYLSNTPSS   YFP
Sbjct  278   MFYVSQKRQLPNAFRLFSGSAVVILSRNFVEFCILGTDNLPRTLLMYLSNTPSSFPNYFP  337

Query  1025  TVLCNSRQFNRTIINHNLQYVSLNS-RKEARVLNSSDFLDMIRSGAAFASPFKERDPILD  849
             T+LCNS QFN+T+IN +L YV+ +   K+   LNS++F DMI+SGA FAS F+  DP+LD
Sbjct  338   TILCNSHQFNKTVINDSLLYVACDKPSKQNCTLNSTEFDDMIQSGAIFASQFQFDDPVLD  397

Query  848   QIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRF  669
             +ID EIL+RSPG  VPGGWCLG   +  C+VWGDAD+LRPG G++RLE   IE+F+GG F
Sbjct  398   RIDREILNRSPGNVVPGGWCLGEPGNNTCSVWGDADILRPGPGSRRLENRLIEMFSGGNF  457

Query  668   QSQQCIEE  645
             +SQQCI E
Sbjct  458   RSQQCILE  465



>ref|XP_004134387.1| PREDICTED: xylosyltransferase-like [Cucumis sativus]
 gb|KGN56778.1| hypothetical protein Csa_3G133290 [Cucumis sativus]
Length=470

 Score =   499 bits (1286),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 291/363 (80%), Gaps = 2/363 (1%)
 Frame = -2

Query  1733  HRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDR  1554
             HR + H   +S  P PPSIAY ISGS GDS RI+RLLFA YHPRNHYLLHLD SAP+S+R
Sbjct  105   HRTVFHSSNASSDPTPPSIAYLISGSNGDSDRILRLLFAAYHPRNHYLLHLDLSAPQSER  164

Query  1553  DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLS  1374
             D LAL+V +VP+FRAA+NV V+G ADFVY KGSS++SSTLHGAS+LL +S NWDWFI L+
Sbjct  165   DSLALAVESVPIFRAAQNVDVIGRADFVYLKGSSAISSTLHGASLLLHLSPNWDWFIRLT  224

Query  1373  SADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYA  1194
             + DYPLVTQDDLLHILS+LPKD+NFV H+SYIGWRE++KLKPIIVDPGLYL+E + +FYA
Sbjct  225   ADDYPLVTQDDLLHILSFLPKDMNFVTHSSYIGWRETKKLKPIIVDPGLYLSEKTAMFYA  284

Query  1193  TQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLC  1014
             TQ+R LP++F++F GSS SILSR  ++FCILGT+N PRTLLMY SNT S    YFPTVLC
Sbjct  285   TQKRELPNAFQLFTGSSLSILSRNVVEFCILGTDNLPRTLLMYFSNTQSGHLNYFPTVLC  344

Query  1013  NSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQID  840
             NS QFN+T+ N NL +   +   ++E  VL SSDF  MI SGAAFA+ FK  DP+L++ID
Sbjct  345   NSHQFNKTVFNDNLLFAIYDKPPKEEPHVLGSSDFDLMIDSGAAFATRFKLNDPVLNRID  404

Query  839   SEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQ  660
             +EIL+R PG  VPGGWCLG   +  C VWG+ADV+RPG+GA+RLEK  + L + G F+S 
Sbjct  405   NEILNRGPGHTVPGGWCLGEAGNDTCLVWGNADVIRPGLGARRLEKRIVGLLSNGTFRSN  464

Query  659   QCI  651
             +C+
Sbjct  465   RCV  467



>ref|XP_006492148.1| PREDICTED: uncharacterized protein LOC102619366 [Citrus sinensis]
Length=467

 Score =   496 bits (1276),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 298/368 (81%), Gaps = 8/368 (2%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
             P+ P ++  H       P PPS+AY ISGSAGD+ RIVRLL AVYHP+N YLLHLD+SAP
Sbjct  107   PAFPSKIPSH-------PAPPSLAYLISGSAGDAARIVRLLHAVYHPKNQYLLHLDQSAP  159

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
             +++RD LA++V +VP+FRAA+NV V+G ADF Y  GS+S+SSTLHGASILL++S NWDWF
Sbjct  160   QAERDSLAVTVESVPVFRAAQNVDVIGKADFSYPAGSTSISSTLHGASILLKLSKNWDWF  219

Query  1385  INLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD  1206
             INL++ADYPL+ QDDLLHILSY+PK+LNFVNHTSY+  R+S +LK IIVDPGLYL+E + 
Sbjct  220   INLNAADYPLIKQDDLLHILSYMPKELNFVNHTSYLDRRDSIRLKRIIVDPGLYLSEKNP  279

Query  1205  VFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFP  1026
             +FY +Q+R LP++FR+F GS+  ILSR F++FCILGT+N PRTLLMYLSNTPSS   YFP
Sbjct  280   MFYVSQKRQLPNAFRLFSGSTVVILSRNFVEFCILGTDNLPRTLLMYLSNTPSSFPNYFP  339

Query  1025  TVLCNSRQFNRTIINHNLQYVSLNS-RKEARVLNSSDFLDMIRSGAAFASPFKERDPILD  849
             T+LCNS QFN+T+IN NL +V+ +   K+   LNS++F DMI+SGA FAS F+  DP+LD
Sbjct  340   TILCNSHQFNKTVINDNLLFVACDKPSKQNCTLNSTEFDDMIQSGAIFASQFRFDDPVLD  399

Query  848   QIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRF  669
             +ID EIL+RSPG  VPGGWCLG   +  C+VWGDAD+LRPG G++RLE   IE+F+GG F
Sbjct  400   RIDREILNRSPGNVVPGGWCLGEPGNNTCSVWGDADILRPGPGSRRLENRLIEMFSGGNF  459

Query  668   QSQQCIEE  645
             +SQQCI E
Sbjct  460   RSQQCILE  467



>gb|KDO43049.1| hypothetical protein CISIN_1g012284mg [Citrus sinensis]
Length=467

 Score =   494 bits (1273),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 234/368 (64%), Positives = 298/368 (81%), Gaps = 8/368 (2%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
             P+ P ++  H       P PPS+AY ISGSAGD+ RIVRLL AVYHP+N YLLHLD+SAP
Sbjct  107   PAFPSKIPSH-------PAPPSLAYLISGSAGDAARIVRLLHAVYHPKNQYLLHLDQSAP  159

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
             +++RD LA+++ +VP+FRAA+NV V+G ADF Y  GS+S+SSTLHGASILL++S NWDWF
Sbjct  160   QAERDSLAVTIESVPVFRAAQNVDVIGKADFSYPAGSTSISSTLHGASILLKLSKNWDWF  219

Query  1385  INLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD  1206
             INL++ADYPL+ QDDLLHILSY+PK+LNFVNHTSY+  R+S ++K IIVDPGLYL+E + 
Sbjct  220   INLNAADYPLIKQDDLLHILSYMPKELNFVNHTSYLDRRDSSRMKRIIVDPGLYLSEQNP  279

Query  1205  VFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFP  1026
             +FY +Q+R LP++FR+F GS+  ILSR F++FCILGT+N PRTLLMYLSNTPSS   YFP
Sbjct  280   MFYVSQKRQLPNAFRLFSGSAVVILSRNFVEFCILGTDNLPRTLLMYLSNTPSSFPNYFP  339

Query  1025  TVLCNSRQFNRTIINHNLQYVSLNS-RKEARVLNSSDFLDMIRSGAAFASPFKERDPILD  849
             T+LCNS QFN+T+IN +L YV+ +   K+   LNS++F DMI+SGA FAS F+  DP+LD
Sbjct  340   TILCNSHQFNKTVINDSLLYVACDKPSKQNCTLNSTEFDDMIQSGAIFASQFQFDDPVLD  399

Query  848   QIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRF  669
             +ID EIL+RSPG  VPGGWCLG   +  C+VWGDAD+LRPG G++RLE   IE+F+GG F
Sbjct  400   RIDREILNRSPGNVVPGGWCLGEPGNNTCSVWGDADILRPGPGSRRLENRLIEMFSGGNF  459

Query  668   QSQQCIEE  645
             +SQQCI E
Sbjct  460   RSQQCILE  467



>gb|KEH41216.1| core-2/I-branching enzyme [Medicago truncatula]
Length=439

 Score =   493 bits (1270),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 292/368 (79%), Gaps = 4/368 (1%)
 Frame = -2

Query  1748  HPSH-PHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRS  1572
             +P+H  HR++   D ++PPP  PSIAY ISGS GDSGRI+RLL+A YHP N YLLHLD S
Sbjct  74    YPTHQTHRIIYDQDKTTPPP--PSIAYLISGSKGDSGRILRLLYATYHPLNQYLLHLDPS  131

Query  1571  APKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWD  1392
             AP+SDR+ LAL V +  +F AA+NVHVMG  DFVY KGSS +S TLH A+IL+R+S  WD
Sbjct  132   APQSDREKLALVVQSNTVFEAAKNVHVMGKPDFVYVKGSSPVSFTLHAAAILIRLSLRWD  191

Query  1391  WFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAED  1212
             WF++LS+  YPLVTQDDLLHI+S+LPKD+NFVNH+SYIGW+ES+KLKPIIVDPGLYL+E 
Sbjct  192   WFVSLSADSYPLVTQDDLLHIMSFLPKDMNFVNHSSYIGWKESKKLKPIIVDPGLYLSEG  251

Query  1211  SDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVY  1032
             +++FYATQ+R LP ++R+F GSS+SILSR F++FCILG +N PR LLMY SNTPSS + Y
Sbjct  252   TEMFYATQKRELPSAYRMFTGSSFSILSRNFMEFCILGVDNLPRILLMYFSNTPSSLSNY  311

Query  1031  FPTVLCNSRQFNRTIINHNLQYVSLNS-RKEARVLNSSDFLDMIRSGAAFASPFKERDPI  855
             FPTVLCNSRQFN+T+IN +L Y   +S R   R LNS+DF +MI SGA FA  F+  DP+
Sbjct  312   FPTVLCNSRQFNKTVINQDLLYAVYDSHRNNLRPLNSTDFDNMIHSGAVFAKKFQPDDPV  371

Query  854   LDQIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGG  675
             LD ID +IL+RSPG  VPGGWCLG   +  C  WGDA +LRPG G+KRLEK  +EL + G
Sbjct  372   LDLIDQKILNRSPGSVVPGGWCLGEPGNSTCLTWGDASILRPGKGSKRLEKAIVELLSNG  431

Query  674   RFQSQQCI  651
              F+S+QCI
Sbjct  432   TFRSRQCI  439



>ref|XP_008438407.1| PREDICTED: uncharacterized protein LOC103483514 [Cucumis melo]
Length=470

 Score =   494 bits (1273),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 235/363 (65%), Positives = 288/363 (79%), Gaps = 2/363 (1%)
 Frame = -2

Query  1733  HRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDR  1554
             HR + H    S  P PPSIAY ISGS GDS RI+RLL AVYHPRNHYLLHLD SAP+S+R
Sbjct  105   HRTVFHSSNVSSDPTPPSIAYLISGSNGDSDRILRLLLAVYHPRNHYLLHLDLSAPQSER  164

Query  1553  DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLS  1374
             D LAL+V  VP+F+AA+NV V+G ADFVY KGSS++SSTLHGAS+LL +S NWDWFI L+
Sbjct  165   DSLALAVELVPIFKAAQNVDVIGRADFVYLKGSSAISSTLHGASLLLHLSPNWDWFIRLT  224

Query  1373  SADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYA  1194
             + DYPLVTQDDLLHILS+LPKD+NF  H+SYIGWRE++KLKPIIVDPGLYL+E + +FYA
Sbjct  225   ADDYPLVTQDDLLHILSFLPKDMNFATHSSYIGWREARKLKPIIVDPGLYLSEKTAMFYA  284

Query  1193  TQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLC  1014
             TQ+R LP++F++F GSS SILSR  ++FCILGT+N PRTLLMY SNT S    YFPTVLC
Sbjct  285   TQKRELPNAFQLFTGSSLSILSRNVVEFCILGTDNLPRTLLMYFSNTQSGHLNYFPTVLC  344

Query  1013  NSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQID  840
             NS QFN+T++N NL +   +   +++  VL SSDF  MI SGAAFA+ FK  DP+L++ID
Sbjct  345   NSHQFNKTVLNDNLLFAIYDKPPKEQPHVLGSSDFDLMIESGAAFATRFKLNDPVLNRID  404

Query  839   SEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQ  660
             +EIL+R PG  VPGGWCLG   +  C VWGDADV+RPG GA+RLEK  + L + G F+S 
Sbjct  405   NEILNRGPGHTVPGGWCLGEAGNDTCLVWGDADVIRPGSGARRLEKRIVGLLSNGTFRSN  464

Query  659   QCI  651
             +C+
Sbjct  465   RCV  467



>ref|XP_010264011.1| PREDICTED: xylosyltransferase 1 [Nelumbo nucifera]
Length=445

 Score =   493 bits (1270),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 230/351 (66%), Positives = 284/351 (81%), Gaps = 2/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PPSIAY+I+GS GDS RI+RLLFA+YHPRN YLLHLD +A +S R  LALSV +VP+F
Sbjct  74    PTPPSIAYFITGSNGDSERILRLLFAIYHPRNQYLLHLDLTANQSQRHQLALSVQSVPIF  133

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             RA +NV+V+G ADF YS+GSS++SSTLHGA+ILLR SS+WDWFINLS+ADYPLVTQDDLL
Sbjct  134   RAVQNVNVVGKADFAYSRGSSAISSTLHGAAILLRFSSSWDWFINLSAADYPLVTQDDLL  193

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HILS+LPKDLNFVNHTS IGWRES+++KPIIVDPGLYL+  SD+FY TQ+R LP ++R+F
Sbjct  194   HILSFLPKDLNFVNHTSRIGWRESRRMKPIIVDPGLYLSAKSDIFYVTQKRELPQAYRLF  253

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS+ +ILSRKF++FCILG++N PR LLM+ SN PSS A YF TVLCNS++F +T +NHN
Sbjct  254   TGSASAILSRKFVEFCILGSDNLPRVLLMFFSNMPSSLASYFQTVLCNSQEFKKTTVNHN  313

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             LQYVS +   R+E  +L  +DF +MI SGAAF S F + DP+LD+ID EIL+R+ GK +P
Sbjct  314   LQYVSWDKPPRQEPCILTLNDFDEMIHSGAAFGSQFLQNDPVLDRIDEEILNRTAGKIIP  373

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIE  648
             GGWC+ +  +  C VWGD  VLRPG GAKRLEK  +EL + G     QC E
Sbjct  374   GGWCISDSNNDPCTVWGDTAVLRPGPGAKRLEKRIVELLSNGTLHVNQCSE  424



>ref|XP_010245653.1| PREDICTED: xylosyltransferase 1-like [Nelumbo nucifera]
Length=469

 Score =   492 bits (1266),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 224/359 (62%), Positives = 291/359 (81%), Gaps = 2/359 (1%)
 Frame = -2

Query  1718  HGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLAL  1539
               D SS  P+PPSIAY+I+GS GDS R++RLLFA+YHPRN YLLHLD +AP+S RD LA+
Sbjct  80    QADHSSLTPKPPSIAYFITGSNGDSQRMLRLLFAIYHPRNQYLLHLDLTAPQSQRDELAV  139

Query  1538  SVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYP  1359
             SV +VP+FRAA+NV+V+G ADF YS+GSS+++STLHGA+ILLR  S+WDWFINLS+ADYP
Sbjct  140   SVQSVPVFRAAQNVNVVGKADFAYSRGSSAVASTLHGAAILLRFFSDWDWFINLSAADYP  199

Query  1358  LVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRP  1179
             LVTQDDLLHI S+LPKDLNFVNHTS+IGWRES+++KPII+DPG YL   SD+FYATQ+R 
Sbjct  200   LVTQDDLLHIFSFLPKDLNFVNHTSHIGWRESRRMKPIIIDPGFYLTAKSDIFYATQKRE  259

Query  1178  LPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQF  999
              P+++R+F G + +IL+R+F++FC+LG++N PR LLMY SN PSS A YF T+LCNS + 
Sbjct  260   FPNAYRLFTGLASTILNREFVEFCVLGSDNLPRILLMYFSNMPSSQANYFQTILCNSPEL  319

Query  998   NRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILH  825
              +TI+NHNL +VS ++  ++E R L+  DF +MI+SGAAF S F   DP+LD+ID E+L+
Sbjct  320   KKTIVNHNLHHVSWDTPPKREPRALSLKDFNEMIQSGAAFGSRFLPDDPVLDRIDEEVLN  379

Query  824   RSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIE  648
             R+ GK +PGGWCLG+ ++  C VWGD DVLRPG G KRLE+  +EL + G F + QC E
Sbjct  380   RTAGKVIPGGWCLGDPKNDSCTVWGDVDVLRPGPGGKRLERRIVELLSSGTFHANQCDE  438



>ref|XP_004157711.1| PREDICTED: xylosyltransferase 1-like [Cucumis sativus]
Length=445

 Score =   488 bits (1257),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 231/347 (67%), Positives = 283/347 (82%), Gaps = 2/347 (1%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             PSIAY ISGS GDS RI+RLLFA YHPRNHYLLHLD SAP+S+RD LAL+V +VP+FRAA
Sbjct  96    PSIAYLISGSNGDSDRILRLLFATYHPRNHYLLHLDLSAPQSERDSLALAVESVPIFRAA  155

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHIL  1326
             +NV V+G ADFVY KGSS++SSTLHGAS+LL +S NWDWFI L++ DYPLVTQDDLLHIL
Sbjct  156   QNVDVIGRADFVYLKGSSAISSTLHGASLLLHLSPNWDWFIRLTADDYPLVTQDDLLHIL  215

Query  1325  SYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGS  1146
             S+LPKD+NFV H+SYIGWRE++KLKPIIVDPGLYL+E + +FYATQ+R LP++F++F GS
Sbjct  216   SFLPKDMNFVTHSSYIGWRETKKLKPIIVDPGLYLSEKTAMFYATQKRELPNAFQLFTGS  275

Query  1145  SYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQY  966
             S SILSR  ++FCILGT+N PRTLLMY SNT S    YFPTVLCNS QFN+T+ N NL +
Sbjct  276   SLSILSRNVVEFCILGTDNLPRTLLMYFSNTQSGHLNYFPTVLCNSHQFNKTVFNDNLLF  335

Query  965   VSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGW  792
                +   ++E  VL SSDF  MI SGAAFA+ FK  DP+L++ID+EIL+R PG  VPGGW
Sbjct  336   AIYDKPPKEEPHVLGSSDFDLMIDSGAAFATRFKLNDPVLNRIDNEILNRGPGHTVPGGW  395

Query  791   CLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             CLG   +  C VWG+ADV+RPG+GA+RLEK  + L + G F+S +C+
Sbjct  396   CLGEAGNDTCLVWGNADVIRPGLGARRLEKRIVGLLSNGTFRSNRCV  442



>ref|XP_004497742.1| PREDICTED: xylosyltransferase 1-like [Cicer arietinum]
Length=430

 Score =   488 bits (1255),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 237/368 (64%), Positives = 288/368 (78%), Gaps = 4/368 (1%)
 Frame = -2

Query  1748  HPSH-PHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRS  1572
             +P+H  HR++   D ++PPP  PSIAY ISGS GDSGRI+RLL A YHP NHYLLHLD S
Sbjct  65    YPTHQTHRIIYDQDKTTPPP--PSIAYLISGSKGDSGRILRLLSATYHPLNHYLLHLDPS  122

Query  1571  APKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWD  1392
             A  SDR+ LAL V    +F+AA+NVHVMG  DFVY+KGSS +S TLH ASI LR+S  WD
Sbjct  123   ASHSDRENLALVVQKNRVFKAAQNVHVMGKPDFVYTKGSSPVSFTLHAASIFLRLSVKWD  182

Query  1391  WFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAED  1212
             WF++LS+  YPLVTQDDLLHI+S+LPKD+NFVNH+SYIGW+E +KLKPIIVDPGLYL+E 
Sbjct  183   WFVSLSADSYPLVTQDDLLHIMSFLPKDMNFVNHSSYIGWKELRKLKPIIVDPGLYLSEG  242

Query  1211  SDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVY  1032
             +D+FYATQ+R LP ++R+F GSS+SILSR F++FCILG +N PR LLMY SNTPSS + Y
Sbjct  243   TDMFYATQKRDLPSAYRLFTGSSFSILSRNFMEFCILGVDNLPRILLMYFSNTPSSLSSY  302

Query  1031  FPTVLCNSRQFNRTIINHNLQYVSLNS-RKEARVLNSSDFLDMIRSGAAFASPFKERDPI  855
             FPTVLCNSRQFNRT+IN +L Y   +S R + R LNS+DF +M+ SGAAFA  F+  DP+
Sbjct  303   FPTVLCNSRQFNRTVINQDLLYSIYDSHRNDLRSLNSTDFDNMLHSGAAFARKFEPDDPV  362

Query  854   LDQIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGG  675
             LD ID +IL RSPG  VPGGWCLG   +  C  WGDA +LRPG G++RLEK  +EL   G
Sbjct  363   LDLIDQKILDRSPGSVVPGGWCLGEPGNNTCLTWGDASILRPGTGSQRLEKAIVELLLNG  422

Query  674   RFQSQQCI  651
              F+S QCI
Sbjct  423   TFRSHQCI  430



>ref|XP_010025822.1| PREDICTED: xylosyltransferase 1 [Eucalyptus grandis]
Length=372

 Score =   483 bits (1243),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 230/341 (67%), Positives = 279/341 (82%), Gaps = 1/341 (0%)
 Frame = -2

Query  1673  YYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNVH  1494
             Y+ISGSAG SGRI+RLL A YHP+NHYLLHLDR AP++DRD LAL+V + P+FRAA+NV 
Sbjct  28    YFISGSAGHSGRILRLLHAAYHPKNHYLLHLDRFAPQADRDALALAVQSSPIFRAAQNVD  87

Query  1493  VMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYLP  1314
             V+G ADF Y KGSS +S+TLHGASILLR++  WDWF+NL++ DYPLVTQDDLLHILSYLP
Sbjct  88    VLGRADFAYPKGSSPISATLHGASILLRLAPRWDWFVNLNALDYPLVTQDDLLHILSYLP  147

Query  1313  KDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYSI  1134
             KDLNF+NHTSYIGWRES+KL+PIIVDPGLYL E +++FYA+Q+R LPD+FR+F GS+++I
Sbjct  148   KDLNFLNHTSYIGWRESRKLRPIIVDPGLYLTEKTEMFYASQKRNLPDAFRLFSGSTFAI  207

Query  1133  LSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSLN  954
             LSR F++ CILGT+N PRTLLMYLSNTPSS + YFPT+LCNS QFN TI+N NLQY S  
Sbjct  208   LSRNFIEHCILGTDNLPRTLLMYLSNTPSSLSNYFPTILCNSHQFNHTIVNTNLQYTSNK  267

Query  953   SRK-EARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGNG  777
             S K E   L+S+DF + I+SGAAFAS F   + +LD+ID EIL R P K VPGGWCLG  
Sbjct  268   SMKGEYPELDSNDFDNSIKSGAAFASSFPTDESVLDRIDREILGRYPDKVVPGGWCLGES  327

Query  776   ESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              +  C++WGDADVLRPG GA+RLEK  +   + G   SQQC
Sbjct  328   RNDTCSIWGDADVLRPGPGARRLEKFLVSFLSNGTVLSQQC  368



>ref|XP_008223996.1| PREDICTED: xylosyltransferase 1 [Prunus mume]
Length=438

 Score =   485 bits (1248),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 226/363 (62%), Positives = 293/363 (81%), Gaps = 1/363 (0%)
 Frame = -2

Query  1733  HRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDR  1554
             HR++ H D +S  P PPSIAY +SGS GD GRI+RLL+A YHPRN YLLHLDR A  S+R
Sbjct  77    HRIVYH-DNNSSDPIPPSIAYLLSGSKGDLGRILRLLYATYHPRNQYLLHLDRFASDSER  135

Query  1553  DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLS  1374
             + LAL V ++ +FRAA+NVHV+G ADFVY  GSS +S TLHGASILLR+S+ WDWFI+LS
Sbjct  136   EKLALKVQSLSIFRAAQNVHVIGKADFVYPTGSSGISFTLHGASILLRLSTIWDWFISLS  195

Query  1373  SADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYA  1194
               DYPLVTQDDLLHI+S+LPKDLNFVNH+SYIGWRES++LKPIIVDPGLYL++ +++FYA
Sbjct  196   VGDYPLVTQDDLLHIMSFLPKDLNFVNHSSYIGWRESRRLKPIIVDPGLYLSQKTEMFYA  255

Query  1193  TQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLC  1014
              Q+R LP+++R+F GSS++ILSR F++FC++GT+N PRT+LMY SNTPS+ + YFPT+LC
Sbjct  256   AQKRVLPNAYRLFTGSSFAILSRNFIEFCVVGTDNLPRTVLMYFSNTPSALSNYFPTILC  315

Query  1013  NSRQFNRTIINHNLQYVSLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSE  834
             NS QFN+T+INHNL Y + ++RK+ + ++S D+  MI  GAAFA+ F+  DP+LD+ID +
Sbjct  316   NSYQFNKTVINHNLLYANFDTRKKPQPISSDDYDVMIHHGAAFATGFRLDDPMLDRIDRD  375

Query  833   ILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             +L R  GK VPGGWCLG   +  C+VWGDAD+LRPG G + LEK  + L + G F+S QC
Sbjct  376   VLKRGRGKVVPGGWCLGGFGNDTCSVWGDADILRPGPGVRGLEKLMVGLLSNGSFRSHQC  435

Query  653   IEE  645
             + E
Sbjct  436   LYE  438



>ref|XP_009362054.1| PREDICTED: xylosyltransferase 1-like [Pyrus x bretschneideri]
Length=472

 Score =   486 bits (1251),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 230/365 (63%), Positives = 295/365 (81%), Gaps = 3/365 (1%)
 Frame = -2

Query  1733  HRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDR  1554
             HR++ H D +S  P PPSIAY +SGS GD GRI+RLL A YHPRN YLLHLDRSA  S+R
Sbjct  109   HRIIYH-DNNSSDPTPPSIAYLVSGSKGDLGRILRLLHAAYHPRNQYLLHLDRSASDSER  167

Query  1553  DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLS  1374
             + LAL V ++P+FRAA+NVHV+G ADFVY  GSS++S TLHGASILLR+S NWDWFI+LS
Sbjct  168   EKLALRVQSLPIFRAAQNVHVIGKADFVYPTGSSAISFTLHGASILLRLSPNWDWFISLS  227

Query  1373  SADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYA  1194
               DYPL+TQDDLLHI+S+LPKDLNFVNH+SYIGWRES++L+PIIVDPGLYL+E +D+FYA
Sbjct  228   VRDYPLITQDDLLHIMSFLPKDLNFVNHSSYIGWRESRRLRPIIVDPGLYLSEKTDMFYA  287

Query  1193  TQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLC  1014
             TQ+R LP+++R+F GSS++ILSR F++FC++G EN PRTLLMY SNTPS+ + YFPT+LC
Sbjct  288   TQKRVLPNAYRLFTGSSFTILSRNFIEFCVVGIENLPRTLLMYFSNTPSALSNYFPTILC  347

Query  1013  NSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQID  840
             NS+QFN+TIINHNL Y + ++  R++ + ++S+ +  MI+ GAAFA+  +  DPILD++D
Sbjct  348   NSQQFNKTIINHNLVYANSDTPPREKPQPISSTGYDAMIQHGAAFATGLQLDDPILDRVD  407

Query  839   SEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQ  660
              EIL R  GK VPGGWCLG   +  C+VWGDAD+LRP   A+ LE+  + L + G F+S 
Sbjct  408   REILKRRRGKIVPGGWCLGGFANDTCSVWGDADILRPSPRARILERLLVRLLSNGTFRSH  467

Query  659   QCIEE  645
             QCI E
Sbjct  468   QCIYE  472



>gb|KHG13957.1| Xylosyltransferase 1 [Gossypium arboreum]
Length=434

 Score =   484 bits (1246),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 286/352 (81%), Gaps = 2/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PPSIAY+ISGSAGDS RI+RLL A YHPRNHYLLHLD SA +++RD LA+++  +P+F
Sbjct  83    PTPPSIAYFISGSAGDSARILRLLLASYHPRNHYLLHLDLSASQTERDRLAITIQAIPIF  142

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +AA+NV V+G +D+ Y +G S++SSTLHGASILLR++S+W+WFI+L++ DYPL TQDD+L
Sbjct  143   KAAQNVDVVGKSDYAYPRGPSAISSTLHGASILLRLASDWNWFISLNAGDYPLATQDDIL  202

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HILSYLPKDLNFVNHT+YIGW+ES+KLKPIIVD GLYL E  ++FYATQ+R LP +F++F
Sbjct  203   HILSYLPKDLNFVNHTNYIGWKESKKLKPIIVDTGLYLLEKEEIFYATQKRELPTAFKLF  262

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GSS+++L+R F++FCILGT+N PRTLLMY +NTP S + YFPTVLCNS Q+ +T+INHN
Sbjct  263   SGSSFTMLTRSFVEFCILGTDNLPRTLLMYFTNTPYSYSNYFPTVLCNSDQYKKTVINHN  322

Query  974   LQYVSLNSRKEAR--VLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             LQ+V+ N     +   L   +F  MI+SGAAFA+ F+   P+LD+ID EIL RSPGK VP
Sbjct  323   LQHVAFNKTISTKPLSLKPEEFDAMIQSGAAFATHFQFDSPVLDRIDREILKRSPGKVVP  382

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             GGWCLG   +  C+VWGDA +LRPG GAKRL+K  ++L A  +++S QC +E
Sbjct  383   GGWCLGEPANDTCSVWGDASILRPGPGAKRLKKRIVDLLADDKYRSMQCRDE  434



>ref|XP_009365478.1| PREDICTED: xylosyltransferase 1-like [Pyrus x bretschneideri]
Length=452

 Score =   485 bits (1248),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 229/362 (63%), Positives = 293/362 (81%), Gaps = 3/362 (1%)
 Frame = -2

Query  1733  HRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDR  1554
             HR++ H D +S  P PPSIAY +SGS GD GRI+RLL+A YHPRN YLLHLDRSA  S+R
Sbjct  91    HRIIYH-DNNSSDPTPPSIAYLLSGSKGDLGRILRLLYAAYHPRNQYLLHLDRSASDSER  149

Query  1553  DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLS  1374
             + LAL V ++P+FRAA+NVHV+G ADFVY  GSS++S TLHGASILLR+S NWDWFI+LS
Sbjct  150   EKLALRVQSLPIFRAAQNVHVIGKADFVYPTGSSAISFTLHGASILLRLSPNWDWFISLS  209

Query  1373  SADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYA  1194
               DYPL+TQDDLLHI+S+LPKDLNFVNH+SYIGWRES++L+PIIVDPGLYL+E +D+FYA
Sbjct  210   VRDYPLITQDDLLHIMSFLPKDLNFVNHSSYIGWRESRRLRPIIVDPGLYLSEKTDMFYA  269

Query  1193  TQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLC  1014
             TQ+R LP+++R+F GSS++ILSR F++FC++G +N PRTLLMY SNTPS+ + YFPT+LC
Sbjct  270   TQKRVLPNAYRLFSGSSFTILSRNFIEFCVVGIDNLPRTLLMYFSNTPSALSNYFPTILC  329

Query  1013  NSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQID  840
             NS+QFN+TIINHNL Y +  +  R++ + ++S D+  MI+ GAAFA+  +  DPILD++D
Sbjct  330   NSQQFNKTIINHNLVYANSETPPREKPQPISSGDYDAMIQHGAAFATGLRVDDPILDRVD  389

Query  839   SEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQ  660
              EIL R  GK VPGGWCLG   +  C+VWGDAD+LRP   A+RLE+  + L + G F S 
Sbjct  390   REILKRRRGKVVPGGWCLGGFANDTCSVWGDADILRPSPQARRLEQLLVGLLSNGTFLSH  449

Query  659   QC  654
             QC
Sbjct  450   QC  451



>ref|XP_008352918.1| PREDICTED: xylosyltransferase 1-like [Malus domestica]
Length=466

 Score =   484 bits (1247),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 230/365 (63%), Positives = 295/365 (81%), Gaps = 3/365 (1%)
 Frame = -2

Query  1733  HRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDR  1554
             HR++ H D +S  P PPSIAY +SGS GD GRI+RLL A YHPRN YLLHLDRSA  S+R
Sbjct  103   HRIIYH-DNNSSDPTPPSIAYLLSGSKGDLGRILRLLHAAYHPRNQYLLHLDRSASDSER  161

Query  1553  DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLS  1374
             + LAL V ++P+FRAA+NVHV+GNADFVY  GSS++S TLHGASILLR+S NWDWFI+LS
Sbjct  162   EKLALRVQSLPIFRAAQNVHVIGNADFVYPTGSSAISFTLHGASILLRLSPNWDWFISLS  221

Query  1373  SADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYA  1194
               DYPL+TQDDLLHI+S+LPKDLNFVNH+SYIGWRES++L+PIIVDPGLYL+E +D+FYA
Sbjct  222   VRDYPLITQDDLLHIMSFLPKDLNFVNHSSYIGWRESRRLRPIIVDPGLYLSEKTDMFYA  281

Query  1193  TQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLC  1014
             TQ+R LP+++R+F GSS++ILSR F++FC++G EN PRTLLMY SNTPS+ + YFPT+LC
Sbjct  282   TQKRVLPNAYRLFTGSSFTILSRNFIEFCVVGIENLPRTLLMYFSNTPSALSNYFPTILC  341

Query  1013  NSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQID  840
             NS+QFN+TIINHNL Y + ++  R++ + ++S+ +  MI+ GAAFA+  +  DPILD++D
Sbjct  342   NSQQFNKTIINHNLVYANSDTPPREKPQPISSTGYDAMIQHGAAFATGLQLDDPILDRVD  401

Query  839   SEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQ  660
              E L R  GK VPGGWCLG   +  C+VWGDAD+LRP   A+ LE+  + L + G F S 
Sbjct  402   REXLKRRRGKVVPGGWCLGGFANDTCSVWGDADILRPSPRARILERLLVRLLSNGTFLSH  461

Query  659   QCIEE  645
             QCI+E
Sbjct  462   QCIDE  466



>ref|XP_010097995.1| Xylosyltransferase 1 [Morus notabilis]
 gb|EXB73725.1| Xylosyltransferase 1 [Morus notabilis]
Length=433

 Score =   481 bits (1238),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 227/346 (66%), Positives = 280/346 (81%), Gaps = 2/346 (1%)
 Frame = -2

Query  1676  AYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNV  1497
             AY ISGS GDS RI+RLLFA YHPRNHYLLHLDR A  ++RD LA++V ++P+F+AA+NV
Sbjct  88    AYLISGSNGDSSRILRLLFATYHPRNHYLLHLDRFASAAERDRLAINVQSIPIFKAAQNV  147

Query  1496  HVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYL  1317
              V+G ADFVY KGSSS+S TLHGAS+LLR+  NWDWF++L + DYPL+TQDD LHILSYL
Sbjct  148   DVVGKADFVYPKGSSSLSFTLHGASMLLRLKPNWDWFVSLDAGDYPLLTQDDFLHILSYL  207

Query  1316  PKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYS  1137
             PK LNFV H+SYIGWRES+KLKPIIVDPGLYL+E + +FYA+Q+R LP+++R+F GSS+S
Sbjct  208   PKGLNFVKHSSYIGWRESKKLKPIIVDPGLYLSEKTALFYASQKRELPNAYRLFTGSSFS  267

Query  1136  ILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSL  957
             ILSR F++FCILGT+N PRTLLMY SNTPSS + YFPT+LCNSRQFNRTIINHNL+Y + 
Sbjct  268   ILSRNFVEFCILGTDNLPRTLLMYFSNTPSSLSNYFPTILCNSRQFNRTIINHNLKYANF  327

Query  956   N--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLG  783
             +  S ++   L S DF  MI+SGAAFA+ F+  DP+LD+ID EIL R  G+ VP GWCLG
Sbjct  328   DKPSNEKPLRLTSDDFDAMIQSGAAFAARFQSSDPLLDRIDREILRRERGQVVPSGWCLG  387

Query  782   NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
                +  C+VWGDAD+LRPG GA+RLEK  +EL +     S +CI E
Sbjct  388   ESGNNTCSVWGDADLLRPGSGARRLEKLLVELLSNTTSVSNRCIFE  433



>ref|XP_006589051.1| PREDICTED: xylosyltransferase 2-like [Glycine max]
Length=430

 Score =   479 bits (1233),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 229/351 (65%), Positives = 279/351 (79%), Gaps = 1/351 (0%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PPS+AY ISGS GDS RI+RLL A YHP N YLLHLD SAP +DRD LALSV + P+F
Sbjct  80    PSPPSLAYLISGSHGDSPRILRLLRATYHPLNLYLLHLDPSAPHADRDHLALSVQSDPVF  139

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +AA+NVHV+G  DF Y KGSS +S  LH A+ILLR+S NWDWF++L++  YPLVTQDDLL
Sbjct  140   KAAQNVHVVGRPDFAYHKGSSPVSLRLHAAAILLRLSQNWDWFVSLAADAYPLVTQDDLL  199

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HILS+LPKD+NFVNH+SYIGW+E++KLKPIIVDPGLYL+E +++FYATQ+R LP ++RVF
Sbjct  200   HILSFLPKDMNFVNHSSYIGWKEAKKLKPIIVDPGLYLSEGTEMFYATQKRELPSAYRVF  259

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GSS+SILSR F++FCILG +N PR LLMY +NTPSS + YFPTVLCN+RQFNRT+IN N
Sbjct  260   TGSSFSILSRSFMEFCILGEDNLPRILLMYFANTPSSLSNYFPTVLCNARQFNRTVINQN  319

Query  974   LQYVSLNS-RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPG  798
             L Y   +S R + R LNS+DF DMI SGA FA  F+  DP+LD ID ++L RSP   VPG
Sbjct  320   LLYAIHDSHRNDLRPLNSTDFDDMIHSGAVFAQKFQNDDPVLDLIDQKLLGRSPRSIVPG  379

Query  797   GWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             GWCLG   +  C  WGDA +LRPG G++RLEK  +EL A G F+S+QCI E
Sbjct  380   GWCLGEPGNNTCLTWGDAKILRPGTGSQRLEKAIVELLANGTFRSRQCIYE  430



>ref|XP_004309761.1| PREDICTED: xylosyltransferase 1-like [Fragaria vesca subsp. vesca]
Length=458

 Score =   476 bits (1225),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 224/364 (62%), Positives = 297/364 (82%), Gaps = 3/364 (1%)
 Frame = -2

Query  1736  PHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSD  1557
             P RV+ H D +S  P PPS+AY +SGS GDSGRI+RLL+A YHPRN YLLHL R AP+++
Sbjct  94    PTRVVYH-DYNSSDPTPPSLAYLLSGSKGDSGRILRLLYATYHPRNQYLLHLHRFAPQTE  152

Query  1556  RDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINL  1377
             RDLLAL V + P+FRAA+NVH++GNAD VY KGSSS+S TLHGASILLR+SSNWDWFI+L
Sbjct  153   RDLLALKVQSEPIFRAAQNVHLIGNADIVYPKGSSSISFTLHGASILLRLSSNWDWFISL  212

Query  1376  SSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFY  1197
             +  DYPLV QDDLLHI+S+LPK+LNFVNH+SYIGW+E+++LKP+IVDPGLY +E + +FY
Sbjct  213   TVDDYPLVNQDDLLHIMSFLPKELNFVNHSSYIGWKEAKRLKPVIVDPGLYRSEPNVMFY  272

Query  1196  ATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVL  1017
             A Q+R LP+++R+F G+S++ILSR F++FC++G +N PRTLLMY +NT SS + YFPTV+
Sbjct  273   AAQKRVLPNAYRLFTGASFNILSRSFMEFCVVGIDNLPRTLLMYFANTASSLSDYFPTVI  332

Query  1016  CNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQI  843
             CNSR+FN+TI+NHNL Y + ++  +++   L+S+DF  M+++GAAFA+ F+  DPILD+I
Sbjct  333   CNSRKFNKTILNHNLLYANFDTTPKEKPPRLSSNDFDVMVQNGAAFATGFRSDDPILDRI  392

Query  842   DSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQS  663
             D EIL+R  GK VPGGWCLG   +  C+VWGDAD+LRP   A+ LEK  ++L +   F+S
Sbjct  393   DREILNRHRGKVVPGGWCLGGFGNDTCSVWGDADILRPSPRARGLEKLLVDLLSNDTFRS  452

Query  662   QQCI  651
             +QCI
Sbjct  453   RQCI  456



>ref|XP_010666470.1| PREDICTED: xylosyltransferase [Beta vulgaris subsp. vulgaris]
Length=423

 Score =   473 bits (1216),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 224/364 (62%), Positives = 287/364 (79%), Gaps = 3/364 (1%)
 Frame = -2

Query  1730  RVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRD  1551
             R +++   S P P   SIAY+I+GS+GD  RI RLL ++YHP+N YLLHLDR AP+SDRD
Sbjct  61    RYVLNNPNSPPLPSVSSIAYFITGSSGDYSRIFRLLLSIYHPKNLYLLHLDRFAPQSDRD  120

Query  1550  LLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSS  1371
              LAL V+++P+F+AARNVHV+G+ADF Y KGSS ++S L GASILLR+ S+WDWFINLS+
Sbjct  121   RLALRVSSLPVFKAARNVHVVGHADFAYPKGSSPIASLLRGASILLRLKSDWDWFINLSA  180

Query  1370  ADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYAT  1191
              DYPLVTQDDLLHI+SYLPKDLNFVNHT YIGW+ES+++KPIIVDPGLYLAE + +FYAT
Sbjct  181   KDYPLVTQDDLLHIMSYLPKDLNFVNHTGYIGWKESRRMKPIIVDPGLYLAEKTGMFYAT  240

Query  1190  QQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCN  1011
             Q+R  P+++++F GS  SIL+RKF++FC++G++N PRTLLMYL+NTPSS   Y PT++CN
Sbjct  241   QKRDFPNAYQLFSGSPTSILNRKFVEFCVMGSDNLPRTLLMYLANTPSSLLSYIPTIVCN  300

Query  1010  SRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDS  837
             S  F  + +NHNLQY S  +   +  R LN SD  DM+RSG+AFA+ F+  DP L+ ID 
Sbjct  301   SPDFKESAVNHNLQYASYYTPPDENPRQLNGSDLEDMLRSGSAFATQFRHNDPTLNHIDR  360

Query  836   EILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQ  657
             EIL R  G  VPGGWC+G+  +  CA WGDA++LRPG GAKRLE+  IEL + G F+SQQ
Sbjct  361   EILGRRRGTVVPGGWCVGD-VNNTCAAWGDAEILRPGPGAKRLERRIIELLSNGTFRSQQ  419

Query  656   CIEE  645
             C+ E
Sbjct  420   CLIE  423



>ref|XP_002883496.1| glycosyltransferase family 14 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59755.1| glycosyltransferase family 14 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=416

 Score =   469 bits (1208),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 281/352 (80%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS+GDS RI+RLL+A YHPRN YLLHLD  A +S+RD +A++V  VP+FRA
Sbjct  65    PPSIAYLISGSSGDSRRILRLLYATYHPRNRYLLHLDSLATQSERDRIAVAVQDVPIFRA  124

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             ARNV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF+NLS  DYPLVTQD+LLHI
Sbjct  125   ARNVDVIGKPDFAYQRGSSPMASTLHGASILLRLSGAWDWFVNLSVDDYPLVTQDELLHI  184

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             +S+LPKDLNFVNHTSYIGW+ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  185   MSHLPKDLNFVNHTSYIGWKESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  244

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LGT+NFPRTLLMYLSNTP S + YFPT+LCNS  F +TIIN+NL 
Sbjct  245   PSFSILSRNFIEHCVLGTDNFPRTLLMYLSNTPDSLSNYFPTILCNSNIFKKTIINNNLL  304

Query  968   YVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y++ N  S+++   L+  +F +M+ SGAAFA  F+  D +LD+ID E+L R PG+ VPGG
Sbjct  305   YLASNDTSKEKYHQLDHKEFTEMVESGAAFARGFRFDDTVLDRIDHELLGRRPGEAVPGG  364

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    R  C+VWGD+ +LRPG G+ RLE+  +EL +   F+S QCI E
Sbjct  365   WCLGDSGKNRSSCSVWGDSGILRPGSGSDRLERRIVELLSNDWFRSHQCISE  416



>ref|XP_007145422.1| hypothetical protein PHAVU_007G237800g [Phaseolus vulgaris]
 gb|ESW17416.1| hypothetical protein PHAVU_007G237800g [Phaseolus vulgaris]
Length=436

 Score =   466 bits (1200),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 227/369 (62%), Positives = 286/369 (78%), Gaps = 2/369 (1%)
 Frame = -2

Query  1748  HPSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSA  1569
             HP+H HR L+       PP PP++AY ISGS GD+ RI+RLL A YHP N YLLHLD SA
Sbjct  69    HPTHTHR-LVFDPHKPSPPPPPAVAYLISGSRGDAARILRLLHATYHPLNIYLLHLDPSA  127

Query  1568  PKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDW  1389
             P ++R+L+A++V + P+F+AA+NVHV+G  DF Y KGSS +S  LH AS+LLR+S +WDW
Sbjct  128   PHAERELVAVTVQSHPIFKAAQNVHVVGKPDFSYPKGSSPVSLRLHAASVLLRLSRHWDW  187

Query  1388  FINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDS  1209
             F++LS+  YPLVTQDDLLHILS+LPKD+NFV H+SYIGW+E++KLKPIIVDPGLYL+E +
Sbjct  188   FVSLSADAYPLVTQDDLLHILSFLPKDMNFVKHSSYIGWKEARKLKPIIVDPGLYLSEGT  247

Query  1208  DVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYF  1029
             ++FYATQ+R LP ++RVF GSS+SILSR F++FCILG +N PR LLMY +NTPSS + YF
Sbjct  248   EMFYATQKRELPSAYRVFTGSSFSILSRSFMEFCILGEDNLPRILLMYFANTPSSLSNYF  307

Query  1028  PTVLCNSRQFNRTIINHNLQY-VSLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPIL  852
             PTVLCNSRQFNRT+IN NL Y V  + R + R LNS+D  DMI SGA FA  F++ DP+L
Sbjct  308   PTVLCNSRQFNRTVINQNLLYGVQDSHRNDLRSLNSTDLDDMIGSGAIFAEKFEKDDPVL  367

Query  851   DQIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGR  672
             D ID  +L R+P   VPGGWCLG   +  C  WGDA +LRPG G++RLEK  +E+ A G 
Sbjct  368   DLIDQNLLGRTPRSVVPGGWCLGEAGNNTCLTWGDAKILRPGTGSQRLEKAIVEVLANGI  427

Query  671   FQSQQCIEE  645
             F+S QCI E
Sbjct  428   FRSHQCIYE  436



>ref|XP_010466793.1| PREDICTED: xylosyltransferase 2-like isoform X1 [Camelina sativa]
Length=417

 Score =   465 bits (1197),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 218/352 (62%), Positives = 280/352 (80%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS+GDS RI+RLL+A YHPRN YLLHLD  A +S+RD LA++V  VP+FRA
Sbjct  66    PPSIAYLISGSSGDSRRILRLLYATYHPRNRYLLHLDSLAAQSERDGLAVAVQDVPIFRA  125

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             A+NV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF+NL+  DYPL+TQD+LLHI
Sbjct  126   AKNVDVIGKPDFAYQRGSSPMASTLHGASILLRLSGAWDWFLNLNVDDYPLLTQDELLHI  185

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             +S+LPKDLNFVNHTSYIGW+ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  186   MSHLPKDLNFVNHTSYIGWKESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  245

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LGT+NFPRTLLMYLSNTP S + YFPT+LCNS  F +TIIN+NL 
Sbjct  246   PSFSILSRNFIEHCVLGTDNFPRTLLMYLSNTPDSLSNYFPTILCNSNLFKKTIINNNLL  305

Query  968   YVSLNSRKEARV--LNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             YV+ N   + R   L+  +F +M+ +GAAFAS F+  DP+LD+ID E+L R  G+ VPGG
Sbjct  306   YVASNETVKERYHRLDHKEFTEMVETGAAFASGFRSDDPVLDRIDHELLGRKHGEVVPGG  365

Query  794   WCLGNG--ESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    S  C+VWGD+ +LRPG G+ RLE+  ++L +   F+S QCI E
Sbjct  366   WCLGDSGKNSSSCSVWGDSGILRPGSGSDRLERRIVKLLSNDWFRSHQCISE  417



>emb|CDY46346.1| BnaC01g30240D [Brassica napus]
Length=420

 Score =   464 bits (1193),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 279/352 (79%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS+GDS RI+RLLFA YHPRN YLLHLD  A +S+RD LAL+V  VP+FRA
Sbjct  69    PPSIAYLISGSSGDSRRILRLLFAAYHPRNRYLLHLDSLATQSERDRLALTVGDVPIFRA  128

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             ARNV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF++LS  +YPLVTQD+LLHI
Sbjct  129   ARNVDVVGRPDFAYRRGSSPMASTLHGASILLRLSGAWDWFVDLSVDEYPLVTQDELLHI  188

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             LSYLPKDLNFVNHTSYIGW+ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  189   LSYLPKDLNFVNHTSYIGWKESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  248

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LGT+NFPRTLLMYL+NTP+S + YFPT+LCNS  F +TIIN+NL 
Sbjct  249   PSFSILSRSFIEHCVLGTDNFPRTLLMYLANTPASLSNYFPTILCNSNLFKKTIINNNLL  308

Query  968   YVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y + N  S++    L+  +F +M+ SGAAFA      D +LD+ID E+L R+ G+ VPGG
Sbjct  309   YQASNDTSKERRHQLDPKEFTEMVESGAAFARVSTYDDAVLDRIDHELLGRAHGEVVPGG  368

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+ E  R  C+VWGD+ +LRPG G++RLE+  +EL +   F+  QCI E
Sbjct  369   WCLGDSEDNRSLCSVWGDSGILRPGSGSERLERRIVELLSNDWFRLHQCISE  420



>ref|XP_010488505.1| PREDICTED: xylosyltransferase 2-like [Camelina sativa]
Length=417

 Score =   463 bits (1192),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 217/352 (62%), Positives = 279/352 (79%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS+GDS RI+RLL+A YHPRN YLLHLD  A +S+RD LA++V  VP+FRA
Sbjct  66    PPSIAYLISGSSGDSRRILRLLYATYHPRNRYLLHLDSLAAQSERDGLAVAVQDVPIFRA  125

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             A+NV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF++LS  DYPL+TQD+LLHI
Sbjct  126   AKNVDVIGKPDFAYQRGSSPMASTLHGASILLRLSGAWDWFVHLSVDDYPLLTQDELLHI  185

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             +SYLPKDLNFVNHTSYIGW+ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  186   MSYLPKDLNFVNHTSYIGWKESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  245

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+S+LSR F++ C+L T+NFPRTLLMYLSNTP S + YFPT+LCNS  F +TIIN+NL 
Sbjct  246   PSFSMLSRSFIEHCVLATDNFPRTLLMYLSNTPDSLSNYFPTILCNSNLFKKTIINNNLL  305

Query  968   YVSLNSRKEARV--LNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             YV+ N   + R   L+  +F +M+ +GAAFAS F+  DP+LD+ID E+L R  G+ VPGG
Sbjct  306   YVASNETVKERYHRLDPKEFTEMVETGAAFASGFRSDDPVLDRIDHELLGRKHGEVVPGG  365

Query  794   WCLGNG--ESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    S  C+VWGD+ +LRPG G+ RLE+  ++L +   F+S QCI E
Sbjct  366   WCLGDSGKNSSSCSVWGDSGILRPGSGSDRLERRIVKLLSNDWFRSHQCISE  417



>gb|KFK39705.1| glycosyltransferase family 14 protein [Arabis alpina]
Length=423

 Score =   462 bits (1190),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 217/352 (62%), Positives = 277/352 (79%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY  SGS+GDS RI+RLL+A YHPRN YLLHLD  A + +RD LAL+V  VP+FRA
Sbjct  72    PPSIAYLFSGSSGDSNRILRLLYATYHPRNRYLLHLDSLATQYERDRLALTVQDVPIFRA  131

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             ARNV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF+NL+  DYPLVTQD++LHI
Sbjct  132   ARNVDVIGKPDFAYQRGSSPMASTLHGASILLRLSGAWDWFVNLNVDDYPLVTQDEILHI  191

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             LS+LPKDLNFVNHTSYIGWRES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  192   LSHLPKDLNFVNHTSYIGWRESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  251

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LGT+NFPRTLLMYLSNTP+S + YFPT+LCN+  F +TIIN+NL 
Sbjct  252   PSFSILSRNFIEHCVLGTDNFPRTLLMYLSNTPASLSNYFPTILCNTNLFKKTIINNNLL  311

Query  968   YVSLNSRKEARV--LNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y++ N   + R   L+  +F +M+ SGAAFA  F+  D +LD+ID E+L R  G+ VPGG
Sbjct  312   YLASNDTSKERYHELDPKEFTEMVESGAAFARGFRSDDTVLDRIDHELLGRRSGEVVPGG  371

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    R  C+VWGD+ +LRPG G+ RLE+  +EL +   F+S QC+ E
Sbjct  372   WCLGDYSQNRSSCSVWGDSGILRPGSGSDRLERRIVELLSNDWFRSHQCVPE  423



>ref|XP_009106072.1| PREDICTED: uncharacterized protein LOC103831886 [Brassica rapa]
Length=420

 Score =   462 bits (1190),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 279/352 (79%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPS+AY ISGS+GDS RI+RLLFA YHPRN YLLHLD  A +S+RD LAL+V  VP+FRA
Sbjct  69    PPSVAYLISGSSGDSRRILRLLFAAYHPRNRYLLHLDSLATQSERDRLALTVGDVPIFRA  128

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             ARNV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF++LS  +YPLVTQD+LLHI
Sbjct  129   ARNVDVVGKPDFAYRRGSSPMASTLHGASILLRLSGAWDWFVDLSVDEYPLVTQDELLHI  188

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             LSYLPKDLNFVNHTSYIGW+ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  189   LSYLPKDLNFVNHTSYIGWKESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  248

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LGT+NFPRTLLMYLSNTP+S + YFPT+LCNS  F +TIIN+NL 
Sbjct  249   PSFSILSRSFIEHCVLGTDNFPRTLLMYLSNTPASLSNYFPTILCNSNLFKKTIINNNLL  308

Query  968   YVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y + N  S++    L+S +F +M+ SGAAFA      D +LD+ID E+L R+ G+ VPGG
Sbjct  309   YQASNDTSKERRHQLDSKEFTEMVESGAAFARVSTFDDAVLDRIDHELLGRAHGEVVPGG  368

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    R  C+VWGD+ +LRPG G++RLE+  +EL +   F+  QCI E
Sbjct  369   WCLGDSGDNRSLCSVWGDSGILRPGSGSERLERRIVELLSNDWFRLHQCIAE  420



>ref|NP_189046.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 dbj|BAB03022.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44649.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76847.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38752.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=417

 Score =   462 bits (1189),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 215/352 (61%), Positives = 277/352 (79%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS+GD+ RI+RLL+A YHPRN YLLHLD  A +S+RD LA+ V  VP+FRA
Sbjct  66    PPSIAYLISGSSGDTRRILRLLYATYHPRNRYLLHLDSLATQSERDRLAVDVQDVPIFRA  125

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             ARNV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF+++S  DYPLVTQD+LLHI
Sbjct  126   ARNVDVIGKPDFAYQRGSSPMASTLHGASILLRLSGTWDWFVSISVDDYPLVTQDELLHI  185

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             +S+LPKDLNFVNHTSYIGW+ES+KLKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  186   MSHLPKDLNFVNHTSYIGWKESRKLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  245

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LGT+NFPRTLLMYLSNTP S + YFPT+LCN+  F +TI+N+NL 
Sbjct  246   PSFSILSRNFMEHCVLGTDNFPRTLLMYLSNTPDSLSNYFPTILCNTDTFKKTIMNNNLL  305

Query  968   YVSLNSRKEARV--LNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y++ N   + R   L+  +F +M+ SGAAFA  F+  D +LD+ID E+L R PG+ VPGG
Sbjct  306   YLASNDTSKERYHQLDHKEFTEMVDSGAAFARGFRYDDTVLDRIDHELLGRKPGEVVPGG  365

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    R  C+VWGD+ +LRPG G+ RLE+  +EL +   F+  QC+ E
Sbjct  366   WCLGDSSKNRSSCSVWGDSGILRPGSGSDRLERRIVELLSNDWFRLHQCVPE  417



>ref|XP_006420516.1| hypothetical protein CICLE_v10004926mg [Citrus clementina]
 gb|ESR33756.1| hypothetical protein CICLE_v10004926mg [Citrus clementina]
Length=446

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 223/368 (61%), Positives = 284/368 (77%), Gaps = 27/368 (7%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
             P+ P ++  H       P PPS+AY ISGSAGD+ RIVRLL AVYHP+N YLLHLDRSAP
Sbjct  105   PAFPSKIPSH-------PAPPSLAYLISGSAGDAARIVRLLHAVYHPKNQYLLHLDRSAP  157

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
             +++RD LA+++ +VP+FRAA+NV V+G ADF Y  GS+S+SSTLHGASILL++S NWDWF
Sbjct  158   QAERDSLAVTIESVPVFRAAQNVDVIGKADFSYPAGSTSISSTLHGASILLKLSKNWDWF  217

Query  1385  INLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD  1206
             INL++ADYPL+ QDDLLHILSY+PK+LNFVNHTSY+ WR+S ++K IIVDPGLYL+E + 
Sbjct  218   INLNAADYPLIKQDDLLHILSYMPKELNFVNHTSYLDWRDSSRMKRIIVDPGLYLSEQNP  277

Query  1205  VFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFP  1026
             +FY +Q+R LP++FR+F                   ++N PRTLLMYLSNTPSS   YFP
Sbjct  278   MFYVSQKRQLPNAFRLF-------------------SDNLPRTLLMYLSNTPSSFPNYFP  318

Query  1025  TVLCNSRQFNRTIINHNLQYVSLNS-RKEARVLNSSDFLDMIRSGAAFASPFKERDPILD  849
             T+LCNS QFN+T+IN +L YV+ +   K+   LNS++F DMI+SGA FAS F+  DP+LD
Sbjct  319   TILCNSHQFNKTVINDSLLYVACDKPSKQNCTLNSTEFDDMIQSGAIFASQFQFDDPVLD  378

Query  848   QIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRF  669
             +ID EIL+RSPG  VPGGWCLG   +  C+VWGDAD+LRPG G++RLE   IE+F+GG F
Sbjct  379   RIDREILNRSPGNVVPGGWCLGEPGNNTCSVWGDADILRPGPGSRRLENRLIEMFSGGNF  438

Query  668   QSQQCIEE  645
             +SQQCI E
Sbjct  439   RSQQCILE  446



>gb|AAS99698.1| At3g24040 [Arabidopsis thaliana]
Length=417

 Score =   462 bits (1188),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 215/352 (61%), Positives = 277/352 (79%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS+GD+ RI+RLL+A YHPRN YLLHLD  A +S+RD LA+ V  VP+FRA
Sbjct  66    PPSIAYLISGSSGDTRRILRLLYATYHPRNRYLLHLDSLATQSERDRLAVDVQDVPIFRA  125

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             ARNV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF+++S  DYPLVTQD+LLHI
Sbjct  126   ARNVDVIGKPDFAYQRGSSPMASTLHGASILLRLSGTWDWFVSISVDDYPLVTQDELLHI  185

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             +S+LPKDLNFVNHTSYIGW+ES+KLKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  186   MSHLPKDLNFVNHTSYIGWKESRKLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  245

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LGT+NFPRTLLMYLSNTP S + YFPT+LCN+  F +TI+N+NL 
Sbjct  246   PSFSILSRNFMEHCVLGTDNFPRTLLMYLSNTPDSLSNYFPTILCNTDTFKKTIMNNNLL  305

Query  968   YVSLNSRKEARV--LNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y++ N   + R   L+  +F +M+ SGAAFA  F+  D +LD+ID E+L R PG+ VPGG
Sbjct  306   YLASNDTSKERYHQLDHKEFTEMVDSGAAFARGFRYDDTVLDRIDHELLGRKPGEVVPGG  365

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    R  C+VWGD+ +LRPG G+ RLE+  +EL +   F+  QC+ E
Sbjct  366   WCLGDSSKDRSSCSVWGDSGILRPGSGSDRLERRIVELLSNDWFRLHQCVPE  417



>ref|XP_006297731.1| hypothetical protein CARUB_v10013765mg [Capsella rubella]
 gb|EOA30629.1| hypothetical protein CARUB_v10013765mg [Capsella rubella]
Length=426

 Score =   462 bits (1189),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 219/352 (62%), Positives = 278/352 (79%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS+GDS RI+RLL+A YHPRN YLLHLD  A +S+RD LA++V  V +FRA
Sbjct  75    PPSIAYLISGSSGDSRRILRLLYATYHPRNRYLLHLDSLAVQSERDRLAVAVQDVAIFRA  134

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             ARNV V+G  DFVY +GSS M+STLHGASILLR+S  WDWF+NL+  DYPLVTQD+LLHI
Sbjct  135   ARNVDVIGKPDFVYQRGSSPMASTLHGASILLRLSGAWDWFVNLNVDDYPLVTQDELLHI  194

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             LS+LPKDLNFVNHTSYIGW+ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  195   LSHLPKDLNFVNHTSYIGWKESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  254

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LG +NFPRTLLMYLSNTP S + YFPT+LCNS  F +TIIN+NL 
Sbjct  255   PSFSILSRNFIEHCVLGIDNFPRTLLMYLSNTPDSLSNYFPTILCNSNPFKKTIINNNLL  314

Query  968   YVSLNSRKEARV--LNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             YV+ N   + R   L+  +F +M+ +GAAFA  F+  DP+LD+ID E+L R  G+ VPGG
Sbjct  315   YVASNETTKERYHRLDPKEFTEMVETGAAFARGFRFDDPVLDRIDHELLGRRHGEVVPGG  374

Query  794   WCLGNG--ESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    S  C+VWGD+ +LRPG G+ RLE+  ++L +   F+S QCI E
Sbjct  375   WCLGDSGKNSSSCSVWGDSGILRPGSGSDRLERRIVKLLSNDWFRSHQCISE  426



>emb|CDY18061.1| BnaA01g23220D [Brassica napus]
Length=420

 Score =   461 bits (1185),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 218/352 (62%), Positives = 279/352 (79%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPS+AY ISGS+GDS RI+RLLFA YHPRN YLLHLD  A +S+RD LAL+V  VP+FRA
Sbjct  69    PPSVAYLISGSSGDSRRILRLLFAAYHPRNRYLLHLDSLATQSERDRLALTVGDVPIFRA  128

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             ARNV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF++LS  +YPLVTQD+LLHI
Sbjct  129   ARNVDVVGKPDFAYRRGSSPMASTLHGASILLRLSGAWDWFVDLSVDEYPLVTQDELLHI  188

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             LSY+PKDLNFVNHTSYIGW+ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  189   LSYMPKDLNFVNHTSYIGWKESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  248

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LGT+NFPRTLLMYLSNTP+S + YFPT+LCNS  F +TIIN+NL 
Sbjct  249   PSFSILSRSFIEHCVLGTDNFPRTLLMYLSNTPASLSNYFPTILCNSNLFKKTIINNNLL  308

Query  968   YVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y + N  S++    L+  +F +M++SGAAFA      D +LD+ID E+L R+ G+ VPGG
Sbjct  309   YQASNDTSKERRHQLDPKEFTEMVQSGAAFARVSTFDDAVLDRIDHELLGRAHGEVVPGG  368

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    R  C+VWGD+ +LRPG G++RLE+  +EL +   F+  QCI E
Sbjct  369   WCLGDSGDNRSLCSVWGDSGILRPGSGSERLERRIVELLSNDWFRLHQCIAE  420



>ref|XP_006418794.1| hypothetical protein EUTSA_v10002511mg [Eutrema salsugineum]
 gb|ESQ37230.1| hypothetical protein EUTSA_v10002511mg [Eutrema salsugineum]
Length=477

 Score =   462 bits (1189),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 280/352 (80%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS GDS RI+RLL+A YHPRN YLLHLD  + +S+RD LA++V  VP+FRA
Sbjct  126   PPSIAYLISGSPGDSRRILRLLYATYHPRNRYLLHLDSLSTQSERDRLAVTVQDVPIFRA  185

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             ARNV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF+NLS  DYPLVTQD+LLHI
Sbjct  186   ARNVDVVGKPDFAYQRGSSPMASTLHGASILLRLSGVWDWFVNLSVDDYPLVTQDELLHI  245

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             LS+LPK+LNFVNHTSYIGW+ES++LKP+IVDPGLYL E +++F+A+Q+R LP +F++F G
Sbjct  246   LSHLPKELNFVNHTSYIGWKESRRLKPVIVDPGLYLVEKTEMFFASQKRELPKAFKLFSG  305

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+SILSR F++ C+LGT+NFPRTLLMYLSNTP+S + YFPT+LCNS  F +TIIN+NL 
Sbjct  306   PSFSILSRNFMEHCVLGTDNFPRTLLMYLSNTPASLSNYFPTILCNSNLFKKTIINNNLL  365

Query  968   YVSLNSRKEARV--LNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y++ N   + R   L+S +F +M+ SGAAFA  F+  D +LD+ID E+L R PG+ VPGG
Sbjct  366   YLASNDTSKERYHRLDSKEFTEMVESGAAFARGFRYDDTVLDRIDHELLGREPGEVVPGG  425

Query  794   WCLGN--GESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    S  C+VWGD+ +LRPG G+ RLE+  +EL +   F+S QCI E
Sbjct  426   WCLGDSGSNSSSCSVWGDSGILRPGSGSDRLERRIVELLSNDWFKSHQCISE  477



>ref|XP_010513276.1| PREDICTED: xylosyltransferase 2-like isoform X2 [Camelina sativa]
Length=417

 Score =   458 bits (1179),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 215/352 (61%), Positives = 278/352 (79%), Gaps = 4/352 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPSIAY ISGS+GDS RI+RLL+A YHPRN YLLHLD  A +S+RD LA++V  VP+FRA
Sbjct  66    PPSIAYLISGSSGDSRRILRLLYATYHPRNRYLLHLDSLAAQSERDGLAVAVQDVPIFRA  125

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             A+NV V+G  DF Y +GSS M+STLHGASILLR+S  WDWF++LS  DYPL+TQD+LLHI
Sbjct  126   AKNVDVIGKPDFAYLRGSSPMASTLHGASILLRLSGAWDWFVHLSVDDYPLLTQDELLHI  185

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             +S+LPKDLNFVNHTSYIGW+ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G
Sbjct  186   MSHLPKDLNFVNHTSYIGWKESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSG  245

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
              S+S+LSR F++ C+LGT+NFPRTLLMYLSNTP S + YFPT+LCNS  F +TIIN+NL 
Sbjct  246   PSFSMLSRSFIEHCVLGTDNFPRTLLMYLSNTPDSLSNYFPTILCNSNLFKKTIINNNLL  305

Query  968   YVSLNSRKEARV--LNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             YV+ N   + R   L+  +F +M+ +GAAFA  F+  DP+LD+ID E+L R   + VPGG
Sbjct  306   YVASNETVKERYHRLDPKEFTEMVETGAAFARGFRSDDPVLDRIDHELLGRKHDEVVPGG  365

Query  794   WCLGNG--ESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             WCLG+    S  C+VWGD+ +LRPG G+ RLE+  ++L +   F+S QCI E
Sbjct  366   WCLGDSGKNSSSCSVWGDSGILRPGSGSDRLERRIVKLLSNDWFRSHQCISE  417



>ref|XP_007221796.1| hypothetical protein PRUPE_ppa006063mg [Prunus persica]
 gb|EMJ22995.1| hypothetical protein PRUPE_ppa006063mg [Prunus persica]
Length=429

 Score =   458 bits (1178),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 221/365 (61%), Positives = 284/365 (78%), Gaps = 14/365 (4%)
 Frame = -2

Query  1733  HRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDR  1554
             HR++ H D +S  P PPSIAY +SGS GD GRI+RLL+A YHPRN YLLHLDRSA  S+R
Sbjct  77    HRIVYH-DNNSSDPIPPSIAYLLSGSKGDLGRILRLLYATYHPRNQYLLHLDRSASDSER  135

Query  1553  DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLS  1374
             + LAL V ++P+FRAA+NVHV+G ADFVY  GSS +S TLHGASILLR+S  WDWFI+LS
Sbjct  136   EKLALKVQSLPIFRAAQNVHVIGKADFVYPTGSSGISFTLHGASILLRLSPIWDWFISLS  195

Query  1373  SADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYA  1194
              +DYPLVTQD           DLNFVNH+SYIGWRES++LKPIIVDPGLYL++ +++FYA
Sbjct  196   VSDYPLVTQD-----------DLNFVNHSSYIGWRESRRLKPIIVDPGLYLSQKTEMFYA  244

Query  1193  TQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLC  1014
              Q+R LP+++R+F GSS++ILSR F++FC++GT+N PRT+LMY SNTPS+ + YFPT+LC
Sbjct  245   AQKRVLPNAYRLFTGSSFAILSRNFIEFCVVGTDNLPRTVLMYFSNTPSALSNYFPTILC  304

Query  1013  NSRQFNRTIINHNLQYVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQID  840
             NS QFN+T+INHNL Y + +  SRK+ + ++S D+  MI  GAAFA+ F+  DP+LD+ID
Sbjct  305   NSYQFNKTVINHNLLYANFDTPSRKKPQPISSDDYDVMIHHGAAFATGFRLDDPMLDRID  364

Query  839   SEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQ  660
              ++L R  GK VPGGWCLG   +  C+VWGDAD+LRPG G + LEK  + L + G F+S 
Sbjct  365   RDVLKRGRGKVVPGGWCLGGFGNDTCSVWGDADILRPGPGVRGLEKLMVGLLSNGSFRSH  424

Query  659   QCIEE  645
             QCI E
Sbjct  425   QCIYE  429



>ref|XP_009396136.1| PREDICTED: xylosyltransferase 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009396214.1| PREDICTED: xylosyltransferase 1 [Musa acuminata subsp. malaccensis]
Length=433

 Score =   446 bits (1147),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 268/344 (78%), Gaps = 2/344 (1%)
 Frame = -2

Query  1676  AYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNV  1497
             AY ++GSAGD  R++RLL AVYHPRN YLLHLD +APK +R+ LAL+   VP FR+ARNV
Sbjct  88    AYLLTGSAGDGDRLLRLLHAVYHPRNLYLLHLDGAAPKDERERLALAAWNVPAFRSARNV  147

Query  1496  HVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYL  1317
             HV+G  DF   +GSS++S+TLHGA+ILLRI +NWDWF+NL +++YP+VTQDDLLH+ S+L
Sbjct  148   HVVGKPDFANPRGSSALSATLHGAAILLRIGANWDWFVNLDASEYPIVTQDDLLHVFSFL  207

Query  1316  PKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYS  1137
             P+DLNFV H+SYIGWRES++L+PIIVDPGLYL+  +D+FYATQ+R LP+++++F GS+  
Sbjct  208   PRDLNFVQHSSYIGWRESRQLRPIIVDPGLYLSSRTDIFYATQKRELPNAYKLFTGSASV  267

Query  1136  ILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSL  957
             ILSRKF+++CILGT+N PRTL+MY +NT SS   YF TVLCNS  FNRTI+NH+L Y+  
Sbjct  268   ILSRKFIEYCILGTDNLPRTLMMYYANTLSSHTNYFQTVLCNSPGFNRTIVNHHLHYMIW  327

Query  956   NS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLG  783
             ++  +KE R+L   D  +M  +GAAF + F + DP+LD ID E L R PG+ VPGGWCLG
Sbjct  328   DASPKKEPRLLTMDDLKNMTITGAAFGTRFSKNDPVLDHIDKETLSRGPGRIVPGGWCLG  387

Query  782   NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
                   CAVWG+ DVL PG GA RL K   +L + G+ +SQQCI
Sbjct  388   GSHGDPCAVWGNPDVLIPGPGAARLAKIIADLLSDGKLRSQQCI  431



>ref|XP_008804738.1| PREDICTED: xylosyltransferase 1-like [Phoenix dactylifera]
Length=404

 Score =   442 bits (1137),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 205/343 (60%), Positives = 264/343 (77%), Gaps = 2/343 (1%)
 Frame = -2

Query  1673  YYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNVH  1494
             Y +SG+AGDS R++RLL A YHPRN YLLHLD +AP+  RD LA +V   P FR+ RNVH
Sbjct  60    YLLSGTAGDSDRLLRLLRAAYHPRNLYLLHLDGAAPQVQRDRLARAVRAAPAFRSTRNVH  119

Query  1493  VMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYLP  1314
             V+G ADF  ++GSS++++ LHGA+ILLR++ NWDWFINL ++DYPLVTQDDLLH+ S+LP
Sbjct  120   VIGKADFANTRGSSALAAILHGAAILLRLAPNWDWFINLDASDYPLVTQDDLLHVFSFLP  179

Query  1313  KDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYSI  1134
             KDL+FV H+SYIGW+E +++KPIIVDPGLYL+  +DVFYATQ+R LP+++R+F GS+  I
Sbjct  180   KDLSFVQHSSYIGWKELRRIKPIIVDPGLYLSARTDVFYATQKRDLPNAYRLFTGSASVI  239

Query  1133  LSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSLN  954
             LSRKF+++CILGTEN PR LLMY +N PSS   YF TVLCNS +FNRTI+NHNL+YV  +
Sbjct  240   LSRKFVEYCILGTENLPRALLMYYANMPSSHTNYFQTVLCNSPEFNRTIVNHNLRYVKWD  299

Query  953   S--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGN  780
                ++E R L  +D  +M +SGAAF   F + D IL+ ID E+L+R PGK VPGGWCLG 
Sbjct  300   MPPKEEPRALTLNDLENMTQSGAAFGRRFAKDDHILNHIDQEVLNRDPGKIVPGGWCLGK  359

Query  779   GESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             G    C +WG ADVL PG GA RL +   +L + G F S+QC+
Sbjct  360   GHGDPCMIWGSADVLSPGPGAMRLARFITQLLSTGTFHSRQCV  402



>ref|XP_010933192.1| PREDICTED: beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 
4-like [Elaeis guineensis]
Length=464

 Score =   431 bits (1109),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 262/344 (76%), Gaps = 2/344 (1%)
 Frame = -2

Query  1676  AYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNV  1497
             AY +SG+AGD+ R++RLL A YHPRN YLLHLD +AP++ RD LA +V  VP FR+ RNV
Sbjct  119   AYLLSGTAGDADRLLRLLRAAYHPRNLYLLHLDGAAPQAQRDRLARAVRAVPAFRSTRNV  178

Query  1496  HVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYL  1317
             HV+G  DF   +GSSS+++ LHGA+ILLR++ NWDWFINL ++DYPLVTQDDLLH+ S+L
Sbjct  179   HVIGKFDFANPRGSSSLAAILHGAAILLRLAPNWDWFINLDASDYPLVTQDDLLHVFSFL  238

Query  1316  PKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYS  1137
             PKDL+FV H+SYIGW+E Q++KPIIVDPGLYL+  +DVFYATQ+R LP+++R+F GS+  
Sbjct  239   PKDLSFVQHSSYIGWKELQRIKPIIVDPGLYLSARTDVFYATQKRDLPNAYRLFTGSASV  298

Query  1136  ILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSL  957
             ILSRKF++ CILGTEN PRTLLMY +NTPSS   YF T+LCNS +FNRTI+NH+L YV+ 
Sbjct  299   ILSRKFVEHCILGTENLPRTLLMYYANTPSSHTNYFQTILCNSPEFNRTIVNHDLHYVAW  358

Query  956   NS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLG  783
             +   +KE RVL  +D  +M +SGAAF   F +   IL+ ID E+L+ SPGK VPGGWCL 
Sbjct  359   DMPPKKEPRVLTLNDLENMTQSGAAFGRRFAKDGHILNHIDQEVLNSSPGKIVPGGWCLR  418

Query  782   NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
              G    C + G+ DVL PG GA+RL     +L +   F S QCI
Sbjct  419   KGHGDPCMLRGNTDVLSPGPGARRLAHFITQLLSIETFHSYQCI  462



>gb|KCW57309.1| hypothetical protein EUGRSUZ_H00106, partial [Eucalyptus grandis]
Length=308

 Score =   422 bits (1086),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 246/304 (81%), Gaps = 1/304 (0%)
 Frame = -2

Query  1562  SDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFI  1383
             +DRD LAL+V + P+FRAA+NV V+G ADF Y KGSS +S+TLHGASILLR++  WDWF+
Sbjct  1     ADRDALALAVQSSPIFRAAQNVDVLGRADFAYPKGSSPISATLHGASILLRLAPRWDWFV  60

Query  1382  NLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDV  1203
             NL++ DYPLVTQDDLLHILSYLPKDLNF+NHTSYIGWRES+KL+PIIVDPGLYL E +++
Sbjct  61    NLNALDYPLVTQDDLLHILSYLPKDLNFLNHTSYIGWRESRKLRPIIVDPGLYLTEKTEM  120

Query  1202  FYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPT  1023
             FYA+Q+R LPD+FR+F GS+++ILSR F++ CILGT+N PRTLLMYLSNTPSS + YFPT
Sbjct  121   FYASQKRNLPDAFRLFSGSTFAILSRNFIEHCILGTDNLPRTLLMYLSNTPSSLSNYFPT  180

Query  1022  VLCNSRQFNRTIINHNLQYVSLNSRK-EARVLNSSDFLDMIRSGAAFASPFKERDPILDQ  846
             +LCNS QFN TI+N NLQY S  S K E   L+S+DF + I+SGAAFAS F   + +LD+
Sbjct  181   ILCNSHQFNHTIVNTNLQYTSNKSMKGEYPELDSNDFDNSIKSGAAFASSFPTDESVLDR  240

Query  845   IDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQ  666
             ID EIL R P K VPGGWCLG   +  C++WGDADVLRPG GA+RLEK  +   + G   
Sbjct  241   IDREILGRYPDKVVPGGWCLGESRNDTCSIWGDADVLRPGPGARRLEKFLVSFLSNGTVL  300

Query  665   SQQC  654
             SQQC
Sbjct  301   SQQC  304



>ref|XP_008808451.1| PREDICTED: xylosyltransferase 1-like [Phoenix dactylifera]
Length=411

 Score =   419 bits (1077),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 205/352 (58%), Positives = 265/352 (75%), Gaps = 2/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  PS AY +SG+ GD+ R++RLL A YHPRN YLLHLD +AP++ RD LA +V  VP F
Sbjct  60    PPTPSFAYLLSGTVGDADRLLRLLRATYHPRNLYLLHLDGAAPQAQRDRLARAVRAVPAF  119

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R+A NVHV+G +DF   +GSS++++TLH A+ILLR+  NWDWFINL ++DYPLVTQDDLL
Sbjct  120   RSAGNVHVIGKSDFANPRGSSALAATLHAAAILLRLGPNWDWFINLHASDYPLVTQDDLL  179

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ S+LPKDLNFV H+SYIGW+ESQ+ K IIVDPGLYL+  ++VFYATQ+R LP+++R+F
Sbjct  180   HVFSFLPKDLNFVQHSSYIGWKESQRQKLIIVDPGLYLSSRTEVFYATQKRELPNAYRLF  239

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS+  ILSRKF+++CIL T+N PRTLLMY  NTPSS   YF TVLCNS +FNRT++NH+
Sbjct  240   TGSASVILSRKFVEYCILDTDNLPRTLLMYYGNTPSSCTNYFQTVLCNSPEFNRTVVNHD  299

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L YV  ++  +KE  VL ++D  +M +SGAAF + F   DP+LD ID E+L+  P K VP
Sbjct  300   LHYVVWDTSPKKEPHVLTTNDLENMTQSGAAFGTRFARDDPVLDHIDQEVLNCGPSKIVP  359

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             GGWCLG G +  C +WG+ DVL PG GA RL     +L + G   S QCI +
Sbjct  360   GGWCLGKGHTDACLIWGNVDVLIPGPGAMRLADFMAQLLSAGTLHSHQCIWD  411



>ref|XP_004987178.1| PREDICTED: xylosyltransferase 1-like, partial [Setaria italica]
Length=370

 Score =   410 bits (1055),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 194/355 (55%), Positives = 260/355 (73%), Gaps = 5/355 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +SS  P PP++A+ ++GSAGD+ R+ RLL A YHPRN YLL LDR+A  +DR+ LA    
Sbjct  17    VSSAGPAPPTLAFLLTGSAGDADRLQRLLLATYHPRNTYLLLLDRAASPADREWLARKAR  76

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
               P      NVHV+G+  F   +G+S++++TLHGA++LLRI   WDWF++L +ADYPLVT
Sbjct  77    AAP---GHDNVHVVGDPGFANPRGASALAATLHGAALLLRIGQGWDWFVHLDAADYPLVT  133

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
              DDLLH+LSYLPKDLNF+ HTSYIGW+ES++++PIIVDPGLYL+  +D+FYATQ+R LP+
Sbjct  134   PDDLLHVLSYLPKDLNFIQHTSYIGWKESRQIRPIIVDPGLYLSSRNDIFYATQKRDLPN  193

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             ++++F GSS  ILSRKF+++CI+G +N PRTLLMY +N P     YF TVLCNS +FNRT
Sbjct  194   AYKLFTGSSSVILSRKFIEYCIVGMDNLPRTLLMYYTNMPLPHRKYFQTVLCNSPEFNRT  253

Query  989   IINHNLQYVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
             ++NH+L Y + +  S+ E R+L  +D  +M  SGAAF + F + DP+LD ID+EILHR P
Sbjct  254   VVNHDLHYSTWDAPSKNEPRLLTMADVENMTESGAAFGTRFPKDDPVLDHIDAEILHRLP  313

Query  815   GKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             G+ V GGWC+G G    C V G+ DVLRPG  A ++ K   E  +   F SQQCI
Sbjct  314   GELVTGGWCIGVGHDSPCDVSGNLDVLRPGPAATKVAKFLAERLSYRSFYSQQCI  368



>ref|XP_006854275.1| hypothetical protein AMTR_s00039p00066770 [Amborella trichopoda]
 gb|ERN15742.1| hypothetical protein AMTR_s00039p00066770 [Amborella trichopoda]
Length=488

 Score =   407 bits (1047),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 184/327 (56%), Positives = 252/327 (77%), Gaps = 2/327 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY+I+GS G++ +I RLL A+YHP NHYLLHLD SA   +R  LA+ V  VP F  A+N
Sbjct  65    LAYFITGSNGEAQKIFRLLLALYHPNNHYLLHLDLSATAQERRDLAIMVRNVPAFVTAQN  124

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             ++V+G ADF   KGSS+++STLHGA++LLR   +WDWFINLS+++YPLVTQDDLLHILS+
Sbjct  125   INVVGKADFANHKGSSAVASTLHGAALLLRYGGDWDWFINLSASEYPLVTQDDLLHILSF  184

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP++LNF+  +S IG  E + ++P+IVDPGLYL+  SD+FYATQ+RP+P+++++F GS+ 
Sbjct  185   LPRNLNFIQLSSQIGKTEYKMIRPVIVDPGLYLSSGSDIFYATQKRPMPNAYKIFTGSAS  244

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSRKF++FCI+G +N PRTLLMY SN+ ++   YF TV+CN R+FN TI+N ++ Y +
Sbjct  245   IMLSRKFIEFCIMGIDNSPRTLLMYFSNSVAAQEAYFQTVICNVRKFNTTIVNDDMHYAA  304

Query  959   LNSRKEA--RVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              +  K+   R L+S+DF +MI+ GA FA  F E DP+LD ID E+LHR  GK VPGGWC+
Sbjct  305   WDKPKKLDPRTLSSNDFDEMIKDGAPFARNFNENDPVLDHIDREVLHRGEGKIVPGGWCI  364

Query  785   GNGESGRCAVWGDADVLRPGVGAKRLE  705
             G G+   C+VWGD  +L+PG GAKRLE
Sbjct  365   GEGKEDPCSVWGDVQILKPGPGAKRLE  391



>gb|ADE76377.1| unknown [Picea sitchensis]
Length=415

 Score =   399 bits (1026),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/359 (52%), Positives = 260/359 (72%), Gaps = 4/359 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             L+   P  P +AY ISGS GD  RI RLL A+YHPRN YLLHLD++A  ++R  L L V 
Sbjct  57    LTDRMPAAPRLAYLISGSEGDGQRIKRLLGAIYHPRNQYLLHLDKAARDAERISLGLYVQ  116

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
             +VP+F AA NV+V+G ADFV  +G ++++STLH A++LLR S NWDWFINLS +DYPL+T
Sbjct  117   SVPVFAAAGNVNVIGKADFVSYRGPTAIASTLHAAALLLRYSRNWDWFINLSPSDYPLIT  176

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH+ SYLP+DLNF+ H+S IGW+E  ++KPII+DPGL +   S +FYATQ+R +P+
Sbjct  177   QDDLLHVFSYLPRDLNFIEHSSDIGWKEYHRIKPIIIDPGLSMLGRSQIFYATQKRMVPN  236

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +++ F GS++ +LSR F+++CILG +N PRT+L+Y +N+  S+  YF TV+CN+++F  T
Sbjct  237   AYKTFTGSAFVVLSRNFMEYCILGWDNLPRTVLIYSANSLLSEEAYFQTVICNAQEFRNT  296

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N++L+YV+ ++  + E   LNS+D+  M++SGAAFA  F+E DPILD+ID  +LHR  
Sbjct  297   TVNNDLRYVAWDNPPKPEPYYLNSTDYKKMMQSGAAFARQFREDDPILDRIDRVVLHRQH  356

Query  815   GKPVPGGWCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
                 PGGWCLG  N +   C+VWGD  +L+PG  AK  EK    L A   F+S QC  E
Sbjct  357   EWVTPGGWCLGKSNKKKDPCSVWGDISILKPGSRAKVFEKSLSRLLANETFRSNQCKLE  415



>ref|XP_010918856.1| PREDICTED: xylosyltransferase 1-like [Elaeis guineensis]
Length=419

 Score =   396 bits (1017),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/344 (57%), Positives = 258/344 (75%), Gaps = 2/344 (1%)
 Frame = -2

Query  1676  AYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNV  1497
             AY +SG+ GD+  ++RLL A YHPRN YLLHLD +AP++ RD LA +V  VP+FR+A NV
Sbjct  74    AYLLSGTVGDADCLLRLLRATYHPRNLYLLHLDGAAPQAQRDRLARAVRAVPVFRSAGNV  133

Query  1496  HVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYL  1317
             HV+G  DF   +GSS++++TLH A+ILLR+  NWDWFINL ++DYPLVTQDDLLH+ S+L
Sbjct  134   HVIGKPDFANPRGSSALAATLHAAAILLRLGPNWDWFINLHASDYPLVTQDDLLHVFSFL  193

Query  1316  PKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYS  1137
             PKDL+FV H+SYIG +ES++LKPIIVD GLYL+  ++VFYATQ+R LP+++R+F GS+  
Sbjct  194   PKDLSFVQHSSYIGRKESRRLKPIIVDFGLYLSLRTEVFYATQKRELPNAYRLFTGSASV  253

Query  1136  ILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYV--  963
             ILSRKF+++CILGT+N PR LLMY  NTPSS   YF TVLCNS +FN T++NH+L YV  
Sbjct  254   ILSRKFVEYCILGTDNLPRALLMYYGNTPSSHMNYFQTVLCNSPEFNMTVVNHDLHYVMG  313

Query  962   SLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLG  783
              +  + E RVL ++D  +M +SGAAF + F + D +L+ ID E+L+R P K VPGGWCLG
Sbjct  314   DMPLKPEPRVLTTNDLENMTQSGAAFGTRFAKDDLVLNHIDHEVLNRDPSKMVPGGWCLG  373

Query  782   NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             NG    C +WG+ADVL PG  A +L      L + G   S QCI
Sbjct  374   NGSGDACMIWGNADVLSPGPRAMKLADFMALLLSTGTLHSHQCI  417



>ref|XP_002965647.1| glycosyltransferase CAZy family 14 [Selaginella moellendorffii]
 gb|EFJ33067.1| glycosyltransferase CAZy family 14 [Selaginella moellendorffii]
Length=422

 Score =   395 bits (1014),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 251/351 (72%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISG+ GD  R+ R+L A+YHPRN Y+LHLD  AP  +R  LA  V   P F
Sbjct  68    PPPPRLAYLISGTKGDGNRMRRVLQALYHPRNQYVLHLDLEAPPRERVELARYVKMDPTF  127

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                +NVHV+G A+ V  +G + +S TLH A+ILLR S +WDWFINLS++DYPLVTQDDLL
Sbjct  128   GDVKNVHVIGKANLVTYRGPTMVSCTLHAAAILLRQSPDWDWFINLSASDYPLVTQDDLL  187

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+LSYLPKDLNF++HTS IGW+E Q+ KP+IVDPGLYL + SDVF+ATQ+R LP +F++F
Sbjct  188   HVLSYLPKDLNFIDHTSDIGWKEFQRAKPLIVDPGLYLNKKSDVFWATQRRSLPTAFKLF  247

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+ ++G +N PRTLLMY +N  SS   YF TV+CNS +F  T +NH+
Sbjct  248   TGSAWVGLSRAFVDYTVMGWDNLPRTLLMYYTNFISSPEGYFHTVICNSPEFRNTTVNHD  307

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y++ ++  ++    L S  F +M  SGA FA  F   DP+LD+ID E+L R PG+ VP
Sbjct  308   LHYIAWDNPPKQHPLTLTSKLFKNMTSSGAPFARKFAREDPVLDKIDKELLRRVPGRFVP  367

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWCLG+ +SG   C   GD+ VLRPG GAKR EK  +++ +   F+S QC
Sbjct  368   GGWCLGSSDSGEDPCLTVGDSSVLRPGPGAKRFEKLILQVVSSKTFRSNQC  418



>ref|XP_002468516.1| hypothetical protein SORBIDRAFT_01g047240 [Sorghum bicolor]
 gb|EER95514.1| hypothetical protein SORBIDRAFT_01g047240 [Sorghum bicolor]
Length=417

 Score =   392 bits (1007),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/354 (53%), Positives = 250/354 (71%), Gaps = 5/354 (1%)
 Frame = -2

Query  1706  SSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNT  1527
             +S  P PPS+A+ ++GSAGD+ R+ RLL A YHPRN YLL LDR+A   DR  LA S  +
Sbjct  65    ASAGPAPPSLAFLLTGSAGDADRLQRLLLATYHPRNVYLLLLDRAASADDRARLARSARS  124

Query  1526  VPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQ  1347
              P      NVHV+G+  F   +G+S++++TLHGA++LLR+   WDWF++L + +YPLVT 
Sbjct  125   AP---GRDNVHVVGDPGFANPRGASALAATLHGAALLLRVDQGWDWFLHLDADEYPLVTP  181

Query  1346  DDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDS  1167
             DDLLH+ SYLPKDLNF+ HTSYIGW+E ++++PIIVDPGLYL+  +D+FYATQ+R LP++
Sbjct  182   DDLLHVFSYLPKDLNFIQHTSYIGWKEERQIRPIIVDPGLYLSSRNDIFYATQKRDLPNA  241

Query  1166  FRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTI  987
             +++F GSS  ILSRKF+++CI+G +N PRTLLMY +N P     YF TVLCNS +FN T 
Sbjct  242   YKLFTGSSSVILSRKFIEYCIVGMDNLPRTLLMYYTNMPLPHRKYFQTVLCNSPEFNETA  301

Query  986   INHNLQYVSLNSR--KEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPG  813
             +NH+L Y + ++R   E R+L   D  +M  SGAAF + F + D +LD ID+EILHR PG
Sbjct  302   VNHDLHYSTWDARSKNEPRLLTIDDLENMTDSGAAFGTRFPKDDHVLDHIDAEILHRLPG  361

Query  812   KPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
              PV GGWC+G G    C + G+ DVLRPG  A +L K   E  +   F   QCI
Sbjct  362   DPVTGGWCIGVGHDSPCDISGNPDVLRPGPKAVKLAKFLAERLSYQNFYGHQCI  415



>ref|XP_010253319.1| PREDICTED: xylosyltransferase-like isoform X1 [Nelumbo nucifera]
Length=429

 Score =   385 bits (989),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/371 (50%), Positives = 252/371 (68%), Gaps = 4/371 (1%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
             P  P     + DL +P P PP +AY+ISGS GD  R+VRLL AVYHPRN YLLHLD   P
Sbjct  59    PYRPRIFPPNADLENPFPPPPRVAYFISGSDGDGPRMVRLLHAVYHPRNQYLLHLDCRTP  118

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
             +  R+ LA SVN+V  F +A NV+V+G AD V S GS+ ++S LHGA++LLR + +WDWF
Sbjct  119   QRQREELADSVNSVDAFLSAENVNVVGKADCVNSGGSTPIASLLHGAAVLLRHAKDWDWF  178

Query  1385  INLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD  1206
             +NL+++DYPL++QDD LH+LS++PKD NF+ HTS IGW+E Q+   I+VDPGLYLA    
Sbjct  179   VNLAASDYPLISQDDFLHVLSFVPKDFNFIQHTSNIGWKEYQRAIQIVVDPGLYLASKGT  238

Query  1205  VFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFP  1026
             +F  +++R  P ++R F GS Y +LSRK +++ ILG +N PRTLL+Y SN  SS   YF 
Sbjct  239   IFVGSRKRARPRAYRFFTGSPYVVLSRKLVEYSILGWDNLPRTLLLYFSNMKSSHHGYFQ  298

Query  1025  TVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPIL  852
             T++CNS  F  T++N +L++++ ++   +E R L  SD   M+RSGAAFA  F+  DP+L
Sbjct  299   TLVCNSEGFRNTVVNSDLRFIAWDNPPGEEPRDLRLSDLNKMLRSGAAFAGSFRPNDPVL  358

Query  851   DQIDSEILHRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAG  678
             D ID  ILHR   +  PGGWC G  E GR  C +WGD ++LRPG  A R EK  ++L A 
Sbjct  359   DTIDRVILHRGRDRIAPGGWCTGRHERGRDPCQLWGDVNILRPGPAANRFEKLLMKLMAN  418

Query  677   GRFQSQQCIEE  645
               F S  C + 
Sbjct  419   TTFWSNLCKQR  429



>gb|ABR16364.1| unknown [Picea sitchensis]
Length=423

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 245/352 (70%), Gaps = 4/352 (1%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             P RPP +AY ISG+ GD  R+ RLL AVYHPRN YLLHLDR AP  +R  LAL   +  +
Sbjct  69    PGRPPVLAYLISGTRGDGERMKRLLNAVYHPRNQYLLHLDRQAPDGERVKLALYAKSDRV  128

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
             FR   NV+VMG AD V   GS++++STLH A+ILLR+S+NWDW I LS+ DYPL+TQDDL
Sbjct  129   FRVMDNVNVMGKADAVTYMGSTAIASTLHAAAILLRVSTNWDWLITLSALDYPLITQDDL  188

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LH+LSYLP+D NF++HTS +GW+E Q+ KPII+DPGLYL+  S++FY++Q+R +PD+++V
Sbjct  189   LHVLSYLPRDFNFIDHTSDLGWKEYQRAKPIIIDPGLYLSTKSEIFYSSQRREMPDTYKV  248

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS + +LSR F+++C+LG +N PRT+LMY SN   S   YF TV+CN+ +F  T +N 
Sbjct  249   FTGSPWVVLSRSFMEYCVLGWDNLPRTVLMYFSNVVLSQEGYFHTVVCNAPEFKNTTVNS  308

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L+Y+  +   + E   L  SDF  +  +GAAFA  F + DP+LD+ID   L R  G+  
Sbjct  309   DLRYLVWDVPPKPEPHYLELSDFKAIAENGAAFARQFHQDDPVLDKIDRIFLKRRQGRLA  368

Query  803   PGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PGGWC       +  C+ WG+ +VL+PG  AK  EK  + L A   F+S QC
Sbjct  369   PGGWCAEKFSKRKDPCSQWGNINVLKPGPRAKLFEKLILNLIANETFRSNQC  420



>gb|ABK26987.1| unknown [Picea sitchensis]
Length=424

 Score =   380 bits (975),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 248/358 (69%), Gaps = 4/358 (1%)
 Frame = -2

Query  1712  DLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSV  1533
             D  S   + P +AY ISG+ GDS R+ R L A+YHP NHYLLHLD  AP  +R  +A+ V
Sbjct  67    DAHSGEAKLPRLAYLISGTKGDSHRMKRTLQALYHPLNHYLLHLDLEAPPRERLEVAMYV  126

Query  1532  NTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLV  1353
              + P F    NVHV+G A+ V  KG + ++ TL   +ILLR S +WDWFINLS++DYPLV
Sbjct  127   KSDPTFSKINNVHVVGKANLVTYKGPTMVACTLQAVAILLRQSKDWDWFINLSASDYPLV  186

Query  1352  TQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLP  1173
             TQDDLL + S LP+ LNF+ HTS IGW+E Q+ KPII+DPGLYL + SD+F+ TQ R +P
Sbjct  187   TQDDLLRVFSALPRGLNFIEHTSDIGWKEYQRAKPIIIDPGLYLPKKSDIFWVTQHRAVP  246

Query  1172  DSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNR  993
              SF++F GS++ +L+R FL+FCI G +N PRT+LMY +N  SS   YF TV+CNS+ F  
Sbjct  247   TSFKLFTGSAWVMLTRTFLEFCIWGWDNLPRTVLMYYTNFVSSPEGYFHTVICNSQVFRN  306

Query  992   TIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRS  819
             T +NH+L Y++ ++  ++    L   +F DM++SGA FA  F + DP+LD+ID E+L RS
Sbjct  307   TTVNHDLHYIAWDTPPKQHPTSLTVKNFDDMVKSGAPFARKFAKDDPVLDKIDKELLGRS  366

Query  818   PGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
              G+  PGGWC+G+ E+GR  CAV GD  V +PG G KRLE    +L A   F+++QCI
Sbjct  367   DGQFTPGGWCVGSRENGRDPCAVRGDPAVFKPGPGDKRLEGLLFKLLAPENFRAKQCI  424



>ref|XP_001778780.1| predicted protein [Physcomitrella patens]
 gb|EDQ56366.1| predicted protein [Physcomitrella patens]
Length=389

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/350 (51%), Positives = 247/350 (71%), Gaps = 2/350 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISG+ GD  RI R L A+YHPRN+Y+LHLD  AP  +R  LA  V + P+F
Sbjct  38    PAPPRLAYLISGNKGDGMRIRRTLQALYHPRNYYVLHLDLEAPPKERVELARYVRSDPVF  97

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +  +NV ++  A+ V  +G + +S+TLHGA+ILL+   +WDWFINLS++DYPL TQDD+L
Sbjct  98    QQTKNVIMIVKANLVTYRGPTMVSTTLHGAAILLKNFQDWDWFINLSASDYPLATQDDIL  157

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ S+LP+DLNF+ HTS IGW+E Q+ KPII+DPGL++   SD+F+ATQ+R LP ++R+F
Sbjct  158   HVFSFLPRDLNFIEHTSNIGWKEFQRAKPIIIDPGLHMNRKSDIFWATQRRALPTAYRLF  217

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++++LSR F++F I+G +N PR LLMY +N  SS   YF TV+CNS++F  T +NH+
Sbjct  218   TGSAWAVLSRSFMEFTIMGWDNLPRILLMYYTNFVSSPEGYFHTVICNSQEFRNTTVNHD  277

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y++ ++  ++    L+  DF +M  SGA FA  F   DP+L  ID ++L RSPGK  P
Sbjct  278   LHYIAWDNPPKQHPLALSMRDFQNMTSSGAPFARKFNREDPVLTFIDKQLLGRSPGKFTP  337

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             GGWC+G      C + GD  VLRPG GA+RL+     L A  RF+S+QCI
Sbjct  338   GGWCIGGVGDDPCTMIGDTSVLRPGPGARRLQGLIERLLAKPRFRSEQCI  387



>ref|XP_001782405.1| predicted protein [Physcomitrella patens]
 gb|EDQ52799.1| predicted protein [Physcomitrella patens]
Length=412

 Score =   379 bits (973),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/350 (51%), Positives = 250/350 (71%), Gaps = 3/350 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISG+ GD  R+ R L A+YHP N+YLLHLD  AP+ +R  LA+ V   P+F
Sbjct  62    PPPPKLAYLISGTKGDGFRMQRTLQALYHPHNYYLLHLDLEAPEKERMDLAVYVKHEPVF  121

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             + A NV V+G A+ V  KGS+ +++TLHGA+ILLR + +WDWFINLS++DYPL+TQDDLL
Sbjct  122   QEAGNVFVVGKANLVTYKGSTMIATTLHGAAILLRKAKDWDWFINLSASDYPLITQDDLL  181

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ SYLPKDLNF+ HTS IGW+E Q++KPII+DPGLY    +D+++ TQ+R +P +FR+F
Sbjct  182   HVFSYLPKDLNFIEHTSDIGWKEEQRVKPIIIDPGLYQKTKTDIYWMTQRRAVPSAFRLF  241

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +LSR F+++ I+G EN PRT+LMY +N  SS   YF TVLCNS++F  T +NH+
Sbjct  242   TGSAWVVLSRSFIEYTIMGWENLPRTVLMYYANFVSSPEGYFHTVLCNSQEFRNTTVNHD  301

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L +++ ++  ++    L    F DM  SGA FA  F + DP+LD+ID+E+LHR      P
Sbjct  302   LHFIAWDTPPKQHPLSLTVKFFKDMSNSGAPFARKFNKDDPVLDKIDAELLHRKKHGFSP  361

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             GGWC+G  ++  C+V GD  +L+PG GA+R E   + L     F+S+QC+
Sbjct  362   GGWCVGPDDNP-CSVRGDYSLLKPGPGARRFEDLVVRLLLPENFRSRQCV  410



>gb|ABK24335.1| unknown [Picea sitchensis]
Length=442

 Score =   380 bits (975),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 245/351 (70%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISGS GD  R+VR L A+YHP N Y++HLD  +   +R  LA+ V T P+F
Sbjct  91    PPPPRLAYLISGSRGDGERLVRTLQALYHPLNQYVVHLDLESSPRERVDLAVYVKTDPIF  150

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NVH++  A+ V  +G + +++TLH A+ILL+ S  WDWFINLS++DYPLV+QDDLL
Sbjct  151   AKVGNVHMITKANLVTYRGPTMVANTLHAAAILLKKSQEWDWFINLSASDYPLVSQDDLL  210

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF+ HTS IGW+E Q+ +PII+DPGLY+++ SDVF+ TQ+R +P SF++F
Sbjct  211   HTFSYLPRDLNFIEHTSNIGWKEHQRARPIIIDPGLYMSKKSDVFWVTQKRGVPTSFKLF  270

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F++FCI G +N PRT+LMY +N  SS   YF TV+CN+R+F  T +NH+
Sbjct  271   TGSAWMALSRAFIEFCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAREFQNTTVNHD  330

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             + Y+S ++  ++    L   DF  M  S A FA  F   DP+LD+ID E+L R  G  VP
Sbjct  331   MHYISWDTPPKQHPHSLGLKDFEKMNESSAPFARKFDRMDPVLDKIDKELLGRKNGSFVP  390

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+GN + G   C+V GD  VL+PG GAKRLEK  + L +   F+++QC
Sbjct  391   GGWCIGNRDDGSDPCSVMGDKTVLKPGPGAKRLEKLIVALLSKENFRNKQC  441



>ref|XP_002284096.1| PREDICTED: xylosyltransferase 1 [Vitis vinifera]
 emb|CBI26925.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   378 bits (970),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 184/349 (53%), Positives = 242/349 (69%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  G   RI+RLL AVYHPRN YLLHL   A   +R LLA +V +VP  RA
Sbjct  52    PPAFAYYISGGRGHKDRILRLLLAVYHPRNRYLLHLGADASDEERRLLASAVKSVPAIRA  111

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D +   GSS++++TL  ASILLR+ S W+WFI LSS DYPL+TQDDL H+
Sbjct  112   FGNVDVVGKPDRLTYMGSSNIAATLRAASILLRVDSGWNWFITLSSMDYPLITQDDLSHV  171

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+ESQ++ PI+VDPG+YLA  S +F+AT++RP PD F+ F G
Sbjct  172   FSSVRRDLNFIDHTSDLGWKESQRVHPIVVDPGIYLARRSQIFHATEKRPTPDGFKFFTG  231

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + IL+R FL+FCILG +N PRTLLMY +N   SD  YF +V+CNS +F  T +N++L+
Sbjct  232   SPWVILNRSFLEFCILGWDNLPRTLLMYFTNVILSDEGYFHSVICNSPEFRNTTVNNDLR  291

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             YV  +S  + E   LN SD+   ++SGAAFA  F++ DP+L+ ID +IL R   + VPG 
Sbjct  292   YVIWDSPPKMEPHFLNVSDYDQTVQSGAAFARQFQKDDPVLNMIDEKILKRGRNRVVPGA  351

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C+ WGDA+VLRPG+ AK+LE+    L  G   QS QC
Sbjct  352   WCTGRKSWWMDPCSNWGDANVLRPGLQAKKLEESVTNLLEGSNSQSNQC  400



>ref|XP_009618079.1| PREDICTED: uncharacterized protein LOC104110320 isoform X2 [Nicotiana 
tomentosiformis]
Length=285

 Score =   372 bits (954),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 205/238 (86%), Gaps = 0/238 (0%)
 Frame = -2

Query  1358  LVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRP  1179
             L+   DLLHILSYLPKDLNFVNHTSYIGWRES+KLKPI+VDPGLYL E+ +VF+A+Q+R 
Sbjct  48    LIRGRDLLHILSYLPKDLNFVNHTSYIGWRESRKLKPIVVDPGLYLEEEDEVFFASQKRE  107

Query  1178  LPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQF  999
             LPD++++F GSS +ILSRKF++FCILGT+N PRTLLMYLSN+PSS +VYFPT+LCNSR+F
Sbjct  108   LPDAYQLFSGSSSAILSRKFIEFCILGTDNLPRTLLMYLSNSPSSASVYFPTILCNSRKF  167

Query  998   NRTIINHNLQYVSLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRS  819
             N+T INHN+QY S NSR+E R LNSSDF D++ SGAAFA+PF+  DPILDQID E+LH  
Sbjct  168   NKTTINHNMQYASFNSRQETRKLNSSDFNDLVMSGAAFATPFEANDPILDQIDRELLHHK  227

Query  818   PGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
               +PVPGGWCLG+ E+ +C +WGDA+VLRPG GAKRLEKHF+ELF  G F+S +C+ E
Sbjct  228   YDEPVPGGWCLGDNETDKCTLWGDAEVLRPGRGAKRLEKHFVELFTNGTFRSSRCVYE  285



>gb|EPS68967.1| hypothetical protein M569_05800, partial [Genlisea aurea]
Length=342

 Score =   370 bits (951),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 208/353 (59%), Positives = 253/353 (72%), Gaps = 23/353 (7%)
 Frame = -2

Query  1712  DLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSV  1533
             D S PPP  PS+AY ISGS+ DSG++VRLL A+YHP+N YLL LD SA + DR+ LA+ V
Sbjct  1     DGSEPPP--PSLAYLISGSSNDSGQMVRLLHAIYHPKNQYLLRLDGSATQKDRESLAVVV  58

Query  1532  NTVPLFRAARNVHVMGNADFVY---SKGSSSMSSTLHGASILLRISSNWDWFINLSSADY  1362
              +VPLF A +NVHV+G AD       +G S++SSTLHGAS+LL +SSNWDW INL +  Y
Sbjct  59    QSVPLFWALQNVHVVGKADSAAPANGEGPSALSSTLHGASLLLHVSSNWDWLINLHADCY  118

Query  1361  PLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD--VFYATQ  1188
             PLVTQDDLLHILSYLPKDLNF+ H+SYIGWRES KLKPIIVDPGLY A+      F+ATQ
Sbjct  119   PLVTQDDLLHILSYLPKDLNFIKHSSYIGWRESGKLKPIIVDPGLYNADKRSTYTFFATQ  178

Query  1187  QRPLPDSFRVFRGSSYSILSRKFLDFCILGTE-NFPRTLLMYLSNTPSSDAVYFPTVLCN  1011
             +R LPD+FR+F G   ++LSR F+++CI   E N PRTLLMYL+NTP S A+YFPT+ CN
Sbjct  179   KRALPDAFRLFSGHPTAVLSRGFVEYCIAAAEDNLPRTLLMYLTNTPVSSALYFPTLACN  238

Query  1010  SRQFNRTIINHNLQYVSLNSRKEARVLNSSDFLDMIRSGAAFASPFKERD-PILDQIDSE  834
             S  FNRT ++H  Q     SR       +  F  +I SGAAFASPF + D P+LD+ID E
Sbjct  239   SPGFNRTAVDHAFQV----SR------GADGFDGLILSGAAFASPFGDGDGPVLDRIDRE  288

Query  833   ILHR--SPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFA  681
             IL R    G P PGGWCL +GESG C V GDA+VL PG GA RL+   +   +
Sbjct  289   ILRRRSGGGGPAPGGWCL-DGESG-CRVLGDAEVLVPGPGAGRLQAGLVRTLS  339



>emb|CDY30282.1| BnaC04g31930D [Brassica napus]
Length=432

 Score =   372 bits (954),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 247/352 (70%), Gaps = 5/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD   + R L A+YHP N Y++HLDR++ + +R+ L   +    LF
Sbjct  80    PSPPRFAYLISGSAGDGKSLRRTLLALYHPSNRYVVHLDRASSEEEREDLHGYIRNSSLF  139

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQD-DL  1338
             R  RNVH++  A+ V  +G + +++TLH A+ILLR  + WDWFINLSS+DYPL++QD DL
Sbjct  140   RRFRNVHMIEKANLVTYRGPTMVANTLHAAAILLREGAEWDWFINLSSSDYPLMSQDADL  199

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LHI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++
Sbjct  200   LHIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKL  259

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N 
Sbjct  260   FTGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFKNTTVNS  319

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L +++ ++  ++    L  +D   M+ S A FA  F+  DP+LD ID E+L++ PG P 
Sbjct  320   DLHFIAWDNPPKQHPHHLTLADMDRMVNSNAPFARKFRREDPVLDTIDEELLNKGPGMPT  379

Query  803   PGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PGGWC+G+ E+G   CAV GD DV+RPG+GA+RLE     L +   F+ +QC
Sbjct  380   PGGWCIGSHENGTDPCAVIGDTDVIRPGLGARRLETLVTSLLSPENFRPKQC  431



>ref|XP_009125126.1| PREDICTED: xylosyltransferase 1-like [Brassica rapa]
Length=435

 Score =   372 bits (955),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 245/351 (70%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD   + R L A+YHP N Y++HL+R++   +R+ L   +    LF
Sbjct  84    PDPPRFAYLISGSAGDGKSLRRTLLALYHPNNRYVVHLERASSPEEREDLHGYIRNSSLF  143

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  +NVHV+  A+ V  +G + +++TLH A+ILLR  + WDWFINLSS+DYPL+TQDDLL
Sbjct  144   RRFQNVHVIEKANLVTYRGPTMVANTLHAAAILLREGAEWDWFINLSSSDYPLMTQDDLL  203

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  204   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  263

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  264   TGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNSD  323

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L +++ ++  ++    L  +D   M+ S A FA  F+  DP+LD+ID E+L+R  G P P
Sbjct  324   LHFITWDNPPKQHPHHLTLADMDRMVNSNAPFARKFRREDPVLDKIDEELLNRGFGMPTP  383

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   CAV GD DV+RPG GA+RLE     L +   F+ +QC
Sbjct  384   GGWCIGSHENGTDPCAVIGDTDVIRPGPGARRLESLVTSLLSTENFRPKQC  434



>ref|XP_008446701.1| PREDICTED: xylosyltransferase 1 [Cucumis melo]
Length=396

 Score =   369 bits (948),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 244/368 (66%), Gaps = 13/368 (4%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
             PS  HR L H         PP+ +YYI G  GD  RI RLL AVYHPRN YLLHL+  A 
Sbjct  37    PSSVHRGLHH---------PPAFSYYIYGGHGDKDRIFRLLLAVYHPRNRYLLHLNHEAS  87

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
               DR  LA +V +VP  RA  NV ++G  D +   GSS +++TLH A+ILL+I S WDWF
Sbjct  88    DGDRQQLAAAVKSVPAIRAFGNVDLVGKPDRMTYSGSSYIAATLHAAAILLKIDSGWDWF  147

Query  1385  INLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD  1206
             I LS+ DYPL+TQDDL H+LS + +DLNF+ HTS IGW+ES+++ PI+VDP +YLA  S 
Sbjct  148   ITLSAKDYPLITQDDLAHVLSSVRRDLNFIQHTSDIGWKESKRINPIVVDPAVYLARRSQ  207

Query  1205  VFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFP  1026
             +F+AT+QRP PD+F++F GS + ILSR FL+FC+LG +N PR LLMY +N   S   YF 
Sbjct  208   IFHATEQRPTPDAFKIFTGSPWVILSRSFLEFCVLGWDNLPRKLLMYFTNVVWSQEGYFH  267

Query  1025  TVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPIL  852
             +V+CNS +F    +N +L+Y+  ++  + +   L+SS+F  M +SGAAFA  F++ DP+L
Sbjct  268   SVICNSPEFKNKTVNSDLRYMVWDNPPKMDPHFLHSSNFDQMSQSGAAFARQFQQNDPVL  327

Query  851   DQIDSEILHRSPGKPVPGGWCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAG  678
             + +D  IL+R P +P PG WC G  +  +  C+ WGD +VL+PG  AK+ EK    L+  
Sbjct  328   NMVDKIILNRKPNRPTPGAWCSGWNSWWTDPCSQWGDVNVLKPGFWAKKFEKSITNLYDE  387

Query  677   GRFQSQQC  654
                Q  QC
Sbjct  388   LSSQPNQC  395



>ref|XP_008644297.1| PREDICTED: uncharacterized protein LOC100383031 isoform X1 [Zea 
mays]
 tpg|DAA43343.1| TPA: hypothetical protein ZEAMMB73_099523 [Zea mays]
Length=415

 Score =   370 bits (949),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 252/354 (71%), Gaps = 5/354 (1%)
 Frame = -2

Query  1706  SSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNT  1527
             +S  P P ++A+ ++GSAGD+ R+ RLL A YHPRN YLL LDR+A  +DR  LA S   
Sbjct  63    ASAGPAPSALAFLLTGSAGDADRLQRLLLATYHPRNVYLLLLDRAASAADRARLARSARA  122

Query  1526  VPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQ  1347
              P      NVHV+G+  F   +G+S++++TLHGA++LLR+   WDWF++L + +YPLVT 
Sbjct  123   AP---GRDNVHVVGDPGFANPRGASALAATLHGAALLLRVDQGWDWFVHLDADEYPLVTP  179

Query  1346  DDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDS  1167
             DDLLH+ SYLPKDLNF+ HTSYIGW+E ++++PIIVDPGLYL+  +D+FYATQ+R +P++
Sbjct  180   DDLLHVFSYLPKDLNFIQHTSYIGWKEERQIRPIIVDPGLYLSSRNDIFYATQKRDIPNA  239

Query  1166  FRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTI  987
             +++F GSS  ILSRKF+++CI+G +N PRTLLMY +N P     YF TVLCNS +FN+T+
Sbjct  240   YKLFTGSSSVILSRKFIEYCIVGMDNLPRTLLMYYTNMPLPHRKYFQTVLCNSAEFNKTV  299

Query  986   INHNLQYVSLNSR--KEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPG  813
             +NH+L Y + ++R   E R+L   D  +M  SGAAF + F + D  LD+ID EILHR PG
Sbjct  300   VNHDLHYSTWDARSKNEPRLLTIDDVENMTESGAAFGTRFPKDDHALDRIDEEILHRHPG  359

Query  812   KPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             + V GGWC+G G    C + G+ DVLRPG  A +L K   E  +   F SQQCI
Sbjct  360   ELVTGGWCIGVGHDSPCDISGNPDVLRPGPKAIKLAKFLSERLSYRNFYSQQCI  413



>ref|XP_001774021.1| predicted protein [Physcomitrella patens]
 gb|EDQ61211.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   370 bits (951),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 247/359 (69%), Gaps = 3/359 (1%)
 Frame = -2

Query  1721  IHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLA  1542
             I  D ++  P PP +AY ISG+ GD  R+ R L A+YHP N+YLLHLD  AP  +R  LA
Sbjct  71    IAQDPTAELPPPPRLAYLISGTKGDGLRMQRTLQALYHPWNYYLLHLDLDAPPRERLDLA  130

Query  1541  LSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADY  1362
               V    +F+   NV+V+G  + V  +G + +++TLHGA+ILLR + +WDWFINLS+ADY
Sbjct  131   RYVKNEVVFKEGGNVYVVGKTNLVTYRGPTMIAATLHGAAILLRKAKDWDWFINLSAADY  190

Query  1361  PLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQR  1182
             PLVTQDDLLH+ SYLP+DLNF+ HTS IGW+E Q+ KPII+DPGLY  + +D+F+ATQ+R
Sbjct  191   PLVTQDDLLHVFSYLPRDLNFIQHTSDIGWKEFQRAKPIIIDPGLYQNKKTDIFWATQRR  250

Query  1181  PLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQ  1002
              LP +FR+F GS++  L+R F+++C LG EN PRTLLMY +N  SS   YF TVLCN+++
Sbjct  251   ALPTAFRLFTGSAWFALTRSFMEYCNLGWENLPRTLLMYYTNFVSSPEGYFHTVLCNAQE  310

Query  1001  FNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEIL  828
             F  T +NH+L Y+  +   ++    L   D  +M  SGAAFA  F + DP+LD+ID  +L
Sbjct  311   FRNTTVNHDLHYIKWDHPPKQHPLSLTLKDMENMTISGAAFARKFDKDDPVLDRIDETLL  370

Query  827   HRSPGKPVPGGWCLGNGESGR-CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             +R  G+  PGGWC+G   +   CA+ G+  +LRPG G++R E   + + +   F++QQC
Sbjct  371   NRKKGQFTPGGWCIGRRHATDPCALRGNHSLLRPGPGSRRFENLVVRMLSAESFRTQQC  429



>ref|XP_004135058.1| PREDICTED: xylosyltransferase 1-like [Cucumis sativus]
 gb|KGN52143.1| hypothetical protein Csa_5G611740 [Cucumis sativus]
Length=396

 Score =   369 bits (947),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/368 (49%), Positives = 244/368 (66%), Gaps = 13/368 (4%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
             PS  HR L H         PP+ +YYI G  GD  RI RLL AVYHPRN YLLHL++ A 
Sbjct  37    PSSVHRGLHH---------PPAFSYYIYGGHGDKDRIFRLLLAVYHPRNRYLLHLNQEAS  87

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
               DR  LA +V +VP  RA  NV V+G  D +   GSS +++TLH A+ILL+I S WDWF
Sbjct  88    DGDRQQLAEAVKSVPAIRAFGNVDVVGKPDRMTYSGSSYIAATLHAAAILLKIDSGWDWF  147

Query  1385  INLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD  1206
             I LS+ DYPL+TQDDL H LS + +DLNF+ HTS IGW+ES+++ PI+VDP +YLA  S 
Sbjct  148   ITLSAKDYPLITQDDLAHALSSVSRDLNFIQHTSDIGWKESKRVNPIVVDPAVYLARRSQ  207

Query  1205  VFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFP  1026
             +F+AT+QRP PD+F++F GS + ILSR FL+FC+LG +N PR LLMY +N   S   YF 
Sbjct  208   IFHATEQRPTPDAFKIFTGSPWVILSRPFLEFCVLGWDNLPRKLLMYFTNVVWSQEGYFH  267

Query  1025  TVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPIL  852
             +V+CNS +F    +N +L+Y++ ++  + +   L+SS+F  M +SGAAFA  F++ DP+L
Sbjct  268   SVICNSPEFKNKTVNSDLRYMTWDNPPKMDPHFLHSSNFDKMSQSGAAFARQFQQNDPVL  327

Query  851   DQIDSEILHRSPGKPVPGGWCLGNG--ESGRCAVWGDADVLRPGVGAKRLEKHFIELFAG  678
             + +D  IL+R P +P PG WC G     +  C+ WGD +VL+PG  AK+ EK    L+  
Sbjct  328   NMVDKIILNRKPNQPTPGAWCSGWNIWWTDPCSQWGDVNVLKPGFWAKKFEKTITNLYDE  387

Query  677   GRFQSQQC  654
                Q  QC
Sbjct  388   LGSQPNQC  395



>ref|NP_198815.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 dbj|BAB10223.1| glycosylation enzyme-like protein [Arabidopsis thaliana]
 gb|AAP21301.1| At5g39990 [Arabidopsis thaliana]
 dbj|BAE99445.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED94499.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38595.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=447

 Score =   370 bits (949),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 246/351 (70%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD   + R L A+YHP N Y++HLDR + + +R+ L   +    LF
Sbjct  96    PSPPRFAYLISGSAGDGKSLRRTLLALYHPNNRYVVHLDRESSREEREELHGYIKNSSLF  155

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NVH++  A+ V  +G + +++TLH A+ILLR  ++WDWFINLSS+DYPLVTQDDLL
Sbjct  156   RRFMNVHMIEKANLVTYRGPTMVANTLHAAAILLREGADWDWFINLSSSDYPLVTQDDLL  215

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  216   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  275

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  276   TGSAWMALSRPFVDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNSD  335

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L  +D   M+ S A FA  F+  DP+LD+ID E+L+R PG   P
Sbjct  336   LHFISWDNPPKQHPHHLTLTDMTKMVNSNAPFARKFRREDPVLDKIDDELLNRGPGMITP  395

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   CAV GD DV+RPG GA+RLE     L +   F+S+QC
Sbjct  396   GGWCIGSHENGSDPCAVIGDTDVIRPGPGARRLENLVTSLLSTENFRSKQC  446



>ref|XP_007027048.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY07550.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=415

 Score =   369 bits (946),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 246/351 (70%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P+ P  AY ISG+ GD  R+ RLL +VYHPRN+Y+LHLD  A  S+R  LA  V +  +F
Sbjct  64    PKLPRFAYLISGTKGDGPRVKRLLQSVYHPRNYYVLHLDLEASDSERLELAKYVKSEGVF  123

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NV V+G AD V  KG + ++STLH  +ILL+ +  WDWF+NLS++DYPL++QDD++
Sbjct  124   REFGNVMVIGKADLVTYKGPTMIASTLHAVAILLKKAKEWDWFLNLSASDYPLMSQDDIV  183

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ HTS IGW+E Q+ +PII+DPGLY ++ S VF+A ++R LP SF++F
Sbjct  184   HIFSYLPRDLNFLEHTSSIGWKEYQRARPIIIDPGLYHSKKSGVFWAKEKRSLPASFKLF  243

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +L++ FL+FC+ G +N PRTLLMY +N  SS   YF TV+CN++ +  T +NH+
Sbjct  244   MGSEWVVLTKSFLEFCVWGWDNLPRTLLMYYTNFLSSPEGYFHTVICNNKDYQNTTVNHD  303

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  ++  ++    L    F DM++SGA FA  F + DP+L++ID E+L RS G+  P
Sbjct  304   LHYIRWDNPPKQHPMTLTLEHFDDMVQSGAPFARKFAKDDPVLNKIDKELLRRSYGQLTP  363

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G   SG+  C V+G+ + ++P V +KRLEK  ++L     F+S+QC
Sbjct  364   GGWCVGGSYSGKDPCVVYGNPNAVKPSVSSKRLEKLLVKLLDSESFRSKQC  414



>ref|XP_004159283.1| PREDICTED: xylosyltransferase 1-like [Cucumis sativus]
Length=396

 Score =   368 bits (944),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 243/368 (66%), Gaps = 13/368 (4%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
             PS  HR L H         PP+ +YYI G  GD  RI RLL AVYHPRN YLLHL++ A 
Sbjct  37    PSSVHRGLHH---------PPAFSYYIYGGHGDKDRIFRLLLAVYHPRNRYLLHLNQEAS  87

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
               DR  LA +V +VP  RA  NV V+G  D +   GSS +++TLH A+ILL+I S WDWF
Sbjct  88    DGDRQQLAEAVKSVPAIRAFGNVDVVGKPDRMTYSGSSYIAATLHAAAILLKIDSGWDWF  147

Query  1385  INLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD  1206
             I L + DYPL+TQDDL H LS + +DLNF+ HTS IGW+ES+++ PI+VDP +YLA  S 
Sbjct  148   ITLGAKDYPLITQDDLAHALSSVSRDLNFIQHTSDIGWKESKRVNPIVVDPAVYLARRSQ  207

Query  1205  VFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFP  1026
             +F+AT+QRP PD+F++F GS + ILSR FL+FC+LG +N PR LLMY +N   S   YF 
Sbjct  208   IFHATEQRPTPDAFKIFTGSPWVILSRPFLEFCVLGWDNLPRKLLMYFTNVVWSQEGYFH  267

Query  1025  TVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPIL  852
             +V+CNS +F    +N +L+Y++ ++  + +   L+SS+F  M +SGAAFA  F++ DP+L
Sbjct  268   SVICNSPEFKNKTVNSDLRYMTWDNPPKMDPHFLHSSNFDKMSQSGAAFARQFQQNDPVL  327

Query  851   DQIDSEILHRSPGKPVPGGWCLGNG--ESGRCAVWGDADVLRPGVGAKRLEKHFIELFAG  678
             + +D  IL+R P +P PG WC G     +  C+ WGD +VL+PG  AK+ EK    L+  
Sbjct  328   NMVDKIILNRKPNQPTPGAWCSGWNIWWTDPCSQWGDVNVLKPGFWAKKFEKTITNLYDE  387

Query  677   GRFQSQQC  654
                Q  QC
Sbjct  388   LGSQPNQC  395



>ref|XP_007151184.1| hypothetical protein PHAVU_004G025100g [Phaseolus vulgaris]
 gb|ESW23178.1| hypothetical protein PHAVU_004G025100g [Phaseolus vulgaris]
Length=430

 Score =   369 bits (947),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/357 (49%), Positives = 246/357 (69%), Gaps = 5/357 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +S+ PP PP +AY +SGSAGD G + R+L A+YHP N Y++HLD  A   +R  LA  V 
Sbjct  75    VSALPP-PPRLAYLVSGSAGDGGAVRRVLLALYHPGNRYVVHLDLEASAEERADLARFVE  133

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
               PLFR   NV V+  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVT
Sbjct  134   EHPLFRRFGNVRVIKKANLVTYRGPTMVANTLHAAAILLRELGDWDWFINLSASDYPLVT  193

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW++ Q+ +PIIVDPGLY+ +  DVF+ TQ+R  P 
Sbjct  194   QDDLLHTFSYLPRDLNFIDHTSDIGWKDHQRARPIIVDPGLYMNKKQDVFWVTQKRSRPT  253

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LS+ F+D+CI G +N PRT+LMY SN  SS   YF TV+CN+++F  T
Sbjct  254   AFKLFTGSAWMALSKSFIDYCIWGWDNLPRTVLMYYSNFISSPEGYFHTVICNAQEFRNT  313

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L ++S ++  ++    L   D   M+ S A FA  F   DP+LD+ID+E+L R P
Sbjct  314   TVNSDLHFISWDNPPKQHPHYLTVEDMKGMVDSNAPFARKFHREDPVLDKIDAELLSRGP  373

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             G  VPGGWC+G  E+G   C+  GD ++LRPG G+KRLE     L +  +F+ +QC+
Sbjct  374   GMTVPGGWCIGKRENGTDPCSQIGDTNILRPGQGSKRLEALISSLLSNKKFRPRQCV  430



>ref|XP_006405565.1| hypothetical protein EUTSA_v10027776mg [Eutrema salsugineum]
 gb|ESQ47018.1| hypothetical protein EUTSA_v10027776mg [Eutrema salsugineum]
Length=435

 Score =   369 bits (946),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 243/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD   + R L A+YHP N Y++HLDR++   +R+ L   +    LF
Sbjct  84    PSPPRFAYLISGSAGDGKSLRRTLLALYHPNNRYVVHLDRASSPEEREDLHGYIRNSSLF  143

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NVH++  A+ V  +G + +++TLH A+ILLR  ++WDWFINLSS+DYPLVTQDDLL
Sbjct  144   GRFNNVHMIEKANLVTYRGPTMVANTLHAAAILLREGADWDWFINLSSSDYPLVTQDDLL  203

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  204   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  263

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  264   TGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNSD  323

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L  +D   M+ S A FA  F+  DP+LD+ID E+L+R PG   P
Sbjct  324   LHFISWDNPPKQHPHHLTLADMDKMVNSNAPFARKFRREDPVLDKIDDELLNRGPGMVTP  383

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+  +G   CA+ GD DV+RPG GAKRLE     L +   F+ +QC
Sbjct  384   GGWCIGSQGNGSDPCALIGDTDVIRPGPGAKRLENLVTWLLSNENFRPKQC  434



>ref|XP_002870736.1| glycosyltransferase family 14 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46995.1| glycosyltransferase family 14 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=445

 Score =   368 bits (945),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 246/351 (70%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD   + R L A+YHP N Y++HLDR + K +R+ L   +    LF
Sbjct  94    PSPPRFAYLISGSAGDGKSLRRTLLALYHPNNRYVVHLDRESSKEEREELHGYIKNSSLF  153

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NVH++  A+ V  +G + +++TLH A+ILLR  ++WDWFINLSS+DYPLVTQDDLL
Sbjct  154   RRFMNVHMIEKANLVTYRGPTMVANTLHAAAILLREGADWDWFINLSSSDYPLVTQDDLL  213

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  214   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  273

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  274   TGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNSD  333

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L  +D   MI S A FA  F+  DP+LD+ID ++L+R PG   P
Sbjct  334   LHFISWDNPPKQHPHHLTHADMTKMIDSNAPFARKFRREDPVLDKIDDDLLNRGPGMATP  393

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   CAV G+ DV+RPG GA+RLE     L +   F+S+QC
Sbjct  394   GGWCIGSYENGSDPCAVIGETDVIRPGPGARRLENLVTSLLSTENFRSKQC  444



>ref|XP_010230278.1| PREDICTED: xylosyltransferase 1 [Brachypodium distachyon]
Length=368

 Score =   365 bits (936),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 258/357 (72%), Gaps = 5/357 (1%)
 Frame = -2

Query  1715  GDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALS  1536
              D SS  P PP++A+ ++GSAGD+ R++RLL A YHPRNHYLL LDR+A  +DR  LA  
Sbjct  13    ADASSAGPAPPALAFLLTGSAGDADRLLRLLLATYHPRNHYLLLLDRAASDADRARLARE  72

Query  1535  VNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPL  1356
               T P      NVHV+G+  F    G+S++++ LHGA++LLR+  +WDWF++L +ADYPL
Sbjct  73    ARTGP---GRANVHVVGDPGFANPSGASALAAALHGAALLLRVDQDWDWFLHLDAADYPL  129

Query  1355  VTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPL  1176
             VT DDLLH+LSYLP++LNF+ H+SYIGW+ES+++KPI+VDPGLYL+  +D+FYATQ+R L
Sbjct  130   VTPDDLLHVLSYLPRNLNFIQHSSYIGWKESRQIKPIVVDPGLYLSSRTDIFYATQKREL  189

Query  1175  PDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFN  996
             P ++++F GSS  ILSRKF+++CI+GT N PRTLLMY +N P     YF TVLCNS +FN
Sbjct  190   PSAYKLFTGSSSVILSRKFIEYCIVGTNNLPRTLLMYYTNMPLPHRKYFQTVLCNSPEFN  249

Query  995   RTIINHNLQY--VSLNSRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHR  822
             RT++NH+L Y     + + E R+L  +D  ++ +S  AF + F + DP+L  ID EILHR
Sbjct  250   RTVVNHDLHYSITDKSPKNEPRLLTLADAENITQSSVAFGTRFAKDDPVLGHIDEEILHR  309

Query  821   SPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
              PG+P PGGWC+G G+   C+V G+ DVLRPG  A +L K   +  +   F SQQCI
Sbjct  310   RPGEPAPGGWCMGAGDDSPCSVSGNTDVLRPGPEAMKLAKFLAQRLSYPGFYSQQCI  366



>emb|CDX67446.1| BnaA07g14860D [Brassica napus]
Length=436

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 245/352 (70%), Gaps = 5/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD   + R L A+YHP N Y++HL+R++   +R+ L   +    LF
Sbjct  84    PDPPRFAYLISGSAGDGKSLRRTLLALYHPNNRYVVHLERASSPEEREDLHGYIRNSSLF  143

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQD-DL  1338
             R  +NVHV+  A+ V  +G + +++TLH A+ILLR  + WDWFINLSS+DYPL+TQD DL
Sbjct  144   RRFQNVHVIEKANLVTYRGPTMVANTLHAAAILLREGAEWDWFINLSSSDYPLMTQDADL  203

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LHI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++
Sbjct  204   LHIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKL  263

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N 
Sbjct  264   FTGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNS  323

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L +++ ++  ++    L  +D   M+ S A FA  F+  DP+LD+ID E+L+R  G P 
Sbjct  324   DLHFITWDNPPKQHPHHLTLADMDRMVNSNAPFARKFRREDPVLDKIDEELLNRGFGMPT  383

Query  803   PGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PGGWC+G+ E+G   CAV GD DV+RPG GA+RLE     L +   F+ +QC
Sbjct  384   PGGWCIGSHENGTDPCAVIGDTDVIRPGPGARRLESLVTSLLSTENFRPKQC  435



>emb|CDX74413.1| BnaA04g09760D [Brassica napus]
Length=428

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 246/352 (70%), Gaps = 5/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD   + R L A+YHP N Y++HLDR++ + +R+ L   + +  LF
Sbjct  76    PAPPRFAYLISGSAGDGKSLRRTLLALYHPSNRYVVHLDRASSEEEREDLNGYIRSSSLF  135

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQD-DL  1338
             R  RNV ++  A+ V  +G + +++TLH A+ILLR  + WDWFINLSS+DYPL++QD DL
Sbjct  136   RRFRNVDMIEKANLVTYRGPTMVANTLHAAAILLREGAEWDWFINLSSSDYPLMSQDADL  195

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LH+ S+LP+ LNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++
Sbjct  196   LHVFSHLPRGLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKL  255

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N 
Sbjct  256   FTGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFKNTTVNS  315

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L +++ ++  ++    L  +D   M+ S A FA  F+  DP+LD ID E+L+R PG P 
Sbjct  316   DLHFIAWDNPPKQHPHHLTLADMDRMVNSNAPFARKFRREDPVLDTIDEELLNRGPGMPT  375

Query  803   PGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PGGWC+G+ E+G   CAV GD DV+RPG+GA+RLE     L +   F+ +QC
Sbjct  376   PGGWCIGSHENGTDPCAVIGDTDVIRPGLGARRLETLVTSLLSPENFRPKQC  427



>ref|XP_010527488.1| PREDICTED: xylosyltransferase 2 [Tarenaya hassleriana]
Length=273

 Score =   360 bits (925),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 176/273 (64%), Positives = 220/273 (81%), Gaps = 5/273 (2%)
 Frame = -2

Query  1448  MSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWR  1269
             M+STLHGASILLR+SSNWDWFINL + DYPLVTQDD LHILS+LPK+LNFVNHTSYIGWR
Sbjct  1     MASTLHGASILLRLSSNWDWFINLRADDYPLVTQDDFLHILSHLPKELNFVNHTSYIGWR  60

Query  1268  ESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTEN  1089
             ES++LKPIIVDPGLYL E +D+FYATQ+R LP +FR+F G S+SIL+R F++ C+LGT+N
Sbjct  61    ESRRLKPIIVDPGLYLVEKTDMFYATQKRELPKAFRLFSGPSFSILTRNFVEHCVLGTDN  120

Query  1088  FPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSLN--SRKEARVLNSSDF  915
             FPRTLLMYLSNTPSS + YFPTVLC+S QF +TIINHNL Y++ N  SR++   L+S +F
Sbjct  121   FPRTLLMYLSNTPSSISNYFPTVLCSSNQFRKTIINHNLLYLARNETSREKYHHLDSKEF  180

Query  914   LDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKP-VPGGWCLGN--GESGRCAVWGDA  744
               M+ SGAAFA  F+  DPILD+ID E+L R+PG+  VPGGWCL +       C++WGDA
Sbjct  181   STMVGSGAAFARGFRHDDPILDRIDQELLGRNPGEEVVPGGWCLADSSNNISSCSIWGDA  240

Query  743   DVLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
              VLRPG G+ RL++  ++L +   F+S QC+ E
Sbjct  241   GVLRPGPGSDRLQRRIVQLLSDDWFKSHQCVVE  273



>ref|XP_010066647.1| PREDICTED: xylosyltransferase 1 [Eucalyptus grandis]
 gb|KCW64613.1| hypothetical protein EUGRSUZ_G02200 [Eucalyptus grandis]
Length=396

 Score =   365 bits (936),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 238/352 (68%), Gaps = 4/352 (1%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             P  PP+ AYYISG  G   RI+RLL AVYHPRN YLLHL + A   +R  LA +V  VP 
Sbjct  44    PHHPPAFAYYISGGRGQKDRILRLLLAVYHPRNRYLLHLGKEASDDERSKLAAAVEAVPA  103

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
              R+  NV V+GN D     GSS++++TL  A+ILL++ S WDWFI LS+ DYPL+TQDDL
Sbjct  104   IRSFGNVDVVGNPDPFTYMGSSNIAATLRAAAILLKLDSGWDWFITLSAFDYPLITQDDL  163

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
              H+ S + +DLNF++HTS +GW+E Q+++PI+VDPG+YLA  + +F AT++RP PD+F+V
Sbjct  164   SHVFSSVSRDLNFIDHTSDLGWKEQQRIQPIVVDPGIYLARRTQIFQATEKRPTPDAFKV  223

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS + +LSR FL+FC+ G  N PRTLLMY +N   S   YF +V+CNS +F  T +N 
Sbjct  224   FTGSPWVMLSRPFLEFCVFGWNNLPRTLLMYFNNVMLSQEAYFHSVICNSPEFKNTTVNS  283

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L+++  ++  + +   LNS D+  M++SGAAFA  FK+ DP+LD +D+ IL R P +  
Sbjct  284   DLRFMIWDNPPKMDPLFLNSPDYDQMVQSGAAFARQFKQNDPVLDMVDAHILKREPSRVA  343

Query  803   PGGWCLGNGE--SGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PG WC G        C+ WGD +VL+PG  AK+LE   + L    + Q +QC
Sbjct  344   PGPWCTGRKGWLMDPCSQWGDVNVLKPGPQAKKLEDSIMNLVDDTKSQLKQC  395



>ref|XP_010496515.1| PREDICTED: xylosyltransferase 1-like isoform X1 [Camelina sativa]
Length=439

 Score =   366 bits (939),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 243/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY +SGSAGD   + R L A+YHP N Y++HLDR +   +R+ L   +    LF
Sbjct  88    PSPPRFAYLVSGSAGDGKSLRRTLLALYHPNNRYVVHLDRESSHEEREELHGYIKNSSLF  147

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NVH++  A+ V  +G + +++TLH A+ILLR  ++WDWFINLSS+DYPLVTQDDLL
Sbjct  148   SRFMNVHMIEKANLVTYRGPTMVANTLHAAAILLREGADWDWFINLSSSDYPLVTQDDLL  207

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  208   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  267

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  268   TGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNSD  327

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+S ++  ++    LN +D   M+ S A FA  F+  DP+LD+ID E+L+R  G   P
Sbjct  328   LHYISWDNPPKQHPHHLNLADMTKMVNSNAPFARKFRREDPVLDKIDDELLNRGSGMATP  387

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   CAV GD +V+RPG GAKRLE     L +   F+ +QC
Sbjct  388   GGWCIGSNENGSDPCAVIGDTNVIRPGPGAKRLENLVTWLLSTENFRPKQC  438



>emb|CDY11668.1| BnaC06g12760D [Brassica napus]
Length=435

 Score =   365 bits (937),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 245/352 (70%), Gaps = 5/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD   + R L A+YHP N Y++HL+R++   +R+ L   +    LF
Sbjct  83    PDPPRFAYLISGSAGDGKSLRRTLLALYHPNNRYVVHLERASSPEEREDLHGYIRNSSLF  142

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQD-DL  1338
             R  +NVH++  A+ V  +G + +++TLH A+ILLR  + WDWFINLSS+DYPL+TQD DL
Sbjct  143   RRFQNVHMIEKANLVTYRGPTMVANTLHAAAILLREGAEWDWFINLSSSDYPLMTQDADL  202

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LHI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++
Sbjct  203   LHIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKL  262

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N 
Sbjct  263   FTGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNS  322

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L +++ ++  ++    L  +D   M+ S A FA  F+  DP+LD+ID E+L+R  G P 
Sbjct  323   DLHFITWDNPPKQHPHHLTLADMDRMVNSNAPFARKFRREDPVLDKIDEELLNRGFGMPT  382

Query  803   PGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PGGWC+G+ E+G   CAV GD DV+RPG GA+RLE     + +   F+ +QC
Sbjct  383   PGGWCIGSHENGTDPCAVIGDTDVIRPGPGARRLESLVTSMLSTENFRPKQC  434



>ref|XP_006285970.1| hypothetical protein CARUB_v10007491mg [Capsella rubella]
 gb|EOA18868.1| hypothetical protein CARUB_v10007491mg [Capsella rubella]
Length=445

 Score =   365 bits (938),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 240/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P  AY +SGSAGD   + R L A+YHP N Y++HLDR++   +R+ L   +    LF
Sbjct  94    PSSPRFAYLVSGSAGDGKSLRRTLLALYHPNNRYVVHLDRASSNEEREELHGYIKNSTLF  153

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NVH++  A+ V  +G + +++TLH A+ILLR  ++WDWFINLSS+DYPLVTQDDLL
Sbjct  154   ARFMNVHMIEKANLVTYRGPTMVANTLHAAAILLREGADWDWFINLSSSDYPLVTQDDLL  213

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  214   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  273

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  274   TGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNSD  333

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+S ++  ++    L  +D   M+ S A FA  F+  DP+LD+ID E+L+R  G   P
Sbjct  334   LHYISWDNPPKQHPHHLTLADMTKMVNSNAPFARKFRREDPVLDKIDDELLNRGTGMATP  393

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   C V GD  V+RPG GAKRLE     L +   F+ +QC
Sbjct  394   GGWCIGSRENGSDPCDVIGDTGVIRPGPGAKRLENLVTWLLSTENFRPKQC  444



>ref|XP_010666906.1| PREDICTED: xylosyltransferase 2 [Beta vulgaris subsp. vulgaris]
Length=411

 Score =   364 bits (934),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 238/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P  AY ISG+ G+  ++ RLL AVYHPRN+YL+HLDR A   +R   A  V +    
Sbjct  60    PEIPRFAYLISGTKGEGLQVKRLLQAVYHPRNYYLIHLDRDASDDERVDFAKYVKSEAAV  119

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  RNV V+G AD + SKG S+ +S LHG +ILL+ +  WDWFINL++ DYPL++QDDLL
Sbjct  120   RRFRNVMVVGKADLITSKGPSATASMLHGFAILLKQAKQWDWFINLNAWDYPLISQDDLL  179

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ HTS IGW+E Q+ +PII+DPGLY  + S VF+A ++R LP SF++F
Sbjct  180   HIFSYLPRDLNFLEHTSDIGWKEHQRARPIIIDPGLYHVKKSGVFWAKEKRSLPSSFKLF  239

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +L++ F+DFCI G +N PRTLLMY +N  SS   YF TV+CN + +  T +NH+
Sbjct  240   TGSEWVVLTKSFVDFCIWGWDNLPRTLLMYYTNFLSSSEGYFHTVVCNHKNYQNTTVNHD  299

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L+Y+  ++   +    L    F DM++SGA FA  F   DP+LDQID ++L RS G  VP
Sbjct  300   LRYMKWDNPPNQHPVNLTQEHFHDMVQSGAPFARRFAINDPVLDQIDRDLLKRSNGHFVP  359

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWCLG    G+  C ++G++D ++P V  + LEK  ++L     F+S+QC
Sbjct  360   GGWCLGKSSHGKDPCVLFGNSDAIKPSVNTRMLEKLVLQLLDPENFRSKQC  410



>ref|XP_010466794.1| PREDICTED: xylosyltransferase 2-like isoform X2 [Camelina sativa]
Length=272

 Score =   358 bits (920),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 216/272 (79%), Gaps = 4/272 (1%)
 Frame = -2

Query  1448  MSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWR  1269
             M+STLHGASILLR+S  WDWF+NL+  DYPL+TQD+LLHI+S+LPKDLNFVNHTSYIGW+
Sbjct  1     MASTLHGASILLRLSGAWDWFLNLNVDDYPLLTQDELLHIMSHLPKDLNFVNHTSYIGWK  60

Query  1268  ESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTEN  1089
             ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G S+SILSR F++ C+LGT+N
Sbjct  61    ESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSGPSFSILSRNFIEHCVLGTDN  120

Query  1088  FPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSLNSRKEARV--LNSSDF  915
             FPRTLLMYLSNTP S + YFPT+LCNS  F +TIIN+NL YV+ N   + R   L+  +F
Sbjct  121   FPRTLLMYLSNTPDSLSNYFPTILCNSNLFKKTIINNNLLYVASNETVKERYHRLDHKEF  180

Query  914   LDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGNG--ESGRCAVWGDAD  741
              +M+ +GAAFAS F+  DP+LD+ID E+L R  G+ VPGGWCLG+    S  C+VWGD+ 
Sbjct  181   TEMVETGAAFASGFRSDDPVLDRIDHELLGRKHGEVVPGGWCLGDSGKNSSSCSVWGDSG  240

Query  740   VLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             +LRPG G+ RLE+  ++L +   F+S QCI E
Sbjct  241   ILRPGSGSDRLERRIVKLLSNDWFRSHQCISE  272



>ref|XP_010496516.1| PREDICTED: xylosyltransferase 1-like isoform X2 [Camelina sativa]
Length=439

 Score =   364 bits (935),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 243/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY +SGSAGD   + R L A+YHP N Y++HLDR +   +R+ L   +    LF
Sbjct  88    PSPPRFAYLVSGSAGDGKSLRRTLLALYHPNNRYVVHLDRESSHEEREELHGYIKNSSLF  147

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NVH++  A+ V  +G + +++TLH A+ILLR  ++WDWFINLSS+DYPLVTQDDLL
Sbjct  148   SRFMNVHMIEKANLVTYRGPTMVANTLHAAAILLREGADWDWFINLSSSDYPLVTQDDLL  207

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  208   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  267

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  268   TGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNSD  327

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+S ++  ++    LN +D   M+ S A FA  F+  DP+LD+ID E+L+R  G   P
Sbjct  328   LHYISWDNPPKQHPHHLNLADMTKMVNSNAPFARKFRREDPVLDKIDDELLNRGSGMATP  387

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   CAV GD +V+RPG GAKR+E     L +   F+ +QC
Sbjct  388   GGWCIGSNENGSDPCAVIGDTNVIRPGPGAKRVENLVTWLLSTENFRPKQC  438



>gb|KFK33164.1| hypothetical protein AALP_AA6G338800 [Arabis alpina]
Length=438

 Score =   364 bits (934),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 243/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P  AY ISGS+GD   + R L AVYHP N Y++HLDR +   +R+ L   +    LF
Sbjct  87    PTLPRFAYLISGSSGDGKSLQRTLLAVYHPSNRYVVHLDRESSYEEREELHGYIRNSSLF  146

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +  +NVH++  A+ V  +G + +++TLH A+ILLR  ++WDWFINLSS+DYPLVTQDDLL
Sbjct  147   KRFKNVHMIEKANLVTYRGPTMVANTLHAAAILLRDGADWDWFINLSSSDYPLVTQDDLL  206

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  207   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  266

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  267   TGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNADEFRNTTVNSD  326

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L  SD   M+ S A FA  F+  DP+LD+ID E+L+R PG P P
Sbjct  327   LHFISWDNPPKQHPHHLTLSDMAKMVNSNAPFARKFRREDPVLDKIDDELLNRGPGMPTP  386

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G   +G   CAV GD DV+RPG G++RLE     L +   F+ +QC
Sbjct  387   GGWCIGTNVNGSDPCAVIGDTDVIRPGPGSRRLENLVTSLLSTENFRPKQC  437



>ref|XP_004302748.1| PREDICTED: xylosyltransferase 2-like [Fragaria vesca subsp. vesca]
Length=416

 Score =   363 bits (931),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 177/367 (48%), Positives = 248/367 (68%), Gaps = 4/367 (1%)
 Frame = -2

Query  1742  SHPHRVLIHGDLSS--PPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSA  1569
             ++P    I GD S     PR P  AY ++GS G+  ++ RLL A YHPRNHYLLHLD  A
Sbjct  49    ANPDHNFIDGDNSYGLELPRLPRFAYLLTGSKGEGPQLKRLLQAAYHPRNHYLLHLDLEA  108

Query  1568  PKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDW  1389
               ++R  LA  V +  +  A RN  V+G AD V +KG + M++TLH  +ILL+ + +WDW
Sbjct  109   SDAERLDLAKYVKSESVMHAFRNAMVVGAADLVTAKGPTVMAATLHAVAILLKRAGDWDW  168

Query  1388  FINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDS  1209
             FINLS++DYPL++QDDLLHI SYLP+DLNF+ HTS IGW+E+Q+ +PII+DPGLY  + S
Sbjct  169   FINLSASDYPLMSQDDLLHIFSYLPRDLNFLEHTSNIGWKENQRARPIIIDPGLYHNKKS  228

Query  1208  DVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYF  1029
              VF+A ++R +P SF++F GS+  +L+R FL+FCILG +N PRTLLMY +N   S   YF
Sbjct  229   GVFWAKERRSMPASFKLFMGSTGVVLTRSFLEFCILGWDNLPRTLLMYYTNFLQSPEGYF  288

Query  1028  PTVLCNSRQFNRTIINHNLQYVSLNSRKEARVLNSS--DFLDMIRSGAAFASPFKERDPI  855
              TV+CN + +  T +NH+L Y+  +S  +   +N +   + D+I++GA  A PF   DP+
Sbjct  289   HTVICNHKDYQNTTVNHDLHYIRWDSPPKLNPVNLTLEHYNDIIQAGAPLAGPFTRDDPV  348

Query  854   LDQIDSEILHRSPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGG  675
             LD+ID E+L R  G   PGGWCLG     RC+V+G+   ++P V +KRLEK  ++L    
Sbjct  349   LDKIDKELLGRPSGHLTPGGWCLGRVGKDRCSVYGNPVAVKPSVVSKRLEKLIVKLLDSE  408

Query  674   RFQSQQC  654
              F+S+QC
Sbjct  409   NFRSKQC  415



>ref|XP_011094845.1| PREDICTED: xylosyltransferase 2 [Sesamum indicum]
Length=406

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 240/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P  AY+ISG++GD GR++RLL A+YHPRN+YLLHLD  A +++R  LA    +  + 
Sbjct  55    PELPRFAYFISGTSGDGGRLLRLLQALYHPRNYYLLHLDLEASETERLELAKFAKSDAII  114

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  +NV VMG  + V +KG + M+STLH  +ILL+ +  WDWF+NL ++DYPL+ QDD+L
Sbjct  115   RGFKNVMVMGKGNLVTAKGPTMMASTLHAVAILLKHAKRWDWFVNLGASDYPLMPQDDIL  174

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ HTS  GW+E Q+ +PII+DPGLY ++ S VF+A ++R LP SF++F
Sbjct  175   HIFSYLPRDLNFIEHTSEFGWKEHQRARPIIIDPGLYHSKKSGVFWAKERRSLPASFKLF  234

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS+  +LSR FL+FCI G +N PRTLLMY +N  SS   YF TV+CN + +  T +NH+
Sbjct  235   TGSACVVLSRSFLEFCIWGWDNLPRTLLMYYTNFLSSPEGYFHTVVCNHKDYQNTTVNHD  294

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  +   ++E   L    F +M++SGA FA    E D +LD+ID  +L RS G+  P
Sbjct  295   LHYMKWDEPPKEEPVNLTLEHFENMVQSGAPFAHKIAENDSVLDKIDRVLLKRSNGQFTP  354

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWCL +    R  C V+G AD ++P + +KRLEK  ++L     F+S+QC
Sbjct  355   GGWCLESYGLKRDPCMVYGSADAVKPSLSSKRLEKLVVQLLDSDNFRSKQC  405



>ref|XP_010450743.1| PREDICTED: xylosyltransferase 1-like [Camelina sativa]
Length=438

 Score =   362 bits (930),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 242/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY +SGSAGD   + R L A+YHP N Y++HLDR +   +R+ L   +    LF
Sbjct  87    PSPPRFAYLVSGSAGDGKSLRRTLLALYHPNNRYVVHLDRESSHEEREELHGYIKNSSLF  146

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NVH++  A+ V  +G + +++TLH A+ILLR  ++WDWFINLSS+DYPLVTQDDLL
Sbjct  147   SRFMNVHMIEKANLVTYRGPTMVANTLHAAAILLREGADWDWFINLSSSDYPLVTQDDLL  206

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  207   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  266

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PR +LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  267   TGSAWMALSRPFIDYCIWGWDNLPRIVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNSD  326

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y++ ++  ++    LN +D   M+ S A FA  F+  DP+LD+ID E+L+R  G   P
Sbjct  327   LHYIAWDNPPKQHPHHLNLADMTKMVNSNAPFARKFRREDPVLDKIDDELLNRGSGMATP  386

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   CAV GD +V+RPG GAKRLE     L +   F+ +QC
Sbjct  387   GGWCIGSNENGSDPCAVIGDTNVIRPGPGAKRLENLVTWLLSTENFRPKQC  437



>ref|XP_010435960.1| PREDICTED: xylosyltransferase 1-like [Camelina sativa]
Length=439

 Score =   362 bits (930),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 242/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P P   AY +SGSAGD   + R L A+YHP N Y++HLDR +   +R+ L   +    LF
Sbjct  88    PSPTRFAYLVSGSAGDGKSLRRTLLALYHPNNRYVVHLDRESSHEEREELHGYIKNSSLF  147

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NVH++  A+ V  +G + +++TLH A+ILLR  ++WDWFINLSS+DYPLVTQDDLL
Sbjct  148   SRFMNVHMIEKANLVTYRGPTMVANTLHAAAILLREGADWDWFINLSSSDYPLVTQDDLL  207

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+ TQ+R +P +F++F
Sbjct  208   HIFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVTQRRSIPTAFKLF  267

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +
Sbjct  268   TGSAWMALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFRNTTVNSD  327

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+S ++  ++    LN +D   M+ S A FA  F+  DP+LD+ID E+L+R  G   P
Sbjct  328   LHYISWDNPPKQHPHHLNLADMTKMVNSNAPFARKFRREDPVLDKIDDELLNRGSGMATP  387

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   CAV GD +V+RPG GAKRLE     L +   F+ +QC
Sbjct  388   GGWCIGSNENGSDPCAVIGDTNVIRPGPGAKRLENLVTWLLSTENFRPKQC  438



>ref|XP_002531062.1| acetylglucosaminyltransferase, putative [Ricinus communis]
 gb|EEF31323.1| acetylglucosaminyltransferase, putative [Ricinus communis]
Length=396

 Score =   360 bits (925),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/349 (50%), Positives = 233/349 (67%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  GD  RI+RLL AVYHPRNHYLLHL   A   +R  L  ++N VP  R+
Sbjct  47    PPAFAYYISGGRGDGDRILRLLLAVYHPRNHYLLHLGADASDEERARLVWAINAVPAIRS  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G    +   GSS++++TL  A+ILLR+ S W+WF+ LS+ DYPL+TQDDL H+
Sbjct  107   FANVDVVGKPSRLVYMGSSNLAATLRAAAILLRVQSGWNWFVALSAFDYPLLTQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +D NF++HTS +GW+ESQ+ +PI+VDPG+YLA  S +F+ATQ+R  PD+F+VF G
Sbjct  167   FSSISRDFNFIDHTSDLGWKESQRFQPIVVDPGIYLARRSQIFHATQKRGTPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCILG +N PRTLLMY +N   S+  YF +V+CN+ +F  T +N +L+
Sbjct  227   SPWVILSRSFLEFCILGWDNLPRTLLMYFNNMILSEEGYFHSVICNAPEFKNTTVNSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN SD+  M++SGAAFA  FK  DPILD +D +IL R   +  PG 
Sbjct  287   YMVWDNPPKMEPHFLNISDYDQMVQSGAAFARQFKRNDPILDMVDEKILKRGYNQAAPGA  346

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C+ WGD +V++PG  AKR E     L      Q  QC
Sbjct  347   WCTGRRSWWMDPCSQWGDVNVVKPGPQAKRFEDTIRNLLDEWNSQMNQC  395



>ref|XP_009374686.1| PREDICTED: xylosyltransferase 2-like isoform X4 [Pyrus x bretschneideri]
Length=423

 Score =   361 bits (927),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 243/349 (70%), Gaps = 2/349 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P+ P  AY ISGS GD  ++ RLL AVYHPRN+YLLHLD  A  ++R  LA  V +    
Sbjct  74    PKLPRFAYLISGSKGDGPQLRRLLQAVYHPRNYYLLHLDLEASDAERLELAKYVKSESAI  133

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  RN  V+GNAD V +KG +  ++TLH  +ILL+ + +W+WFINL ++DYPL++QDDLL
Sbjct  134   REFRNAMVIGNADLVTAKGPTMTAATLHAIAILLKRAKDWNWFINLGASDYPLMSQDDLL  193

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP+DLNF+ HTS IGW+E+Q+ +PII+DPGLY ++ S VF+A ++R +P SF+++
Sbjct  194   HIFSFLPRDLNFLEHTSNIGWKENQRARPIIIDPGLYHSKKSGVFWAKERRSIPASFKLY  253

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L++ FL+FC+ G +N PRTLLMY +N  SS   YF TV+CN + +  T +NHN
Sbjct  254   MGSTWVVLTKSFLEFCVWGWDNLPRTLLMYYTNFLSSPEGYFHTVVCNHKDYQNTTVNHN  313

Query  974   LQYVSLNSRKEARVLNSS--DFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  +S  +A  +N +   + DM++SGA FA  F   DP+L++ID E+L R  G   P
Sbjct  314   LHYIRWDSPPKANPINLTLEHYNDMVQSGAPFAGTFSRDDPVLNKIDKELLRRPSGHFTP  373

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWCLGN     C V+G+++ ++P V +KRLEK  ++L     F+ +QC
Sbjct  374   GGWCLGNFGKNPCLVYGNSNAVKPTVVSKRLEKLIVKLLDSENFRPKQC  422



>gb|EYU34686.1| hypothetical protein MIMGU_mgv1a006669mg [Erythranthe guttata]
Length=435

 Score =   362 bits (928),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 241/350 (69%), Gaps = 5/350 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP +AY ISGSAGD G + R L A+YHP N Y++HLD  +   +R  L   V+T  +FR 
Sbjct  85    PPRLAYLISGSAGDGGMLRRTLEALYHPNNQYVVHLDAESSGEERLDLYNYVDTHSVFRR  144

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV ++  A+ V  +G + +++TLH A+ILL+   +WDWFINLS++DYPLVTQDDLLH 
Sbjct  145   FENVRMISRANLVTYRGPTMVANTLHAAAILLKEGGDWDWFINLSASDYPLVTQDDLLHA  204

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              SYLP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + +DVF+ TQ+R +P +F++F G
Sbjct  205   FSYLPRDLNFMDHTSDIGWKEFQRAKPVIIDPGLYMTKKTDVFWITQRRSVPTAFKLFTG  264

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S++ +LSR F+D+CI G +N PRT LMY SN  SS   YF TV+CN+++F  T +N +L 
Sbjct  265   SAWMVLSRPFVDYCIWGWDNLPRTALMYYSNFISSPEGYFHTVICNAKEFRNTTVNSDLH  324

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             ++S ++  ++    L   D   MI S A FA  F   DP+LD+ID E+L R  G  VPGG
Sbjct  325   FISWDNPPKQHPHYLTLKDMQRMIDSNAPFARKFHRDDPVLDKIDEELLFRGKGMLVPGG  384

Query  794   WCLGNGESGR--CAVWG-DADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WCLG GE+G   C V G D  VLRP VGAKR+E   + L + G F+S+QC
Sbjct  385   WCLGGGENGTDPCLVVGNDTAVLRPTVGAKRVESLVVSLLSEGSFESRQC  434



>ref|XP_010531794.1| PREDICTED: xylosyltransferase 1 [Tarenaya hassleriana]
Length=433

 Score =   362 bits (928),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/351 (48%), Positives = 241/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD G + R L A+YHP N Y++HLDR +   +R+ L   + +  LF
Sbjct  82    PAPPRFAYVISGSAGDGGALRRTLLALYHPNNRYVVHLDRESSPEEREDLHGFIRSFSLF  141

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +  +NVHV+  A+ V  +G + +++TLH A+ILLR  + WDWFINLS++DYPLVTQDDLL
Sbjct  142   QRFQNVHVIEKANLVTYRGPTMVANTLHAAAILLREGAEWDWFINLSASDYPLVTQDDLL  201

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ S+LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLY+ + +DVF+  Q+R +P +F++F
Sbjct  202   HVFSHLPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYMNKKADVFWVKQRRSIPTAFKLF  261

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  L+R F+D+CI G +N PRT+LMY SN  SS   YF TV+CN+ +F  T +N +
Sbjct  262   TGSAWMALTRSFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVICNAEEFRNTTVNSD  321

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L   D   MI S A F   F+  +P+LD+ID E+L+R PG   P
Sbjct  322   LHFISWDNPPKQHPHHLTVLDMGKMIDSNAPFGRKFRREEPVLDKIDDELLNRGPGMVTP  381

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   CA+ GD   +RPG GA+RLE     L +   FQ +QC
Sbjct  382   GGWCIGSHENGSDPCALIGDTSDIRPGPGARRLETLISFLLSSENFQPRQC  432



>ref|XP_006482519.1| PREDICTED: xylosyltransferase 1-like [Citrus sinensis]
Length=430

 Score =   361 bits (927),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 244/351 (70%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGS GD   I R L A+YHP N Y++HLDR++ +S+R  L   VN   LF
Sbjct  79    PPPPRFAYLISGSVGDGNMIKRTLLALYHPNNVYVVHLDRASSESERLDLQNFVNGFHLF  138

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV ++  A+ V  +G + +++TLH A++LLR   +WDWFINLS++DYPLVTQDDLL
Sbjct  139   NKFSNVKMITKANLVTYRGPTMVANTLHAAAVLLREGGDWDWFINLSASDYPLVTQDDLL  198

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
                SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY+++ +DVF+ TQ+R +P +F++F
Sbjct  199   DAFSYLPRDLNFIDHTSDIGWKEFQRAKPIIIDPGLYMSKKADVFWVTQKRSVPSAFKLF  258

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +
Sbjct  259   TGSAWMALSRSFIDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFRNTTVNSD  318

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    LN +D   M+ S A FA  F   DP+LD+IDSE+L R+PG   P
Sbjct  319   LHFISWDNPPKQHPHYLNLADMQRMVDSNAPFARKFPREDPVLDKIDSELLSRNPGMVTP  378

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ ++G   C+V G+  VLRPG+GAKRL      L +  +F+ +QC
Sbjct  379   GGWCIGSRKNGSDPCSVVGNTTVLRPGLGAKRLGTLITSLLSKEKFRPRQC  429



>ref|XP_002960850.1| glycosyltransferase CAZy family GT14 [Selaginella moellendorffii]
 gb|EFJ38389.1| glycosyltransferase CAZy family GT14 [Selaginella moellendorffii]
Length=410

 Score =   360 bits (925),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 180/370 (49%), Positives = 244/370 (66%), Gaps = 16/370 (4%)
 Frame = -2

Query  1736  PHRVLIHGDLSSPP----PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSA  1569
             P  + +   LS  P    P  P +AY ISG+ GD  R+ R+L A+YHPRN YLLHLD  A
Sbjct  48    PADMYVESKLSQVPASDLPTAPRLAYLISGTRGDGDRMKRVLQAIYHPRNQYLLHLDLEA  107

Query  1568  PKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDW  1389
             P  +R  LA  V   P F  A NVHV+G A+ V  +GS+ ++ TLH A+ILLR S  WDW
Sbjct  108   PPRERVELARYVKMDPTFTLAGNVHVIGKANLVTYRGSTMIACTLHAAAILLRQSKEWDW  167

Query  1388  FINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDS  1209
             FINLS++DYPLV+QDDLL++ SYLP+DLNF+ HTS IGW+E Q+ KPII+DPGLY+ + +
Sbjct  168   FINLSASDYPLVSQDDLLNVFSYLPRDLNFLEHTSDIGWKEFQRAKPIIIDPGLYMNKKT  227

Query  1208  DVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYF  1029
             D+F+ TQ+R +P +F++F GS++  L+R F +FCI G +N PRT+LMY +N  SS   YF
Sbjct  228   DIFWVTQRRSVPSAFKLFTGSAWVALTRNFTEFCIWGWDNLPRTVLMYYTNFLSSPEGYF  287

Query  1028  PTVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPI  855
              T +        T +NH+L Y++ ++  ++    L   DF +M  SG+ F   F + DP+
Sbjct  288   HTGI--------TTVNHDLHYITWDNPPKQHPLSLTVKDFDNMNASGSPFGRKFDKDDPV  339

Query  854   LDQIDSEILHRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFA  681
             LD IDS +L R   +  PGGWCLG+ E+G   C+V GDADVLRP  GAKRLE   ++L A
Sbjct  340   LDMIDSRLLGREKDRFTPGGWCLGSSENGNDPCSVMGDADVLRPSAGAKRLESLVLKLLA  399

Query  680   GGRFQSQQCI  651
                F+  QC+
Sbjct  400   PENFRKNQCV  409



>dbj|BAD43851.1| unknown protein [Arabidopsis thaliana]
Length=272

 Score =   355 bits (911),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 214/272 (79%), Gaps = 4/272 (1%)
 Frame = -2

Query  1448  MSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWR  1269
             M+STLHGASILLR+S  WDWF+++S  DYPLVTQD+LLHI+S+LPKDLNFVNHTSYIGW+
Sbjct  1     MASTLHGASILLRLSGTWDWFVSISVDDYPLVTQDELLHIMSHLPKDLNFVNHTSYIGWK  60

Query  1268  ESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTEN  1089
             ES+KLKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G S+SILSR F++ C+LGT+N
Sbjct  61    ESRKLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSGPSFSILSRNFMEHCVLGTDN  120

Query  1088  FPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSLNSRKEARV--LNSSDF  915
             FPRTLLMYLSNTP S + YFPT+LCN+  F +TI+N+NL Y++ N   + R   L+  +F
Sbjct  121   FPRTLLMYLSNTPDSLSNYFPTILCNTDTFKKTIMNNNLLYLASNDTSKERYHQLDHKEF  180

Query  914   LDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGNGESGR--CAVWGDAD  741
              +M+ SGAAFA  F+  D +LD+ID E+L R PG+ VPGGWCLG+    R  C+VWGD+ 
Sbjct  181   TEMVDSGAAFARGFRYDDTVLDRIDHELLGRKPGEVVPGGWCLGDSSKDRSSCSVWGDSG  240

Query  740   VLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             +LRPG G+ RLE+  +EL +   F+  QC+ E
Sbjct  241   ILRPGSGSDRLERRIVELLSNDWFRLHQCVPE  272



>ref|XP_004147458.1| PREDICTED: xylosyltransferase 1-like [Cucumis sativus]
 ref|XP_004172526.1| PREDICTED: xylosyltransferase 1-like [Cucumis sativus]
 gb|KGN59600.1| hypothetical protein Csa_3G827420 [Cucumis sativus]
Length=428

 Score =   361 bits (926),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 246/356 (69%), Gaps = 5/356 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +SS PP PP  AY ISGS G+   + R L A+YHP N Y+LHLD  +P ++R  L   V 
Sbjct  73    ISSLPP-PPRFAYLISGSVGEGNMLKRTLEALYHPINRYVLHLDLESPPAERLDLQKYVQ  131

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
               P+F+   NV V+  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVT
Sbjct  132   NHPIFKKFGNVKVITKANLVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVT  191

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW+ESQ+ KP+I+DPGLY+++ +DVF+ TQ+R +P 
Sbjct  192   QDDLLHTFSYLPRDLNFIDHTSNIGWKESQRAKPVIIDPGLYMSKKADVFWITQRRSVPT  251

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LSR F+D+CI G EN PR +LMY +N  SS   YF TV+CN++QF  T
Sbjct  252   AFKLFTGSAWMALSRPFIDYCIWGWENLPRIVLMYYANFISSPEGYFHTVVCNAQQFQNT  311

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L ++S ++  ++    LN +D   M+ S A FA  F   DP+LD+ID ++LH+ P
Sbjct  312   TVNSDLHFISWDNPPKQHPHHLNVNDMQRMVDSNAPFARKFVGEDPVLDEIDKQLLHKRP  371

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
                V GGWC+G+ E+G   C++ G  +VL+PG GAKRLE     L +  +F+ +QC
Sbjct  372   NMVVAGGWCIGSHENGTDPCSIAGSTNVLKPGPGAKRLETLINSLLSEEKFRPRQC  427



>ref|XP_007222964.1| hypothetical protein PRUPE_ppa006761mg [Prunus persica]
 gb|EMJ24163.1| hypothetical protein PRUPE_ppa006761mg [Prunus persica]
Length=396

 Score =   360 bits (923),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 236/349 (68%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYI G  GD GRI+RLL AVYHPRN YLLHL     + +R  LA ++  VP  RA
Sbjct  47    PPAFAYYIWGGRGDRGRILRLLLAVYHPRNRYLLHLSADESEDERRRLASAIKAVPAIRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D +   GSS++++TL  A+ILL++ S WDWF+ LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKPDRITYMGSSNIATTLRAAAILLKVDSGWDWFVTLSAMDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+E  +++PI+VDPGLYLA  S +F+AT++R  PD+F++F G
Sbjct  167   FSSVRRDLNFIDHTSDLGWKELHRVQPIVVDPGLYLARRSQIFHATEKRKTPDAFKIFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCILG +N PRT+LMY +N   S   YF +V+CNS +F  T +N +L+
Sbjct  227   SPWVILSRSFLEFCILGWDNLPRTMLMYFTNVMLSQEGYFHSVICNSPEFKNTTVNSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN SD+  M++ GAAFA  F++ DP+LD +D +IL R   +  PG 
Sbjct  287   YMIWDTPPKMEPHFLNISDYDQMVQGGAAFARQFQKDDPVLDVVDEKILKRGRSRAAPGA  346

Query  794   WCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G  +     C+ WGDA++L+PG  AK+ E+    L      QS QC
Sbjct  347   WCSGWKSWWMDPCSQWGDANILKPGPQAKKFEESITNLLDDWTAQSNQC  395



>gb|KDP35617.1| hypothetical protein JCGZ_09055 [Jatropha curcas]
Length=416

 Score =   360 bits (924),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 239/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P  AY ISG+ G+  R+ RLL AVYHPRN+YLLHLD  A  ++R  LA  V +  + 
Sbjct  65    PTLPRFAYLISGTKGEGARVKRLLQAVYHPRNYYLLHLDLEASDAERLELAKYVKSEGVI  124

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  RNV V+G AD V  KG + ++STLH  +ILL+ +S+WDWF+NLS++DYPL+ QDD+L
Sbjct  125   RVFRNVMVIGKADLVTYKGPTMIASTLHAIAILLKQASDWDWFVNLSASDYPLMPQDDIL  184

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ HTS IGW+E Q+ +PII+DPGLY ++ S VF+A ++R LP +F++F
Sbjct  185   HIFSYLPRDLNFLEHTSSIGWKEYQRARPIIIDPGLYHSKKSGVFWAKEKRSLPAAFKLF  244

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +L+R FL+FC+ G +N PRTLLMY +N  SS   YF TV+CN + +  T INH+
Sbjct  245   MGSEWVMLTRSFLEFCVWGWDNLPRTLLMYYTNFLSSPEGYFHTVVCNHKDYQNTTINHD  304

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  ++  ++    L    F DM+ SGA FA  F + DP+L++ID ++L RS G   P
Sbjct  305   LHYIKWDNPPKQHPISLALEHFNDMVESGAPFAREFAKDDPVLNKIDEKLLMRSDGGFTP  364

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC GN   G+  C  +G  D ++P + +KRLEK  + L     F+S+QC
Sbjct  365   GGWCAGNTVLGKDPCVAYGSPDAIKPTLSSKRLEKLILTLVDSENFRSKQC  415



>ref|XP_008243337.1| PREDICTED: xylosyltransferase 1 [Prunus mume]
Length=396

 Score =   359 bits (922),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 170/349 (49%), Positives = 234/349 (67%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYI G  GD GRI+RLL AVYHPRN YLLHL     + +R  LA ++  VP  RA
Sbjct  47    PPAFAYYIWGGRGDRGRILRLLLAVYHPRNRYLLHLSADESEDERRHLASAIKAVPAIRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D +   GSS++++TL  A+ILL+  S WDWF+ LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKPDRITYMGSSNIATTLRAAAILLKFDSGWDWFVTLSAMDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+E  +++PI+VDPGLYLA  S +F+AT++R  PD+FR+F G
Sbjct  167   FSSVRRDLNFIDHTSDLGWKELHRVRPIVVDPGLYLARRSQIFHATEKRKTPDAFRIFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCILG +N PRT+LMY +N   S   YF +V+CNS +F  T +N +L+
Sbjct  227   SPWVILSRSFLEFCILGWDNLPRTMLMYFTNVMLSQEGYFHSVICNSPEFKNTTVNSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN SD+  M++ GAAFA  F++ DP+LD +D  IL R   +  PG 
Sbjct  287   YMIWDTPPKMEPHFLNISDYDQMVQGGAAFARQFQKDDPVLDMVDERILKRGRNRAAPGA  346

Query  794   WCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G  +     C+ WGDA++L+PG  AK+ E+    L      QS QC
Sbjct  347   WCSGWKSWWMDPCSQWGDANILKPGPQAKKFEESITNLLDDWTAQSNQC  395



>ref|XP_009139946.1| PREDICTED: xylosyltransferase 1 [Brassica rapa]
Length=427

 Score =   360 bits (923),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 243/346 (70%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
              AY ISGSAGD   + R L A+YHP N Y++HLDR++ + +R+ L   + +  LFR  RN
Sbjct  81    FAYLISGSAGDGKSLRRTLLALYHPSNRYVVHLDRASSEEEREELNGYIRSSSLFRRFRN  140

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+ V  +G + +++TLH A+ILLR  + WDWFINLSS+DYPL++QDDLLH+ S+
Sbjct  141   VDMIEKANLVTYRGPTMVANTLHAAAILLREGAEWDWFINLSSSDYPLMSQDDLLHVFSH  200

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ SQ+ KP+I+DPGLYL + SDVF+  Q+R +P +F++F GS++
Sbjct  201   LPRDLNFIDHTSNIGWKASQRAKPVIIDPGLYLNKKSDVFWVKQRRSIPTAFKLFTGSAW  260

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
               LSR F+D+CI G +N PRT+LMY SN  SS   YF TVLCN+ +F  T +N +L +++
Sbjct  261   MALSRPFIDYCIWGWDNLPRTVLMYYSNFLSSPEGYFHTVLCNAEEFKNTTVNSDLHFIA  320

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L  +D   M+ S A FA  F+  DP+LD ID E+L+R PG P PGGWC+
Sbjct  321   WDNPPKQHPHHLTLADMDRMVNSNAPFARKFRREDPVLDTIDEELLNRGPGMPTPGGWCI  380

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G+ E+G   CAV GD DV+RPG+GA+RLE     L +   F+ +QC
Sbjct  381   GSHENGTDPCAVIGDTDVIRPGLGARRLETLVTSLLSPENFRPKQC  426



>ref|XP_010272183.1| PREDICTED: xylosyltransferase 2 [Nelumbo nucifera]
 ref|XP_010272184.1| PREDICTED: xylosyltransferase 2 [Nelumbo nucifera]
Length=427

 Score =   359 bits (922),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 242/356 (68%), Gaps = 5/356 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +SS PP PP  AY ISG+ GD   + R L A+YHP N Y++HLD  +P  +R  L   V 
Sbjct  72    VSSLPP-PPRFAYLISGTVGDGEMVKRTLQALYHPHNRYVVHLDLESPPKERLDLHDYVK  130

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
               P+F +  NV V+  A+ V  +G + +++TLH A+ILL+   +WDWFINLS++DYPLVT
Sbjct  131   NHPVFSSVGNVWVITKANLVTYRGPTMVANTLHAAAILLKEGGDWDWFINLSASDYPLVT  190

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ +  D+F+ TQ+R +P 
Sbjct  191   QDDLLHTFSYLPRDLNFIDHTSNIGWKEYQRAKPIIIDPGLYMTKKVDIFWVTQRRSVPT  250

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LSR F+DFCI G +N PRT+LMY +N  SS   YF TV+CN+++F  T
Sbjct  251   AFKLFTGSAWMALSRSFIDFCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQEFRNT  310

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L ++S ++  ++   +L  +D   M  S A FA  F   DP+LD+ID+E+L R P
Sbjct  311   TVNSDLHFISWDNPPKQHPHLLTLNDMSRMTNSNAPFARKFHRNDPVLDKIDAELLSREP  370

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  VPGGWC+G+ E+G   C V G+  +LRPG GAKRLE     L +   F+ +QC
Sbjct  371   GMLVPGGWCIGSKENGSDPCLVVGNTKILRPGPGAKRLETLIASLLSNDNFRPRQC  426



>ref|XP_008230710.1| PREDICTED: xylosyltransferase 1 [Prunus mume]
Length=428

 Score =   359 bits (922),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 242/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY+ISGS GD   + R L A+YHP N Y++HLD  AP  +R  L   V+T PLF
Sbjct  77    PPPPRFAYFISGSNGDGKMLKRTLQALYHPHNRYVVHLDLEAPPEERLDLQNYVSTHPLF  136

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV ++  A+ V  +G + +++TLH A+ILL+   +WDWFINLS++DYPLVTQDDLL
Sbjct  137   VKFGNVKMITKANLVTYRGPTMVANTLHAAAILLKEGGDWDWFINLSASDYPLVTQDDLL  196

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPIIVDPGLY+ + +DVF+ TQ+R +P +F++F
Sbjct  197   HTFSYLPRDLNFIDHTSNIGWKEYQRAKPIIVDPGLYMTKKADVFWVTQRRSVPTAFKLF  256

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LS+ F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +
Sbjct  257   TGSAWMALSKPFVDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFRNTTVNTD  316

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L +++ ++  ++    LN  D   MI S A FA  F + DP+LD+IDSE+L + PG  VP
Sbjct  317   LHFITWDNPPKQHPHHLNLGDMQRMIDSKAPFARKFHQDDPVLDKIDSELLFKGPGMLVP  376

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G  ++G   C+V G+  VLRP  GAKRLE     L +   F+S+QC
Sbjct  377   GGWCIGRRDNGSDPCSVVGNTTVLRPSPGAKRLEVLISSLLSNENFRSKQC  427



>ref|XP_008452258.1| PREDICTED: xylosyltransferase 1-like [Cucumis melo]
 gb|ADN34223.1| acetylglucosaminyltransferase [Cucumis melo subsp. melo]
Length=396

 Score =   358 bits (919),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/351 (48%), Positives = 235/351 (67%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PPS AYYISG  GD  RI RLL AVYHPRN YLLHL   A   +R  LA++V +VP  
Sbjct  45    PYPPSFAYYISGDRGDKDRIFRLLLAVYHPRNRYLLHLAADASNDERLQLAVAVKSVPAI  104

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             RA  NV ++G  + +   GSS++++ LH A+ILL+I S WDWFI LS+ DYPL++QDDL 
Sbjct  105   RAFENVDIVGKPNRISYMGSSNIATILHAAAILLKIESGWDWFITLSARDYPLISQDDLS  164

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ S + +DLNF++HTS +GW+E Q+++PI+VDPGLYLA  + +F+AT++RP PD+F++F
Sbjct  165   HVFSSVSRDLNFIDHTSDLGWKEGQRVQPIVVDPGLYLARRTQIFHATEKRPTPDAFKIF  224

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +LSR FL+FC+LG +N PR LLMY +N   S+  YF +V+CNS +F    +N +
Sbjct  225   TGSPWFVLSRSFLEFCVLGWDNLPRVLLMYFNNIVLSEEGYFHSVICNSNEFKNKTVNSD  284

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L+++  +   + E   LN S+F DM  SGAAFA  F + D +LD +D +IL R   + +P
Sbjct  285   LRFMIWDDPPKMEPLFLNGSNFNDMAESGAAFARKFHKDDSVLDMVDQKILKRGRNRLLP  344

Query  800   GGWCLGNGE--SGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G WC G        C+ W D ++L+PG  AK+ E+    L    + QS QC
Sbjct  345   GAWCSGRKSWLMDPCSQWSDVNILKPGSQAKKFEESMKNLLDDWKTQSNQC  395



>ref|XP_008443440.1| PREDICTED: xylosyltransferase 1-like [Cucumis melo]
Length=428

 Score =   359 bits (922),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 244/356 (69%), Gaps = 5/356 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +SS PP PP  AY ISGS G+   + R L A+YHP N Y+LHLD  +P  +R  L   V 
Sbjct  73    ISSLPP-PPRFAYLISGSVGEGNMLKRTLEALYHPINRYVLHLDLESPPEERLDLQKYVQ  131

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
               P+F+   NV V+  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVT
Sbjct  132   NHPIFKKFGNVKVITKANLVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVT  191

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW+ESQ+ KP+I+DPGLY+++ +DVF+ TQ+R +P 
Sbjct  192   QDDLLHTFSYLPRDLNFIDHTSNIGWKESQRAKPVIIDPGLYMSKKADVFWITQRRSVPT  251

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LSR F+D+CI G EN PR +LMY +N  SS   YF TV+CN++QF  T
Sbjct  252   AFKLFTGSAWMALSRPFIDYCIWGWENLPRIVLMYYANFISSPEGYFHTVVCNAQQFQNT  311

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L ++S ++  ++    LN +D   M+ S A FA  F   DP+LD+ID ++LH+ P
Sbjct  312   TVNSDLHFISWDNPPKQHPHHLNVNDMQRMVDSNAPFARKFVGEDPVLDEIDKQLLHKRP  371

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
                V GGWC+G+ E+G   C++ G  +VL+PG GAKRLE     L +   F+ +QC
Sbjct  372   NMVVAGGWCIGSHENGTDPCSITGSTNVLKPGPGAKRLETLINSLLSEENFRPRQC  427



>ref|XP_001767086.1| predicted protein [Physcomitrella patens]
 gb|EDQ68007.1| predicted protein [Physcomitrella patens]
Length=355

 Score =   357 bits (915),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 242/350 (69%), Gaps = 3/350 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISG+ GD  R+ RLL A+YHP N+YLLHLD  AP  +R  L   V    ++
Sbjct  5     PPPPKLAYLISGTKGDGRRMQRLLRALYHPHNYYLLHLDLEAPMRERAELVWHVKKQLVY  64

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV V+G ++ V  +G + +++TLHGA+ILLR + +WDWFINLS++DYPLVTQDDLL
Sbjct  65    EEVMNVFVIGKSNLVTYRGPTMVAATLHGAAILLRKAKDWDWFINLSASDYPLVTQDDLL  124

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ SYLPKDLNF+ HTS +GW+E Q+ +PII+DPGLY  + +++++ TQ+R  P +FR+F
Sbjct  125   HVFSYLPKDLNFIEHTSALGWKEFQRARPIIMDPGLYQKKKTNIYWTTQKRASPSAFRLF  184

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  L+R F+++C +G +N PRT LMY +N  SS   YF TV+CNSR+F  T +NH+
Sbjct  185   TGSAWIALTRSFMEYCNVGWDNLPRTALMYYTNFLSSPEGYFQTVICNSREFRNTTVNHD  244

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L +++ ++  R+    L+ + + +M +SGA FA  F +   +LD+ID EIL+R   +  P
Sbjct  245   LHFIAWHNPPRQHPITLSFTFYRNMTKSGAPFARKFDKGSAVLDKIDREILNRRMNEFTP  304

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             GGWC+G  +   C V GD  +LRPG G++R E+  + L A   F+SQQC+
Sbjct  305   GGWCIGLNDDP-CGVRGDPTLLRPGPGSRRFEELVVRLLAHPNFRSQQCV  353



>gb|KDP38031.1| hypothetical protein JCGZ_04674 [Jatropha curcas]
Length=396

 Score =   358 bits (918),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/349 (49%), Positives = 236/349 (68%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  GD  RI+RLL AVYHPRN+YLLHL   A   +R  L  ++N+VP  R+
Sbjct  47    PPAFAYYISGGRGDGNRILRLLLAVYHPRNNYLLHLGADASDEERVRLVGAINSVPAIRS  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G    +   GSS++++TL  A+ILL++ S W+WF+ LS++DYPL+TQDDL H+
Sbjct  107   FANVDVVGKPSRLVYMGSSNLAATLRAAAILLKVHSGWNWFVQLSASDYPLLTQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+ESQ+ +PI+VDPG+YLA  S +F+AT++RP PD+F+VF G
Sbjct  167   FSSVSRDLNFIDHTSDLGWKESQRFQPIVVDPGIYLARRSQIFHATEKRPTPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCILG +N PRTLLMY +N   S+  YF +V+CN+ +F  T +N +L+
Sbjct  227   SPWFILSRSFLEFCILGWDNLPRTLLMYFNNVMLSEEGYFHSVICNAPEFKNTTVNSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             YV  ++  + E   LN SD+  M++SGAAFA  FK  DP+LD +D +IL R   +  PG 
Sbjct  287   YVIWDNPPKMEPHFLNVSDYDQMVQSGAAFARQFKRNDPVLDMVDEKILKRGYNRAGPGA  346

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C+ W D +V++PG  AK+ E     L      Q  QC
Sbjct  347   WCTGRKSWWMDPCSQWSDVNVVKPGPQAKKFEDAIKNLLDDWNSQMNQC  395



>ref|XP_007215424.1| hypothetical protein PRUPE_ppa006088mg [Prunus persica]
 gb|EMJ16623.1| hypothetical protein PRUPE_ppa006088mg [Prunus persica]
Length=428

 Score =   359 bits (921),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 242/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY+ISGS GD   + R L A+YHP N Y++HLD  AP  +R  L   V+T P+F
Sbjct  77    PPPPRFAYFISGSNGDGKMLKRTLQALYHPHNRYVVHLDLEAPPEERLDLQNYVSTHPVF  136

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV ++  A+ V  +G + +++TLH A+ILL+   +WDWFINLS++DYPLVTQDDLL
Sbjct  137   VKFGNVKMITKANLVTYRGPTMVANTLHAAAILLKEGGDWDWFINLSASDYPLVTQDDLL  196

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPIIVDPGLY+ + +DVF+ TQ+R +P +F++F
Sbjct  197   HTFSYLPRDLNFIDHTSNIGWKEYQRAKPIIVDPGLYMTKKADVFWVTQRRSVPTAFKLF  256

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LS+ F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +
Sbjct  257   TGSAWMALSKPFVDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFRNTTVNSD  316

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L +++ ++  ++    LN  D   MI S A FA  F + DP+LD+IDSE+L + PG  VP
Sbjct  317   LHFITWDNPPKQHPHHLNLGDMQRMIDSKAPFARKFHQDDPVLDKIDSELLFKGPGMLVP  376

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G  ++G   C+V G+  VLRP  GAKRLE     L +   F+S+QC
Sbjct  377   GGWCIGKRDNGSDPCSVVGNTTVLRPSPGAKRLEVLISSLLSNENFRSKQC  427



>ref|XP_010033225.1| PREDICTED: xylosyltransferase 1 [Eucalyptus grandis]
 gb|KCW52809.1| hypothetical protein EUGRSUZ_J02142 [Eucalyptus grandis]
Length=428

 Score =   359 bits (921),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 239/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGS GD   + R L A+YHPRN Y++HLD      +R  L   V   P+F
Sbjct  77    PPPPRFAYLISGSTGDGSMLRRTLMALYHPRNQYVVHLDLECKPEERLDLQRFVEAHPIF  136

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                +NV ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLV+QDDLL
Sbjct  137   VKFKNVRMITKANLVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVSQDDLL  196

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ + +DVF+ TQ+R +P +F++F
Sbjct  197   HTFSYLPRDLNFIDHTSNIGWKEFQRAKPIIIDPGLYMTKKADVFWVTQRRSVPTAFKLF  256

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  L+R F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +
Sbjct  257   TGSAWMALTRPFIDYCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQEFRNTTVNSD  316

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    LN  D   MI S A FA  F   DP+LD+IDSE+L R P   VP
Sbjct  317   LHFISWDNPPKQHPHYLNHLDMQRMINSNAPFARKFPRNDPVLDKIDSELLSRGPDMLVP  376

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   C+V G+  VLRP  GAKR+EK    L +  +F+ +QC
Sbjct  377   GGWCIGSRENGSDPCSVAGEPTVLRPTSGAKRIEKLISTLLSNEKFRPRQC  427



>ref|XP_010654300.1| PREDICTED: xylosyltransferase [Vitis vinifera]
Length=419

 Score =   358 bits (919),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 242/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P+ P  AY ISG+ GD  R+ R+L AVYHPRN+YLLHLD  A  ++R  LA    +  + 
Sbjct  68    PKLPRFAYMISGTKGDGARLRRVLQAVYHPRNYYLLHLDLEASDAERLELAKYAKSEAVI  127

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +  +NV V+G A+ V  KG + ++STLH  SI L+ + +WDWFINLS++DYPL++QDDLL
Sbjct  128   KEFKNVMVVGKANLVTYKGPTMIASTLHAISIFLKQAKDWDWFINLSASDYPLMSQDDLL  187

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ HTS IGW+E Q+ +PII+DPGLY ++ S VF+A ++R +P SF++F
Sbjct  188   HIFSYLPRDLNFLEHTSNIGWKEYQRARPIIIDPGLYHSKKSGVFWAKEKRVMPASFKLF  247

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L++ FL+FC+ G +N PRTLLMY +N  SS   YF TV+CN + +  T +NH+
Sbjct  248   MGSAWVVLTKSFLEFCVWGWDNLPRTLLMYYTNVLSSPEGYFHTVICNHKDYQNTTVNHD  307

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  ++  ++    L    F DM+ SGA FA  F + DP+L++ID E+L R  G+  P
Sbjct  308   LHYIRWDNPPKQHPITLTVEHFNDMVNSGAPFARKFAKDDPVLNKIDKELLKRLDGQFTP  367

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+GN  S +  C V+G  + ++P + ++RLEK  ++L     F+S+QC
Sbjct  368   GGWCVGNSASVKDPCVVYGSPNSIKPTINSRRLEKLIVKLLDFENFRSKQC  418



>gb|KHG30757.1| Xylosyltransferase 2 [Gossypium arboreum]
Length=416

 Score =   358 bits (919),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 241/352 (68%), Gaps = 5/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             PR P  AY ISG+ GD   + RLL A+YHPRN+YL+HLD  A  S+R  LA  V    + 
Sbjct  64    PRLPRFAYSISGTKGDGPLVKRLLQAIYHPRNYYLVHLDLDASDSERFDLAKYVKAEGVI  123

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +   NV V+G AD +  KG + +++TLH  +ILL+ + +WDWF+NLS+ DYPL+TQDD++
Sbjct  124   KEFGNVMVIGKADLMTYKGPTMVAATLHAVAILLKEAKDWDWFVNLSADDYPLMTQDDIV  183

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ HTS IGW+E Q+ +PII+DPGLY ++ S VF+A ++R LP SF++F
Sbjct  184   HIFSYLPRDLNFLEHTSSIGWKEYQRARPIIIDPGLYHSKKSGVFWAKEKRSLPASFKLF  243

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +L++ FLDFC+ G +N PRTLLMY +N  SS   YF TV+CN + +  T +NH+
Sbjct  244   MGSEWVVLTKSFLDFCVWGWDNLPRTLLMYYTNFISSPEGYFHTVICNHKDYQNTTVNHD  303

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPF-KERDPILDQIDSEILHRSPGKPV  804
             L Y+  ++  ++    L    F DM+RSGA FA  F K+ D  L++ID E+L RS G+  
Sbjct  304   LHYIRWDNPPKQHPMTLTLEHFDDMVRSGAPFARKFAKDDDSALNKIDKELLRRSNGRFT  363

Query  803   PGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PGGWC+G    G+  C V+G+ + ++P V +KRLEK  ++L   G F+S+QC
Sbjct  364   PGGWCVGGSNPGKDPCVVYGNPNAVKPTVSSKRLEKLLVQLLDSGNFRSKQC  415



>ref|XP_006856751.1| hypothetical protein AMTR_s00055p00031110 [Amborella trichopoda]
 gb|ERN18218.1| hypothetical protein AMTR_s00055p00031110 [Amborella trichopoda]
Length=434

 Score =   358 bits (920),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 239/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
              AY ISGS GD  R+ R L A+YHP N Y +HLD  +P ++R  L   V    +F    N
Sbjct  88    FAYLISGSKGDGERLKRTLQALYHPLNFYAVHLDLESPPAERMELEKYVREEDVFSKVGN  147

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V VM  A+ V  KG + +++TLH A+ILLR S+ WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  148   VVVMSKANLVTYKGPTMVANTLHAAAILLRKSAEWDWFINLSASDYPLVTQDDLLHTFSY  207

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF+ HTS IGW+E Q+ +PII+DPGLY +  SDVF+ +Q+R +P SF++F GS++
Sbjct  208   LPRDLNFIEHTSNIGWKEFQRARPIIIDPGLYASNKSDVFWVSQRRSVPTSFKLFTGSAW  267

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F++FCI G +N PR +LMY +N  SS   YF TV+CN+++F  T +NH+L Y++
Sbjct  268   MVLSRSFMEFCIWGWDNLPRRVLMYYANFISSPEGYFHTVICNTKEFRNTTVNHDLHYIA  327

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L  +D   MI S A FA  FK  DP+LD+ID+E+L RS G  +PGGWC 
Sbjct  328   WDNPPKQHPHNLGLNDTQMMIDSNAPFARKFKRDDPVLDKIDAELLGRSKGALLPGGWCS  387

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G+G++G   C+V GD  VLRPG GA RLE   ++L +  +F+ +QC
Sbjct  388   GDGQNGSNPCSVLGDPSVLRPGPGAMRLEHLTVDLLSHRKFRPRQC  433



>ref|XP_009614444.1| PREDICTED: xylosyltransferase 1-like [Nicotiana tomentosiformis]
Length=431

 Score =   358 bits (919),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 242/357 (68%), Gaps = 5/357 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +S+ PP PP  AY ISGSAGD     R L A+YHP N Y++HLD  +   +R  L   V 
Sbjct  76    ISAVPP-PPRFAYLISGSAGDGNMTKRTLQALYHPNNQYVVHLDVESSPEERLDLRNYVT  134

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
               P+F   +NV ++  A+ V  +G + +++TLH A+ILL+    WDWFINLS++DYPLVT
Sbjct  135   NHPIFNKFKNVRMITKANLVTYRGPTMVANTLHAAAILLKEGGEWDWFINLSASDYPLVT  194

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ + +DVF+ TQ+R +P 
Sbjct  195   QDDLLHTFSYLPRDLNFIDHTSKIGWKEFQRAKPIIIDPGLYMTKKADVFWITQRRSVPT  254

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++ +LSR F+DFCI G +N PRT+LMY +N  SS   YF TV+CN+++F  T
Sbjct  255   AFKLFTGSAWMVLSRPFIDFCIWGWDNLPRTVLMYYANFISSPEGYFHTVVCNAQEFRNT  314

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L ++S ++  ++    L   D   M+ S A FA  F   DP+LD+IDSE+L R  
Sbjct  315   TVNSDLHFISWDNPPKQHPHYLTLDDMQRMVDSNAPFARKFPRDDPVLDKIDSELLFRGK  374

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             G  VPGGWC+G+ ++G   C+V G+  +LRP  GAKRLEK    L +   F+S QCI
Sbjct  375   GMLVPGGWCIGSRKNGTDPCSVTGNITILRPTAGAKRLEKLIGSLLSNENFRSNQCI  431



>ref|XP_010513272.1| PREDICTED: xylosyltransferase 2-like isoform X1 [Camelina sativa]
Length=272

 Score =   352 bits (904),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 214/272 (79%), Gaps = 4/272 (1%)
 Frame = -2

Query  1448  MSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWR  1269
             M+STLHGASILLR+S  WDWF++LS  DYPL+TQD+LLHI+S+LPKDLNFVNHTSYIGW+
Sbjct  1     MASTLHGASILLRLSGAWDWFVHLSVDDYPLLTQDELLHIMSHLPKDLNFVNHTSYIGWK  60

Query  1268  ESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTEN  1089
             ES++LKP+IVDPGLYL E +D+F+A+Q+R LP +F++F G S+S+LSR F++ C+LGT+N
Sbjct  61    ESRRLKPVIVDPGLYLVEKTDMFFASQKRELPKAFKLFSGPSFSMLSRSFIEHCVLGTDN  120

Query  1088  FPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSLNSRKEARV--LNSSDF  915
             FPRTLLMYLSNTP S + YFPT+LCNS  F +TIIN+NL YV+ N   + R   L+  +F
Sbjct  121   FPRTLLMYLSNTPDSLSNYFPTILCNSNLFKKTIINNNLLYVASNETVKERYHRLDPKEF  180

Query  914   LDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGNG--ESGRCAVWGDAD  741
              +M+ +GAAFA  F+  DP+LD+ID E+L R   + VPGGWCLG+    S  C+VWGD+ 
Sbjct  181   TEMVETGAAFARGFRSDDPVLDRIDHELLGRKHDEVVPGGWCLGDSGKNSSSCSVWGDSG  240

Query  740   VLRPGVGAKRLEKHFIELFAGGRFQSQQCIEE  645
             +LRPG G+ RLE+  ++L +   F+S QCI E
Sbjct  241   ILRPGSGSDRLERRIVKLLSNDWFRSHQCISE  272



>ref|NP_001077453.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AEE27582.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase-like 
protein [Arabidopsis thaliana]
Length=358

 Score =   355 bits (911),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 246/351 (70%), Gaps = 6/351 (2%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R  LA+SV T P F
Sbjct  9     PEPPRLAYLISGTKGDSHRMMRTLQAVYHPRNQYVLHLDLEAPPRERMELAMSVKTDPTF  68

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NV VM  ++ V  KG + ++ TL   SILLR S +WDWF+NLS++DYPLVTQDDLL
Sbjct  69    REMENVRVMAQSNLVTYKGPTMIACTLQAVSILLRESLHWDWFLNLSASDYPLVTQDDLL  128

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             ++ S L +++NF+ +    GW+ +Q+ K IIVDP LYL++ SD+ + TQ+R LP+SFR+F
Sbjct  129   YVFSNLSRNVNFIENMQLTGWKLNQRAKSIIVDPALYLSKKSDIAWTTQRRSLPNSFRLF  188

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L+R FL++CI G +NFPRT+LMY +N  SS   YF TV+CNS++F  T I H+
Sbjct  189   TGSAWIMLTRSFLEYCIWGWDNFPRTILMYYTNFVSSPEGYFHTVICNSKEFINTAIGHD  248

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y++ +S  ++  R L+  DF +M++S A FA  F + DP LD+ID E+L R+  +  P
Sbjct  249   LHYIAWDSPPKQHPRSLSLKDFDNMVKSKAPFARKFHKNDPALDKIDKELLGRT-HRFAP  307

Query  800   GGWCLGNGESG--RCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+  +G  +C+V GD  VL+PG G++RL++  ++  +   F+ +QC
Sbjct  308   GGWCVGSSANGNDQCSVQGDDSVLKPGPGSERLQE-LVQTLSSEEFRRKQC  357



>ref|XP_009795975.1| PREDICTED: xylosyltransferase 1-like [Nicotiana sylvestris]
Length=431

 Score =   357 bits (917),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 241/357 (68%), Gaps = 5/357 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +S+ PP PP  AY ISGSAGD     R L A+YHP N Y++HLD  +   +R  L   V 
Sbjct  76    ISAVPP-PPRFAYLISGSAGDGNMTKRTLQALYHPNNQYVVHLDAESSPEERLDLRNYVT  134

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
               P+F   +NV ++  A+ V  +G + +++TLH A+ILL+    WDWFINLS++DYPLVT
Sbjct  135   NHPIFNKFKNVRMITKANLVTYRGPTMVANTLHAAAILLKEGGEWDWFINLSASDYPLVT  194

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ + +DVF+ TQ+R +P 
Sbjct  195   QDDLLHTFSYLPRDLNFIDHTSKIGWKEFQRAKPIIIDPGLYMTKKADVFWITQRRSVPT  254

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LSR F+DFC+ G +N PRT+LMY +N  SS   YF TV+CN+++F  T
Sbjct  255   AFKLFTGSAWMALSRPFIDFCVWGWDNLPRTVLMYYANFISSPEGYFHTVVCNAQEFRNT  314

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L ++S ++  ++    L   D   M+ S A FA  F   DP+LD+IDSE+L R  
Sbjct  315   TVNSDLHFISWDNPPKQHPHYLTLDDMQRMVDSNAPFARKFPREDPVLDKIDSELLFRGK  374

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             G  VPGGWC+G+ ++G   C+V G+  VLRP  GAKRLEK    L +   F+S QCI
Sbjct  375   GMLVPGGWCVGSRKNGTDPCSVTGNITVLRPTAGAKRLEKLIGSLLSNENFRSNQCI  431



>ref|XP_010091911.1| Xylosyltransferase 1 [Morus notabilis]
 gb|EXB47691.1| Xylosyltransferase 1 [Morus notabilis]
Length=429

 Score =   357 bits (917),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 240/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGS GD   + R L A+YHPRN Y++HLD  +P  +R  L   V   P +
Sbjct  78    PPPPRFAYLISGSNGDGNMLKRTLEALYHPRNCYVVHLDLESPPEERLDLQNYVKDHPTY  137

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV ++  A+ V  +G + +++TLH A+ILL+   +WDWFINLS++DYPLVTQDDLL
Sbjct  138   AKFGNVRMITKANLVTYRGPTMVANTLHAAAILLKEGGDWDWFINLSASDYPLVTQDDLL  197

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPIIVDPGLY+ +  DVF+ TQ+R +P +F++F
Sbjct  198   HTFSYLPRDLNFIDHTSNIGWKEYQRAKPIIVDPGLYMTKKEDVFWVTQRRSVPTAFKLF  257

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN++ F  T +N +
Sbjct  258   TGSAWMALSRPFIDYCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQDFRNTTVNSD  317

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    LN +D   MI S A FA  F+  +P+LD+IDS +L R PG  VP
Sbjct  318   LHFISWDNPPKQHPHHLNHADMKRMIDSNAPFARKFRRDEPVLDEIDSVLLSRGPGLVVP  377

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   C+V GD  +LRPG+GAKRLE     L +  +F+ +QC
Sbjct  378   GGWCIGSKENGSDPCSVTGDTTILRPGLGAKRLETLTSYLLSQEKFRPRQC  428



>ref|XP_007205349.1| hypothetical protein PRUPE_ppa007142mg [Prunus persica]
 gb|EMJ06548.1| hypothetical protein PRUPE_ppa007142mg [Prunus persica]
Length=380

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/349 (49%), Positives = 241/349 (69%), Gaps = 2/349 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P+ P  AY ISGS GD  ++ RLL A+YHPRN+YLLHLD  A  ++R  LA  V +  L 
Sbjct  31    PKLPRFAYLISGSKGDGPQLRRLLQALYHPRNYYLLHLDLEASDAERLELAKFVKSEALI  90

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  RN  V+GNAD V +KG + ++STLH  +ILL+ + +WDWFINLS++DYPL++QD+LL
Sbjct  91    REFRNAMVIGNADLVTAKGPTMIASTLHAIAILLKRAKDWDWFINLSASDYPLMSQDELL  150

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP++LNF+ HTS IGW+E+Q+ +PIIVDPGLY ++ S VF+A ++R +P SF++F
Sbjct  151   HIFSFLPRELNFLEHTSNIGWKENQRARPIIVDPGLYHSKKSGVFWAKERRSMPASFKLF  210

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L++ FL+FC+LG +N PRTLLMY +N  SS   YF T+ CN + +  T +NHN
Sbjct  211   MGSTWVLLTKSFLEFCVLGWDNLPRTLLMYYTNFLSSPEGYFHTLACNHKDYQNTTVNHN  270

Query  974   LQYVSLNSRKEARVLNSS--DFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  +S  +A  +N +   + DM++SGA FA  F   DP+LD ID E+L R  G+  P
Sbjct  271   LHYIRWDSPPKANPINLTLEHYNDMVQSGAPFAGSFARDDPVLDIIDKELLKRPRGQFTP  330

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWCLG      C   G+ + ++P V +K LEK  ++L     F+ +QC
Sbjct  331   GGWCLGKLGKDPCLACGNPNAVKPTVVSKMLEKLIVKLLDSENFRPKQC  379



>ref|XP_006846117.1| hypothetical protein AMTR_s00012p00140940 [Amborella trichopoda]
 gb|ERN07792.1| hypothetical protein AMTR_s00012p00140940 [Amborella trichopoda]
Length=369

 Score =   355 bits (911),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 245/352 (70%), Gaps = 5/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             PR P  AY ISG+ GD  R+ RLL AVYHPRN+YLLH+D  A   +R  LA       +F
Sbjct  17    PRLPRFAYLISGTKGDGLRMRRLLQAVYHPRNYYLLHMDLEASPKERLDLAKFAKLEAVF  76

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
               A NV V+GNA+ V  KG + ++ TLH  +ILL+ +  WDWFINLS++DYPL+TQDDLL
Sbjct  77    VEANNVKVVGNANLVTYKGPTMIACTLHAVAILLKRAKAWDWFINLSASDYPLMTQDDLL  136

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ SY+P+DLNF+ HTS IGW+E Q+ KPII+DPGLY +E SD+F+ATQ R +P SF++F
Sbjct  137   HVFSYMPRDLNFIEHTSDIGWKEYQRAKPIIIDPGLYNSEKSDIFWATQHRSMPSSFKIF  196

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +LSR FL+FCI G +N PRTLL+Y +N  SS   YF TV+CN++ +  T INH+
Sbjct  197   IGSAWVVLSRSFLEFCIHGWDNLPRTLLLYYTNFLSSPEGYFHTVICNAKDYQNTTINHD  256

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  ++  R+    L S  F  M++SGA FA  F    P+L++ID E+L RS GK  P
Sbjct  257   LHYIMWHNPPRQHPVSLTSVHFEGMVQSGAPFARKFARDAPVLEKIDKELLGRSIGKFTP  316

Query  800   GGWCLGNGESGR--CA-VWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+   GR  CA + G  DV+RPG+G+KRLEK  ++L     F+S+QC
Sbjct  317   GGWCMGSKSLGRDPCASLRGGLDVVRPGLGSKRLEKLLLKLLDPENFRSRQC  368



>ref|XP_004302366.1| PREDICTED: xylosyltransferase 1-like [Fragaria vesca subsp. vesca]
Length=431

 Score =   357 bits (917),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 245/356 (69%), Gaps = 5/356 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +S+ PP PP  AY++SGS GD   + R L A+YHP N Y++HLD  +P  +R  L   V+
Sbjct  76    ISTLPP-PPRFAYFVSGSNGDGKMLKRTLQALYHPHNQYVVHLDAESPPEERLDLQNYVS  134

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
                +F+   NV ++  A+ V  +G + +++TLH A+ILL+   +WDWFINLS++DYPLVT
Sbjct  135   NHEVFKKFGNVRMITKANLVTYRGPTMVANTLHAAAILLKEGGDWDWFINLSASDYPLVT  194

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW+E Q+ KP+IVDPGLY+ + +DVF+ TQ+R +P 
Sbjct  195   QDDLLHTFSYLPRDLNFIDHTSNIGWKEFQRAKPLIVDPGLYMTKKTDVFWVTQRRSVPT  254

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LS+ F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T
Sbjct  255   AFKLFTGSAWMALSKPFIDYCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQEFRNT  314

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L +++ ++  ++    LN  DF  MI S A FA  F++ DP+LD+IDSE+L + P
Sbjct  315   TVNTDLHFIAWDNPPKQHPHHLNLGDFPRMIGSNAPFARKFRKDDPVLDKIDSELLFKGP  374

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  VPGGWC G  E+G   C+V GD  VLRP  GAKRLE     L +   F+ +QC
Sbjct  375   GMLVPGGWCTGRSENGSDPCSVIGDTTVLRPSPGAKRLELLISSLMSNENFRPKQC  430



>ref|XP_011008364.1| PREDICTED: xylosyltransferase 1 [Populus euphratica]
Length=428

 Score =   357 bits (916),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 245/360 (68%), Gaps = 4/360 (1%)
 Frame = -2

Query  1721  IHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLA  1542
             IH   +S  P PP  AY ISGSAGD G + R L A+YHP N Y++HLDR +   +R  L+
Sbjct  68    IHPIPTSNLPPPPRFAYLISGSAGDGGMLKRTLQALYHPNNQYVVHLDRESSDEERLDLS  127

Query  1541  LSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADY  1362
               V   P+F    NV ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DY
Sbjct  128   NFVKDHPVFLRFGNVRMITKANLVTYRGPTMVANTLHAAAILLRKGGDWDWFINLSASDY  187

Query  1361  PLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQR  1182
             PLVTQDDLLH  SYLP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + +DVF+ TQ+R
Sbjct  188   PLVTQDDLLHTFSYLPRDLNFIDHTSNIGWKEFQRAKPVIIDPGLYMTKKADVFWITQRR  247

Query  1181  PLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQ  1002
              +P +F++F GS++  LSR F+D+ I G +N PRT+LMY +N  SS   YF TV+CN+++
Sbjct  248   SVPTAFKLFTGSAWMALSRPFIDYTIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQE  307

Query  1001  FNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEIL  828
             F  T +N +L ++S ++  ++    LN +D   MI S A FA  F + DP+LD+IDSE+L
Sbjct  308   FLNTTVNSDLHFISWDNPPKQHPHHLNLADMQRMIDSNAPFARKFPQDDPVLDKIDSELL  367

Query  827   HRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              R PG   PGGWC+G+ E+G   C+  G+  VLRPG GAKRLE     L +   F+ +QC
Sbjct  368   SRGPGMFTPGGWCVGSRENGTDPCSAIGNTTVLRPGPGAKRLETLISTLLSNENFRPRQC  427



>ref|XP_004238858.1| PREDICTED: xylosyltransferase 1 [Solanum lycopersicum]
Length=402

 Score =   356 bits (914),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 235/349 (67%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  GDS RI RLL AVYHPRN YLLH+       +R  L + V +VP+ +A
Sbjct  53    PPAFAYYISGGGGDSDRIFRLLLAVYHPRNRYLLHIGTDGSDEERWKLGMLVKSVPVIQA  112

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D V   GS+++++ L   SILL++   WDWF+NLS++DYPL+TQDDL H+
Sbjct  113   FGNVDVVGKPDPVTYMGSTNIAAMLRAVSILLKVDDGWDWFVNLSASDYPLITQDDLSHV  172

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
             LS + +D+NF++HTS +GW+E Q++KPI+VDPGLYLA  + +FYAT++RP+P++F+VF G
Sbjct  173   LSSVSRDVNFIDHTSDLGWKEGQRVKPIVVDPGLYLARKTQIFYATEKRPMPEAFKVFTG  232

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + +LSR FL+FC+ G +N PRTLLMY +N+  S  VYF +V+CNS  F  T +N +++
Sbjct  233   SPWVVLSRPFLEFCVFGWDNLPRTLLMYFTNSVLSQEVYFHSVVCNSPGFKNTTVNSDMR  292

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN+SD+  M +SGAAFA  F   + +LD ID  IL RSP +  PG 
Sbjct  293   YMVWDNPPKMEPLFLNTSDYDLMAQSGAAFARQFNRDEAVLDMIDQNILKRSPNRVTPGA  352

Query  794   WCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC+G  N     C+ WGD +VL+PG   K L      L      +S QC
Sbjct  353   WCIGRKNWWMDPCSRWGDVNVLKPGPQVKYLGDSVQRLLQDLSSESNQC  401



>ref|XP_002324028.1| hypothetical protein POPTR_0017s11200g [Populus trichocarpa]
 gb|EEF04161.1| hypothetical protein POPTR_0017s11200g [Populus trichocarpa]
Length=428

 Score =   357 bits (916),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 245/360 (68%), Gaps = 4/360 (1%)
 Frame = -2

Query  1721  IHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLA  1542
             IH   +S  P PP  AY ISGSAGD   + R L A+YHP N Y++HLDR +   +R  L+
Sbjct  68    IHPIPTSNLPPPPRFAYLISGSAGDGSMLKRTLQALYHPNNQYVVHLDRESSDEERLDLS  127

Query  1541  LSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADY  1362
               V   P+F    NV ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DY
Sbjct  128   NFVKDHPVFLRFGNVRMITKANLVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDY  187

Query  1361  PLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQR  1182
             PLVTQDDLLH  SYLP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + +DVF+ TQ+R
Sbjct  188   PLVTQDDLLHTFSYLPRDLNFIDHTSNIGWKEFQRAKPVIIDPGLYMTKKADVFWITQRR  247

Query  1181  PLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQ  1002
              +P +F++F GS++  LSR F+D+ I G +N PRT+LMY +N  SS   YF TV+CN+++
Sbjct  248   SVPTAFKLFTGSAWMALSRPFIDYTIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQE  307

Query  1001  FNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEIL  828
             F  T +N +L ++S ++  ++    LN +D   MI S A FA  F + DP+LD+IDSE+L
Sbjct  308   FLNTTVNSDLHFISWDNPPKQHPHHLNLADMQRMIDSNAPFARKFPQDDPVLDKIDSELL  367

Query  827   HRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              RSPG   PGGWC+G+ E+G   C+  G+  VLRPG GAKRLE     L +   F+ +QC
Sbjct  368   SRSPGMFTPGGWCVGSRENGTDPCSAIGNTTVLRPGPGAKRLETMISTLLSNENFRPRQC  427



>gb|ABK25159.1| unknown [Picea sitchensis]
Length=433

 Score =   357 bits (915),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/351 (48%), Positives = 238/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGS GD G++ R L ++YHP N Y++HLDR     +R  LA  V + P+F
Sbjct  82    PGPPRFAYLISGSKGDGGKLKRTLASLYHPLNQYVVHLDRECLPKERVDLANHVRSNPIF  141

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NVHV+  A+ +  KG + +S+TLH A+ILLR S  WDWFINLS++DYPLVTQDDLL
Sbjct  142   AEVGNVHVITKANMITYKGPTMVSNTLHAAAILLRKSKEWDWFINLSASDYPLVTQDDLL  201

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H    LP++LNF+ HTS +GW+E+Q+ KPII+DPGLY++  SD+ +  ++R +P +F++F
Sbjct  202   HTFQSLPRNLNFLEHTSSLGWKENQRAKPIIIDPGLYMSRKSDIVWVAEKRDIPTAFKLF  261

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +LSR F+++CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +NH+
Sbjct  262   TGSAWMVLSRAFVEYCIWGWDNLPRTVLMYYANFVSSPEGYFHTVICNTQEFQNTTVNHD  321

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+S ++  ++    L  SD   MI S A FA  F   DP+LD+ID E+L R  G+  P
Sbjct  322   LHYISWDNPPKQHPHSLGLSDSPKMIDSKAPFARKFHGDDPVLDKIDKELLGRQNGRFTP  381

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC GN ++G   C+  GD + L+PG+GAKRL +   +L +  +F   QC
Sbjct  382   GGWCKGNRDNGSDPCSAIGDKNFLKPGLGAKRLGELIKDLLSPAKFAQNQC  432



>ref|XP_009764786.1| PREDICTED: xylosyltransferase 1 [Nicotiana sylvestris]
Length=402

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 241/365 (66%), Gaps = 10/365 (3%)
 Frame = -2

Query  1721  IHGDLSSP----PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDR  1554
             +H   ++P    P  PP+  YYISG  GDS RI RLL AVYHPRN YLLH+     + +R
Sbjct  38    LHRRFATPVHHGPGHPPAFGYYISGGRGDSDRIFRLLLAVYHPRNRYLLHIGLDGSEEER  97

Query  1553  DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLS  1374
               L + V +VP  +A  NV V+G  D V   GS+++++ L   +ILL++   WDWF+NLS
Sbjct  98    RKLGMLVKSVPAIQAFGNVDVVGKPDPVTYMGSTNIAAMLRAVAILLKMDGGWDWFVNLS  157

Query  1373  SADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYA  1194
             ++DYPL+TQDDL H+LS + +DLNF++HTS +GW+E Q++KPI+VDPGLYLA  + +FYA
Sbjct  158   ASDYPLITQDDLSHVLSSVSRDLNFIDHTSDLGWKEGQRIKPIVVDPGLYLARKTQIFYA  217

Query  1193  TQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLC  1014
             T++RPLP++F+VF GS + ILSR FL+FC+ G +N PRTLLMY +N   S  VYF +V+C
Sbjct  218   TEKRPLPEAFQVFTGSPWVILSRPFLEFCVFGWDNLPRTLLMYFTNAVLSQEVYFHSVVC  277

Query  1013  NSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQID  840
             NS +F  T +N +++Y+  ++  + E   LN+SD+  M +SGAAFA  F   + +LD ID
Sbjct  278   NSPEFKNTTVNSDMRYMVWDNPPKMEPLFLNTSDYDLMAQSGAAFARQFNNDEAVLDMID  337

Query  839   SEILHRSPGKPVPGGWCLGNGESGR---CAVWGDADVLRPGVGAKRLEKHFIELFAGGRF  669
               IL RS  +  PG WC G  +S R   C+ WGD ++L+PG   K LE     L      
Sbjct  338   QNILKRSHNRVTPGAWCTGR-KSWRMDPCSRWGDVNILKPGPQVKNLEDSVQRLLQDLSS  396

Query  668   QSQQC  654
             QS QC
Sbjct  397   QSNQC  401



>ref|XP_002273459.1| PREDICTED: xylosyltransferase [Vitis vinifera]
Length=420

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/354 (47%), Positives = 241/354 (68%), Gaps = 4/354 (1%)
 Frame = -2

Query  1703  SPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTV  1524
             +P   PP +AY ISG+ GD G + R L A+YHP N Y++HLD  +P+ +R  L   +   
Sbjct  66    TPVSLPPRLAYLISGTVGDCGALKRTLQALYHPHNLYIIHLDLESPQIERSHLRDYIRNH  125

Query  1523  PLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQD  1344
             P F + +NV +M  A+ V  +G + +++TLH A+ILL+    WDWFINLS++DYPLVTQD
Sbjct  126   PAFSSVKNVWMMEKANLVTYRGPTMVANTLHAAAILLKEGGEWDWFINLSASDYPLVTQD  185

Query  1343  DLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSF  1164
             DLLH  SYLP+DLNFV+HTS IGW+E Q+ KPIIVDPGLY+ + ++VF+  Q+R +P +F
Sbjct  186   DLLHTFSYLPRDLNFVDHTSNIGWKEFQRAKPIIVDPGLYMTKKNNVFWVKQRRSVPTAF  245

Query  1163  RVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTII  984
             ++F GS++  LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+ +F  T +
Sbjct  246   KLFTGSAWVALSRPFIDYCIWGWDNLPRTVLMYYTNFVSSPEGYFHTVICNAEEFRNTTV  305

Query  983   NHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGK  810
             N +L ++S ++  ++   +L  +D   MI S A FA  F+  DP+LD+ID+E+L R P  
Sbjct  306   NSDLHFISWDNPPKQHPHLLTITDMSKMISSNAPFARKFRRDDPVLDKIDAELLSRRPDM  365

Query  809   PVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              VPG WC+G+  +G   C+V G+  VL+PG GAKRLE   + L +   F+ +QC
Sbjct  366   LVPGAWCIGSSSNGTDPCSVVGNPSVLKPGPGAKRLENLLVSLLSKQNFRPRQC  419



>ref|XP_006841769.1| hypothetical protein AMTR_s00003p00265190 [Amborella trichopoda]
 gb|ERN03444.1| hypothetical protein AMTR_s00003p00265190 [Amborella trichopoda]
Length=435

 Score =   357 bits (915),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 245/372 (66%), Gaps = 12/372 (3%)
 Frame = -2

Query  1736  PHRVLIHGDLSS--PPPR---PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRS  1572
             P    +  DL +  PP R   PP IAY I+G+ GD  RI R+L A+YHPRN Y+LH+D  
Sbjct  63    PVGYFVESDLKNQKPPIRVSEPPRIAYLIAGTKGDGPRIRRVLQALYHPRNRYILHMDLE  122

Query  1571  APKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWD  1392
              P  +R  LA+ V   P+FR  +NV VM  A+ V  KG + ++ TL   +ILL+   NWD
Sbjct  123   VPPRERIDLAIYVKEDPVFREVKNVIVMAQANLVTYKGPTMIACTLQAIAILLKEGGNWD  182

Query  1391  WFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAED  1212
             WF+NLS++DYPLVTQDDLLH +S++ + LNF+ HT  +GW+E+Q+ KPIIVDPGLYL++ 
Sbjct  183   WFVNLSASDYPLVTQDDLLHAMSHMSRGLNFIEHTRIVGWKENQRAKPIIVDPGLYLSKK  242

Query  1211  SDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVY  1032
             +++++A+Q+R LP SF +F GS++ +L+R FL++CI G EN PRT+LMY +N  SS   Y
Sbjct  243   AEIYWASQRRSLPTSFALFTGSAWVMLARPFLEYCIWGWENLPRTILMYYANFVSSPEGY  302

Query  1031  FPTVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDP  858
             F TV+CNS+ F  T +NH+L Y++ ++  R+    L+  DF +M++SGA FA  F + DP
Sbjct  303   FHTVICNSKDFKNTTLNHDLHYIAWDNPPRQHPLSLSMKDFEEMVQSGAPFARKFAKDDP  362

Query  857   ILDQIDSEILHRSPGKPVPGGWCLGNGESGR----CAVWGDADVLRPGVGAKRLEKHFIE  690
             +LD+IDSE+L R+     PG WC G    G     C V GD  V RPG G++RL K   E
Sbjct  363   VLDKIDSELLGRAHTGFTPGAWCAGGSRVGSNEDPCLVRGDDSVFRPGPGSERL-KGLFE  421

Query  689   LFAGGRFQSQQC  654
                   FQ +QC
Sbjct  422   KLCSKEFQDKQC  433



>ref|XP_003543654.1| PREDICTED: xylosyltransferase 1-like isoform X1 [Glycine max]
Length=429

 Score =   356 bits (914),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/352 (48%), Positives = 237/352 (67%), Gaps = 4/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY +SGS GD   + R+L A+YHP N Y++HLD  +   +R  L   V    LF
Sbjct  78    PPPPRLAYLVSGSKGDGAAVTRVLLALYHPNNRYVVHLDLESSAEERSDLVRFVEGHALF  137

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +   NV V+  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLL
Sbjct  138   KRFGNVRVIKKANLVTYRGPTMVANTLHAAAILLRELGDWDWFINLSASDYPLVTQDDLL  197

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW++  + +PIIVDPGLY+ +  DVF+ TQ+R  P +F++F
Sbjct  198   HTFSYLPRDLNFIDHTSDIGWKDHHRARPIIVDPGLYMNKKQDVFWVTQRRSRPTAFKLF  257

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LS+ F+D+CI G +N PRT+LMY SN  SS   YF TV+CN+++F  T +N +
Sbjct  258   TGSAWMALSKSFIDYCIWGWDNLPRTVLMYYSNFISSPEGYFHTVICNAQEFRNTTVNSD  317

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L   D   M+ S A FA  F   DP+LD+ID+E+L R PG  VP
Sbjct  318   LHFISWDNPPKQHPHYLTVDDMKGMVGSNAPFARKFHREDPVLDKIDAELLSRGPGMAVP  377

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             GGWC+G  E+G   C+  GD +VLRPG G+KRLE     L +  +F+ +QC+
Sbjct  378   GGWCIGKRENGTDPCSEVGDPNVLRPGQGSKRLETLISSLLSNEKFRPRQCV  429



>ref|XP_006468827.1| PREDICTED: xylosyltransferase 1-like isoform X2 [Citrus sinensis]
Length=396

 Score =   355 bits (911),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/349 (49%), Positives = 230/349 (66%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  GD  RI RLL A+YHPRN YLLHL   A   +R  LA +V +VP  RA
Sbjct  47    PPAFAYYISGGTGDKDRIFRLLLALYHPRNRYLLHLAADASDDERLKLAAAVRSVPAVRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D V   GSS++++ L  A+ILL++   W+WFI LS+ DYPL+TQDDL H 
Sbjct  107   FGNVDVVGKPDRVNFVGSSNVAAVLRAAAILLKVDKGWNWFIALSALDYPLITQDDLAHA  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+ESQ+++P+IVDPGLYLA  S +F AT++RP PD+F+VF G
Sbjct  167   FSSVRRDLNFIDHTSDLGWKESQRIQPVIVDPGLYLARKSQIFQATEKRPTPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + +LSR FL+FC+ G +N PRTLLMY +N   S  VYF +V+CN+ +F  T IN +L+
Sbjct  227   SQWFVLSRSFLEFCVFGWDNLPRTLLMYFNNVMLSQEVYFHSVICNAPEFKNTTINSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN SD+  M++SG  FA  F++ DP+L+ ID +IL R   +  PG 
Sbjct  287   YMIWDNPPKMEPHFLNVSDYDQMVQSGVVFARQFQKDDPVLNMIDEKILKRGHNRVAPGA  346

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C  WGD +VL+PG  A +LE     L      QS QC
Sbjct  347   WCTGQRSWWMDPCTQWGDVNVLKPGQQATKLEDTITNLLDDWSSQSNQC  395



>ref|XP_010268807.1| PREDICTED: xylosyltransferase 1-like [Nelumbo nucifera]
 ref|XP_010268808.1| PREDICTED: xylosyltransferase 1-like [Nelumbo nucifera]
Length=446

 Score =   357 bits (916),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 245/348 (70%), Gaps = 5/348 (1%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             P IAY ISG+ GD+ R+ R L AVYHPRN Y+LHLD  AP  +R  L  ++ + P FR  
Sbjct  87    PRIAYLISGTKGDTQRMRRTLQAVYHPRNQYILHLDLEAPPRERIELTTTIKSDPTFREV  146

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHIL  1326
             +NV VM  ++ V  KG + ++ TL   +I+LR S +WDWF+NLS++DYPLVTQDDLLH+ 
Sbjct  147   KNVRVMEQSNLVTYKGPTMIACTLQAVAIMLRESIDWDWFVNLSASDYPLVTQDDLLHVF  206

Query  1325  SYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGS  1146
             + L +DLNF+ HT   GW+ +Q+ KPII+DPGLYL++ SD+F  TQ+R LP SF++F GS
Sbjct  207   ANLSRDLNFIEHTPIAGWKLNQRAKPIIIDPGLYLSKKSDIFLTTQRRSLPTSFKLFTGS  266

Query  1145  SYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQY  966
             ++ +LSR FL++CI G +N PRT+LMY +N  SS   YF TV+CN+ +FN+T ++H+L Y
Sbjct  267   AWIMLSRSFLEYCIWGWDNLPRTVLMYYTNFVSSPEGYFHTVICNTEEFNKTAVSHDLHY  326

Query  965   VSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGW  792
             ++ ++  ++  R+L   DF +M++SGA FA  F + D +LD+ID E+L RS G+  PG W
Sbjct  327   IAWDNPPKQHPRLLTIKDFDNMVKSGAPFARKFTKDDSVLDKIDKELLGRSEGRFAPGAW  386

Query  791   CLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             C+G+ + G   C++ G+  V RPG GA+RL++ F +L +   + S++C
Sbjct  387   CIGSSDGGVDPCSLRGEDSVFRPGPGAERLKELFQKLLSEDLY-SKRC  433



>ref|XP_008241149.1| PREDICTED: xylosyltransferase [Prunus mume]
Length=421

 Score =   356 bits (913),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 240/349 (69%), Gaps = 2/349 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P+ P  AY ISGS GD  ++ RLL A+YHPRN+YLLHLD  A  ++R  LA  V +  + 
Sbjct  72    PKLPGFAYLISGSKGDGPQLRRLLQALYHPRNYYLLHLDLEASDAERLELAKFVKSEAVI  131

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  RN  V+G AD V +KG + ++STLH  +ILL+ + +WDWFINLS++DYPL++QD+LL
Sbjct  132   REFRNAMVIGKADLVTAKGPTMIASTLHAIAILLKRAKDWDWFINLSASDYPLMSQDELL  191

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S+LP++LNF+ HTS IGW+E+Q+ +PIIVDPGLY ++ S VF+A ++R +P SF++F
Sbjct  192   HIFSFLPRELNFLEHTSNIGWKENQRARPIIVDPGLYHSKKSGVFWAKERRSMPASFKLF  251

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L++ FL+FC+LG +N PRTLLMY +N  SS   YF T+ CN + +  T +NHN
Sbjct  252   MGSTWVVLTKSFLEFCVLGWDNLPRTLLMYYTNFLSSPEGYFHTLACNHKDYQNTTVNHN  311

Query  974   LQYVSLNSRKEARVLNSS--DFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  +S  +A  +N +   + DM +SGA FA  F   DP+LD ID E+L R  G+  P
Sbjct  312   LHYIRWDSPPKANPINLTLEHYNDMAQSGAPFAGSFARDDPVLDIIDKELLKRPRGQFTP  371

Query  800   GGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWCLG      C   G+ + ++P V +KRLEK  ++L     F+ +QC
Sbjct  372   GGWCLGKLGKDLCLACGNPNAVKPSVVSKRLEKLVVKLLDSKNFRPKQC  420



>ref|XP_011023083.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica]
Length=396

 Score =   355 bits (911),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/349 (48%), Positives = 235/349 (67%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  GD  RI+RLL AVYHPRN YLLHL   A   +R  L  +VN VP  R+
Sbjct  47    PPAFAYYISGGRGDKDRILRLLLAVYHPRNRYLLHLGAEASDEERMRLVGAVNAVPAIRS  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G    +   GSS++++ L  A+ILLR+ + W WF++LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVIGMPSRLTYMGSSNLAAVLRAAAILLRMDAGWTWFVSLSATDYPLITQDDLAHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+ESQ+++PI+VDPG+YLA  S +F+AT++RP PD F++F G
Sbjct  167   FSCVSRDLNFIDHTSELGWKESQRIQPIVVDPGIYLARRSQIFHATEKRPTPDGFKLFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCILG +N PRTLLMY +N   S+  YF +V+CN+ +F  T +N +L+
Sbjct  227   SPWVILSRSFLEFCILGWDNLPRTLLMYFNNVVLSEESYFHSVICNAPEFKNTTVNSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN+SD+  M++SG AFA  F+  DP+LD++D +IL R   +  PG 
Sbjct  287   YMVWDNPPKMEPHFLNTSDYDLMVQSGVAFARQFRRDDPVLDKVDEKILKRGHKRAAPGA  346

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C+ WGD +V++PG  AK+ E+    L      Q  QC
Sbjct  347   WCTGRRTWWMDPCSQWGDVNVVKPGPQAKKFEETIKNLLDEWNSQMNQC  395



>ref|XP_004489366.1| PREDICTED: xylosyltransferase-like [Cicer arietinum]
Length=430

 Score =   356 bits (914),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 244/357 (68%), Gaps = 5/357 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +S+ PP PP +AY ISGSAGD G + R L ++YHP N Y++HLD  + + +R  L   V 
Sbjct  75    ISTFPP-PPRLAYLISGSAGDGGSVKRALLSMYHPHNRYVVHLDLESSQQERSDLFEFVK  133

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
                LF+   NV ++  A+ +  +G + +++TLH A++LL+   +WDWFINLS++DYPLVT
Sbjct  134   NHELFQRFGNVKMITKANLITYRGPTMVANTLHAAAVLLKECGDWDWFINLSASDYPLVT  193

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW++ Q+ +PIIVDPGLY+ +  DVF+ TQ+R  P 
Sbjct  194   QDDLLHTFSYLPRDLNFIDHTSDIGWKDHQRARPIIVDPGLYMNKKQDVFWVTQRRSRPT  253

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LSR F+D+CI G +N PRT+LMY SN  SS   YF TV+CN++ F  T
Sbjct  254   AFKLFTGSAWMALSRSFIDYCIWGWDNLPRTVLMYYSNFISSPEGYFHTVICNAQDFRNT  313

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L ++S ++  ++    L  +D   M+ S A FA  F   DP+LD+ID+E+L R  
Sbjct  314   TVNSDLHFISWDNPPKQHPHYLTVADMKVMVDSNAPFARKFHRNDPVLDKIDAELLSRGS  373

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             G PVPGGWC+G+ E+G   C V G+  VLRPG G+KRLE    +L +   F+ +QC+
Sbjct  374   GMPVPGGWCIGSRENGTDPCLVTGNTTVLRPGNGSKRLETLISKLLSNENFRPRQCV  430



>ref|XP_009602042.1| PREDICTED: xylosyltransferase 1-like isoform X3 [Nicotiana tomentosiformis]
Length=420

 Score =   356 bits (913),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 248/374 (66%), Gaps = 10/374 (3%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPP----PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLD  1578
             P  P  + +   L S P    P PP  AY ISGSAGD G + R L A+YHP NHY++HLD
Sbjct  48    PLIPLPIFVESKLQSLPISAAPPPPRFAYLISGSAGDGGMLKRTLQALYHPNNHYVVHLD  107

Query  1577  RSAPKSDR-DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISS  1401
               +   +R DL    VN   +F    NV ++  A+ V  +G + +++TLH A+ILL+   
Sbjct  108   AESSADERLDLHNFVVNH-KIFAKFTNVKMISKANLVTYRGPTMVANTLHAAAILLKEGG  166

Query  1400  NWDWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYL  1221
              WDWFINLS++DYPLVTQDDL+H  S++P+DLNF++HTS IGW+E Q+ KPIIVDPGLYL
Sbjct  167   EWDWFINLSASDYPLVTQDDLIHTFSHIPRDLNFIDHTSDIGWKEFQRAKPIIVDPGLYL  226

Query  1220  AEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSD  1041
              + SDVF+  Q+R +P +F++F GS++++LSR F+DFCI G +N PRT+LMY +N  S+ 
Sbjct  227   NKKSDVFWIRQRRSVPTAFKLFTGSAWTVLSRPFIDFCIWGWDNLPRTVLMYYANFISTP  286

Query  1040  AVYFPTVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKE  867
               YF TV+CN+++F  T +N +L Y+S ++  ++    L   D   M+ S A FA  F +
Sbjct  287   EGYFHTVVCNAQEFRNTTVNSDLHYISWDNPPKQHPHYLTLDDMQRMVDSNAPFARKFHQ  346

Query  866   RDPILDQIDSEILHRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFI  693
              DP+LD+IDSE+L R  G  VPGGWC+G+ E+G   C++ G+   LRP  GAKRLE    
Sbjct  347   DDPVLDKIDSELLFRGQGMFVPGGWCIGSRENGTDPCSIVGNITFLRPTAGAKRLENLIG  406

Query  692   ELFAGGRFQSQQCI  651
              L +   F+S+QCI
Sbjct  407   SLLSNDNFRSRQCI  420



>ref|XP_007045076.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045077.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOY00908.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOY00909.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
Length=396

 Score =   355 bits (910),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 234/349 (67%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+  YYI G  GD  RI RLL AVYHPRN YLL L   A   +R  LAL++ +VP  R+
Sbjct  47    PPAFGYYIFGGRGDKDRIFRLLLAVYHPRNRYLLQLGADASDEERYRLALALKSVPAIRS  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D     GS+ +++TLH A++L+++   WDWFI LS+ DYPLVTQDDL H+
Sbjct  107   FGNVDVIGKPDRFSYMGSTHIAATLHAAAVLMKLDRGWDWFIALSALDYPLVTQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+E Q+++PI+VDPGLYLA  + +F+AT++R +PD+F+VF G
Sbjct  167   FSSVRRDLNFIDHTSDLGWKEGQRIQPIVVDPGLYLARRTQIFHATEKRQMPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + +LSR FL+FC+ G +N PRTLLMY +N   ++  YF +V+CNS +F  T +N +L+
Sbjct  227   SQWVVLSRSFLEFCLFGWDNLPRTLLMYFNNVMLAEESYFHSVICNSPEFKNTTVNGDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  +S  + E   LN +D+  M +SGAAFA  F++ DP+LD +D +IL+R   +  PG 
Sbjct  287   YMIWDSPPKMEPHFLNITDYDQMAQSGAAFARQFQKDDPVLDMVDEKILNRGRNRAAPGA  346

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C+ WGD +VL+PG  AK+ E+  I L      QS QC
Sbjct  347   WCTGRKSWWMDPCSQWGDVNVLKPGPQAKKFEETIINLLDDWNSQSNQC  395



>ref|XP_004232249.1| PREDICTED: xylosyltransferase 1-like [Solanum lycopersicum]
Length=430

 Score =   355 bits (912),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 238/352 (68%), Gaps = 4/352 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY +SGSAGD   + R L A+YHP N Y++HLD  +   +R  L   V   P+F
Sbjct  79    PPPPRFAYLVSGSAGDGNMLKRTLQALYHPNNQYVVHLDAESSPEERLDLHNFVTNHPIF  138

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                +NV ++  A+ V  +G + +++TLH A+ILL+ +  WDWFINLS++DYPLVTQDDLL
Sbjct  139   IQFKNVRMITKANLVTYRGPTMVANTLHAAAILLKQAGEWDWFINLSASDYPLVTQDDLL  198

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPIIVDPGLY  + +DVF+ TQ+R +P +F++F
Sbjct  199   HTFSYLPRDLNFIDHTSKIGWKEFQRAKPIIVDPGLYATKKADVFWITQRRSVPTAFKLF  258

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +LSR F+DFCI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +
Sbjct  259   TGSAWMVLSRSFIDFCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQEFQNTTVNSD  318

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+S ++  ++    L   D   M+ S A FA  F   DP+LD+IDSE+L R   + VP
Sbjct  319   LHYISWDNPPKQHPHYLTVEDMQKMVDSNAPFARKFHREDPVLDKIDSELLFRGKDRLVP  378

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             GGWC+G+ ++G   C+V G+   L+P  GAKRLEK    L +   F+ +QCI
Sbjct  379   GGWCIGSRKNGTDPCSVAGNITALKPTSGAKRLEKLIGSLLSNDNFRPRQCI  430



>gb|AES74697.2| BGGP beta-1-3-galactosyl-O-glycosyl-glycoprotein [Medicago truncatula]
Length=433

 Score =   355 bits (912),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 248/358 (69%), Gaps = 7/358 (2%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLD-RSAPKSDRDLLALSV  1533
             +S+ PP PP +AY ISGSAGD G + R+L A+YHP N Y++HLD  S+ K   DL    +
Sbjct  78    VSTLPP-PPRLAYLISGSAGDGGSVKRVLLAMYHPHNRYVVHLDLESSAKERADLFEFVM  136

Query  1532  NTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLV  1353
             N   LF+   NV ++  A+ +  +G + +++TLH A+ILL+   +WDWFINLS++DYPLV
Sbjct  137   NH-ELFKRFENVKMITKANLITYRGPTMVANTLHAAAILLKECGDWDWFINLSASDYPLV  195

Query  1352  TQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLP  1173
             TQDDLLH  S+LP+DLNF++HTS IGW++ Q+ +PIIVDPGLY+ +  DVF+ TQ+R  P
Sbjct  196   TQDDLLHTFSFLPRDLNFIDHTSDIGWKDHQRARPIIVDPGLYMNKKQDVFWVTQRRSRP  255

Query  1172  DSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNR  993
              +F++F GS++ +LSR F+D+ I G +N PRT+LMY SN  SS   YF TV+CN+++F  
Sbjct  256   TAFKLFTGSAWMVLSRPFVDYVIWGWDNLPRTVLMYYSNFISSPEGYFHTVICNAQEFRN  315

Query  992   TIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRS  819
             T +N +L +++ ++  ++    L  +D   M  S A FA  F   DP+LD+ID+E+L R+
Sbjct  316   TTVNSDLHFIAWDNPPKQHPHYLTVADMKVMTDSNAPFARKFHREDPVLDRIDTELLSRN  375

Query  818   PGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             PG PVPGGWC+G+ E+G   C+V G+  VLRP  G+KRLE    +L +   F+ +QC+
Sbjct  376   PGMPVPGGWCIGSRENGTDPCSVVGNTTVLRPENGSKRLETLITKLMSNENFRPRQCV  433



>gb|KDO47185.1| hypothetical protein CISIN_1g015219mg [Citrus sinensis]
Length=411

 Score =   354 bits (909),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 168/351 (48%), Positives = 239/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P +AY ISG+ GD  R+ R+L AVYHP N+Y+LHLD  A   +R  LA  V +  + 
Sbjct  60    PALPRLAYLISGTKGDGARVKRVLQAVYHPMNYYVLHLDLEASDGERLELAKYVKSEKVI  119

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  +NV V+G AD V  KG + +++TLH  +ILL+ + +WDWFINLS++DYPL++QDD+L
Sbjct  120   RDFKNVMVIGKADLVTYKGPTMIAATLHAVAILLKQAKDWDWFINLSASDYPLMSQDDIL  179

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLPK LNF+ HTS IGW+E Q+ +PII+DPGLY  + S VF+A ++R +P SF++F
Sbjct  180   HIFSYLPKYLNFLEHTSSIGWKEYQRARPIIIDPGLYHPKKSGVFWAKEKRSMPASFKLF  239

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L+R FL+FCI G +N PRTLLMY +N  SS   YF +V+CN + +  T +NH+
Sbjct  240   MGSAWVVLTRSFLEFCIWGWDNLPRTLLMYYTNFLSSPEGYFHSVICNHKDYQNTTVNHD  299

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  +S  ++    L    F DM+RSGA FA  F + DP+L++ID  +L RS  +  P
Sbjct  300   LHYIRWDSPPKQHPMTLTLKHFDDMVRSGAPFARKFAKDDPVLNKIDENLLKRSNNRFTP  359

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+GN   G+  C V+G+   ++P V +K LEK  ++L     F+S+QC
Sbjct  360   GGWCVGNSAFGKDPCLVYGNPYAIKPSVNSKTLEKLIVKLLDPEIFRSKQC  410



>ref|XP_009357743.1| PREDICTED: xylosyltransferase 1-like [Pyrus x bretschneideri]
Length=396

 Score =   354 bits (908),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 168/349 (48%), Positives = 231/349 (66%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYI G  GD  RI RLL AVYHPRN YLLHL     + +R  LA ++  VP  +A
Sbjct  47    PPAFAYYIWGGRGDRARIFRLLLAVYHPRNRYLLHLSADESEEERRRLAAAIKAVPAIQA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D +   GSS++++TL  A+ILL++ S WDW + LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKPDRITYMGSSNIATTLRAAAILLKVDSGWDWLVTLSAMDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+E  +++PI+VDP  YLA  S +F+AT++R  PD+F+VF G
Sbjct  167   FSSVRRDLNFIDHTSDLGWKELHRVQPIVVDPATYLARRSQIFHATEKRKTPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S +  LSR FL+FCILG +N PRTLLMY +N   S   YF +V+CNS +F  T +N +L+
Sbjct  227   SPWVTLSRSFLEFCILGWDNLPRTLLMYFTNVILSQEGYFHSVICNSPEFKNTTVNSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN+SDF  MI+SGAAFA  F++ DP+LD +D +IL R   +  PG 
Sbjct  287   YMIWDTPPKMEPHFLNTSDFDQMIQSGAAFARQFEKDDPVLDMVDKKILKRGRNQAAPGA  346

Query  794   WCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G  +     C  WGDA++L+PG  AK+ E+    L      QS QC
Sbjct  347   WCSGWKSWWMDPCTHWGDANILKPGPQAKKFEESITNLLDDWNAQSNQC  395



>ref|XP_002282083.1| PREDICTED: xylosyltransferase 1 [Vitis vinifera]
Length=428

 Score =   355 bits (910),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/360 (48%), Positives = 245/360 (68%), Gaps = 4/360 (1%)
 Frame = -2

Query  1721  IHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLA  1542
             +H   +S  P PP  AY ISGS GD   + R L A+YHPRN Y++HLD  +   +R  L 
Sbjct  68    LHPISTSSIPPPPRFAYLISGSTGDGDMLKRTLQALYHPRNSYVVHLDLESSPEERLDLQ  127

Query  1541  LSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADY  1362
               V + PLF    NV ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DY
Sbjct  128   NYVKSQPLFAKFGNVRMITKANLVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDY  187

Query  1361  PLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQR  1182
             PLVTQDDLLH  SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ + +DVF+ TQ+R
Sbjct  188   PLVTQDDLLHAFSYLPRDLNFLDHTSNIGWKEYQRAKPIIIDPGLYMTKKADVFWVTQRR  247

Query  1181  PLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQ  1002
              +P +F++F GS++  LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++
Sbjct  248   SVPTAFKLFTGSAWMALSRPFVDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVMCNAQE  307

Query  1001  FNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEIL  828
             F  T +NH+L ++S ++  ++   +L  +D   MI S A FA  F+  DP+LD+ID+ +L
Sbjct  308   FRNTTVNHDLHFISWDNPPKQHPHILTIADMPRMIESNAPFARKFRHDDPVLDKIDANLL  367

Query  827   HRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              R     VPGGWC+G+ ++G   C+V G++ +LRPG GAKRLE     L +   F+ +QC
Sbjct  368   GRGQDMFVPGGWCIGSRKNGSDPCSVVGNSTILRPGPGAKRLENLISSLLSQENFRPRQC  427



>ref|XP_008379320.1| PREDICTED: xylosyltransferase 1 [Malus domestica]
Length=428

 Score =   355 bits (910),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 245/356 (69%), Gaps = 5/356 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +SS PP PP  AY+ISGS GD   + R L A+YHP N Y++HLD  +P  +R  L   V+
Sbjct  73    VSSLPP-PPRFAYFISGSIGDGNMLKRTLQALYHPHNRYVVHLDLESPPKERTDLQNYVS  131

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
             T P+F    NV ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVT
Sbjct  132   THPVFIRFGNVKMISKANLVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVT  191

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW+E Q+ KPIIVDPGLY+ + +DVF+ TQ+R +P 
Sbjct  192   QDDLLHTFSYLPRDLNFIDHTSNIGWKEYQRAKPIIVDPGLYMTKKADVFWVTQRRSVPT  251

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LS+ F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T
Sbjct  252   AFKLFTGSAWMALSKPFVDYCIWGWDNLPRTVLMYYANFXSSPEGYFHTVICNAQEFRNT  311

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L +++ ++  ++    LN +D   M+ S A FA  F++ DP+LD+IDS +L + P
Sbjct  312   TVNSDLHFITWDNPPKQHPHHLNLADMQRMVDSNAPFARKFRQDDPVLDKIDSALLFKGP  371

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  VPGGWC+G  ++G   C+  G   +LRP  GAKRLE     L +  +F+ +QC
Sbjct  372   GMLVPGGWCIGKRDNGSDPCSDIGSTTILRPTPGAKRLEVLISSLLSNEKFRPKQC  427



>gb|KGN56245.1| hypothetical protein Csa_3G105970 [Cucumis sativus]
Length=396

 Score =   353 bits (907),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 233/351 (66%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP+ AYYISG  GD  R+ RLL AVYHPRN YLLHL   A   +R  LA++V +VP  
Sbjct  45    PYPPAFAYYISGGRGDKDRLFRLLLAVYHPRNRYLLHLAADASNEERLQLAVAVKSVPAI  104

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             RA  NV V+G  + +   GSS++++ LH ASILL++ S WDWFI LS+ DYPL++QDDL 
Sbjct  105   RAFENVDVVGKPNRISYMGSSNIATILHAASILLKLESGWDWFITLSARDYPLISQDDLS  164

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ S + +DLNF++HTS +GW+E Q++ PI+VDPGLYLA  + +F+AT++RP PD+F++F
Sbjct  165   HVFSSVSRDLNFIDHTSDLGWKEGQRVHPIVVDPGLYLARRTQIFHATEKRPTPDAFKIF  224

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +LSR FL+FC+LG +N PR LLMY +N   S+  YF +V+CNS +F    +N +
Sbjct  225   TGSPWFVLSRSFLEFCVLGWDNLPRVLLMYFNNIVLSEEGYFHSVICNSNEFKNKTVNSD  284

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L+++  +   + E   LN S+F  M  SGAAFA  F + D +LD +D E+L R   + +P
Sbjct  285   LRFMIWDDPPKMEPVFLNVSNFNVMAESGAAFAREFHKDDSVLDMVDQELLKRGRNRLLP  344

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G WC G        C+ W D ++L+PG  AK+ E+    L    + QS QC
Sbjct  345   GAWCTGRKSWWMDPCSQWSDVNILKPGSQAKKFEESMKNLLDDWKTQSNQC  395



>ref|XP_004155231.1| PREDICTED: xylosyltransferase 1-like [Cucumis sativus]
Length=396

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 233/351 (66%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP+ AYYISG  GD  R+ RLL AVYHPRN YLLHL   A   +R  LA++V +VP  
Sbjct  45    PYPPAFAYYISGGRGDKDRLFRLLLAVYHPRNRYLLHLAADASNEERLQLAVAVKSVPAI  104

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             RA  NV V+G  + +   GSS++++ LH ASILL++ S WDWFI LS+ DYPL++QDDL 
Sbjct  105   RAFENVDVVGKPNRISYMGSSNIATILHAASILLKLESGWDWFITLSARDYPLISQDDLS  164

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ S + +DLNF++HTS +GW+E Q++ PI+VDPGLYLA  + +F+AT++RP PD+F++F
Sbjct  165   HVFSSVSRDLNFIDHTSDLGWKEGQRVHPIVVDPGLYLARRTQIFHATEKRPTPDAFKIF  224

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +LSR FL+FC+LG +N PR LLMY +N   S+  YF +V+CNS +F    +N +
Sbjct  225   TGSPWFVLSRSFLEFCVLGWDNLPRMLLMYFNNIVLSEEGYFHSVICNSNEFKNKTVNSD  284

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L+++  +   + E   LN S+F  M  SGAAFA  F + D +LD +D E+L R   + +P
Sbjct  285   LRFMIWDDPPKMEPVFLNVSNFNVMAESGAAFAREFHKDDSVLDMVDQELLKRGRNRLLP  344

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G WC G        C+ W D ++L+PG  AK+ E+    L    + QS QC
Sbjct  345   GAWCTGRKSWWMDPCSQWSDVNILKPGSQAKKFEESMKNLLDDWKTQSNQC  395



>ref|XP_008368205.1| PREDICTED: xylosyltransferase 1-like [Malus domestica]
Length=396

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 232/349 (66%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYI G  GD  RI RLL AVYHPRN YLLHL     + +R  LA ++  VP  +A
Sbjct  47    PPAFAYYIWGGRGDRARIFRLLLAVYHPRNRYLLHLSADESEEERRRLAAAIKAVPAIQA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D +   GS+++++TL  A+ILL++ S WDWF+ LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKPDRITYMGSTNIATTLRAAAILLKVDSGWDWFVTLSAMDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+E  +++PI+VDP  YLA  S +F+AT++R  PD+F+VF G
Sbjct  167   FSSVRRDLNFIDHTSDLGWKELHRVQPIVVDPATYLARRSQIFHATEKRKTPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S +  LSR FL+FCILG +N PRTLLMY +N   S   YF +V+CNS ++  T +N +L+
Sbjct  227   SPWVTLSRSFLEFCILGWDNLPRTLLMYFTNVILSQEGYFHSVICNSPEYKNTTVNSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN+SDF  MI+SGAAFA  F++ DP++D +D +IL R   +  PG 
Sbjct  287   YMIWDTPPKMEPHFLNTSDFDQMIQSGAAFARQFEKDDPVMDMVDKKILKRGRNRAAPGA  346

Query  794   WCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G  +     C  WGDA++L+PG  AK+ E+    L      QS QC
Sbjct  347   WCSGWKSWWMDPCTHWGDANILKPGPQAKKFEESITNLLDDWNAQSNQC  395



>gb|KDO72430.1| hypothetical protein CISIN_1g037238mg [Citrus sinensis]
Length=410

 Score =   353 bits (906),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 239/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
              AY ISGS GD   I R L A+YHP N Y++HLDR++ +S+R  L   VN   LF    N
Sbjct  64    FAYLISGSVGDGNMIKRTLLALYHPNNVYVVHLDRASSESERLDLQNFVNGFHLFNKFSN  123

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+ V  +G + +++TLH A++LLR   +WDWFINLS++DYPLVTQDDLL   SY
Sbjct  124   VKMITKANLVTYRGPTMVANTLHAAAVLLREGGDWDWFINLSASDYPLVTQDDLLDAFSY  183

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+E Q+ KPII+DPGLY+++ +DVF+ TQ+R +P +F++F GS++
Sbjct  184   LPRDLNFIDHTSNIGWKEFQRAKPIIIDPGLYMSKKADVFWVTQKRSVPSAFKLFTGSAW  243

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
               LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +L ++S
Sbjct  244   MALSRSFIDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFRNTTVNSDLHFIS  303

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    LN +D   M+ S A FA  F   DP+LD+IDSE+L R+PG   PGGWC+
Sbjct  304   WDNPPKQHPHYLNLADMQRMVDSNAPFARKFPREDPVLDKIDSELLSRNPGMVTPGGWCI  363

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G+ ++G   C+V G+  VLRPG GAKRL      L +  +F+  QC
Sbjct  364   GSRKNGSDPCSVVGNTTVLRPGPGAKRLGSLITSLLSKEKFRPGQC  409



>ref|XP_008389227.1| PREDICTED: xylosyltransferase 1 [Malus domestica]
Length=396

 Score =   352 bits (904),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 230/349 (66%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYI G  GD  RI RLL AVYHPRN YLLHL     + +R  LA ++N VP  +A
Sbjct  47    PPAFAYYIWGGRGDRARIFRLLLAVYHPRNRYLLHLSADESEDERRRLAAAINAVPAIQA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D     GSS++++TLH A+I L++ S WDWF+ LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKPDRXTYMGSSNIATTLHAAAIFLKVDSGWDWFVTLSAMDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+E  +++PI+VDPG+YLA  S +F+AT++R  PD+F+VF G
Sbjct  167   FSSVRRDLNFIDHTSDLGWKELHRVQPIVVDPGIYLARRSQIFHATEKRKTPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCI G +N PRTLLMY +N   S   YF +V+CNS +F  T +N +L+
Sbjct  227   SPWVILSRSFLEFCINGWDNLPRTLLMYFTNVMLSQEGYFHSVICNSPEFKNTTVNSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             YV  ++  + E   LN+ DF  M +SGAAFA  FK+ D +LD +D +IL R   +  PG 
Sbjct  287   YVIWDTPPKMEPLFLNTXDFDQMAQSGAAFARQFKKDDRVLDMVDKKILKRGRNRAAPGA  346

Query  794   WCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G  +     C  W DA++L+PG  AK+LE     L      Q+ QC
Sbjct  347   WCSGWRSWWMDPCTQWSDANILKPGPQAKKLEDSITNLLDDWNAQTNQC  395



>ref|XP_006344216.1| PREDICTED: xylosyltransferase 1-like [Solanum tuberosum]
Length=402

 Score =   353 bits (905),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 236/352 (67%), Gaps = 4/352 (1%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             P  PP+ AYYISG  GDS RI RLL AVYHPRN YLLH+     + +R  L + V +VP+
Sbjct  50    PGHPPAFAYYISGGGGDSDRIFRLLLAVYHPRNRYLLHIGTDGSEEERWKLGMLVKSVPV  109

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
              +A  NV V+G  D V   GS+++++ L   SILL++   WDWF+NLS++DYPL+TQDDL
Sbjct  110   IQAFGNVDVVGKPDPVTYMGSTNIAAMLRAVSILLKVDGGWDWFVNLSASDYPLITQDDL  169

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
              H+L  + +D+NF++HTS +GW+E Q++KPI+VDPGLYLA  + +FYAT++RP+P++F V
Sbjct  170   SHVLLSVSRDVNFIDHTSDLGWKEGQRVKPIVVDPGLYLARKTQIFYATEKRPMPEAFNV  229

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS + +LSR FL+FC+ G +N PRTLLMY +N   S+ VYF +V+CNS +F  T +N 
Sbjct  230   FTGSPWVVLSRPFLEFCVFGWDNLPRTLLMYFTNAVLSEEVYFHSVVCNSPEFKNTTVNS  289

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +++Y+  ++  + E   LN+SD+  M +SGAAFA  F + + +LD ID  IL RS  +  
Sbjct  290   DMRYMVWDNPPKMEPLFLNTSDYDLMAQSGAAFARQFNKDEAVLDMIDQNILKRSQNRVT  349

Query  803   PGGWCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PG WC+G  N     C+ WGD ++L+PG   K L      L      +S QC
Sbjct  350   PGAWCIGGKNWWMDPCSRWGDVNMLKPGPQVKILGDSVQRLLQDLSSESNQC  401



>ref|NP_171851.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AAF86534.1|AC002560_27 F21B7.14 [Arabidopsis thaliana]
 gb|AAK92772.1| putative glycosylation enzyme [Arabidopsis thaliana]
 gb|AAM20384.1| putative glycosylation enzyme [Arabidopsis thaliana]
 gb|AEE27581.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase-like 
protein [Arabidopsis thaliana]
 gb|AHL38972.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=447

 Score =   354 bits (909),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 246/351 (70%), Gaps = 6/351 (2%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R  LA+SV T P F
Sbjct  98    PEPPRLAYLISGTKGDSHRMMRTLQAVYHPRNQYVLHLDLEAPPRERMELAMSVKTDPTF  157

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NV VM  ++ V  KG + ++ TL   SILLR S +WDWF+NLS++DYPLVTQDDLL
Sbjct  158   REMENVRVMAQSNLVTYKGPTMIACTLQAVSILLRESLHWDWFLNLSASDYPLVTQDDLL  217

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             ++ S L +++NF+ +    GW+ +Q+ K IIVDP LYL++ SD+ + TQ+R LP+SFR+F
Sbjct  218   YVFSNLSRNVNFIENMQLTGWKLNQRAKSIIVDPALYLSKKSDIAWTTQRRSLPNSFRLF  277

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L+R FL++CI G +NFPRT+LMY +N  SS   YF TV+CNS++F  T I H+
Sbjct  278   TGSAWIMLTRSFLEYCIWGWDNFPRTILMYYTNFVSSPEGYFHTVICNSKEFINTAIGHD  337

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y++ +S  ++  R L+  DF +M++S A FA  F + DP LD+ID E+L R+  +  P
Sbjct  338   LHYIAWDSPPKQHPRSLSLKDFDNMVKSKAPFARKFHKNDPALDKIDKELLGRT-HRFAP  396

Query  800   GGWCLGNGESG--RCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+  +G  +C+V GD  VL+PG G++RL++  ++  +   F+ +QC
Sbjct  397   GGWCVGSSANGNDQCSVQGDDSVLKPGPGSERLQE-LVQTLSSEEFRRKQC  446



>ref|XP_006448296.1| hypothetical protein CICLE_v10015447mg [Citrus clementina]
 gb|ESR61536.1| hypothetical protein CICLE_v10015447mg [Citrus clementina]
Length=396

 Score =   352 bits (904),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/349 (49%), Positives = 229/349 (66%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  GD  RI RLL A+YHPRN YLLHL   A   +R  LA +V +VP  RA
Sbjct  47    PPAFAYYISGGTGDKDRIFRLLLALYHPRNRYLLHLAADASDDERLKLAAAVRSVPAVRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D V   GSS++++ L  A+ILL++   W+WFI LS+ DYPLVTQDDL H 
Sbjct  107   FGNVDVVGKPDRVNFVGSSNVAAVLRAAAILLKVDKGWNWFIALSALDYPLVTQDDLAHA  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+ESQ+++P+IVDPGLYLA  S +F AT++RP PD+F+VF G
Sbjct  167   FSSVRRDLNFIDHTSDLGWKESQRIQPVIVDPGLYLARKSQIFQATEKRPTPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + +LSR FL+FC+ G +N PRTLLMY +    S  VYF +V+CN+ +F  T IN +L+
Sbjct  227   SQWFVLSRSFLEFCVFGWDNLPRTLLMYFNIVMLSQEVYFHSVICNAPEFKNTTINSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN SD+  M++SG  FA  F++ DP+L+ ID +IL R   +  PG 
Sbjct  287   YMIWDNPPKMEPHFLNVSDYDQMVQSGVVFARQFQKDDPVLNMIDEKILKRGHNRVAPGA  346

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C  WGD +VL+PG  A +LE     L      QS QC
Sbjct  347   WCTGQRSWWMDPCTQWGDVNVLKPGQQATKLEDTITNLLDDWSSQSNQC  395



>ref|XP_006400024.1| hypothetical protein EUTSA_v10013590mg [Eutrema salsugineum]
 gb|ESQ41477.1| hypothetical protein EUTSA_v10013590mg [Eutrema salsugineum]
Length=434

 Score =   353 bits (907),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 242/346 (70%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS+GD   + R L A+YHP N Y++HLDR +   +R  L+  V    LF+  RN
Sbjct  88    LAYLISGSSGDGQMLKRTLLALYHPNNQYVVHLDRESSPEERLDLSGFVANQTLFQRFRN  147

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+FV  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  148   VRMIVKANFVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLLHTFSY  207

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ES + KPII+DPGLY+++ +DVF+ +Q+R +P +F++F GS++
Sbjct  208   LPRDLNFIDHTSSIGWKESHRAKPIIIDPGLYMSKKADVFWVSQKRSMPTAFKLFTGSAW  267

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+R+F  T +N +L ++S
Sbjct  268   MMLSRPFVDYFIWGWDNLPRIVLMYYANFLSSPEGYFHTVICNAREFTNTTVNSDLHFIS  327

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L   D+  M+ S A FA  F+  +P+LD+IDSE+L RS G   PGGWC+
Sbjct  328   WDNPPKQHPHHLTLDDYNRMVDSNAPFARKFRRDEPVLDKIDSELLSRSHGMVTPGGWCI  387

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  E+G   CA  GD  V++PG+GAKR+EK    L +   F+S+QC
Sbjct  388   GTRENGSDPCAEIGDTSVIKPGLGAKRVEKLITYLLSTENFRSRQC  433



>ref|XP_009126027.1| PREDICTED: xylosyltransferase 1 [Brassica rapa]
 emb|CDX85567.1| BnaA02g02460D [Brassica napus]
Length=432

 Score =   353 bits (907),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 240/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS+GD   + R L A+YHP N Y++HLDR +   +R  L+  V    LF   RN
Sbjct  86    LAYLISGSSGDGQMLKRTLMALYHPNNQYVVHLDRESSAEERLDLSAFVANQTLFGRFRN  145

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+FV  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  146   VRMIVKANFVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLLHTFSY  205

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ES + KPII+DPGLY+++ +DVF+ +Q+R +P +F++F GS++
Sbjct  206   LPRDLNFIDHTSNIGWKESHRAKPIIIDPGLYMSKKADVFWVSQKRSMPTAFKLFTGSAW  265

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+++F  T +N +L ++S
Sbjct  266   MMLSRPFVDYFIWGWDNLPRIVLMYYANFLSSPEGYFHTVICNAKEFTNTTVNSDLHFIS  325

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L   DF  M+ S A FA  F+  +P+LD+IDSE+L RSPG   PGGWC+
Sbjct  326   WDNPPKQHPHHLTLDDFDRMVDSNAPFARKFRRDEPVLDKIDSELLSRSPGMVTPGGWCI  385

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  E+G   CA  GD  V++PG GAKR+EK    L +   F+ +QC
Sbjct  386   GTRENGSDPCAEIGDTSVVKPGSGAKRVEKLVTYLLSNENFRPRQC  431



>ref|XP_006338492.1| PREDICTED: xylosyltransferase 1-like [Solanum tuberosum]
Length=430

 Score =   353 bits (907),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 241/357 (68%), Gaps = 5/357 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +S+ PP PP  AY +SGSAGD   + R L A+YHP N Y++HLD  +   +R  L   V 
Sbjct  75    ISTVPP-PPRFAYLVSGSAGDGNMLKRTLQALYHPNNQYVVHLDAESSPEERLDLHNFVT  133

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
               P+F   +NV ++  A+ V  +G + +++TLH A+ILL+ +  WDWFINLS++DYPLVT
Sbjct  134   NHPIFIQFKNVRMITKANLVTYRGPTMVANTLHAAAILLKEAGEWDWFINLSASDYPLVT  193

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SY P+DLNF++HTS IGW+E Q+ KPIIVDPGLY  + +DVF+ TQ+R +P 
Sbjct  194   QDDLLHTFSYFPRDLNFIDHTSKIGWKEFQRAKPIIVDPGLYATKKADVFWITQRRSVPT  253

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++ +LSR F+DFCI G +N PRT+LMY +N  SS   YF TV+CN+++F  T
Sbjct  254   AFKLFTGSAWMVLSRSFIDFCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQEFRNT  313

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L Y+S ++  ++    L   D   M+ S A FA  F   DP+LD+IDS++L R  
Sbjct  314   TVNSDLHYISWDNPPKQHPHYLTVEDMQKMVDSNAPFARKFHREDPVLDKIDSDLLFRGK  373

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
              + VPGGWC+G+ ++G   C+V G+   L+P  GAKRLEK    L +   F+ +QCI
Sbjct  374   DRLVPGGWCIGSRKNGTDPCSVAGNITALKPTSGAKRLEKLIGSLLSNDNFRPKQCI  430



>ref|XP_010681688.1| PREDICTED: xylosyltransferase 1 [Beta vulgaris subsp. vulgaris]
Length=405

 Score =   352 bits (904),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 238/367 (65%), Gaps = 9/367 (2%)
 Frame = -2

Query  1742  SHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPK  1563
             + P  +  HG     P  PPS AYYI G  GD  R++RLL AVYHPRN YLLHL   A  
Sbjct  43    NKPTTIPTHG-----PQFPPSFAYYIYGGGGDKERMLRLLLAVYHPRNWYLLHLSSDAST  97

Query  1562  SDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFI  1383
              +R+ LA +V +VP  +A  NV V+G + ++ + G++++++TL  A++LL++   WDWFI
Sbjct  98    LEREWLAAAVRSVPSIQAFENVEVIGKSMWLTNMGATNIAATLRAAAVLLKLDQGWDWFI  157

Query  1382  NLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDV  1203
              LS++DYPL+TQDDL H+ S + +DLNF++HTS +GW+E Q+++PIIVDP +YLA  S +
Sbjct  158   TLSASDYPLLTQDDLAHVFSSIKRDLNFIDHTSELGWKEQQRIQPIIVDPSIYLARKSQI  217

Query  1202  FYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPT  1023
             F ATQ+RP P +F+VF GS + ILSR FL FC+ G +N PRT+LMY +N       YF +
Sbjct  218   FTATQKRPTPAAFKVFTGSPWVILSRSFLKFCLFGWDNLPRTILMYFNNAMFPQEGYFHS  277

Query  1022  VLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILD  849
             V+CNS +F  T +N++L+Y+  +S  + E   LN SDF  MI+SGAA A  F++ DP+L 
Sbjct  278   VICNSPEFRNTTVNNDLRYMIWDSPPKMEPHYLNVSDFDQMIQSGAAIARQFQKDDPVLT  337

Query  848   QIDSEILHRSPGKPVPGGWCLGNGE--SGRCAVWGDADVLRPGVGAKRLEKHFIELFAGG  675
              ID +IL+R   + VPG WC G     +  C  WGD + L+PG+ AKR            
Sbjct  338   MIDEKILNRRHNRVVPGSWCSGRDSWFTDACGQWGDINSLKPGLQAKRFADSMTNYIDDL  397

Query  674   RFQSQQC  654
               QS QC
Sbjct  398   NSQSTQC  404



>ref|XP_002873705.1| glycosyltransferase family 14 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49964.1| glycosyltransferase family 14 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   353 bits (907),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 242/346 (70%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS+GD   + R L A+YHP N Y++HLDR +   +R  L+  V    LF+  +N
Sbjct  88    LAYLISGSSGDGQMLKRTLLALYHPNNQYVVHLDRESSPEERLDLSGFVANQTLFQRFQN  147

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+FV  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  148   VRMIVKANFVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLLHTFSY  207

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ES + KPII+DPGLY+++ +DVF+ +Q+R +P +F++F GS++
Sbjct  208   LPRDLNFIDHTSNIGWKESHRAKPIIIDPGLYMSKKADVFWVSQKRSMPTAFKLFTGSAW  267

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+R+F  T +N +L ++S
Sbjct  268   MMLSRPFVDYFIWGWDNLPRIVLMYYANFLSSPEGYFHTVICNAREFTNTTVNSDLHFIS  327

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L   DF  M+ S A FA  F+  +P+LD+IDSE+L RS G   PGGWC+
Sbjct  328   WDNPPKQHPHHLTVDDFQRMVDSNAPFARKFRRDEPVLDKIDSELLSRSHGMVTPGGWCI  387

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  E+G   CA+ GD  V++PG+GAKR+EK    L +   F+ +QC
Sbjct  388   GTRENGSDPCAMIGDTSVIKPGLGAKRVEKLITYLLSTENFRPRQC  433



>gb|KDP45456.1| hypothetical protein JCGZ_09705 [Jatropha curcas]
Length=412

 Score =   353 bits (905),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 238/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD   + R L A+YHP N Y++HLDR +   +R  L   V   P+F
Sbjct  61    PPPPRFAYLISGSAGDGNMLKRTLQALYHPHNRYVVHLDRESSVEERLDLNNYVKNNPVF  120

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV ++  A+ V  +G + +++TLH A+ILL+   +WDWFINLS++DYPLVTQDDLL
Sbjct  121   VKFGNVKMIAKANLVTYRGPTMVANTLHAAAILLKEGGDWDWFINLSASDYPLVTQDDLL  180

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPIIVDPGLY+ + +DVF+ TQ+R +P +F++F
Sbjct  181   HTFSYLPRDLNFIDHTSNIGWKEFQRAKPIIVDPGLYMTKKADVFWVTQRRSVPTAFKLF  240

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+++F  T +N +
Sbjct  241   TGSAWMALSRPFVDYTIWGWDNLPRVVLMYYANFISSPEGYFHTVICNAQEFRNTTVNSD  300

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L  +D   MI S A FA  F++ +P+LD+IDSE+L R PG   P
Sbjct  301   LHFISWDNPPKQHPHHLTLADMQKMINSNAPFARKFRKDNPVLDKIDSELLSRGPGMFTP  360

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G  E+G   C+  G+  VLRPG GAKRLE     L +  +F+ +QC
Sbjct  361   GGWCIGRKENGTDPCSTIGNTTVLRPGPGAKRLEDLISSLLSSEKFRPRQC  411



>ref|XP_006431054.1| hypothetical protein CICLE_v10011781mg [Citrus clementina]
 gb|ESR44294.1| hypothetical protein CICLE_v10011781mg [Citrus clementina]
Length=430

 Score =   353 bits (906),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 239/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
              AY ISGS GD   I R L A+YHP N Y++HLDR++ +S+R  L   VN   LF    N
Sbjct  84    FAYLISGSVGDGNMIKRTLLALYHPNNVYVVHLDRASSESERLDLQNFVNGFHLFNKFSN  143

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+ V  +G + +++TLH A++LLR   +WDWFINLS++DYPLVTQDDLL   SY
Sbjct  144   VKMITKANLVTYRGPTMVANTLHAAAVLLREGGDWDWFINLSASDYPLVTQDDLLDAFSY  203

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+E Q+ KPII+DPGLY+++ +DVF+ TQ+R +P +F++F GS++
Sbjct  204   LPRDLNFIDHTSNIGWKEFQRAKPIIIDPGLYMSKKADVFWVTQKRSVPSAFKLFTGSAW  263

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
               LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +L ++S
Sbjct  264   MALSRSFIDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFRNTTVNSDLHFIS  323

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    LN +D   M+ S A FA  F   DP+LD+IDSE+L R+PG   PGGWC+
Sbjct  324   WDNPPKQHPHYLNLADMQRMVDSNAPFARKFPREDPVLDKIDSELLSRNPGMVTPGGWCI  383

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G+ ++G   C+V G+  VLRPG GAKRL      L +  +F+  QC
Sbjct  384   GSRKNGSDPCSVVGNTTVLRPGPGAKRLGSLITSLLSKEKFRPGQC  429



>ref|NP_197009.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 emb|CAC01824.1| putative protein [Arabidopsis thaliana]
 gb|AAL14395.1| AT5g15050/F2G14_170 [Arabidopsis thaliana]
 gb|AAM63425.1| putative glycosylation enzyme [Arabidopsis thaliana]
 gb|AAM70541.1| AT5g15050/F2G14_170 [Arabidopsis thaliana]
 gb|AED92110.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38630.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=434

 Score =   353 bits (906),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 242/346 (70%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS+GD   + R L A+YHP N Y++HLDR +   +R  L+  V    LF+  +N
Sbjct  88    LAYLISGSSGDGQMLKRTLMALYHPNNQYVVHLDRESSPEERLDLSGFVANHTLFQRFQN  147

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+FV  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  148   VRMIVKANFVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLLHTFSY  207

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ES + KPII+DPGLY+++ +DVF+ +Q+R +P +F++F GS++
Sbjct  208   LPRDLNFIDHTSNIGWKESHRAKPIIIDPGLYMSKKADVFWVSQKRSMPTAFKLFTGSAW  267

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+R+F  T +N +L ++S
Sbjct  268   MMLSRPFVDYFIWGWDNLPRIVLMYYANFLSSPEGYFHTVICNAREFTNTTVNSDLHFIS  327

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L   DF  M+ S A FA  F+  +P+LD+IDSE+L RS G   PGGWC+
Sbjct  328   WDNPPKQHPHHLTLDDFQRMVDSNAPFARKFRRDEPVLDKIDSELLFRSHGMVTPGGWCI  387

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  E+G   CAV GD  V++PG+GAKR+EK    L +   F+ +QC
Sbjct  388   GTRENGSDPCAVIGDTSVIKPGLGAKRIEKLITYLLSTENFRPRQC  433



>ref|XP_002517446.1| acetylglucosaminyltransferase, putative [Ricinus communis]
 gb|EEF44988.1| acetylglucosaminyltransferase, putative [Ricinus communis]
Length=430

 Score =   353 bits (905),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 238/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISGSAGD   + R L A+YHP N Y++HLDR +   +R  L+  V   P+F
Sbjct  79    PPPPRLAYLISGSAGDGNMLKRTLQALYHPNNRYVVHLDRESSAEERLDLSNYVQQDPVF  138

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLL
Sbjct  139   LKFGNVKMIQKANLVTYRGPTMVANTLHAAAILLRDGGDWDWFINLSASDYPLVTQDDLL  198

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPIIVDPGLY+ + +DVF+ TQ+R +P +F++F
Sbjct  199   HTFSYLPRDLNFIDHTSNIGWKEFQRAKPIIVDPGLYMTKKADVFWVTQRRSVPTAFKLF  258

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+++F  T +N +
Sbjct  259   TGSAWMALSRPFVDYTIWGWDNLPRVVLMYYANFISSPEGYFHTVICNAQEFRNTTVNSD  318

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    LN +D   MI S A FA  F   DP+LD+IDSE+L R P    P
Sbjct  319   LHFISWDNPPKQHPHHLNIADMQRMIDSNAPFARKFPRNDPVLDKIDSELLSRGPSMFTP  378

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G WC+G+ E+G   C+V G+  VLRPG GAKRLE     L +   F+ +QC
Sbjct  379   GAWCIGSRENGSDPCSVIGNTTVLRPGPGAKRLENLISNLLSSENFRPKQC  429



>ref|XP_007032419.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY03345.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=432

 Score =   353 bits (906),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 240/356 (67%), Gaps = 5/356 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +S+ PP PP  AY +SGSAGD   + R L A+YHP N Y++HLDR A   +R  L   V 
Sbjct  77    ISTLPP-PPRFAYLVSGSAGDGRMLKRTLLALYHPLNQYVVHLDREASSEERLDLEKFVK  135

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
                +F    NV ++  A+ V  +G + +++TLH A+ILL+   +WDWFINLS++DYPLVT
Sbjct  136   NHQVFNKVGNVRMIVKANLVTYRGPTMVANTLHAAAILLKEGGDWDWFINLSASDYPLVT  195

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY  + +DVF+ TQ+R +P 
Sbjct  196   QDDLLHTFSYLPRDLNFIDHTSNIGWKEFQRAKPIIIDPGLYSVKKADVFWVTQRRSVPT  255

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T
Sbjct  256   AFKLFTGSAWMALSRPFIDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFRNT  315

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +N +L ++S ++  ++    L   D   MI S A F   F + DP+LD+IDSE+L R P
Sbjct  316   TVNSDLHFISWDNPPKQHPHHLKLDDMQRMINSNAPFGRKFPQEDPVLDKIDSELLSRGP  375

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G   PGGWC+G+ ++G   C+V G+  VLRPG GAKRLE     L +   F+ +QC
Sbjct  376   GMLTPGGWCVGSVKNGTDPCSVVGNTTVLRPGPGAKRLETLISSLLSNDNFRPRQC  431



>ref|XP_009356160.1| PREDICTED: xylosyltransferase 1-like [Pyrus x bretschneideri]
Length=396

 Score =   352 bits (902),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 168/349 (48%), Positives = 230/349 (66%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYI G  GD  RI RLL AVYHPRN YLLHL     + +R  LA ++N VP  +A
Sbjct  47    PPAFAYYIWGGRGDRARIFRLLLAVYHPRNRYLLHLSADESEDERRRLATAINAVPAIQA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D +   GSS++++TL  A+I L++ S WDWF+ LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKPDRITYMGSSNIATTLRAAAIFLKVDSGWDWFVTLSAMDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+E  +++PI+VDPG+YLA  S +F+AT++R  PD+F+VF G
Sbjct  167   FSSVRRDLNFIDHTSDLGWKELHRVQPIVVDPGIYLARRSQIFHATEKRKTPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCI G +N PRTLLMY +N   S   YF +V+CNS +F  T +N +L+
Sbjct  227   SPWVILSRSFLEFCINGWDNLPRTLLMYFTNVMLSQEGYFHSVICNSPEFKNTTVNSDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN+ DF  M RSGA FA  FK+ D +LD +D +IL R   +  PG 
Sbjct  287   YMIWDTPPKMEPLFLNTLDFDQMARSGAVFARQFKKDDRVLDMVDKKILKRGRNQAAPGA  346

Query  794   WCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G  +     C  WGDA++L+PG  AK+LE     L      Q+ QC
Sbjct  347   WCSGWRSWWMDPCTQWGDANILKPGPQAKKLEDSITNLLDDWNAQTNQC  395



>ref|XP_009622073.1| PREDICTED: xylosyltransferase 1 [Nicotiana tomentosiformis]
Length=402

 Score =   352 bits (902),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 236/353 (67%), Gaps = 6/353 (2%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             P  PP+  YYISG   DS RI RLL AVYHPRN YLLH+     + +R  L + V +VP+
Sbjct  50    PGHPPAFGYYISGGRDDSDRIFRLLLAVYHPRNRYLLHIGVDGSEEERQKLGMLVKSVPV  109

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
              +A  NV V+G  D V   GS+++++ L   +ILL++   WDWF+NLS++DYPL+TQDDL
Sbjct  110   IQAFGNVDVVGKPDPVTYMGSTNIAAMLRAVAILLKMDGGWDWFVNLSASDYPLITQDDL  169

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
              H+LS + +DLNF++HTS +GW+E Q++KPI+VDPGLYLA  + +FYAT++RP+P++F+V
Sbjct  170   SHVLSSVSRDLNFIDHTSDLGWKEGQRIKPIVVDPGLYLARKTQIFYATEKRPMPEAFQV  229

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS + ILSR FL+FC+ G +N PRTLLMY +N   S  VYF +V+CNS +F  T +N 
Sbjct  230   FTGSPWVILSRPFLEFCVFGWDNLPRTLLMYFTNAVLSQEVYFHSVVCNSPEFKNTTVNS  289

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +++Y+  ++  + E   LN+SD+  M +SGAAFA  F + + +LD ID  IL RS  +  
Sbjct  290   DMRYMVWDNPPKMEPLFLNTSDYDLMAQSGAAFARQFNKDETVLDMIDQNILKRSHNRVT  349

Query  803   PGGWCLGNGESGR---CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PG WC G  +S R   C+ WGD +VL+PG   K L      L      QS QC
Sbjct  350   PGAWCTGR-KSWRMDPCSRWGDVNVLKPGPQVKNLGDSVQRLLQDLSSQSNQC  401



>ref|XP_001772325.1| predicted protein [Physcomitrella patens]
 gb|EDQ62796.1| predicted protein [Physcomitrella patens]
Length=355

 Score =   350 bits (898),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 243/347 (70%), Gaps = 3/347 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP +AY I G+ GD  R+ R+L A+YHP N+YLLHLDR + + +R  L   V    +F+ 
Sbjct  7     PPKLAYLILGAGGDGLRMQRMLQALYHPHNYYLLHLDRESSEDERKNLDRYVKHEQVFQE  66

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
             A NV+++   + V  KGS+ +++TLHGA+ILL+ + +WDWFINLS++DYPL+TQDDLLH+
Sbjct  67    AGNVYMVAKPNLVTYKGSTMIAATLHGAAILLKKAKDWDWFINLSASDYPLLTQDDLLHV  126

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              SYLPKDLNF+ HT+ +GW+E Q++KPII+DP LY    +DV++ T++R +P +FR+F G
Sbjct  127   FSYLPKDLNFLEHTNDLGWKEEQRVKPIIIDPALYQNTKTDVYWVTEKRAVPTAFRLFTG  186

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S++  LSR F++  I+G +N PRT+LMY +N  SS   YF TV+CNS +F  T +NH+L 
Sbjct  187   SAWIALSRAFMEHTIMGWDNLPRTVLMYYANFVSSPEGYFHTVICNSEEFRNTTVNHDLH  246

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             +++ ++  ++    L  + F  M  SGA FA  F + DP+L++ID+E+L+R+     PGG
Sbjct  247   FIAWDTPPKQHPISLTVNFFEAMTTSGAPFARKFDKDDPVLNKIDAELLNRTRDGFSPGG  306

Query  794   WCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC+G+  +  C+V GD  VLRPG GA+RLE   ++L    RF+S QC
Sbjct  307   WCVGS-HNNPCSVRGDYSVLRPGPGARRLEDLIVQLLLPERFRSSQC  352



>ref|XP_009335809.1| PREDICTED: xylosyltransferase 1 [Pyrus x bretschneideri]
Length=428

 Score =   352 bits (904),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 241/346 (70%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
              AY+ISGS GD   + R L A+YHP NHY++HLD  +P  +R  L   V+T P+F    N
Sbjct  82    FAYFISGSNGDGNMLKRTLQALYHPHNHYVVHLDLESPPDERMDLQNYVSTHPVFVKFGN  141

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+ V  +G + +++TLH A++LLR   +WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  142   VKMISKANLVTYRGPTMVANTLHAAAVLLREGGDWDWFINLSASDYPLVTQDDLLHTFSY  201

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+E Q+ KPIIVDPGLY+ + +DVF+ TQ+R +P +F++F GS++
Sbjct  202   LPRDLNFIDHTSNIGWKEYQRAKPIIVDPGLYMTKKTDVFWVTQRRSVPTAFKLFTGSAW  261

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
               LS+ F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F+ T +N +L +++
Sbjct  262   MALSKPFVDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFHNTTVNSDLHFIT  321

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    LN +D   M+ S A FA  F++ DP+LD+IDSE+L + PG  VPGGWC+
Sbjct  322   WDNPPKQHPHHLNLADMQRMVDSNAPFARKFRQDDPVLDKIDSELLFKGPGMLVPGGWCI  381

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  ++G   C+  G+  VL P  GAKRLE     L +  +F+S QC
Sbjct  382   GKRDNGSDPCSDIGNTTVLMPTPGAKRLEVLISSLLSNEKFRSNQC  427



>ref|XP_009402140.1| PREDICTED: xylosyltransferase 1-like [Musa acuminata subsp. malaccensis]
Length=447

 Score =   353 bits (905),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/356 (46%), Positives = 240/356 (67%), Gaps = 4/356 (1%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             LS+  PRPP +AY ISG+ GD   + R+L A+YHP N Y++HLD  AP  +R+ +   + 
Sbjct  91    LSTASPRPPRLAYLISGTVGDGNMLKRVLLALYHPANRYVVHLDLEAPVEEREDVRDYIA  150

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
                LF A  NV ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVT
Sbjct  151   RHSLFTAVGNVRMITKANLVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVT  210

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLLH  S LP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + SDVF+  Q+R +P 
Sbjct  211   QDDLLHTFSNLPRDLNFIDHTSDIGWKEFQRAKPVIIDPGLYMTKKSDVFWIPQRRSVPT  270

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             +F++F GS++  LSR F+D+CI G +N PR +LMY +N  SS   YF TV+CN+++F+ T
Sbjct  271   AFKLFTGSAWMALSRSFIDYCIWGWDNLPRAVLMYYANFISSPEGYFHTVICNAQEFHNT  330

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +NH+L ++S ++  ++    L   D   M+   A FA  F   DP+LD+ID+E+L R P
Sbjct  331   TVNHDLHFISWDNPPKQHPHYLTMDDMSRMVEGNAPFARKFHRDDPVLDKIDAELLFRGP  390

Query  815   GKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
                VPGGWC G+ ++G   C V G+  +LRPG GA ++E+  + L +  +F   QC
Sbjct  391   NMIVPGGWCAGSRKNGSDPCLVVGNTTILRPGPGAIKIERLMLSLLSDEKFHLSQC  446



>ref|XP_010492328.1| PREDICTED: xylosyltransferase 1-like [Camelina sativa]
Length=442

 Score =   352 bits (904),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 240/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS+GD   + R L A+YHP N Y++HLDR +  ++R  L+  V    LFR   N
Sbjct  96    LAYLISGSSGDGQMLKRTLLALYHPNNQYVVHLDRESSPAERLDLSCFVANQTLFRRFSN  155

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+FV  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  156   VRMIVKANFVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLLHTFSY  215

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ES + KPII+DPGLY+++ SDVF+ +Q+R +P +F++F GS++
Sbjct  216   LPRDLNFIDHTSNIGWKESHRAKPIIIDPGLYMSKKSDVFWVSQKRSMPTAFKLFTGSAW  275

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+R+F  T +N +L ++S
Sbjct  276   MMLSRPFVDYFIWGWDNLPRIVLMYYANFLSSPEGYFHTVICNAREFTNTTVNGDLHFIS  335

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L   DF  M+ S A FA  F+  +P+LD+IDSE+L RS G   PGGWC+
Sbjct  336   WDNPPKQHPHHLTLDDFQRMVDSNAPFARKFRRDEPVLDKIDSELLSRSHGMVTPGGWCI  395

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  E+G   C   GD  V++PG+GAKR+EK    L +   F+ +QC
Sbjct  396   GTRENGSDPCTEIGDTSVIKPGLGAKRVEKLITYLLSTENFRPRQC  441



>ref|XP_006480797.1| PREDICTED: xylosyltransferase 2-like [Citrus sinensis]
Length=411

 Score =   351 bits (901),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 239/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P +AY ISG+ GD  R+ R+L AVYHP N+Y+LHLD  A   +R  LA  V +  + 
Sbjct  60    PALPRLAYLISGTKGDGARVKRVLQAVYHPMNYYVLHLDLEASDGERLELAKYVKSEKVI  119

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  +NV V+G AD V  KG + +++TLH  +ILL+ + +WDWFINLS++DYPL++QDD+L
Sbjct  120   RDFKNVMVIGKADLVTYKGPTMIAATLHAVAILLKQAKDWDWFINLSASDYPLMSQDDIL  179

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLPK LNF+ HTS IGW+E Q+ +PII+DPGLY  + S VF+A ++R +P SF++F
Sbjct  180   HIFSYLPKYLNFLEHTSSIGWKEYQRARPIIIDPGLYHPKKSGVFWAKEKRSMPASFKLF  239

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L+R FL+FCI G +N PRTLLMY +N  SS   YF +V+CN + +  T +NH+
Sbjct  240   MGSAWVVLTRSFLEFCIWGWDNLPRTLLMYYTNFLSSPEGYFHSVICNHKDYQNTTVNHD  299

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  +S  ++    L    F  M++SGA FA  F + DP+L++ID ++L RS  +  P
Sbjct  300   LHYIRWDSPPKQHPMTLTLKHFDGMVQSGAPFARKFAKDDPVLNKIDEKLLKRSNNRFTP  359

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+GN   G+  C V+G+   ++P V +K LEK  ++L     F+S+QC
Sbjct  360   GGWCVGNSAFGKDPCLVYGNPYAIKPSVNSKTLEKLIVKLLDPEIFRSKQC  410



>ref|XP_006602896.1| PREDICTED: xylosyltransferase 1-like [Glycine max]
Length=435

 Score =   352 bits (902),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 239/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1676  AYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNV  1497
             AY ISGS+ D+  I+R L A+YHPRN Y+LHLDR +   DR LL   V+    F+  RNV
Sbjct  90    AYLISGSSADASAILRTLSALYHPRNRYVLHLDRDSSPEDRRLLTHQVDRHLTFQKFRNV  149

Query  1496  HVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYL  1317
              V+  A+ V  +G + +++TLH A+I L  S +WDWFINLS++DYPLVTQDDLLH  S+L
Sbjct  150   RVVTKANLVTYRGPTMVANTLHAAAIALTESDDWDWFINLSASDYPLVTQDDLLHAFSHL  209

Query  1316  PKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYS  1137
             P+DLNF++HTS IGW++ Q+ +PII+DPGLY+ +  DVF+ TQ+R  P +F++F GS++ 
Sbjct  210   PRDLNFIDHTSDIGWKDHQRARPIIIDPGLYMTKKQDVFWITQRRSRPTAFKLFTGSAWM  269

Query  1136  ILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSL  957
             +LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +L +++ 
Sbjct  270   VLSRSFIDYCIWGWDNLPRTVLMYYTNFISSPEGYFHTVVCNAQEFKNTTVNSDLHFIAW  329

Query  956   NS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLG  783
             ++  R+    L+  D   M+ S A FA  F   DP+LD+ID+E+L R PG  VPGGWC+G
Sbjct  330   DNPPRQHPHYLSLDDMKRMVDSNAPFARKFHGDDPVLDKIDAELLSRGPGMVVPGGWCIG  389

Query  782   NGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             +  +G   C+V G+  VLRPG G+KRLE     L +   F+ +QC+
Sbjct  390   SRLNGSDPCSVVGNTTVLRPGPGSKRLETLIKSLLSDENFRPKQCV  435



>ref|XP_010670346.1| PREDICTED: xylosyltransferase 1-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   352 bits (903),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 235/351 (67%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY +SGS+GD   + R L ++YHP N Y++HLD  A   +R  L   V   P+F
Sbjct  96    PTPPRFAYLVSGSSGDGVSLKRTLLSLYHPHNQYVVHLDLEASPQERGELESFVKNHPVF  155

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +   NV ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLL
Sbjct  156   KEFNNVRMITKANLVTYRGPTMVANTLHAAAILLREGGHWDWFINLSASDYPLVTQDDLL  215

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  S LP+DLNF++HTS IGW+E Q+ KP+I+DPGLY  + +DVF+ TQ+R +P +F++F
Sbjct  216   HAFSRLPRDLNFIDHTSNIGWKEFQRAKPVIIDPGLYQTKKADVFWVTQRRSVPTAFKLF  275

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T ++ +
Sbjct  276   TGSAWMALSRPFVDYCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQEFRNTTVSTD  335

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L   D   M++S A FA  F   DP+LD++DSE+L R PG  VP
Sbjct  336   LHFISWDNPPKQHPHYLTIEDMTRMVQSNAPFARKFHREDPVLDKVDSELLSRGPGMIVP  395

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC G+GE+G   C V G+   LRP  GAKR+E     L +  +F+  QC
Sbjct  396   GGWCTGSGENGTDPCLVAGNTTFLRPTSGAKRVETLLSSLLSAEKFRHNQC  446



>ref|XP_002305329.1| hypothetical protein POPTR_0004s13530g [Populus trichocarpa]
 gb|EEE85840.1| hypothetical protein POPTR_0004s13530g [Populus trichocarpa]
Length=428

 Score =   351 bits (900),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 239/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD+  + R L A+YHP N Y++HLDR +   +R  L+  V   P+F
Sbjct  77    PPPPRFAYVISGSAGDANMLKRTLQALYHPNNQYVVHLDRESSTQERLDLSNFVKHHPVF  136

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLL
Sbjct  137   LRFGNVRMISKANLVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLL  196

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ + +DVF+ TQ+R +P +F++F
Sbjct  197   HTFSYLPRDLNFIDHTSDIGWKEFQRAKPIIIDPGLYMTKKADVFWITQRRSVPTAFKLF  256

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+ I G +N PRT+LMY +N  SS   YF TV+CNS QF  T +N +
Sbjct  257   TGSAWMALSRPFIDYTIWGWDNIPRTVLMYYANFISSPEGYFHTVICNSPQFLNTTVNSD  316

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    LN +D   MI S A FA  F   DP+LD+IDSE+L R PG   P
Sbjct  317   LHFISWDNPPKQHPHHLNLADMQRMIESNAPFARKFPHEDPVLDKIDSELLSRGPGMFTP  376

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   C+  G+  VLRPG GAKRL+     L +   FQ +QC
Sbjct  377   GGWCIGSRENGTDPCSAIGNTTVLRPGPGAKRLQSLISSLLSNENFQPRQC  427



>ref|XP_006307501.1| hypothetical protein CARUB_v10009126mg [Capsella rubella]
 gb|EOA40399.1| hypothetical protein CARUB_v10009126mg [Capsella rubella]
Length=448

 Score =   351 bits (901),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/351 (48%), Positives = 245/351 (70%), Gaps = 6/351 (2%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R  LA+SV   P F
Sbjct  99    PEPPRLAYLISGTKGDSHRMMRTLQAVYHPRNQYVLHLDLEAPPRERTELAMSVKNDPTF  158

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NV VM  ++ V  KG + ++ TL   +ILLR S +WDWF+NLS++DYPLVTQDDLL
Sbjct  159   REMENVRVMAQSNLVTYKGPTMIACTLQAVAILLRESLHWDWFLNLSASDYPLVTQDDLL  218

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             ++ S L +++NF+ +    GW+ +Q+ K IIVDPGLYL++ SD+ + TQ+RPLP +F++F
Sbjct  219   YVFSNLSRNVNFIENMQLTGWKLNQRAKSIIVDPGLYLSKKSDIAWTTQRRPLPTAFKLF  278

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L+R FL++CI G +NFPRT+LMY +N  SS   YF TV+CNS++F  T I H+
Sbjct  279   TGSAWIMLTRSFLEYCIWGWDNFPRTILMYYTNFVSSPEGYFHTVICNSKEFVNTAIGHD  338

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y++ ++  ++  R L+  DF +M++S A FA  F + DP LD+ID E+L R+  +  P
Sbjct  339   LHYIAWDNPPKQHPRSLSLKDFDNMVKSKAPFARKFPKNDPTLDKIDKELLGRT-HRFAP  397

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+  +G   C++ GD  VL+PG G++RL++  ++  +   F+ +QC
Sbjct  398   GGWCVGSSANGNDPCSLQGDDSVLKPGPGSERLQE-LVQTLSSDEFRRKQC  447



>ref|XP_004297352.1| PREDICTED: xylosyltransferase 1-like [Fragaria vesca subsp. vesca]
Length=397

 Score =   349 bits (896),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 165/349 (47%), Positives = 233/349 (67%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYI G  GD  RI RLL AVYHPRN YLLHL     + +R  LA +V  VP  R+
Sbjct  48    PPAFAYYIYGGRGDRARIFRLLLAVYHPRNRYLLHLTAEESEEERRRLASAVKAVPAVRS  107

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G AD +   GSS++++TL  A+ILL++   WDWF+ LS+ DYPLVTQDDL H+
Sbjct  108   FGNVDVVGKADRITYMGSSNLATTLRAAAILLKVDEGWDWFVTLSAVDYPLVTQDDLSHV  167

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HTS +GW+E  +++PIIVDPG+YLA  S +F+AT++R  PD+F++F G
Sbjct  168   FSSVRRDLNFIDHTSDLGWKELHRIQPIIVDPGIYLARRSQIFHATEKRKTPDAFKIFTG  227

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + +LSR FL+FCILG +N PRT+LMY +N   S+  YF +V+CNS +F  T +N +L+
Sbjct  228   SPWFVLSRSFLEFCILGWDNLPRTMLMYFTNVILSEEGYFHSVICNSPEFKNTTVNSDLR  287

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN+S +  M++SGAAF   F++ D +LD +D +IL R   +  PG 
Sbjct  288   YMIWDTPPKMEPHFLNTSVYDQMVQSGAAFGRQFQKDDAVLDMVDEKILKRGKNRAAPGA  347

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C+ WGDA++++PG  AK+ E+    L      QS QC
Sbjct  348   WCSGWNSWWMDPCSQWGDANIMKPGPQAKKFEESITNLLDDWSSQSNQC  396



>ref|XP_011010552.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica]
Length=428

 Score =   350 bits (899),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 240/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP  AY ISGSAGD+  + R L A+YHP N Y++HLDR +   +R  L+  V   P+F
Sbjct  77    PPPPRFAYVISGSAGDANMLKRTLQALYHPNNQYVVHLDRESSTQERLDLSNFVKHHPVF  136

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV ++  A+ V  +G + +++TLH A+ILLR    WDWFINLS++DYPLVTQDDLL
Sbjct  137   LRFGNVRMISKANLVTYRGPTMVANTLHAAAILLREGGAWDWFINLSASDYPLVTQDDLL  196

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ + +DVF+ TQ+R +P +F++F
Sbjct  197   HTFSYLPRDLNFIDHTSDIGWKEFQRAKPIIIDPGLYMTKKADVFWITQRRSVPTAFKLF  256

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+ I G +N PRT+LMY +N  SS   YF TV+CNS QF  T +N +
Sbjct  257   TGSAWMALSRPFIDYTIWGWDNIPRTVLMYYANFISSPEGYFHTVICNSPQFLNTTVNSD  316

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    LN +D   MI S A FA  F + DP+LD+IDSE+L R PG   P
Sbjct  317   LHFISWDNPPKQHPHHLNLADMQRMIDSNAPFARKFPQDDPVLDKIDSELLSRGPGMFTP  376

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G+ E+G   C+V G+  VLRPG GAKRL+     L +   FQ +QC
Sbjct  377   GGWCIGSRENGTDPCSVIGNTTVLRPGPGAKRLQSLISSLLSNENFQPRQC  427



>ref|XP_010253215.1| PREDICTED: xylosyltransferase 2 [Nelumbo nucifera]
Length=420

 Score =   350 bits (898),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 236/351 (67%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             PR P  AY ISG+ GD  ++ R+L AVYHPRN+YLLHLD  A  ++R  LA    +  + 
Sbjct  69    PRLPRFAYLISGTKGDGQQLRRVLQAVYHPRNYYLLHLDVEASPAERLELAKFAKSDRVL  128

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NV V+G A+ V  KG + ++ TLH  +ILL+ +  WDWFINLS++DYPL++QDDL 
Sbjct  129   REFNNVLVVGKANMVTYKGPTMIACTLHAIAILLKQAKEWDWFINLSASDYPLISQDDLF  188

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H+ SYLP+DLNF+ HTS IGW+E Q+ +PII+DPGLY ++ S VF+A ++R +P SF++F
Sbjct  189   HVFSYLPRDLNFLEHTSNIGWKEHQRARPIIIDPGLYHSKKSGVFWAKEKRSMPASFKLF  248

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +L+R FL+FC+ G +N PRTLLMY +N  SS   YF TV+CNS+ +  T +NH+
Sbjct  249   MGSEWMVLTRSFLEFCVWGWDNLPRTLLMYYTNFLSSPEGYFHTVICNSKDYQNTTVNHD  308

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  ++  ++    L    F  M++SGA FA  F + DP+LD+ID E+L R  G+  P
Sbjct  309   LHYIKWDNPPKQHPITLTLEHFNAMVQSGAPFARKFNKDDPVLDRIDHELLGRLEGRFTP  368

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G    G+  C V+ +   +RP + +KRLEK  ++L     F+ +QC
Sbjct  369   GGWCMGTSLMGKDPCTVFVNPLAIRPSISSKRLEKLLVQLLDSENFRPKQC  419



>ref|XP_010550094.1| PREDICTED: xylosyltransferase 1 [Tarenaya hassleriana]
Length=432

 Score =   350 bits (899),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 241/355 (68%), Gaps = 4/355 (1%)
 Frame = -2

Query  1706  SSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNT  1527
             +S  P+PP  AY +SGSAGD   + R L A+YHP N Y++HLDR +   +R  L+  V  
Sbjct  77    ASALPQPPRFAYLVSGSAGDGEMLKRTLMALYHPNNQYVVHLDRESSPEERLDLSKFVAG  136

Query  1526  VPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQ  1347
               LFR  +NV ++  A+ V  +G + +++TLH A+ILLR    WDWFINLS++DYPLVTQ
Sbjct  137   NTLFRKFQNVRMIVKANLVTYRGPTMVANTLHAAAILLREGGEWDWFINLSASDYPLVTQ  196

Query  1346  DDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDS  1167
             DDLLH  SYLP+DLNF++HTS IGW+E  + KPII+DPGLY+++ +DVF+ TQ+R +P +
Sbjct  197   DDLLHTFSYLPRDLNFIDHTSNIGWKEYHRAKPIIIDPGLYMSKKADVFWVTQRRSVPTA  256

Query  1166  FRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTI  987
             F+++ GS++ +LSR F+D+ I G +N PRT LMY SN  SS   YF TV+CN+ +F  T 
Sbjct  257   FKLYTGSAWMVLSRPFVDYFIWGWDNLPRTALMYYSNFLSSPEGYFHTVICNALEFRNTT  316

Query  986   INHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPG  813
             +N +L ++S ++  ++    L   DF  M+ S A FA  F+  + +LD+IDSE+L R  G
Sbjct  317   VNSDLHFISWDNPPKQHPHHLTLLDFDRMVDSNAPFARKFRRDEAVLDKIDSELLLRRHG  376

Query  812   KPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             +  PGGWC+G  ++G   C+V GD  VLRPG GAKRLE     L +   F+S+QC
Sbjct  377   RVTPGGWCVGPRDNGSDPCSVTGDTSVLRPGAGAKRLENLISHLLSTENFRSRQC  431



>ref|XP_009768779.1| PREDICTED: xylosyltransferase 1-like [Nicotiana sylvestris]
Length=420

 Score =   350 bits (897),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 239/356 (67%), Gaps = 7/356 (2%)
 Frame = -2

Query  1706  SSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNT  1527
             +SPPPR    AY ISGSAGD G + R L A+YHP NHY++HLD  +   +R  L   V  
Sbjct  68    ASPPPR---FAYLISGSAGDGGMLKRTLQALYHPNNHYVVHLDAESSAEERLDLHNFVFN  124

Query  1526  VPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQ  1347
               +F    NV ++  A+ V  +G + +++TLH A+ILL+    WDWFINLS++DYPLVTQ
Sbjct  125   HKIFAKFTNVKMISKANLVTYRGPTMVANTLHAAAILLKEGGEWDWFINLSASDYPLVTQ  184

Query  1346  DDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDS  1167
             DDL+H  S++P+DLNF++HTS IGW+E Q+ KPIIVDPGLYL + SDVF+  Q+R +P +
Sbjct  185   DDLIHTFSHIPRDLNFIDHTSDIGWKEFQREKPIIVDPGLYLNKKSDVFWIRQRRSVPTA  244

Query  1166  FRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTI  987
             F++F GS+++ LSR F+DFCI G +N PRT+LMY +N  S+   YF TV+CN+++F  T 
Sbjct  245   FKLFTGSAWTALSRPFIDFCIWGWDNLPRTVLMYYANFISTPEGYFHTVICNAQEFCNTT  304

Query  986   INHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPG  813
             +N +L Y+S ++  ++    L   D   M+ S A FA  F + DP+LD IDSE+L R   
Sbjct  305   VNSDLHYISWDNPPKQHPHYLTLDDMQRMVDSNAPFARKFHQDDPVLDNIDSELLFRGQD  364

Query  812   KPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
               VPGGWC+GN E+G   C+V G+   LRP  GA+RLE     L +   F+S+QCI
Sbjct  365   MFVPGGWCIGNRENGTDPCSVVGNITFLRPTAGARRLENLIGSLLSNDNFRSRQCI  420



>ref|XP_009628555.1| PREDICTED: xylosyltransferase 2 [Nicotiana tomentosiformis]
Length=414

 Score =   349 bits (896),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 236/351 (67%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P +AY ISG+  D  RI RLL AVYHPRN+YLLHLD  A  S+R  LA  V +  + 
Sbjct  63    PELPRLAYLISGTKNDVVRIKRLLQAVYHPRNYYLLHLDLEASDSERLELAKYVKSEVVM  122

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NV V+G +D V  KG + ++STLH  +ILL++  NWDWFINLS++DYPL+TQDD+L
Sbjct  123   REFGNVKVVGKSDLVTYKGPTMLASTLHAIAILLKLPKNWDWFINLSASDYPLLTQDDIL  182

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ H+S IG++E  + +PII+DPGLY  + S VF+A ++R +P SF+VF
Sbjct  183   HIFSYLPRDLNFLEHSSNIGYKEFSRARPIIIDPGLYHMKKSGVFWAKEKRSMPASFKVF  242

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +LSR FL+FCI G +N PRTLLMY +N   S   YF T++CN + +  T +NH+
Sbjct  243   MGSEWVMLSRSFLEFCIWGWDNLPRTLLMYYTNFLYSLEGYFHTIVCNHKDYQNTTVNHD  302

Query  974   LQYVSLNSRKEARVLNSS--DFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  ++  +   +N +   F DM++SG  FA  F   DP+LD+ID +IL RS G+  P
Sbjct  303   LHYIKWDNPPKQYPINLTLEHFEDMVQSGVPFARTFATDDPVLDKIDKDILRRSHGRFSP  362

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G WC+G+   G+  C V G  D ++P  G++ LEK  ++L     F+S+QC
Sbjct  363   GAWCMGSSALGKDPCIVNGSPDAVKPSAGSRSLEKLVLKLLDTENFRSRQC  413



>ref|XP_010457360.1| PREDICTED: xylosyltransferase 1-like [Camelina sativa]
Length=450

 Score =   350 bits (899),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 250/368 (68%), Gaps = 12/368 (3%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAP  1566
             P+ PH V         PP PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP
Sbjct  90    PATPHVV------QPEPPTPPRLAYLISGTKGDSHRMMRTLQAVYHPRNQYVLHLDLEAP  143

Query  1565  KSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWF  1386
               +R  L++SV   P FR   NV VM  ++ V  KG + ++STL   +ILLR S +WDWF
Sbjct  144   PRERMDLSMSVKNDPTFRELDNVRVMAQSNLVTYKGPTMIASTLQAVAILLRESLHWDWF  203

Query  1385  INLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD  1206
             +NLS++DYPLVTQDDLLH+ S L +++NF+ +T   GW+ +Q+ K IIVDPGLYL++ SD
Sbjct  204   LNLSASDYPLVTQDDLLHVFSNLSRNVNFIENTQLTGWKLNQRAKSIIVDPGLYLSKKSD  263

Query  1205  VFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFP  1026
             + + TQ+R LP SF++F GS++ +L+R FL++CI G +NFPRT+LMY +N  SS   YF 
Sbjct  264   IAWTTQRRSLPTSFKLFTGSAWIMLTRSFLEYCIWGWDNFPRTILMYYTNFVSSPEGYFH  323

Query  1025  TVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPIL  852
             TV+CNS++F  T I H+L Y++ ++  ++  R L+  DF +M++S A FA  F + DP L
Sbjct  324   TVICNSKEFVNTAIGHDLHYIAWDNPPKQHPRSLSLKDFDNMVKSKAPFARKFHKNDPTL  383

Query  851   DQIDSEILHRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAG  678
             D+ID E+L R+  +  PGGWC+G+  +    C+V GD  VL PG G++RL++  ++  + 
Sbjct  384   DKIDRELLGRT-HRFAPGGWCVGSSANNNDPCSVQGDDSVLNPGPGSERLQE-LVQTLSS  441

Query  677   GRFQSQQC  654
               ++ +QC
Sbjct  442   DEYRRKQC  449



>ref|XP_008808722.1| PREDICTED: xylosyltransferase 1-like [Phoenix dactylifera]
Length=441

 Score =   350 bits (898),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 165/346 (48%), Positives = 236/346 (68%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY +SGS GD   + R L A+YHP N Y++HLD  AP  +R  L   +   P+F A  N
Sbjct  95    LAYLVSGSVGDGNSLKRTLLALYHPTNRYVVHLDLEAPLDERQDLHDFIARHPVFSAVGN  154

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+ V  +G + +++TLH A++LLR   +WDWFINLS+ DYPLVTQDDLLH  SY
Sbjct  155   VKMITKANLVTYRGPTMVANTLHAAAVLLREGGDWDWFINLSATDYPLVTQDDLLHTFSY  214

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+E  + KPII+DPGLY+ + +DVF+  Q+R +P +F++F GS++
Sbjct  215   LPRDLNFIDHTSNIGWKEFHRAKPIIIDPGLYMLKKADVFWIPQRRSVPTAFKLFTGSAW  274

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
               LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +NH+L ++S
Sbjct  275   MALSRSFIDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFRNTTVNHDLHFIS  334

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L       MI S A FA  F + DP+LD+ID+++L R PG  VPGGWC+
Sbjct  335   WDNPPKQHPHYLTMKHMKGMIDSNAPFARKFPKGDPVLDKIDADLLSRGPGMLVPGGWCV  394

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G+ E+G   C V G+  +LRPG GA RLE   + L +  +F+S+QC
Sbjct  395   GSRENGSDPCLVVGNTTILRPGPGAVRLEHLMVSLLSEEKFRSRQC  440



>ref|XP_006287781.1| hypothetical protein CARUB_v10000991mg [Capsella rubella]
 gb|EOA20679.1| hypothetical protein CARUB_v10000991mg [Capsella rubella]
Length=436

 Score =   350 bits (897),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 241/346 (70%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS+GD   + R L A+YHP N Y++HLDR +  ++R  L+  V    LF+  +N
Sbjct  89    LAYLISGSSGDGQMLKRTLMALYHPNNQYVVHLDRESSPAERLDLSGFVANQTLFQRFQN  148

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+FV  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  149   VRMIVKANFVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLLHTFSY  208

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ES + KPII+DPGLY+++ +DVF+ +Q+R +P +F++F GS++
Sbjct  209   LPRDLNFIDHTSNIGWKESHRAKPIIIDPGLYMSKKADVFWVSQKRSMPTAFKLFTGSAW  268

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F+D+ I G +N PR +LMY SN  SS   YF TV+CN+R+F  T +N +L ++S
Sbjct  269   MMLSRPFVDYFIWGWDNLPRIMLMYYSNFLSSPEGYFHTVICNAREFTNTTVNSDLHFIS  328

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L   DF  M+ S A FA  F+  +P+LD+IDSE+L RS G   PGGWC+
Sbjct  329   WDNPPKQHPHHLTLDDFQRMVDSNAPFARKFRRDEPVLDKIDSELLSRSHGMVTPGGWCI  388

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G   +G   CA  GD  V++PG+GAKR+EK    L +   F+ +QC
Sbjct  389   GTRVNGSDPCAEIGDTSVIKPGLGAKRVEKLVTYLLSTENFRPRQC  434



>ref|XP_003536629.1| PREDICTED: xylosyltransferase 1-like [Glycine max]
Length=396

 Score =   348 bits (893),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 229/349 (66%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AY+ISG   D  RI+RLL AVYHPRN YLLHL R A   +R  LA +V  VP+ RA
Sbjct  47    PPAFAYFISGGNQDKDRILRLLLAVYHPRNRYLLHLGRDARDEERQALAAAVRAVPVIRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G AD+V   GSS+++  L  A+I+L++ S W+WFI LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKADYVTYLGSSNVAIILRAAAIMLKLDSGWNWFITLSARDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HT  +GW+ES + +PI+VDPGLYLA  S +F ATQ+RP PD+F++F G
Sbjct  167   FSSVRRDLNFIDHTGDLGWKESDRFQPIVVDPGLYLARKSQIFQATQKRPTPDAFKLFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCI G +N PRTLLMY +N   S   YF +V+CN+ +F  T +N +L+
Sbjct  227   SPWLILSRPFLEFCIFGWDNLPRTLLMYFTNVKLSQEGYFHSVVCNAPEFKNTTVNGDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN+S +  M  SGAAFA  F+  +P+LD ID  IL R   +  PG 
Sbjct  287   YMIWDNPPKMEPHFLNASVYNQMAESGAAFARQFQLNNPVLDMIDERILQRGRHRVTPGA  346

Query  794   WCLGNGE--SGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C+ WGD + ++PG  AK+LE     L      Q+ QC
Sbjct  347   WCTGRRSWWVDPCSQWGDVNTVKPGPRAKKLEGSVSNLLDDWNSQTNQC  395



>ref|XP_009419944.1| PREDICTED: xylosyltransferase 1-like [Musa acuminata subsp. malaccensis]
Length=409

 Score =   348 bits (894),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 231/353 (65%), Gaps = 4/353 (1%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             PP+PP +AY ISG+ GD  R+ RLL A YHP N YLLHLDR+AP  +R  LA    +   
Sbjct  57    PPKPPRLAYLISGTQGDGRRLKRLLQAAYHPWNFYLLHLDRTAPPEERADLATYAASEAT  116

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
             F    NV ++ +AD V  KG + ++ TLH  +ILLR   +W WFINLS+ADYPL+ QDD+
Sbjct  117   FVQFGNVRMVEDADPVSQKGPTMIACTLHAVAILLREFEDWSWFINLSAADYPLMPQDDI  176

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LH+ SYLP+D NF+ HTS IGWRE ++ +PIIVDPG Y    +D+F+A ++R +P +F++
Sbjct  177   LHVFSYLPRDFNFIKHTSDIGWREYERARPIIVDPGFYKPSRTDIFWAKEKRSMPSAFKI  236

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GSS+ IL+R FL+FCI G +N PRTLLMY +N  SS   YF TV+CNS+ F  T IN 
Sbjct  237   FAGSSWVILARPFLEFCIWGWDNLPRTLLMYYTNFLSSSESYFHTVICNSQDFQNTTIND  296

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L+++  +   R     L S  F  M  SGA FA  F   DP+LD+ID E+L RS G+  
Sbjct  297   DLRFMMWDDPPRLHPMNLTSEHFNLMAESGAPFAHSFSREDPVLDRIDDELLQRSAGRFT  356

Query  803   PGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             PG WCL N E G   C+V G   V++P V ++RLE   ++L     F+ +QCI
Sbjct  357   PGKWCLANPEFGTDPCSVRGRPSVIQPTVNSRRLEMLLVKLLDPDDFRPRQCI  409



>ref|XP_010453634.1| PREDICTED: xylosyltransferase 1-like isoform X1 [Camelina sativa]
 ref|XP_010453635.1| PREDICTED: xylosyltransferase 1-like isoform X2 [Camelina sativa]
Length=435

 Score =   349 bits (896),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/346 (48%), Positives = 240/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS+GD   + R L A+YHP N Y++HLDR +  ++R  L+  V    LFR   N
Sbjct  89    LAYLISGSSGDGQMLKRTLMALYHPNNQYVVHLDRESSPAERLDLSGFVANQTLFRRFSN  148

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+FV  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  149   VRMIVKANFVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLLHTFSY  208

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ES + KPII+DPGLY+++ +DVF+ +Q+R +P +F++F GS++
Sbjct  209   LPRDLNFIDHTSNIGWKESHRAKPIIIDPGLYMSKKADVFWVSQKRSMPTAFKLFTGSAW  268

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+R+F  T +N +L ++S
Sbjct  269   MMLSRPFVDYFIWGWDNLPRIVLMYYANFLSSPEGYFHTVICNAREFTNTTVNGDLHFIS  328

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L   DF  M+ S A FA  F+  +P+LD+IDS++L RS G   PGGWC+
Sbjct  329   WDNPPKQHPHHLTLDDFQRMVDSNAPFARKFRRDEPVLDKIDSQLLSRSHGMVTPGGWCI  388

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  E+G   C   GD  V++PG+GAKR+EK    L +   F+ +QC
Sbjct  389   GTRENGSDPCTEIGDTSVIKPGLGAKRVEKLITYLLSTENFRPRQC  434



>ref|XP_011098560.1| PREDICTED: xylosyltransferase 1-like [Sesamum indicum]
Length=434

 Score =   349 bits (895),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 234/351 (67%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISGSAGD   + R L A+YHP N Y++HLD  +   +R  L   V T   F
Sbjct  83    PPPPRLAYLISGSAGDGAMLRRTLEALYHPNNQYVVHLDAESSAEERLDLYNYVTTHITF  142

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R  +NV ++  A+ V  +G + +++TLH A+ILL+    WDWFINLS++DYPLVTQDDLL
Sbjct  143   RRFKNVRMITRANLVTYRGPTMVANTLHAAAILLKEGGEWDWFINLSASDYPLVTQDDLL  202

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ + SDVF+ TQ+R +P +F++F
Sbjct  203   HTFSYLPRDLNFIDHTSNIGWKEFQRAKPIIIDPGLYMTKKSDVFWITQRRSVPTAFKLF  262

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++  LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +
Sbjct  263   TGSAWMALSRPFVDYCIWGWDNLPRTVLMYYANFISSPEGYFHTVVCNAQEFRNTTVNSD  322

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L   D   M+ S A FA  F   DP+LD+ID E+L R     VP
Sbjct  323   LHFISWDNPPKQHPHYLTLDDMQRMVDSNAPFARKFHHNDPVLDKIDEELLFRGKDMLVP  382

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+G  E+G   C+V G+  VLRP  GAKRLE     L +   F+ +QC
Sbjct  383   GGWCIGGRENGTDPCSVVGNTTVLRPTAGAKRLENLVTFLLSDDNFRPRQC  433



>ref|XP_006593666.1| PREDICTED: xylosyltransferase 1-like isoform X2 [Glycine max]
Length=427

 Score =   348 bits (894),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 236/352 (67%), Gaps = 6/352 (2%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY +SGS GD   + R+L A+YHP N Y++HLD  +   +R  L   V    LF
Sbjct  78    PPPPRLAYLVSGSKGDGAAVTRVLLALYHPNNRYVVHLDLESSAEERSDLVRFVEGHALF  137

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             +   NV V+  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPLVTQDDLL
Sbjct  138   KRFGNVRVIKKANLVTYRGPTMVANTLHAAAILLRELGDWDWFINLSASDYPLVTQDDLL  197

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW++  + +PIIVDPGLY+ +  DVF+ TQ+R  P +F++F
Sbjct  198   HTFSYLPRDLNFIDHTSDIGWKDHHRARPIIVDPGLYMNKKQDVFWVTQRRSRPTAFKLF  257

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
               +++  LS+ F+D+CI G +N PRT+LMY SN  SS   YF TV+CN+++F  T +N +
Sbjct  258   --TAWMALSKSFIDYCIWGWDNLPRTVLMYYSNFISSPEGYFHTVICNAQEFRNTTVNSD  315

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L   D   M+ S A FA  F   DP+LD+ID+E+L R PG  VP
Sbjct  316   LHFISWDNPPKQHPHYLTVDDMKGMVGSNAPFARKFHREDPVLDKIDAELLSRGPGMAVP  375

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             GGWC+G  E+G   C+  GD +VLRPG G+KRLE     L +  +F+ +QC+
Sbjct  376   GGWCIGKRENGTDPCSEVGDPNVLRPGQGSKRLETLISSLLSNEKFRPRQCV  427



>ref|XP_010474977.1| PREDICTED: xylosyltransferase 1-like [Camelina sativa]
Length=446

 Score =   349 bits (895),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 245/352 (70%), Gaps = 6/352 (2%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             P  PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R  LA+SV   P 
Sbjct  96    PHTPPRLAYLISGTKGDSHRMMRTLQAVYHPRNQYVLHLDLEAPPRERMDLAMSVKNDPT  155

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
             FR   NV VM  ++ V  KG + ++STL   +ILLR S +WDWF+NLS++DYPLVTQDDL
Sbjct  156   FRELDNVRVMAQSNLVTYKGPTMIASTLQAVAILLRESLHWDWFLNLSASDYPLVTQDDL  215

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LH+ S L +++NF+ +    GW+ +Q+ K IIVDPGLYL++ SD+ + TQ+R LP SF++
Sbjct  216   LHVFSNLSRNVNFIENMQLTGWKLNQRAKSIIVDPGLYLSKKSDIAWTTQRRSLPTSFKL  275

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS++ +L+R FL++CI G +NFPRT+LMY +N  SS   YF TV+CNS++F  T I H
Sbjct  276   FTGSAWIMLTRSFLEYCIWGWDNFPRTILMYYTNFISSPEGYFHTVICNSKEFVNTAIGH  335

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L Y++ +S  ++  R L+  DF +M++S A FA  F + DP LD+ID E+L R+  +  
Sbjct  336   DLHYIAWDSPPKQHPRSLSLKDFDNMVKSKAPFARKFHKNDPTLDKIDRELLGRT-HRFA  394

Query  803   PGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PGGWC+G+  +G   C+V GD  VL+PG G++RL++  ++  +   ++ +QC
Sbjct  395   PGGWCVGSSANGNDPCSVQGDDSVLKPGPGSERLQE-LVQTLSSYEYRRKQC  445



>gb|KFK25741.1| hypothetical protein AALP_AA8G153800 [Arabis alpina]
Length=430

 Score =   348 bits (893),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 240/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS+GD   + R L A+YHP N Y++HLDR +   +R  L+  V    LF   +N
Sbjct  84    LAYLISGSSGDGKMLKRTLMALYHPNNQYVVHLDRESSPEERLDLSDFVRNQSLFTRFKN  143

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+FV  +G + +++TLH A+ILLR  + WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  144   VKMIVKANFVTYRGPTMVANTLHAAAILLRDGARWDWFINLSASDYPLVTQDDLLHTFSY  203

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ES + KPII+DPGLY+++ SDVF+ +Q+R +P +F+++ GS++
Sbjct  204   LPRDLNFMDHTSDIGWKESHRAKPIIIDPGLYMSKKSDVFWVSQKRSMPTAFKLYTGSAW  263

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+R+F  T +N +L ++S
Sbjct  264   MMLSRPFVDYFIWGWDNLPRIVLMYYANFLSSPEGYFHTVICNAREFTNTTVNSDLHFIS  323

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L   DF  M+ S A FA  F+  +P+LD+IDSE+L RS G   PGGWC+
Sbjct  324   WDNPPKQHPHHLTLDDFERMVDSNAPFARKFRTDEPVLDKIDSELLSRSHGMVTPGGWCI  383

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  E+G   CA  GD  V++PG+GAKR+EK    L +   F+ +QC
Sbjct  384   GTRENGSDPCAEIGDNMVIKPGLGAKRVEKLITYLLSTENFRPRQC  429



>ref|XP_009602040.1| PREDICTED: xylosyltransferase 1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602041.1| PREDICTED: xylosyltransferase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=422

 Score =   348 bits (893),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 247/376 (66%), Gaps = 12/376 (3%)
 Frame = -2

Query  1745  PSHPHRVLIHGDLSSPP----PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLD  1578
             P  P  + +   L S P    P PP  AY ISGSAGD G + R L A+YHP NHY++HLD
Sbjct  48    PLIPLPIFVESKLQSLPISAAPPPPRFAYLISGSAGDGGMLKRTLQALYHPNNHYVVHLD  107

Query  1577  RSAPKSDR-DLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISS  1401
               +   +R DL    VN   +F    NV ++  A+ V  +G + +++TLH A+ILL+   
Sbjct  108   AESSADERLDLHNFVVNH-KIFAKFTNVKMISKANLVTYRGPTMVANTLHAAAILLKEGG  166

Query  1400  NWDWFINLSSADYPLVTQDD--LLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGL  1227
              WDWFINLS++DYPLVTQD   L+H  S++P+DLNF++HTS IGW+E Q+ KPIIVDPGL
Sbjct  167   EWDWFINLSASDYPLVTQDGEYLIHTFSHIPRDLNFIDHTSDIGWKEFQRAKPIIVDPGL  226

Query  1226  YLAEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPS  1047
             YL + SDVF+  Q+R +P +F++F GS++++LSR F+DFCI G +N PRT+LMY +N  S
Sbjct  227   YLNKKSDVFWIRQRRSVPTAFKLFTGSAWTVLSRPFIDFCIWGWDNLPRTVLMYYANFIS  286

Query  1046  SDAVYFPTVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPF  873
             +   YF TV+CN+++F  T +N +L Y+S ++  ++    L   D   M+ S A FA  F
Sbjct  287   TPEGYFHTVVCNAQEFRNTTVNSDLHYISWDNPPKQHPHYLTLDDMQRMVDSNAPFARKF  346

Query  872   KERDPILDQIDSEILHRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKH  699
              + DP+LD+IDSE+L R  G  VPGGWC+G+ E+G   C++ G+   LRP  GAKRLE  
Sbjct  347   HQDDPVLDKIDSELLFRGQGMFVPGGWCIGSRENGTDPCSIVGNITFLRPTAGAKRLENL  406

Query  698   FIELFAGGRFQSQQCI  651
                L +   F+S+QCI
Sbjct  407   IGSLLSNDNFRSRQCI  422



>ref|XP_009409889.1| PREDICTED: xylosyltransferase 1-like [Musa acuminata subsp. malaccensis]
Length=446

 Score =   349 bits (895),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 247/382 (65%), Gaps = 17/382 (4%)
 Frame = -2

Query  1748  HPSHPHRVLIHGDLSSPPPRPPSI-------------AYYISGSAGDSGRIVRLLFAVYH  1608
             HPS+P   L       P  RP                AY ISG+ GD   + R+L AVYH
Sbjct  64    HPSNPFAALYAPVFVEPKLRPTPPSSHLRPSPPPPRLAYLISGTVGDGNMLKRVLLAVYH  123

Query  1607  PRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHG  1428
             P N Y++HLD  A   +RD L   +   PLF + +NV ++  A+ V  +G + +++TLH 
Sbjct  124   PANLYVVHLDLEASSEERDDLRNYIAGHPLFASVKNVRMITKANLVTYRGPTMVANTLHA  183

Query  1427  ASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKP  1248
             A+ILL+   NWDWFINLS++DYPLVTQDDLLH LSYLP+DLNF++HTS IGW+  Q+ KP
Sbjct  184   AAILLKEGGNWDWFINLSASDYPLVTQDDLLHTLSYLPRDLNFIDHTSNIGWKAFQRAKP  243

Query  1247  IIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLM  1068
             II+DPGLY+++ +DVF+  Q+R +P +F++F GS++  LS  F+D+CI G EN PRT+LM
Sbjct  244   IIIDPGLYMSKKADVFWIPQRRSVPTAFKLFTGSAWMALSHSFIDYCIWGWENLPRTVLM  303

Query  1067  YLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSG  894
             Y +N  SS   YF TV+CN+++F  T +NH+L ++S ++  ++    L+ +D   ++ S 
Sbjct  304   YYANFISSPEGYFHTVICNAKEFRNTTVNHDLHFISWDNPPKQHPHYLSINDMSPIVDSN  363

Query  893   AAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVG  720
             A FA  F+   PILD+ID+E+L R P   V GGWC+G+ E+G   C V G+  +LRPG G
Sbjct  364   APFARKFRRDHPILDKIDAELLFRRPNMIVLGGWCVGSRENGSDPCLVIGNTTILRPGPG  423

Query  719   AKRLEKHFIELFAGGRFQSQQC  654
             A RLE+  + L +   F+ +QC
Sbjct  424   AIRLERLMLSLLSEENFRLRQC  445



>ref|XP_007134036.1| hypothetical protein PHAVU_010G014000g [Phaseolus vulgaris]
 gb|ESW06030.1| hypothetical protein PHAVU_010G014000g [Phaseolus vulgaris]
Length=421

 Score =   348 bits (892),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/348 (47%), Positives = 241/348 (69%), Gaps = 4/348 (1%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             P +AY ++G+ G+  ++ R+L AVYHPRN+YLLHLD  A  ++R  LA  V    +F A 
Sbjct  73    PRLAYLLTGTKGEEAQLKRVLQAVYHPRNYYLLHLDLEASDAERLELAKYVKFETVFAAF  132

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHIL  1326
              NV V+G +D V  KG + ++STLHG ++LL+   +WDWF+NLS++DYPL++QDDLLHI 
Sbjct  133   GNVMVVGKSDLVTYKGPTMVASTLHGIALLLKRVPHWDWFLNLSASDYPLLSQDDLLHIF  192

Query  1325  SYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGS  1146
             S+LP+DLNF+ HTS IGW+E Q+ +PII+DPGLY  + S V++A ++R +P SF++F GS
Sbjct  193   SFLPRDLNFIEHTSNIGWKEHQRARPIIIDPGLYHLKKSGVYWAKEKRSVPSSFKLFTGS  252

Query  1145  SYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQY  966
              + +L++ FL+FC+ G +N PRTLLMY +N  SS   YF TV+CN++ +  T INH+L+Y
Sbjct  253   PWIVLTKSFLEFCVWGWDNLPRTLLMYYTNFLSSPEGYFHTVICNNKDYQNTTINHDLRY  312

Query  965   VSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGW  792
             +  ++  ++    L    F DM+RSG  FA  F + DP+LD+ID E+L +S G   PGGW
Sbjct  313   IRWDNPPKQHPLFLKLEHFDDMVRSGIPFARKFAKDDPVLDKIDKELLRKSKGHFTPGGW  372

Query  791   CLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             C G+   G+  C V+G+  V++P + +K+LEK  ++L     F+ +QC
Sbjct  373   CFGSPLLGKDPCTVYGNPIVVKPTLQSKKLEKLMVKLLDSENFRPKQC  420



>ref|XP_010482174.1| PREDICTED: xylosyltransferase 1-like [Camelina sativa]
Length=449

 Score =   349 bits (895),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/352 (48%), Positives = 245/352 (70%), Gaps = 6/352 (2%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             PP PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R  L++SV   P 
Sbjct  99    PPTPPRLAYLISGTKGDSHRMMRTLQAVYHPRNQYVLHLDLEAPPRERMDLSMSVKNDPT  158

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
             FR   NV VM  ++ V  KG + ++STL   +ILLR S +WDWF+NLS++DYPLVTQDDL
Sbjct  159   FRELDNVRVMAQSNLVTYKGPTMIASTLQAVAILLRESLHWDWFLNLSASDYPLVTQDDL  218

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
             LH+ S L +++NF+ +    GW+ +Q+ K IIVDPGLYL++ SD+ + TQ+R LP SF++
Sbjct  219   LHVFSNLSRNVNFIENMQLTGWKLNQRAKSIIVDPGLYLSKKSDIAWTTQRRSLPTSFKL  278

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS++ +L+R FL++CI G +NFPRT+LMY +N  SS   YF TV+CNS++F  T I +
Sbjct  279   FTGSAWIMLTRSFLEYCIWGWDNFPRTILMYYTNFVSSPEGYFHTVICNSKEFVNTAIGY  338

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L Y++ +S  ++  R L+  DF +M++S A FA  F + DP LD+ID E+L R+  +  
Sbjct  339   DLHYIAWDSPPKQHPRSLSLKDFDNMVKSKAPFARKFHKNDPTLDKIDRELLGRT-HRFA  397

Query  803   PGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PGGWC+G+  +G   C+V GD  VL+PG G++RL++  ++  +   +  +QC
Sbjct  398   PGGWCVGSSANGNDPCSVQGDDSVLKPGPGSERLQE-LVQTLSSDEYMRKQC  448



>ref|XP_006468826.1| PREDICTED: xylosyltransferase 1-like isoform X1 [Citrus sinensis]
Length=406

 Score =   347 bits (890),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 230/359 (64%), Gaps = 14/359 (4%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  GD  RI RLL A+YHPRN YLLHL   A   +R  LA +V +VP  RA
Sbjct  47    PPAFAYYISGGTGDKDRIFRLLLALYHPRNRYLLHLAADASDDERLKLAAAVRSVPAVRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D V   GSS++++ L  A+ILL++   W+WFI LS+ DYPL+TQDDL H 
Sbjct  107   FGNVDVVGKPDRVNFVGSSNVAAVLRAAAILLKVDKGWNWFIALSALDYPLITQDDLAHA  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFR-  1152
              S + +DLNF++HTS +GW+ESQ+++P+IVDPGLYLA  S +F AT++RP PD+F+VF  
Sbjct  167   FSSVRRDLNFIDHTSDLGWKESQRIQPVIVDPGLYLARKSQIFQATEKRPTPDAFKVFTG  226

Query  1151  ---------GSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQF  999
                      GS + +LSR FL+FC+ G +N PRTLLMY +N   S  VYF +V+CN+ +F
Sbjct  227   RTERGSCIAGSQWFVLSRSFLEFCVFGWDNLPRTLLMYFNNVMLSQEVYFHSVICNAPEF  286

Query  998   NRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILH  825
               T IN +L+Y+  ++  + E   LN SD+  M++SG  FA  F++ DP+L+ ID +IL 
Sbjct  287   KNTTINSDLRYMIWDNPPKMEPHFLNVSDYDQMVQSGVVFARQFQKDDPVLNMIDEKILK  346

Query  824   RSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             R   +  PG WC G        C  WGD +VL+PG  A +LE     L      QS QC
Sbjct  347   RGHNRVAPGAWCTGQRSWWMDPCTQWGDVNVLKPGQQATKLEDTITNLLDDWSSQSNQC  405



>emb|CDP00744.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   347 bits (890),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 228/330 (69%), Gaps = 6/330 (2%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             P  PP+ AYYISG  GD+ RI RL  AVYHPRN YLLH+       +R  L   VN+VP 
Sbjct  52    PGHPPAFAYYISGGRGDANRIFRLFLAVYHPRNRYLLHIGADGSDIERKKLGAMVNSVPA  111

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
              RA  NV V+G  D V   GSS++++ L  A+ILL++   WDWFI LS+ DYPL+TQDDL
Sbjct  112   VRAFGNVDVIGKPDPVTYMGSSNIAAVLRAAAILLKVDKGWDWFITLSALDYPLITQDDL  171

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
              H+ S + +DLNF++HTS +GW+  Q+++PI+VDPG+YLA  + +F+AT++RP+PD+FR+
Sbjct  172   SHVFSSVRRDLNFIDHTSDLGWKGGQRIEPIVVDPGIYLARRTQIFHATEKRPMPDAFRL  231

Query  1157  FR--GSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTII  984
             F   GS + +LSR FL+FCI G +N PRT+LMY++NT  S+ VYF TV+CNS +F  T +
Sbjct  232   FCFPGSPWVMLSRSFLEFCIFGWDNLPRTILMYVTNTMLSEEVYFHTVICNSHEFKNTTV  291

Query  983   NHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGK  810
             N +L+Y   +   + E   L++SD+  M++SGAAFA  F + DP+LD +D +IL R   +
Sbjct  292   NGDLRYFVWDDPPKMEPHFLSTSDYERMVQSGAAFARQFAKDDPVLDMVDEKILKRGSNR  351

Query  809   PVPGGWCLGNGE--SGRCAVWGDADVLRPG  726
             P PG WC G  +  +  C+ WG+ +VL+PG
Sbjct  352   PAPGAWCTGRNKWLTDPCSQWGNVNVLKPG  381



>ref|XP_010062325.1| PREDICTED: xylosyltransferase [Eucalyptus grandis]
 gb|KCW90841.1| hypothetical protein EUGRSUZ_A02896 [Eucalyptus grandis]
Length=407

 Score =   347 bits (890),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 241/351 (69%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             PR P +AY I+G+  D  R+ RLL AVYHPRN+YL+HLD  AP+ +R  LA  V +  + 
Sbjct  56    PRLPRLAYLITGTKDDGARVKRLLQAVYHPRNYYLIHLDLEAPEGERLELARYVKSEGVV  115

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NV V+G+AD V ++G + ++STLH  ++LL+ + +WDWFINLS++DYPLV QDDLL
Sbjct  116   REFGNVMVIGDADLVTAQGPTMIASTLHAIAVLLKRAKDWDWFINLSASDYPLVPQDDLL  175

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ H+  +G++E ++ +PII+DPGLY  + S VFYA ++R LP SF++F
Sbjct  176   HIFSYLPRDLNFLEHSGDLGYKEVERARPIIIDPGLYHLKKSGVFYAKERRSLPASFKLF  235

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +L++ FL+FC+ G +N PRTLLMY +N  SS   YF TV+CN + +  T INH+
Sbjct  236   MGSAWVVLTKPFLEFCVWGWDNLPRTLLMYYTNFLSSPEGYFHTVVCNHKDYQNTTINHD  295

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L+Y   ++  ++    L      DM+RSGA FA  F++ DP+L++ID E+L RS G+  P
Sbjct  296   LRYSRWDNPPKQHPITLTMEHLDDMVRSGAPFARKFEKDDPVLNRIDKELLMRSDGRFTP  355

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G WC+G+  +G+  C V G   V++P + ++RLEK    L     F+ +QC
Sbjct  356   GAWCMGSSRAGKDPCLVSGSPIVVKPTLSSRRLEKLIANLLDPETFRGKQC  406



>ref|NP_001242791.1| uncharacterized protein LOC100813028 precursor [Glycine max]
 gb|ACU24011.1| unknown [Glycine max]
Length=398

 Score =   347 bits (889),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/348 (46%), Positives = 242/348 (70%), Gaps = 4/348 (1%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             P +AY ++ + G+  ++ R+L AVYHPRN+YLLHLD  A  ++R  LA  V +  +  A 
Sbjct  50    PRLAYMLTATKGEGAQLKRVLQAVYHPRNYYLLHLDLEASDAERLELAKYVKSETVLAAF  109

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHIL  1326
              NV V+G  D V  KG + ++STLHG ++LL+ + +WDW INLS++DYPL++QDD+LHI 
Sbjct  110   GNVLVVGKPDLVTYKGPTMIASTLHGIALLLKRAPHWDWLINLSASDYPLLSQDDILHIF  169

Query  1325  SYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGS  1146
             S+LP+DLNF+ HTS IGW+E Q+ +PII+DPGLY ++ S V++A ++R +P SF++F GS
Sbjct  170   SFLPRDLNFIEHTSNIGWKEHQRARPIIIDPGLYHSKKSGVYWAKEKRSVPSSFKLFTGS  229

Query  1145  SYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQY  966
             ++ +L++ FL+FC+ G +N PRTLLMY +N  SS   YF TV+CN + +  T INH+L+Y
Sbjct  230   AWVVLTKSFLEFCVWGWDNLPRTLLMYYTNFLSSPEGYFHTVICNHKDYQNTTINHDLRY  289

Query  965   VSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGW  792
             +  ++  ++    L    F DM+ SGA FA  F + DP+L++ID E+L RS G   PGGW
Sbjct  290   IRWDNPPKQHPVFLKLEHFDDMVHSGAPFARKFTKDDPVLNKIDKELLRRSDGHFTPGGW  349

Query  791   CLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             C+GN   G+  CAV+G+  V++P + +K+LEK  ++L     F+ +QC
Sbjct  350   CIGNPLLGKDPCAVYGNPIVVKPTLQSKKLEKLIVKLLDSENFRPKQC  397



>ref|XP_006605954.1| PREDICTED: xylosyltransferase 1-like [Glycine max]
Length=396

 Score =   347 bits (889),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 167/349 (48%), Positives = 228/349 (65%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AY+ISG   D  RI+RLL AVYHPRN YLLHL R A   +R  L  +V  VP+ R 
Sbjct  47    PPAFAYFISGGNQDKDRILRLLLAVYHPRNRYLLHLGRDARDEERQALVAAVRAVPVIRT  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G AD+V   GSS+++ TL  A+I+L++ S W+WFI LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKADYVTYLGSSNVAITLRAAAIMLKLDSGWNWFITLSARDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HT  +GW+ES + +PI+VDPGLYLA  S +F AT++RP PD+F++F G
Sbjct  167   FSSVSRDLNFIDHTGDLGWKESDRFQPIVVDPGLYLARKSQIFQATEKRPTPDAFKLFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCI G +N PRTLLMY +N   S   YF +V+CN  +F  T +N +L+
Sbjct  227   SPWVILSRPFLEFCIFGWDNLPRTLLMYFTNVKLSQEGYFHSVVCNVPEFKNTTVNGDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN+S +  M  SGAAFA  F+  +P+LD ID +IL R   +  PG 
Sbjct  287   YMIWDNPPKMEPHFLNASVYNQMAESGAAFARQFQLNNPVLDMIDEKILQRGRHRVTPGA  346

Query  794   WCLGNGE--SGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G        C+ WGD + ++PG  AK+LE     L      Q+ QC
Sbjct  347   WCTGRRSWWVDPCSQWGDVNTVKPGPQAKKLEGSVSNLLDDQNSQTNQC  395



>ref|XP_010934023.1| PREDICTED: xylosyltransferase 1-like [Elaeis guineensis]
Length=441

 Score =   348 bits (893),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 165/346 (48%), Positives = 235/346 (68%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY +SGS GD   + R L ++YHP N Y++HLD  AP  +R  L   +   P+F A  N
Sbjct  95    LAYLVSGSNGDGHSLKRALLSLYHPANRYVVHLDLEAPLDERQDLHDFIAGHPVFSAVGN  154

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+ V  +G + +++TLH A++LLR   +WDWFINLS+ DYPLVTQDDLLH  SY
Sbjct  155   VKMITKANLVTYRGPTMVANTLHAAAVLLREGGDWDWFINLSATDYPLVTQDDLLHTFSY  214

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+E  + KPII+DPGLY+ + +DVFY  Q+R +P +F++F GS++
Sbjct  215   LPRDLNFIDHTSNIGWKEFHRAKPIIIDPGLYMLKKADVFYIPQRRSVPTAFKLFTGSAW  274

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
               LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +NH+L ++S
Sbjct  275   MALSRSFIDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFRNTTVNHDLHFIS  334

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L       MI S A FA  F + DP+LD+ID+E+L R PG  VPGGWC+
Sbjct  335   WDNPPKQHPHYLTIKHMRGMIDSNAPFARKFPKDDPVLDKIDAELLSRGPGMLVPGGWCV  394

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G+ E+G   C V G+  +LRPG GA RLE   + L +  +F+ +QC
Sbjct  395   GSRENGTDPCLVVGNTTILRPGPGAVRLEHLMVSLLSEEKFRPRQC  440



>ref|XP_004246431.1| PREDICTED: xylosyltransferase 2 [Solanum lycopersicum]
Length=411

 Score =   347 bits (890),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/351 (48%), Positives = 237/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P +AY ISG+  D  ++ RLL AVYHPRN+YLLHLD  +  S+R  LA  V +  +F
Sbjct  60    PELPRLAYLISGTKNDGVKMKRLLQAVYHPRNYYLLHLDLESLDSERLELAKYVKSEFVF  119

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NV V+G +D V  KG + ++S LH  +ILL++  +WDWFINLS++DYPL+TQDD+L
Sbjct  120   RDFGNVKVVGRSDLVTYKGPTMLASMLHSIAILLKLPKSWDWFINLSASDYPLMTQDDIL  179

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ H+S IG++E  +++PII+DPGLY  + S VF+A ++R +P SF+VF
Sbjct  180   HIFSYLPRDLNFLEHSSNIGYKEFSRVRPIIIDPGLYHLKKSGVFWAKEKRSVPASFKVF  239

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +LSR FL+FCI G +N PRTLLMY +N   S   YF T++CN + +  T +NH+
Sbjct  240   MGSEWVMLSRPFLEFCIWGWDNLPRTLLMYYTNFLYSLEGYFHTIVCNHKDYQNTTVNHD  299

Query  974   LQYVSLNSRKEARVLNSS--DFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  ++  +   +N +   F DMI+SG  FA  F   DP+LD+ID EIL RS G   P
Sbjct  300   LHYIKWDNPPKQYPINLTLKHFEDMIQSGVPFARTFATDDPVLDKIDKEILRRSHGVFSP  359

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G WC+G    G+  C V+G  DV++P  G++ LEK  ++L     F+S+QC
Sbjct  360   GAWCVGTSSLGKDPCIVYGSVDVVKPSTGSRSLEKLVLKLLDTENFRSRQC  410



>ref|XP_003577681.1| PREDICTED: xylosyltransferase 2-like [Brachypodium distachyon]
Length=424

 Score =   347 bits (891),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 171/353 (48%), Positives = 235/353 (67%), Gaps = 9/353 (3%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             P IAY +SGSA D+  + R+L A+YHPRN Y+LHLD  AP SDR  LA  +   P   AA
Sbjct  71    PRIAYLVSGSARDAPALRRVLLALYHPRNLYILHLDAEAPDSDRADLAAGLAAHPAISAA  130

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILL-----RISSNWDWFINLSSADYPLVTQDD  1341
              NV V+  A+ V  +G + ++STLH A+ LL        S+WDWFINLS++DYPLVTQDD
Sbjct  131   GNVRVVEKANLVTYRGPTMVASTLHAAAALLWGHSGAGGSDWDWFINLSASDYPLVTQDD  190

Query  1340  LLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFR  1161
             LLH+ S LP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + +DVF+  Q+R +P +F+
Sbjct  191   LLHVFSKLPRDLNFIDHTSNIGWKEFQRAKPVIIDPGLYMKKKADVFWIPQRRSVPTAFK  250

Query  1160  VFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIIN  981
             +F GS++  LSR  +++ I G +N PRT+LMY SN  SS   YF TV+CN+ +F  T +N
Sbjct  251   LFTGSAWMALSRPLVEYSIWGWDNLPRTVLMYYSNFISSPEGYFHTVVCNAEEFKNTTVN  310

Query  980   HNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKP  807
             H+L Y+S ++  ++    L   D   M+ S A FA  F   DP+LD+ID+EIL R P  P
Sbjct  311   HDLHYISWDNPPKQHPHYLTIDDLDRMVASDAPFARKFHADDPVLDKIDAEILFRGPDMP  370

Query  806   VPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              PGGWC G  E+G   C+  G+A +L+PG GA RLE+    L +  +F  +QC
Sbjct  371   TPGGWCAGTQENGSDPCSAIGNATLLQPGRGAVRLERLITSLLSEEKFHPRQC  423



>ref|XP_010658623.1| PREDICTED: xylosyltransferase 1-like [Vitis vinifera]
Length=399

 Score =   346 bits (888),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 240/348 (69%), Gaps = 5/348 (1%)
 Frame = -2

Query  1682  SIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAAR  1503
              +AY+ISG+ GDS R++RLL A+YHP N YLLHLDR A   +R  L+ SV +V +F AA 
Sbjct  51    KLAYFISGTHGDSPRLLRLLRALYHPNNQYLLHLDRRATPQERVELSASVGSVAVFAAAE  110

Query  1502  NVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILS  1323
             NV+V+G+AD V   GS+ ++S L GA+ILLR  S+WDWF+NL ++DYPL++QDDLLHILS
Sbjct  111   NVNVVGSADAVNLDGSTPIASLLRGAAILLRYCSDWDWFVNLEASDYPLISQDDLLHILS  170

Query  1322  YLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSS  1143
             ++P+D NF+ HTS IGW E Q++  I+VDPGLYLA    +F  T++R LP  FR F GS 
Sbjct  171   FVPRDFNFIEHTSNIGWNEYQRIIQIVVDPGLYLASKRGIFLGTKRRVLPRQFRFFTGSP  230

Query  1142  YSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYV  963
               ILSRK ++F ILG +NFPRTLL++ +N  SS   YF T+ CN+R+F+ T++N NL+Y+
Sbjct  231   QVILSRKLVEFSILGWDNFPRTLLLFFANIKSSHRGYFQTLACNAREFSNTVMNSNLRYM  290

Query  962   SLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERD-PILDQIDSEILHRSPGKPVPGGW  792
             + ++   KE R    SD   M+ SGAAFA  F   D  +LD IDS +LHR  G   PGGW
Sbjct  291   AWDNPPGKEPRNPRVSDVKKMLGSGAAFAGNFAPNDHEVLDLIDSVVLHRRKGMISPGGW  350

Query  791   CLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             C+G  + GR  C  WGD ++LRPG  A+R EK  + + A    +S QC
Sbjct  351   CVGRRDRGRDPCQHWGDTNILRPGHAAERFEKLLLRVMANSTLRSNQC  398



>emb|CDY63764.1| BnaCnng42580D [Brassica napus]
Length=433

 Score =   347 bits (891),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/346 (48%), Positives = 237/346 (68%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS+GD   + R L A+YHP N Y++HLDR +   +R  L+  V    LF   +N
Sbjct  87    LAYLISGSSGDGQMLKRTLMALYHPNNQYVVHLDRESSAEERLDLSAFVANQTLFGRFKN  146

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+FV  +G + +++TLH A+ILLR   +WDWF+NLS++DYPLVTQDDLLH  SY
Sbjct  147   VRMIAKANFVTYRGPTMVANTLHAAAILLREGGDWDWFVNLSASDYPLVTQDDLLHTFSY  206

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+ES + KPII+DPGLY+++ +DVF+ +Q+R +P +F++F GS++
Sbjct  207   LPRDLNFIDHTSNIGWKESHRAKPIIIDPGLYMSKKADVFWVSQKRSMPTAFKLFTGSAW  266

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
              +LSR F+D+ I G +N PR +LMY +N  SS   YF TV+CN+++F  T +N +L ++S
Sbjct  267   MMLSRPFVDYFIWGWDNLPRIVLMYYANFLSSPEGYFHTVICNAKKFTNTTVNSDLHFIS  326

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L   DF  M+ S A FA  F+  +P LD+IDSE+L R PG   PGGWC+
Sbjct  327   WDNPPKQHPHHLTLDDFDRMVDSNAPFARKFRRDEPGLDKIDSELLSRRPGMVTPGGWCI  386

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  E+G   CA  GD  V+ PG GAKR+EK    L +   F+ +QC
Sbjct  387   GTRENGSDPCAEIGDTSVIMPGSGAKRVEKLVTYLLSNENFRPRQC  432



>ref|XP_009604692.1| PREDICTED: xylosyltransferase 2-like [Nicotiana tomentosiformis]
 ref|XP_009604693.1| PREDICTED: xylosyltransferase 2-like [Nicotiana tomentosiformis]
Length=421

 Score =   347 bits (889),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 231/343 (67%), Gaps = 5/343 (1%)
 Frame = -2

Query  1676  AYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNV  1497
             AY ISGS GD  ++ R L A+YHPRN+Y++HLD  +P  +R  LA  V   P+F    NV
Sbjct  81    AYLISGSKGDLEKLWRTLQALYHPRNYYVVHLDLESPTQERLELASRVEKDPIFAQVGNV  140

Query  1496  HVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYL  1317
             H++  A+ V  +G + +++TLH  +ILL+  ++WDWFINLS++DYPLVTQDDL++  S L
Sbjct  141   HMIAKANMVTYRGPTMVANTLHACAILLKKYTDWDWFINLSASDYPLVTQDDLIYTFSDL  200

Query  1316  PKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYS  1137
              ++ NF+ HTS +GW+E Q+  P+IVDPGLY    SD+F+A+ +R LP SF++F GS++ 
Sbjct  201   KREFNFIEHTSRLGWKEGQRAMPLIVDPGLYKTTKSDIFWASPKRALPTSFKLFTGSAWM  260

Query  1136  ILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSL  957
             ILSR F+++CI G +N PRTLLMY +N  SS   YF TV+CN+ +F  T+INH++ Y+S 
Sbjct  261   ILSRAFVEYCIWGWDNLPRTLLMYYTNFVSSPEGYFQTVVCNAPEFATTVINHDMHYISW  320

Query  956   NS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLG  783
             +   R+    LN +D   MI S AAFA  FK+ DP+LD+ID E+LHRS G   PGGWC G
Sbjct  321   DYPPRQHPHTLNINDTAKMIGSDAAFARKFKQDDPVLDKIDEELLHRSNGSFTPGGWCTG  380

Query  782   NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
                  RC+  G+   L+PG GAKRL +   +L    +F   QC
Sbjct  381   K---PRCSKVGNLTKLKPGPGAKRLRRLIGKLVLSAKFSQHQC  420



>ref|XP_002527729.1| acetylglucosaminyltransferase, putative [Ricinus communis]
 gb|EEF34642.1| acetylglucosaminyltransferase, putative [Ricinus communis]
Length=389

 Score =   345 bits (885),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 241/355 (68%), Gaps = 4/355 (1%)
 Frame = -2

Query  1703  SPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTV  1524
             S  P+ P  AY ISG+ GD  R+ RL+ AVYHPRN+Y++HLD  A   +R  +A  V + 
Sbjct  35    SDQPKLPRFAYLISGTKGDGERVKRLVQAVYHPRNYYVVHLDLEASDEERLEIAKYVKSE  94

Query  1523  PLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQD  1344
              + R   NV V+G AD V  KG + ++STLH  +ILL+ +++WDWF+NLS++DYPL+ QD
Sbjct  95    VVIREFGNVMVIGKADLVTLKGPTIIASTLHAIAILLKEATDWDWFVNLSTSDYPLMPQD  154

Query  1343  DLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSF  1164
             D+LHI SYLP+DLNF+ HTS IGW+E Q+ +PII+DPGLY ++ S VF+A ++R LP SF
Sbjct  155   DILHIFSYLPRDLNFLEHTSSIGWKEYQRARPIIIDPGLYHSKKSGVFWAKEKRSLPASF  214

Query  1163  RVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTII  984
             ++F GS + +L+R FL+FC+ G +N PRTLLMY +N  SS   YF TV+CN + +  T +
Sbjct  215   KLFMGSEWVVLTRSFLEFCVWGWDNLPRTLLMYYTNFHSSPEGYFHTVVCNHKDYQNTTV  274

Query  983   NHNLQYVSLNSRKEAR--VLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGK  810
             NH+L Y+  ++  + R   L    F DM+ SGA FA  F + DP+L++ID ++L R  G+
Sbjct  275   NHDLHYIKWDNPPKQRPISLALEHFEDMVESGAPFAREFAKDDPVLNKIDEKLLRRMDGR  334

Query  809   PVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
               PGGWC+G    G+  C  +G  + ++P V +KRLEK  ++L     F+S+QCI
Sbjct  335   FTPGGWCIGTTVLGKDPCVAYGSPNAVKPTVSSKRLEKLLLQLLDSESFRSKQCI  389



>ref|XP_008341525.1| PREDICTED: xylosyltransferase 1-like [Malus domestica]
Length=428

 Score =   346 bits (888),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/346 (48%), Positives = 239/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
              AY+ISGS GD   + R L A+YHP N+Y++HLD  +P  +R  L   V+T P+F    N
Sbjct  82    FAYFISGSNGDGNMLKRTLQALYHPHNYYVVHLDLESPPDERMDLQNYVSTHPVFVQFGN  141

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+ V  +G + +++TLH A+ILLR   +WDWFINLS++DYPL+TQDDLLH  SY
Sbjct  142   VKMISKANLVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLITQDDLLHTFSY  201

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+E Q+ KPIIVDPGLY+ + +DVF+ TQ+R +P +F++F GS++
Sbjct  202   LPRDLNFIDHTSNIGWKEYQRAKPIIVDPGLYMTKKADVFWVTQRRSVPTAFKLFTGSAW  261

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
               LS+ F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N +L +++
Sbjct  262   MALSKPFVDYCIWGWDNLPRTVLMYYANFLSSPEGYFHTVICNAQEFRNTTVNSDLHFIT  321

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    LN +D   M+ S A FA  F++ D +LD+IDSE+L + PG  VPGGWC+
Sbjct  322   WDNPPKQHPHHLNLADMQRMVDSNAPFARKFRQDDXVLDKIDSELLSKGPGMLVPGGWCI  381

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G  ++G   C+  G+  VL P  GAKRLE     L +  +F+S QC
Sbjct  382   GKRDNGSDPCSDIGNTTVLMPTPGAKRLEVLISSLLSNEKFRSNQC  427



>ref|XP_009758526.1| PREDICTED: xylosyltransferase 2 [Nicotiana sylvestris]
Length=414

 Score =   346 bits (887),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/351 (48%), Positives = 236/351 (67%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P  P +AY ISG+  D  RI RLL AVYHPRN+YLL+LD  A  S+R  LA  V +  + 
Sbjct  63    PELPRLAYLISGTKNDVVRIKRLLQAVYHPRNYYLLNLDLEASDSERLELAKYVKSEVVI  122

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
             R   NV V+G +D V  KG + ++STLH  +ILL++  NWDWFINLS++DYPL+TQDD+L
Sbjct  123   REFGNVKVVGKSDLVTYKGPTMLASTLHAIAILLKLPKNWDWFINLSASDYPLLTQDDIL  182

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI SYLP+DLNF+ H+S IG++E  + +PII+DPGLY  + S VF+A ++R +P SF+VF
Sbjct  183   HIFSYLPRDLNFLEHSSNIGYKEFSRARPIIIDPGLYHLKKSGVFWAKEKRSMPASFKVF  242

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS + +LSR FL+FCI G +N PRTLLMY +N   S   YF T++CN + +  T +NH+
Sbjct  243   MGSEWVMLSRSFLEFCIWGWDNLPRTLLMYYTNFLFSLEGYFHTIVCNHKDYQNTTVNHD  302

Query  974   LQYVSLNSRKEARVLNSS--DFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L Y+  ++  +   +N +   F DM++SG  FA  F   DP+LD+ID +IL RS G+  P
Sbjct  303   LHYIKWDNPPKQYPINLTLEHFEDMLQSGVPFARTFATDDPVLDKIDKDILRRSHGRFSP  362

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G WC+G+   G+  C   G  D+++P  G++ LEK  ++L     F+S+QC
Sbjct  363   GAWCMGSSALGKDPCITNGSPDIVKPSAGSRSLEKLVLKLLDTENFRSRQC  413



>emb|CDP02181.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   346 bits (888),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 239/346 (69%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
              AY ISGSAGD   + R L A+YHP N Y++HLD  +   +R  L   V    +F   +N
Sbjct  84    FAYLISGSAGDGDMLKRTLQALYHPNNQYVVHLDAESSPEERLGLHKFVRGHRIFSKFKN  143

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+ V  +G + +++TLH ASILL+   +WDWFINLS++DYPLVTQDDLLH  SY
Sbjct  144   VRMITRANLVTYRGPTMVANTLHAASILLKEGGDWDWFINLSASDYPLVTQDDLLHTFSY  203

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + SDVF+ TQ+R +P +F++F GS++
Sbjct  204   LPRDLNFIDHTSNIGWKEFQRAKPVIIDPGLYMTKKSDVFWITQRRSVPTAFKLFTGSAW  263

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
               LSR F+DFCI G +N PRT+LMY +N  SS   YF TV+CN+++F  T +N++L ++S
Sbjct  264   MALSRPFIDFCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAQEFLNTTVNNDLHFIS  323

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L+++D   M+ S A FA  F + DP+LD+ID+E+L R  G+ VPGGWC+
Sbjct  324   WDNPPKQHPHYLSANDMQRMVDSNAPFARKFHQDDPVLDRIDAELLLRGQGRLVPGGWCI  383

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G+ E+G   C+V G+  VLRP  GAKRLE     L +   F+ +QC
Sbjct  384   GSRENGTDPCSVAGNTTVLRPTAGAKRLENLISFLLSNENFRPRQC  429



>gb|EYU24912.1| hypothetical protein MIMGU_mgv1a022320mg [Erythranthe guttata]
Length=434

 Score =   346 bits (888),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/356 (47%), Positives = 240/356 (67%), Gaps = 6/356 (2%)
 Frame = -2

Query  1709  LSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVN  1530
             +   P  PP +AY ISG+ GDS R++R L AVYHPRN Y+LH+D  AP  +R  L  SV 
Sbjct  76    IQESPLEPPRLAYLISGTKGDSQRLMRTLRAVYHPRNQYILHMDLEAPPRERLNLTNSVK  135

Query  1529  TVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVT  1350
             + P F    NV VM  ++ V  KG + ++ TL   +ILL+ S NWDWFINLS++DYPLVT
Sbjct  136   SDPTFSRVENVRVMAQSNLVTYKGPTMIACTLQAIAILLKESLNWDWFINLSASDYPLVT  195

Query  1349  QDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPD  1170
             QDDLL+ LS + +++NF+ HT   GW+ SQ++KPIIVDPGLYL++ SD+++ TQ+R +P 
Sbjct  196   QDDLLYALSNVSRNINFIEHTPIHGWKLSQRVKPIIVDPGLYLSKKSDIYWTTQRRSIPT  255

Query  1169  SFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRT  990
             SF++F GS++ +L+R F+++CI G +N PRT+LMY +N  SS   YF TV+CN+  F  T
Sbjct  256   SFKLFTGSAWVMLTRSFVEYCIWGWDNLPRTILMYYTNFVSSPEGYFHTVICNTEHFRHT  315

Query  989   IINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSP  816
              +NH+L Y++ ++  ++  R+L   DF  M  S + FA  F + DP+LD+ID E+L R+ 
Sbjct  316   AVNHDLHYIAWDTPPKQHPRLLTMKDFAKMTNSSSPFARKFPKDDPVLDKIDRELLGRN-  374

Query  815   GKPVPGGWCLGN--GESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              +  PG WC+G+  G +  C+V GD  V RPG GA+RL K  ++      F+S+QC
Sbjct  375   DRFAPGAWCVGSTAGSADPCSVRGDDSVFRPGPGAERL-KELVKTLLSEDFRSKQC  429



>ref|XP_003633289.2| PREDICTED: xylosyltransferase 1 [Vitis vinifera]
 ref|XP_010657285.1| PREDICTED: xylosyltransferase 1 [Vitis vinifera]
 ref|XP_010657286.1| PREDICTED: xylosyltransferase 1 [Vitis vinifera]
Length=435

 Score =   346 bits (888),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/360 (46%), Positives = 242/360 (67%), Gaps = 9/360 (3%)
 Frame = -2

Query  1721  IHGDLSSPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLA  1542
             + GD +   PR   +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R  L 
Sbjct  80    VKGDSNMEAPR---LAYLISGTKGDSQRMMRTLQAVYHPRNQYILHLDLEAPPRERLDLT  136

Query  1541  LSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADY  1362
             +SV   P FR   NV VM  ++ V  KG + ++ TL   +ILL+ S  WDWF+NLS++DY
Sbjct  137   MSVKAEPTFREVENVRVMAQSNLVTYKGPTMIACTLQAIAILLKESLEWDWFLNLSASDY  196

Query  1361  PLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQR  1182
             PLVTQDDLLH+ S L + LNF+ HT   GW+ +Q+ KPI++DPGL+L++ SD+F+ TQ+R
Sbjct  197   PLVTQDDLLHVFSNLSRTLNFIEHTKITGWKLNQRAKPIVIDPGLHLSKKSDIFWTTQRR  256

Query  1181  PLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQ  1002
              LP SF++F GS++ +L+R F+++CILG +N PRT+LMY +N  SS   YF TV+CN+ +
Sbjct  257   SLPTSFKLFTGSAWVMLTRSFVEYCILGWDNLPRTILMYYTNFISSPEGYFHTVICNTEE  316

Query  1001  FNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEIL  828
             F  T I+H+L Y++ ++  ++    L   D+  M++SGA FA  F + DP+LD+ID E+L
Sbjct  317   FRNTAISHDLHYIAWDNPPKQHPLSLTIKDYDKMVKSGAPFARKFAKDDPVLDKIDKELL  376

Query  827   HRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              R   +  PG WC+GN + G   C+V G+  + R G GA+RL++   +L +   +QS QC
Sbjct  377   GRI-NRFAPGAWCVGNSDGGADPCSVRGNDSIFRSGPGAERLQEQTQKLLS-EEYQSNQC  434



>ref|XP_002319376.2| glycosyltransferase family 14 family protein [Populus trichocarpa]
 gb|EEE95299.2| glycosyltransferase family 14 family protein [Populus trichocarpa]
Length=442

 Score =   346 bits (888),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/350 (47%), Positives = 235/350 (67%), Gaps = 6/350 (2%)
 Frame = -2

Query  1691  RPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFR  1512
              PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R +L   V   P F+
Sbjct  94    EPPRLAYLISGTKGDSQRMMRTLQAVYHPRNQYILHLDLEAPPRERLMLGGYVKNDPTFQ  153

Query  1511  AARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLH  1332
                NV VM  ++ V  KG +  + TL   +I+LR S  WDWFINLS++DYPLVTQDDLLH
Sbjct  154   EVGNVRVMAQSNLVTYKGPTMFACTLQAIAIMLRESLEWDWFINLSASDYPLVTQDDLLH  213

Query  1331  ILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFR  1152
             + S L ++LNF+ HT   GW+ + + KPIIVDPGLY ++ SD+++ TQ+R LP SF++F 
Sbjct  214   VFSNLSRNLNFIEHTQLTGWKLNSRAKPIIVDPGLYSSKKSDLYFTTQRRSLPSSFKLFT  273

Query  1151  GSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNL  972
             GS++ +L+R FL++CI+G EN PRT+LMY +N  SS   YF TV+CN+ +F  T I H+L
Sbjct  274   GSAWVMLTRSFLEYCIMGWENLPRTILMYYTNFISSPEGYFHTVICNTEEFQNTAIGHDL  333

Query  971   QYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPG  798
              Y++ +S  ++    L   DF  M++S A FA  F   DP+LD+ID EIL+R+ G+  PG
Sbjct  334   HYIAWDSPPKQHPISLTMKDFDKMVKSNAPFARKFARDDPVLDKIDKEILNRT-GRFAPG  392

Query  797   GWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              WC+G  ++G   C++ G+  V RPG GA+RL++  ++      F+ +QC
Sbjct  393   AWCIGGADNGSDPCSIPGNYSVFRPGPGAQRLQE-LLQTLLSEDFRKKQC  441



>ref|XP_004235090.2| PREDICTED: xylosyltransferase 1-like [Solanum lycopersicum]
Length=432

 Score =   346 bits (887),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 236/350 (67%), Gaps = 4/350 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP  AY +SGSAGD   + R L A+YHP N Y++HLD  +   +R  L   V   P+FR 
Sbjct  83    PPRFAYLVSGSAGDGAMLKRTLQALYHPNNQYVVHLDADSSPQERLHLHKFVVNNPIFRK  142

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV ++  A+ V  +G + +++TLH A+ILL+    WDWFINLS++DYPLVTQDDL+H 
Sbjct  143   FNNVRMITKANLVTYRGPTMVANTLHAAAILLKQGGQWDWFINLSASDYPLVTQDDLIHA  202

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S LP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ + SDVF+ TQ+R +P +F++F G
Sbjct  203   FSDLPRDLNFIDHTSDIGWKEFQRAKPIIIDPGLYMNKKSDVFWITQRRSVPTAFKLFTG  262

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S++  LSR F+DFCI G +N PRT+LMY +N  S+   YF TV+CN+++F  T +N +L 
Sbjct  263   SAWMALSRPFIDFCIWGWDNLPRTVLMYYANFISTPEGYFHTVVCNAQEFRNTTVNSDLH  322

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             ++S ++  ++    L   D   M+ S A FA  F + DP+LD+ID+E+L R  G  VPGG
Sbjct  323   FISWDNPPKQHPHYLTLGDMQKMVDSNAPFARKFHQDDPVLDKIDNELLFRGQGMFVPGG  382

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             WC G+ E+G   C+V G+A VLRP  GAKR++     L +   F+ +QCI
Sbjct  383   WCTGSLENGTDPCSVVGNATVLRPTAGAKRVKTLTGSLLSNDSFRPRQCI  432



>ref|XP_007153286.1| hypothetical protein PHAVU_003G022600g [Phaseolus vulgaris]
 gb|ESW25280.1| hypothetical protein PHAVU_003G022600g [Phaseolus vulgaris]
Length=405

 Score =   345 bits (884),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/354 (47%), Positives = 231/354 (65%), Gaps = 5/354 (1%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             P  PP+ AY+ISG   D  RI RLL AVYHPRN YLLHL   A   +R  L  +  +VP 
Sbjct  44    PHHPPAFAYFISGGNRDGDRIFRLLLAVYHPRNRYLLHLGMDARDEERQKLGAAAMSVPA  103

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
              RA RNV V+G AD+V   GSS++++TL  AS+++++   WDWF+ LS+ DYPLVTQDDL
Sbjct  104   IRAFRNVDVVGKADYVTYMGSSNVAATLRAASVMMKLDGGWDWFVTLSARDYPLVTQDDL  163

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
              H+ S + +D+NF++HTS +GW+E  + +PI+VDPGLYLA  S +F+ATQ+R  PD+F +
Sbjct  164   SHVFSSVQRDINFIDHTSDLGWKEKDRFQPIVVDPGLYLARRSQIFHATQKRDTPDAFNL  223

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS + ILSR FL+FCI G +N PRTLLMY +N   S   YF +V+CN+ +F  T +N 
Sbjct  224   FTGSPWVILSRPFLEFCIFGWDNLPRTLLMYFTNVKLSQEGYFHSVICNAPEFKNTTVNA  283

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L+Y+  ++  + E   LN+S +  M  SGAAFA  F+  DP+LD ID +IL R   + V
Sbjct  284   DLRYMIWDNPPKMEPLFLNASVYEQMAESGAAFARQFEVGDPVLDMIDRKILKRGHNQAV  343

Query  803   PGGWCLG--NGESGRCAVWG-DADVLRPGVGAKRLEKHFIELFAGGRFQSQQCI  651
             PG WC G  +     C+ WG D ++L+PG  AK+LE     L       + QC+
Sbjct  344   PGAWCSGRRSWWVDPCSQWGEDVNILKPGPQAKKLEDSVSSLLDDWSSHTNQCL  397



>ref|XP_003604961.1| Xylosyltransferase [Medicago truncatula]
 gb|AES87158.1| core-2/I-branching enzyme [Medicago truncatula]
Length=419

 Score =   345 bits (886),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 238/351 (68%), Gaps = 4/351 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P+ P  AY ++G+ G+  ++ R+L A+YHPRN+YLLHLD  A   +R  LA  V +  +F
Sbjct  68    PKLPKFAYLLTGTKGEVSQLKRVLQAIYHPRNYYLLHLDLEASSEERVELAKYVKSEKVF  127

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                 NV V+G  D V  KG + ++STLH  ++ L+   +WDWF+NLS++DYPL +QDDLL
Sbjct  128   GVFGNVMVVGKGDLVTYKGPTMIASTLHSVALFLKRVGDWDWFVNLSASDYPLFSQDDLL  187

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             HI S++P+D+NF+ HTS +GW+E Q+ +PII+DPGLY +  S V+YA ++R LP SF++F
Sbjct  188   HIFSFMPRDINFIEHTSNMGWKEFQRARPIIIDPGLYHSRVSSVYYAKERRSLPSSFKLF  247

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS +++L++ FL+FC+ G +N PRTLLMY +N  SS+  YF TVLCN + +  T +N++
Sbjct  248   TGSEWAVLTKPFLEFCVYGWDNLPRTLLMYYTNFLSSNEGYFQTVLCNHKDYQNTTVNND  307

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L+Y+  ++  +++   L    F DM  SGA FA  F + DPILD+ID E+L RS G+  P
Sbjct  308   LRYLRWDNPPKQQPLSLKLEHFEDMAHSGAPFARRFDKDDPILDKIDRELLGRSDGRFTP  367

Query  800   GGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWCLGN   G+  C V+G+ DV+ P V +K LEK  + L     F+ +QC
Sbjct  368   GGWCLGNHLKGKDPCDVYGNPDVVNPSVRSKILEKLMLILLDSENFRPKQC  418



>ref|XP_011045463.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica]
 ref|XP_011045464.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica]
 ref|XP_011045465.1| PREDICTED: xylosyltransferase 1-like [Populus euphratica]
Length=442

 Score =   346 bits (887),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 235/350 (67%), Gaps = 6/350 (2%)
 Frame = -2

Query  1691  RPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFR  1512
              PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R +L   V   P F+
Sbjct  94    EPPRLAYLISGTKGDSQRMMRTLQAVYHPRNQYILHLDLEAPPRERLMLGGYVKNDPTFQ  153

Query  1511  AARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLH  1332
                NV VM  ++ V  KG +  + TL   +I+LR S  WDWFINLS++DYPLVTQDDLLH
Sbjct  154   EVGNVRVMAQSNLVTYKGPTMFACTLQAIAIMLRESVEWDWFINLSASDYPLVTQDDLLH  213

Query  1331  ILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFR  1152
             + S L ++LNF+ HT   GW+ + + KPIIVDPGLY ++ SD+++ TQ+R LP SF++F 
Sbjct  214   VFSNLSRNLNFIEHTQLTGWKLNSRAKPIIVDPGLYSSKKSDLYFTTQRRSLPTSFKLFT  273

Query  1151  GSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNL  972
             GS++ +L+R FL++CI+G EN PRT+LMY +N  SS   YF TV+CN+ +F  T I H+L
Sbjct  274   GSAWVMLTRSFLEYCIMGWENLPRTILMYYTNFISSPEGYFHTVICNAEEFQNTAIGHDL  333

Query  971   QYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPG  798
              Y++ +S  ++    L   DF  M++S A FA  F   DP+LD+ID EIL+R+ G+  PG
Sbjct  334   HYIAWDSPPKQHPISLTMKDFDKMVKSNAPFARKFARDDPVLDKIDKEILNRT-GRFAPG  392

Query  797   GWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              WC+G  ++G   C++ G+  V RPG GA+RL++    L +   F+ +QC
Sbjct  393   AWCIGGSDNGSDPCSLRGNYSVFRPGPGAQRLQELLRALLS-DEFRKKQC  441



>ref|XP_008662662.1| PREDICTED: xylosyltransferase 1 [Zea mays]
 tpg|DAA47720.1| TPA: hypothetical protein ZEAMMB73_782256 [Zea mays]
Length=465

 Score =   347 bits (889),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 237/348 (68%), Gaps = 6/348 (2%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             IA+ ISGSAGD+  + R+L A+YHPRN Y+LHLD  AP SDR  LA  + + P   AA N
Sbjct  117   IAFLISGSAGDASALRRVLLALYHPRNRYILHLDAEAPDSDRSNLAADLASHPAIAAAAN  176

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILL--RISSNWDWFINLSSADYPLVTQDDLLHIL  1326
             V V+  A+ V  +G + +++TLH A+  L    +S+WDWFINLS++DYPLVTQDDL+H+ 
Sbjct  177   VRVVDRANLVTYRGPTMVANTLHAAAAFLWGDGASHWDWFINLSASDYPLVTQDDLIHVF  236

Query  1325  SYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGS  1146
             S LP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + +DVF+  Q+R +P +F++F GS
Sbjct  237   SKLPRDLNFIDHTSDIGWKEFQRAKPVIIDPGLYMKKKADVFWIPQRRSVPTAFKLFTGS  296

Query  1145  SYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQY  966
             ++  LSR F+++CI G +N PRT+LMY SN  SS   YF TV+CN+ +F  T +NH+L Y
Sbjct  297   AWMALSRPFVEYCIWGWDNLPRTVLMYYSNFISSPEGYFHTVVCNAEEFKNTTVNHDLHY  356

Query  965   VSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGW  792
             +S ++  ++    L + D   M+ S A FA  F E DP+LD+ID EIL R    P PGGW
Sbjct  357   ISWDNPPKQHPHYLTAEDLDRMVASDAPFARKFHEDDPVLDRIDEEILGRGADVPTPGGW  416

Query  791   CLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             C G  E+G   C+V GD  ++ PG GA RL++    L +  +F  +QC
Sbjct  417   CAGTRENGSDPCSVVGDTGLVVPGRGAARLQRLVTSLLSEEKFHPRQC  464



>ref|XP_009104929.1| PREDICTED: xylosyltransferase 1-like [Brassica rapa]
Length=397

 Score =   344 bits (883),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 232/353 (66%), Gaps = 5/353 (1%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRS-APKSDRDLLALSVNTVP  1521
             P  PPS AYYI+G  GD  RI RLL AVYHPRN YLLHL  + A +++R  L   V +VP
Sbjct  44    PHYPPSFAYYITGGRGDKDRIFRLLLAVYHPRNRYLLHLGGAEANEAERVALLSDVKSVP  103

Query  1520  LFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDD  1341
                A  NV V+G  D +   G+S  ++TLH  SILL++  +W WF+ LS+ DYPL+TQDD
Sbjct  104   AVSAFGNVDVLGKVDRLSENGASKTANTLHAVSILLKLDGSWSWFVELSAFDYPLITQDD  163

Query  1340  LLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFR  1161
             L H+ + + + LNF++HTS + W+ESQ++KPI+VDP LYLA  + +F AT++RP PD+F+
Sbjct  164   LSHVFASVNRSLNFIDHTSDLAWKESQRIKPIVVDPALYLARRTQLFTATEKRPTPDAFK  223

Query  1160  VFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIIN  981
             VF GS +++LSR FL++CI G EN PR LLMY +N   S+  YF TV+CN+ +F+ T +N
Sbjct  224   VFTGSPWTVLSRSFLEYCIFGWENLPRILLMYFNNVILSEECYFHTVICNAPEFSNTTVN  283

Query  980   HNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKP  807
              +L+Y+  +S  + E   L  SDF  M +SGAAFA  FK+ DP+LD +D EIL R   + 
Sbjct  284   GDLRYMIWDSPPKMEPHFLTVSDFDQMAQSGAAFARQFKKDDPVLDMVDREILRRGRYRV  343

Query  806   VPGGWCLGNGE--SGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              PG WC   G   +  C+ WGD +V++ G  AK+L++  +        Q+ QC
Sbjct  344   TPGAWCASRGSWWNDPCSEWGDVNVVKAGPQAKKLDETIVNFLDDLNSQTNQC  396



>gb|KHN19785.1| Xylosyltransferase 2 [Glycine soja]
Length=415

 Score =   345 bits (884),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/348 (46%), Positives = 241/348 (69%), Gaps = 4/348 (1%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             P + Y ++ + G+  ++ R+L AVYHPRN+YLLHLD  A  ++R  LA  V +  +  A 
Sbjct  67    PRLTYMLTATKGEGAQLKRVLQAVYHPRNYYLLHLDLEASDAERLELAKYVKSETVLAAF  126

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHIL  1326
              NV V+G  D V  KG + ++STLHG ++LL+ + +WDW INLS++DYPL++QDD+LHI 
Sbjct  127   GNVLVVGKPDLVTYKGPTMIASTLHGIALLLKRAPHWDWLINLSASDYPLLSQDDILHIF  186

Query  1325  SYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGS  1146
             S+LP+DLNF+ HTS IGW+E Q+ +PII+DPGLY ++ S V++A ++R +P SF++F GS
Sbjct  187   SFLPRDLNFIEHTSNIGWKEHQRARPIIIDPGLYHSKKSGVYWAKEKRSVPSSFKLFTGS  246

Query  1145  SYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQY  966
             ++ +L++ FL+FC+ G +N PRTLLMY +N  SS   YF TV+CN + +  T INH+L+Y
Sbjct  247   AWVVLTKSFLEFCVWGWDNLPRTLLMYYTNFLSSPEGYFHTVICNHKDYQNTTINHDLRY  306

Query  965   VSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGW  792
             +  ++  ++    L    F DM+ SGA FA  F + DP+L++ID E+L RS G   PGGW
Sbjct  307   IRWDNPPKQHPVFLKLEHFDDMVHSGAPFARKFTKDDPVLNKIDKELLRRSDGHFTPGGW  366

Query  791   CLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             C+GN   G+  CAV+G+  V++P + +K+LEK  ++L     F+ +QC
Sbjct  367   CIGNPLLGKDPCAVYGNPIVVKPTLQSKKLEKLIVKLLDSENFRPKQC  414



>gb|KDO64720.1| hypothetical protein CISIN_1g039162mg [Citrus sinensis]
Length=406

 Score =   344 bits (883),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 228/359 (64%), Gaps = 14/359 (4%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  GD  RI RLL A+YHPRN YLLHL   A   +R  LA +V +VP  RA
Sbjct  47    PPAFAYYISGGTGDKDRIFRLLLALYHPRNRYLLHLAADASDDERLKLAAAVRSVPAVRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D V   GSS++++ L  A+ILL++   W+WFI LS+ DYPLVTQDDL H 
Sbjct  107   FGNVDVVGKPDRVNFVGSSNVAAVLRAAAILLKVDKGWNWFIALSALDYPLVTQDDLAHA  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFR-  1152
              S + +DLNF++HTS +GW+ESQ+++P+IVDPGLYLA  S +F AT++RP PD+F+VF  
Sbjct  167   FSSVRRDLNFIDHTSDLGWKESQRIQPVIVDPGLYLARKSQIFQATEKRPTPDAFKVFTG  226

Query  1151  ---------GSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQF  999
                      GS + +LSR FL+FC+ G +N PRTLLMY +N      VYF +V+CN+ +F
Sbjct  227   RTERGSCIAGSQWFVLSRSFLEFCVFGWDNLPRTLLMYFNNVMLPQEVYFHSVICNAPEF  286

Query  998   NRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILH  825
               T IN +L+Y+  ++  + E   LN SD+  M++SG  FA  F++ DP L+ ID +IL 
Sbjct  287   KNTTINSDLRYMIWDNPPKMEPHFLNVSDYDQMVQSGVVFARQFQKDDPALNMIDEKILK  346

Query  824   RSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             R   +  PG WC G        C  WGD +VL+PG  A +LE     L      QS QC
Sbjct  347   RGHNRAAPGAWCTGQRSWWMDPCTQWGDVNVLKPGQQATKLEDTITNLLDDWSSQSNQC  405



>gb|EPS61904.1| hypothetical protein M569_12889, partial [Genlisea aurea]
Length=422

 Score =   345 bits (884),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 170/350 (49%), Positives = 237/350 (68%), Gaps = 3/350 (1%)
 Frame = -2

Query  1694  PRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLF  1515
             P PP +AY ISGSAGD   + R L A+YHP N YL+HLD  +   +R  L   V    +F
Sbjct  73    PSPPRLAYLISGSAGDGSMLRRTLEALYHPNNKYLVHLDADSSAEERRHLYDYVANHSIF  132

Query  1514  RAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLL  1335
                +NV ++  A+ V  KG + +++TLH A++LLR   +WDWFINLS+ADYPLVTQDDLL
Sbjct  133   GRFKNVEMITKANLVTYKGPTMVANTLHAAAVLLRNGGDWDWFINLSAADYPLVTQDDLL  192

Query  1334  HILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVF  1155
             H  SYLP+DLNF++HTS IGW+E  + KP+I+DPGLY+A+ S+VF+ TQ+R +P  F++F
Sbjct  193   HTFSYLPRDLNFIDHTSSIGWKEFLRAKPVIIDPGLYMAKKSEVFWITQRRSVPTKFKLF  252

Query  1154  RGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHN  975
              GS++ +LSR F+D+ I G +N PRT+LMY +N  SS  VYF TV+CN+ +F+ T +N +
Sbjct  253   TGSAWMVLSRPFIDYLIWGWDNLPRTVLMYSANFVSSPEVYFHTVICNAPEFSNTTVNSD  312

Query  974   LQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVP  801
             L ++S ++  ++    L  S +  MI S A FA  F+ RDP+LD+ID E+L R  G  VP
Sbjct  313   LHFISWDNPPKQHPHYLTLSHWDLMIASSAPFARKFRHRDPVLDRIDRELLFRQEGMVVP  372

Query  800   GGWCLG-NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             GGWC+  NG S  C+V G+  V+RP  GAKRL+     L +   F+ +QC
Sbjct  373   GGWCIARNGSSDPCSVVGNISVVRPTSGAKRLQNLVSFLLSEENFRPRQC  422



>ref|XP_006448297.1| hypothetical protein CICLE_v10015447mg [Citrus clementina]
 gb|ESR61537.1| hypothetical protein CICLE_v10015447mg [Citrus clementina]
Length=406

 Score =   344 bits (883),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 229/359 (64%), Gaps = 14/359 (4%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AYYISG  GD  RI RLL A+YHPRN YLLHL   A   +R  LA +V +VP  RA
Sbjct  47    PPAFAYYISGGTGDKDRIFRLLLALYHPRNRYLLHLAADASDDERLKLAAAVRSVPAVRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D V   GSS++++ L  A+ILL++   W+WFI LS+ DYPLVTQDDL H 
Sbjct  107   FGNVDVVGKPDRVNFVGSSNVAAVLRAAAILLKVDKGWNWFIALSALDYPLVTQDDLAHA  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFR-  1152
              S + +DLNF++HTS +GW+ESQ+++P+IVDPGLYLA  S +F AT++RP PD+F+VF  
Sbjct  167   FSSVRRDLNFIDHTSDLGWKESQRIQPVIVDPGLYLARKSQIFQATEKRPTPDAFKVFTG  226

Query  1151  ---------GSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQF  999
                      GS + +LSR FL+FC+ G +N PRTLLMY +    S  VYF +V+CN+ +F
Sbjct  227   RTERGSCIAGSQWFVLSRSFLEFCVFGWDNLPRTLLMYFNIVMLSQEVYFHSVICNAPEF  286

Query  998   NRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILH  825
               T IN +L+Y+  ++  + E   LN SD+  M++SG  FA  F++ DP+L+ ID +IL 
Sbjct  287   KNTTINSDLRYMIWDNPPKMEPHFLNVSDYDQMVQSGVVFARQFQKDDPVLNMIDEKILK  346

Query  824   RSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             R   +  PG WC G        C  WGD +VL+PG  A +LE     L      QS QC
Sbjct  347   RGHNRVAPGAWCTGQRSWWMDPCTQWGDVNVLKPGQQATKLEDTITNLLDDWSSQSNQC  405



>emb|CAN64646.1| hypothetical protein VITISV_030959 [Vitis vinifera]
Length=404

 Score =   344 bits (882),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 167/354 (47%), Positives = 238/354 (67%), Gaps = 4/354 (1%)
 Frame = -2

Query  1703  SPPPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTV  1524
             +P   PP +AY ISG+ GD G + R L A+YHP N Y++HLD  +P+ +R  L   +   
Sbjct  50    TPVSLPPRLAYLISGTVGDCGALKRTLQALYHPHNLYIIHLDLESPQIERSHLRDYIRNH  109

Query  1523  PLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQD  1344
             P F + +NV +M  A+ V  +G + +++TLH A+ILL    +WDWFINLS++DYPLVTQD
Sbjct  110   PAFSSVKNVWMMEKANLVTYRGPTMVANTLHAAAILLXEGGDWDWFINLSASDYPLVTQD  169

Query  1343  DLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSF  1164
             DLLH  SYLP+DLNFV+HTS IGW+E Q+ KPIIVDPGLY+ + ++VF+  Q+R +P +F
Sbjct  170   DLLHTFSYLPRDLNFVDHTSNIGWKEFQRAKPIIVDPGLYMTKKNNVFWVKQRRSVPTAF  229

Query  1163  RVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTII  984
             ++F GS++  LSR F+D+CI G +N PRT+LMY +N  SS   YF TV+CN+ +F  T +
Sbjct  230   KLFTGSAWVALSRXFIDYCIWGWDNLPRTVLMYYTNFVSSPEGYFHTVICNAEEFRNTTV  289

Query  983   NHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGK  810
             N +L ++S ++  ++   +L  +D   MI S A FA  F   DP+LD+ID+E+L R P  
Sbjct  290   NSDLHFISWDNPPKQHPHLLTITDMSKMISSNAPFARKFXRDDPVLDKIDAELLSRRPDM  349

Query  809   PVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              VPG WC+G+  +G   C V G+  VL+PG GAKRL    + L +   F+ +QC
Sbjct  350   LVPGAWCIGSSSNGTDPCXVVGNPSVLKPGPGAKRLXNLLVSLLSKQNFRPRQC  403



>ref|XP_010255890.1| PREDICTED: xylosyltransferase 1-like [Nelumbo nucifera]
Length=427

 Score =   345 bits (884),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 166/346 (48%), Positives = 237/346 (68%), Gaps = 4/346 (1%)
 Frame = -2

Query  1679  IAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARN  1500
             +AY ISGS GD   + R L A+YHP N Y++HLD  +   +R  L   +   P+F +  N
Sbjct  81    LAYLISGSVGDGEMLKRTLQALYHPFNRYVVHLDLESSPQERLDLHDYIKNHPVFSSVGN  140

Query  1499  VHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSY  1320
             V ++  A+ V  +G + +++TLH A+ILL+   +WDWFINLS++DYPLVTQDDLLH  S+
Sbjct  141   VWMITKANLVTYRGPTMVANTLHAAAILLKKGGDWDWFINLSASDYPLVTQDDLLHTFSH  200

Query  1319  LPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSY  1140
             LP+DLNF++HTS IGW+E Q+ KPII+DPGLY+ + +DVF+ TQ+R +P +F++F GS++
Sbjct  201   LPRDLNFIDHTSDIGWKEFQRAKPIIIDPGLYMTKKADVFWVTQRRSVPTAFKLFTGSAW  260

Query  1139  SILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVS  960
               LSR F+DFCI G +N PRT+LMY +N  SS   YF TV+CN+ +F  T +N +L ++S
Sbjct  261   MALSRPFIDFCIWGWDNLPRTVLMYYANFISSPEGYFHTVICNAPEFRNTTVNSDLHFIS  320

Query  959   LNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCL  786
              ++  ++    L  +D   MI S A FA  F   DP+LD+ID+E+L R PG  VPGGWC+
Sbjct  321   WDNPPKQHPHHLTLNDMSRMIESNAPFARKFHRDDPVLDKIDAELLSRGPGMLVPGGWCM  380

Query  785   GNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             G+ ++G   C V G++ VLRPG GAKRLE   + L +   F+ +QC
Sbjct  381   GSRKNGSDPCLVAGNSTVLRPGSGAKRLETLVVSLLSDDNFRPRQC  426



>ref|XP_004963343.1| PREDICTED: xylosyltransferase 1-like [Setaria italica]
Length=426

 Score =   344 bits (883),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/372 (47%), Positives = 244/372 (66%), Gaps = 14/372 (4%)
 Frame = -2

Query  1727  VLIHGDLSSPPPRP-----PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPK  1563
             + +   LS  PP P     P IA+ ISGSA D+  + R+L A+YHPRN Y+LHLD  AP 
Sbjct  54    LFVEHKLSPTPPSPAGASLPRIAFLISGSAKDASALRRVLLALYHPRNRYILHLDAEAPD  113

Query  1562  SDRDLLALSVNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILL-----RISSN  1398
             SDR  LA ++   P+  AA NV V+  A+ +  +G + +++TLH A+  L        S+
Sbjct  114   SDRRDLAAALAAHPVIAAADNVRVVDRANLITYRGPTMVANTLHAAAAFLWGHAGDGGSD  173

Query  1397  WDWFINLSSADYPLVTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLA  1218
             WDWFINLS++DYPLVTQDDL+H+ S LP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ 
Sbjct  174   WDWFINLSASDYPLVTQDDLIHVFSKLPRDLNFIDHTSDIGWKEFQRAKPVIIDPGLYMK  233

Query  1217  EDSDVFYATQQRPLPDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDA  1038
             + +DVF+  Q+R +P +F++F GS++  LSR F+++CI G +N PRT+LMY SN  SS  
Sbjct  234   KKADVFWIPQRRSVPTAFKLFTGSAWMALSRPFVEYCIWGWDNLPRTVLMYYSNFISSPE  293

Query  1037  VYFPTVLCNSRQFNRTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKER  864
              YF TV+CN+ +F  T +NH+L Y+S ++  ++    L   D   M+ S A FA  F   
Sbjct  294   GYFHTVVCNAEEFKNTTVNHDLHYISWDNPPKQHPHYLTVEDLDRMVASDAPFARKFHAD  353

Query  863   DPILDQIDSEILHRSPGKPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIE  690
             DP+LD+ID EIL RS   P PGGWC G  E+G   C+V GD  +LRPG GA RL++    
Sbjct  354   DPVLDRIDGEILSRSVDMPTPGGWCAGTRENGSDPCSVIGDTSLLRPGRGAVRLQRLMTS  413

Query  689   LFAGGRFQSQQC  654
             L +  +F  +QC
Sbjct  414   LLSEEKFHPRQC  425



>ref|XP_002892166.1| glycosyltransferase family 14 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68425.1| glycosyltransferase family 14 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=447

 Score =   345 bits (885),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/349 (48%), Positives = 242/349 (69%), Gaps = 6/349 (2%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R  LA+SV + P FR 
Sbjct  100   PPRLAYLISGTKGDSHRMMRTLQAVYHPRNQYVLHLDLEAPPRERMELAMSVKSDPTFRE  159

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV VM  ++ V  KG + ++ TL   +ILLR S  WDWF+NLS++DYPLVTQDDLL++
Sbjct  160   MENVRVMSQSNLVTYKGPTMIACTLQAVAILLRESLYWDWFLNLSASDYPLVTQDDLLYV  219

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S L +++NF+ +    GW+ +Q+ K IIVDP LYL++ SD+ + TQ+R LP+SF++F G
Sbjct  220   FSNLSRNVNFIENMQLTGWKLNQRAKSIIVDPALYLSKKSDIAWTTQRRSLPNSFKLFTG  279

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S++ +L+R FL++CI G +NFPRT+LMY +N  SS   YF TV+CNS++F  T I H+L 
Sbjct  280   SAWIMLTRSFLEYCIWGWDNFPRTILMYYTNFVSSPEGYFHTVICNSKEFINTAIGHDLH  339

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y++ +S  ++  R L+  DF +M++S A FA  F + DP LD+ID E+L R+  +  PGG
Sbjct  340   YIAWDSPPKQHPRSLSLKDFDNMVKSKAPFARKFHKNDPALDKIDKELLGRT-HRFAPGG  398

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC+G+  +G   C+V GD  VL+PG G+ RL++  ++  +   F+ +QC
Sbjct  399   WCIGSSANGNDPCSVKGDDSVLKPGPGSARLQE-LVQTLSSDEFRRKQC  446



>ref|XP_007143027.1| hypothetical protein PHAVU_007G037400g [Phaseolus vulgaris]
 gb|ESW15021.1| hypothetical protein PHAVU_007G037400g [Phaseolus vulgaris]
Length=396

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/349 (47%), Positives = 228/349 (65%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AY+ISG   D  RI+RLL AVYHPRN YLLHL R A   +R  L  +   VP  RA
Sbjct  47    PPAFAYFISGGHKDKDRILRLLLAVYHPRNRYLLHLGRDARDDERKALVAATRAVPAIRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G AD+V   GSS+++  L  A+I+L++ S W+WFI LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKADYVTYLGSSNVAIALRAAAIMLKLDSGWNWFITLSALDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HT  +GW+E+ + +PI+VDPGLYLA  S +F AT++R  P++F++F G
Sbjct  167   FSSVRRDLNFIDHTGDLGWKETDRFQPIVVDPGLYLARKSQIFQATEKRATPNAFKLFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCI G +N PRTLLMY +N   S   YF +V+CN+ +F  T +N +L+
Sbjct  227   SPWVILSRPFLEFCIFGWDNLPRTLLMYFTNVKLSQEGYFHSVICNAPEFKNTTVNGDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LN+S +  M+ SGAAFA  F   +P+LD ID +ILHR   +  PG 
Sbjct  287   YIVWDNPPKMEPLFLNASFYDQMVESGAAFARQFHLNNPVLDMIDEKILHRGSHRATPGM  346

Query  794   WCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G  +     C+ WGD +++ PG  AK LE     L  G   Q+ QC
Sbjct  347   WCTGRRSWWVDPCSQWGDVNLVEPGPQAKNLEGSVANLLDGWNSQTNQC  395



>ref|XP_010256416.1| PREDICTED: xylosyltransferase 1-like [Nelumbo nucifera]
Length=403

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 232/334 (69%), Gaps = 5/334 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ +YYISG  G   RI+RLL AVYHPRN YLLHL   A   +R  LA++V  VP  +A
Sbjct  53    PPAFSYYISGGRGHKDRILRLLLAVYHPRNRYLLHLGTDASYRERRQLAVAVRAVPAIQA  112

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G  D     GSS++++TL  A+ILL++ S WDWFI LS ADYPL+TQDDL H+
Sbjct  113   FGNVDVLGKPDAATYMGSSNVAATLRAAAILLKVDSGWDWFITLSVADYPLLTQDDLFHV  172

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSD-VFYATQQRPLPDSFRVFR  1152
              S + +DLNF++HTS +GW+E Q+++PI+VDPG+YLA   + +F+A+++RP P++FR F 
Sbjct  173   FSTVRRDLNFIDHTSDLGWKEYQRVQPIVVDPGIYLARRGNKIFHASEKRPTPETFRFFT  232

Query  1151  GSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNL  972
             GS + ILSR FL+FC+ G +N PR+LLMY +N   S+  YF +V+CNS +F  T +N +L
Sbjct  233   GSPWVILSRPFLEFCVFGWDNLPRSLLMYFTNVALSEEGYFHSVICNSPEFQNTTVNSDL  292

Query  971   QYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPG  798
             +++  ++  + E   LN+SDF  M++SGAAFA  F++ DP+LD +D +IL R   +P PG
Sbjct  293   RFMIWDNPPKMEPHFLNTSDFDLMVQSGAAFARQFQKDDPVLDMVDEKILMRGHRRPAPG  352

Query  797   GWCLGNGE--SGRCAVWGDADVLRPGVGAKRLEK  702
              WC G     +  C+ WGD +++RPG  A++  +
Sbjct  353   AWCTGKRSWWTDPCSKWGDVNIVRPGPQARKFAE  386



>ref|XP_010278355.1| PREDICTED: xylosyltransferase 1-like [Nelumbo nucifera]
 ref|XP_010278356.1| PREDICTED: xylosyltransferase 1-like [Nelumbo nucifera]
 ref|XP_010278357.1| PREDICTED: xylosyltransferase 1-like [Nelumbo nucifera]
Length=446

 Score =   345 bits (884),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 238/348 (68%), Gaps = 5/348 (1%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             P IAY ISG+ GD+ R+ R L AVYHPRN Y+LHLD  AP  +R  L  ++   P FR  
Sbjct  87    PRIAYLISGTKGDTRRMRRTLQAVYHPRNQYILHLDLEAPPRERIELTTTIKIDPTFRQV  146

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHIL  1326
              NV VM  ++ V  +G + ++STL   +I+L+ S +WDWFINLS++DYPLVTQDDLLH+ 
Sbjct  147   ENVRVMAQSNLVTYRGPTMIASTLQAVAIMLKESIDWDWFINLSASDYPLVTQDDLLHVF  206

Query  1325  SYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGS  1146
             + L +DLNF+ HT  IGW+ +Q+ +PIIVDPGLYL++ S++F+ TQ+R LP  F++F GS
Sbjct  207   TNLSRDLNFIEHTPIIGWKLNQRARPIIVDPGLYLSKKSNIFWTTQRRSLPTFFKLFTGS  266

Query  1145  SYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQY  966
             ++ +LSR FL++CI G +N PRTLLMY +N  SS   YF TV+CN+ +F  T ++H+L Y
Sbjct  267   AWVMLSRSFLEYCIWGWDNLPRTLLMYYTNFVSSPEGYFHTVICNTEEFRNTAVSHDLHY  326

Query  965   VSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGW  792
             ++ ++  ++  R L   D   M++SGA FA  F + DP+LD+ID E+L R   +  PG W
Sbjct  327   IAWDNPPKQHPRSLTMKDLNGMVKSGAPFARKFAKDDPVLDKIDKELLGRPKDQFAPGAW  386

Query  791   CLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             C+G+ + G   C++ G+  V  PGVGA+RL++   +L +   + S++C
Sbjct  387   CIGSSDGGSDPCSLRGNDSVFSPGVGAERLKELLQKLLSEDLY-SKRC  433



>ref|XP_009784590.1| PREDICTED: xylosyltransferase 2-like [Nicotiana sylvestris]
 ref|XP_009784591.1| PREDICTED: xylosyltransferase 2-like [Nicotiana sylvestris]
Length=421

 Score =   343 bits (881),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 231/343 (67%), Gaps = 5/343 (1%)
 Frame = -2

Query  1676  AYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAARNV  1497
             AY ISGS GD  ++ R L A+YHPRN+Y++HLD  +P  +R  LA  V   P+F    NV
Sbjct  81    AYLISGSKGDLEKLWRTLQALYHPRNYYVVHLDLESPPQERLELASRVEKDPIFAQVGNV  140

Query  1496  HVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHILSYL  1317
             H++  A+ V  +G + +++TLH  +ILL+  ++WDWFINLS++DYPLVTQDDL++  S L
Sbjct  141   HMIAKANMVTYRGPTMVANTLHACAILLKKYTDWDWFINLSASDYPLVTQDDLIYTFSDL  200

Query  1316  PKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRGSSYS  1137
              ++ NF+ HTS +GW+E Q+  P+IVDPGLY    SD+++A+ +R LP SF++F GS++ 
Sbjct  201   KREFNFIEHTSRLGWKEGQRAMPLIVDPGLYKTTKSDIYWASPKRALPTSFKLFTGSAWM  260

Query  1136  ILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQYVSL  957
             ILSR F+++CI G +N PRTLLMY +N  SS   YF TV+CN+ +F  T+INH++ Y+S 
Sbjct  261   ILSRAFVEYCIWGWDNLPRTLLMYYTNFVSSPEGYFQTVVCNAPEFATTVINHDMHYISW  320

Query  956   N--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGGWCLG  783
             +   R+    LN +D   MI S AAFA  FK+ DP+LD+ID E+LHRS G   PGGWC G
Sbjct  321   DYPPRQHPHTLNINDTAKMIGSDAAFARKFKQDDPVLDKIDKELLHRSNGSFTPGGWCSG  380

Query  782   NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
                  RC+  G+   L+PG GAKRL +   +L    +F   QC
Sbjct  381   K---PRCSKVGNLTKLKPGPGAKRLRRLIGKLVLTAKFSQHQC  420



>gb|ABF70128.1| glycosyl transferase family 14 protein [Musa balbisiana]
Length=408

 Score =   343 bits (880),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/356 (47%), Positives = 235/356 (66%), Gaps = 8/356 (2%)
 Frame = -2

Query  1706  SSPPP---RPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALS  1536
             ++PPP   R P +AY ISGS GD  R+ R L A+YHPRN Y++HLD  +P S+R  LAL 
Sbjct  55    AAPPPVGSRIPRLAYLISGSKGDLDRLWRTLRALYHPRNIYVVHLDLESPASERLELALR  114

Query  1535  VNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPL  1356
             V    +     NVHV+  A+ V  +G + ++STLH  +ILL+ S  WDWFINLS++DYPL
Sbjct  115   VANDTVLSTVGNVHVVEKANMVTYRGPTMVASTLHACAILLKESKEWDWFINLSASDYPL  174

Query  1355  VTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPL  1176
             VTQDD+LH+ S LP++++FV HTS +GW+E Q+ KP++VDPGLY+   +DVF+ +Q+R +
Sbjct  175   VTQDDILHVFSSLPRNISFVEHTSRLGWKEGQRAKPLMVDPGLYMTRKTDVFWVSQKREV  234

Query  1175  PDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFN  996
             P +F++F GS++  L+R+F +FC+ G +N PR LLMY +N  SS   YF TV+CN+ +F+
Sbjct  235   PTAFKLFTGSAWVALTREFAEFCVWGWDNLPRILLMYYTNFVSSPEGYFQTVICNAPEFS  294

Query  995   RTIINHNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHR  822
              T+ NH+L Y+S +   ++    L+  D   MI S A FA  FK  DP+LDQID+E+L R
Sbjct  295   VTVANHDLHYISWDVPPKQHPHTLSMDDLPKMIGSNAPFARKFKRDDPVLDQIDAELLGR  354

Query  821   SPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             + G  VPGGWC G   +  C   GD   L+PG GA+RL      +    +F   QC
Sbjct  355   AKGSFVPGGWCAG---APLCTEIGDPTRLQPGPGAERLAALMDVIVRSKKFTQNQC  407



>ref|XP_004496976.1| PREDICTED: xylosyltransferase 1-like [Cicer arietinum]
Length=396

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 230/349 (66%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP+ AY+ISG  GD  +I RLL A+YHPRN YLLH+   A   +R  LA SV++VP  RA
Sbjct  47    PPAFAYFISGGHGDKDQIFRLLLAIYHPRNRYLLHIGMDARNEERQSLADSVSSVPAIRA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G AD++   GSS+++ TL  A+I+L++ S W+WFI LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVVGKADWITYLGSSNVAITLRAAAIMLKLDSGWNWFITLSARDYPLITQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + +DLNF++HT  +GW+ES + +PI+VDPG YLA  S  F AT++R  PD+F++F G
Sbjct  167   FSSVNRDLNFIDHTGDLGWKESDRFQPIVVDPGTYLARKSKTFQATEKRTTPDAFKLFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + ILSR FL+FCI G +N PRTLLMY +N   S   YF +V+CN+ +F  T +N +L+
Sbjct  227   SPWVILSRPFLEFCIFGWDNLPRTLLMYFTNVKLSQEGYFHSVICNAPEFKNTTVNGDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  ++  + E   LNSS +  M  SGAAFA  F+  +P+LD ID +IL R   +  PG 
Sbjct  287   YMIWDNPPKMEPLFLNSSVYDMMAESGAAFARKFEVNNPVLDMIDEKILQRGHNRAAPGA  346

Query  794   WCLG--NGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC G  +     C+ WGD ++L+PG  AK+LE     L      Q+ QC
Sbjct  347   WCSGRRSWWVDPCSQWGDVNILKPGPQAKKLEASVSSLLDDWTAQTNQC  395



>ref|XP_010427921.1| PREDICTED: xylosyltransferase 1-like [Camelina sativa]
Length=395

 Score =   342 bits (877),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/352 (46%), Positives = 231/352 (66%), Gaps = 4/352 (1%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             P  PP+ AYYI+G  GD+ RI RLL AVYHPRN YLLHL   A  ++R  L   + +VP 
Sbjct  43    PHYPPAFAYYITGGRGDNDRIFRLLLAVYHPRNRYLLHLGAEATDAERLALLSDLKSVPA  102

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
               A  NV V+G  D +   G+S  ++TLH  SILL++   W+WFI LS+ DYPL+TQDDL
Sbjct  103   VNAFGNVDVLGKVDRLSDNGASKTAATLHAVSILLKLDRTWNWFIELSALDYPLITQDDL  162

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
              H+ + + + LNF++HTS + W+ESQ++KPI+VDP LYLA  + +F AT++RP PD+F+V
Sbjct  163   SHVFASVNRSLNFIDHTSDLAWKESQRIKPIVVDPALYLARRTQLFTATEKRPTPDAFKV  222

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS + +LSR FL++CI G +N PRTLLMY +N   S+  YF TV+CN+ +F+ T +N 
Sbjct  223   FTGSPWIVLSRSFLEYCIFGWDNLPRTLLMYFNNVILSEECYFHTVICNAPEFSNTTVNG  282

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L+Y+  +S  + E   L+ SDF  M +SGAAFA  FK+ DP+LD +D EIL R   +  
Sbjct  283   DLRYMIWDSPPKMEPHFLSVSDFDQMAQSGAAFARQFKKDDPVLDMVDREILKRGRYRVT  342

Query  803   PGGWCLGNGE--SGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PG WC  +    +  C+ WG+ ++++ G  AK+L++           QS QC
Sbjct  343   PGAWCSSHSSWWTDPCSEWGEVNIVKAGPQAKKLDETITNFLDDLNSQSNQC  394



>ref|XP_009389364.1| PREDICTED: xylosyltransferase oxt-like [Musa acuminata subsp. 
malaccensis]
Length=427

 Score =   343 bits (880),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/356 (47%), Positives = 235/356 (66%), Gaps = 8/356 (2%)
 Frame = -2

Query  1706  SSPPP---RPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALS  1536
             ++PPP   R P +AY ISGS GD  R+ R L A+YHPRN Y++HLD  +P S+R  LAL 
Sbjct  74    AAPPPVGSRIPRLAYLISGSKGDLDRLWRTLRALYHPRNIYVVHLDLESPASERLELALR  133

Query  1535  VNTVPLFRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPL  1356
             V    +     NVHV+  A+ V  +G + ++STLH  +ILL+ S  WDWFINLS++DYPL
Sbjct  134   VANDTVLSTVGNVHVVEKANMVTYRGPTMVASTLHACAILLKESKEWDWFINLSASDYPL  193

Query  1355  VTQDDLLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPL  1176
             VTQDD+LH+ S LP++++FV HTS +GW+E Q+ KP++VDPGLY+   +DVF+ +Q+R +
Sbjct  194   VTQDDILHVFSSLPRNISFVEHTSRLGWKEGQRAKPLMVDPGLYMTRKTDVFWVSQKREV  253

Query  1175  PDSFRVFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFN  996
             P +F++F GS++  L+R+F +FC+ G +N PR LLMY +N  SS   YF TV+CN+ +F+
Sbjct  254   PTAFKLFTGSAWVALTREFAEFCVWGWDNLPRILLMYYTNFVSSPEGYFQTVICNAPEFS  313

Query  995   RTIINHNLQYVSLN--SRKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHR  822
              T+ NH+L Y+S +   ++    L+  D   MI S A FA  FK  DP+LDQID+E+L R
Sbjct  314   VTVANHDLHYISWDVPPKQHPHTLSMDDLPKMIGSNAPFARKFKRDDPVLDQIDAELLGR  373

Query  821   SPGKPVPGGWCLGNGESGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             + G  VPGGWC G   +  C   GD   L+PG GA+RL      +    +F   QC
Sbjct  374   AKGSFVPGGWCAG---APLCTEIGDPTRLQPGPGAERLAALMDVIVRSKKFTQNQC  426



>emb|CDX72774.1| BnaC06g32220D [Brassica napus]
Length=397

 Score =   342 bits (877),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 232/353 (66%), Gaps = 5/353 (1%)
 Frame = -2

Query  1697  PPRPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPL  1518
             P  PP+ AYYI+G  GD  RI RLL AVYHPRN YLLHL   A +++R  L   + TVP 
Sbjct  44    PHHPPAFAYYITGGCGDGDRIFRLLLAVYHPRNRYLLHLGAEATEAERLSLLSRLKTVPA  103

Query  1517  FRAARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDL  1338
               A  NV V+G  D +   G+S  +STLH  SILL++  +W+WFI LS+ DYPL+TQDDL
Sbjct  104   VNAFGNVDVLGKVDRLSDNGASKTASTLHAVSILLKLGRSWNWFIELSALDYPLITQDDL  163

Query  1337  LHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRV  1158
              H+ + + + +NF++HTS + W+ESQ++KPI+VDP LYLA  + +F AT++RP PD+F+V
Sbjct  164   SHVFASVNRSINFIDHTSDLSWKESQRIKPIVVDPALYLARRTQLFTATEKRPTPDAFKV  223

Query  1157  FRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINH  978
             F GS + +LSR FL++CI G +N PRTLLMY +N   S+  YF TV+CN+ +F+ T +N 
Sbjct  224   FTGSPWIVLSRSFLEYCIFGWDNLPRTLLMYFNNVILSEECYFHTVICNAPEFSNTTVNG  283

Query  977   NLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPV  804
             +L+Y+  +S  + E   L+ SD+ +M +SGAAFA  FK+ DP+LD +D EIL R   +  
Sbjct  284   DLRYMIWDSPPKMEPHFLSVSDYDEMAQSGAAFARQFKKDDPVLDMVDREILKRGRFRVT  343

Query  803   PGGWCLGNGESGR---CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             PG WC     S     C+ WGD +V++ G  AK+L++           ++ QC
Sbjct  344   PGAWCARRHSSWWTDPCSEWGDVNVVKGGPQAKKLDETVTNFLDDLSSETNQC  396



>gb|AAS88559.1| glycosylation enzyme-like protein [Triticum monococcum]
 emb|CAH10044.1| BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein [Triticum aestivum]
 emb|CAJ13540.1| unnamed protein product [Triticum aestivum]
Length=425

 Score =   343 bits (879),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 237/355 (67%), Gaps = 11/355 (3%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             P IAY ISGSA D+  + R+L A+YHPRN Y+LHLD  AP+SDR  LA  +   P+  AA
Sbjct  70    PRIAYVISGSAKDASALRRVLLALYHPRNLYVLHLDAEAPESDRRDLAAGLAAHPVIAAA  129

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILL-----RISSNWDWFINLSSADYPLVTQDD  1341
              NV V+  A+ V  +G + ++STLH A+ LL        S+WDWFINLS++DYPLVTQDD
Sbjct  130   GNVRVVERANLVTYRGPTMVASTLHAAAALLWGHSGAGGSDWDWFINLSASDYPLVTQDD  189

Query  1340  LLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFR  1161
             L+H+ S LP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + +DVF+  Q+R +P +F+
Sbjct  190   LIHVFSKLPRDLNFIDHTSNIGWKEFQRAKPVIIDPGLYMKKKADVFWIPQRRSVPTAFK  249

Query  1160  VFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIIN  981
             +F GS++  LSR  +++ I G +N PRT+LMY SN  SS   YF TV+CN+ +F  T +N
Sbjct  250   LFTGSAWMALSRSLVEYSIWGWDNLPRTVLMYYSNFISSPEGYFHTVVCNAEEFKNTTVN  309

Query  980   HNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEIL--HRSPG  813
             H+L Y+S ++  ++    L   D   MI S A FA  F   +P+LD+ID+E+L  H  P 
Sbjct  310   HDLHYISWDNPPKQHPHYLTMDDLDRMIASDAPFARKFHADEPVLDRIDAELLSRHAGPD  369

Query  812   KPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              P PGGWC G G++G   C+V G+   L+PG GA RL++    L +  +F  +QC
Sbjct  370   APTPGGWCAGTGDNGSDPCSVVGNTSFLQPGRGAVRLQRLVTSLLSDEKFHPRQC  424



>ref|XP_010556817.1| PREDICTED: xylosyltransferase 1 [Tarenaya hassleriana]
 ref|XP_010556818.1| PREDICTED: xylosyltransferase 1 [Tarenaya hassleriana]
 ref|XP_010556819.1| PREDICTED: xylosyltransferase 1 [Tarenaya hassleriana]
 ref|XP_010556820.1| PREDICTED: xylosyltransferase 1 [Tarenaya hassleriana]
 ref|XP_010556821.1| PREDICTED: xylosyltransferase 1 [Tarenaya hassleriana]
Length=443

 Score =   343 bits (880),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 167/349 (48%), Positives = 239/349 (68%), Gaps = 6/349 (2%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PP +AY ISG+ GDS R++R L AVYHPRN Y+LHLD  AP  +R  LA+SV + P FR 
Sbjct  96    PPRLAYLISGTKGDSQRMMRTLQAVYHPRNQYILHLDLEAPPRERLELAMSVKSDPTFRE  155

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV VM  ++ V  KG + ++STL   SILL+ S  WDWF+NLS++DYPLVTQDDLLH+
Sbjct  156   VENVRVMAQSNLVTYKGPTMIASTLQAISILLKESLEWDWFLNLSASDYPLVTQDDLLHV  215

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S L +DLNF+ H    GW+ +Q+ + IIVDPGLYL++ SD+ + TQ+R LP SF++F G
Sbjct  216   FSNLSRDLNFIEHMRLTGWKLNQRGRSIIVDPGLYLSKKSDLAWTTQRRSLPTSFKLFTG  275

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S++ +L+R FL++CI G +NFPRT+LMY +N  SS   YF TV+CN+ +F  T I H+L 
Sbjct  276   SAWVLLTRSFLEYCIWGWDNFPRTVLMYYTNFVSSPEGYFHTVICNTGKFRGTAIGHDLH  335

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y++ ++  ++    L+  D+  M++S A FA  F +  P+LD+ID E+L R+  +  PG 
Sbjct  336   YIAWDNPPKQHPISLSMKDYEKMVKSKAPFARKFHKDSPVLDKIDKELLGRT-HRFSPGA  394

Query  794   WCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC+G+ E+G   C+V G+  V RPG GA+RL++  ++      F+ +QC
Sbjct  395   WCVGSLENGSDPCSVRGNDSVFRPGAGAERLQE-LVQTLLSEEFRRKQC  442



>ref|XP_006447365.1| hypothetical protein CICLE_v10015218mg [Citrus clementina]
 ref|XP_006469848.1| PREDICTED: xylosyltransferase 1-like [Citrus sinensis]
 gb|ESR60605.1| hypothetical protein CICLE_v10015218mg [Citrus clementina]
Length=450

 Score =   343 bits (880),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/350 (47%), Positives = 238/350 (68%), Gaps = 6/350 (2%)
 Frame = -2

Query  1691  RPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFR  1512
              PP +AY ISG+ GDS R++R L AVYHPRNHY+LHLD  AP  +R  LALSV   P+F 
Sbjct  102   EPPRLAYLISGTKGDSHRMMRTLQAVYHPRNHYILHLDLEAPPRERLDLALSVKNDPIFF  161

Query  1511  AARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLH  1332
                NV VM  ++ V  KG + ++ TL   +ILL+ S  WDWFINLS++DYPLVTQDD+L+
Sbjct  162   EVENVRVMLQSNLVTYKGPTMIACTLQAIAILLKESLEWDWFINLSASDYPLVTQDDMLY  221

Query  1331  ILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFR  1152
             + S + K+LNF+ HT   GW+ +Q+ KPIIVDPGLYL++ SD+ + TQ+R LP SF++F 
Sbjct  222   VFSNMSKNLNFIEHTLISGWKLNQRAKPIIVDPGLYLSKKSDIAWTTQRRSLPTSFKLFT  281

Query  1151  GSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNL  972
             GS++ +L+R+F+++CI G +N PRTLLMY +N  SS   YF TV+CN+ +F  T I+H+L
Sbjct  282   GSAWVMLTRRFVEYCIWGWDNLPRTLLMYYTNFISSPEGYFHTVICNTEEFRNTAISHDL  341

Query  971   QYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPG  798
              Y++ ++  ++    L   DF  M++S A FA  F + DP+LD+ID E+L R+  +  PG
Sbjct  342   HYIAWDNPPKQHPVKLTMKDFDKMVKSNAPFARKFAKDDPVLDKIDKELLGRT-NRFAPG  400

Query  797   GWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              WC+G+ E G   C + G+  + RPG GA+RL+   ++      F+ +QC
Sbjct  401   AWCIGSSEGGADPCTLRGNDSMFRPGPGAERLQA-LLQTLLSEDFRKKQC  449



>emb|CAH10066.1| BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein [Triticum turgidum]
 emb|CAJ13553.1| unnamed protein product [Triticum turgidum]
 gb|ACJ22501.1| beta-1-3-galactosyl-o-glycosyl-glycoprotein [Triticum aestivum]
Length=425

 Score =   342 bits (878),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 237/355 (67%), Gaps = 11/355 (3%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             P IAY ISGSA D+  + R+L A+YHPRN Y+LHLD  AP+SDR  LA  +   P+  AA
Sbjct  70    PRIAYVISGSAKDASALRRVLLALYHPRNLYVLHLDAEAPESDRRDLAAGLAAHPVIAAA  129

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILL-----RISSNWDWFINLSSADYPLVTQDD  1341
              NV V+  A+ V  +G + ++STLH A+ LL        S+WDWFINLS++DYPLVTQDD
Sbjct  130   GNVRVVERANLVTYRGPTMVASTLHAAAALLWGHSGAGGSDWDWFINLSASDYPLVTQDD  189

Query  1340  LLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFR  1161
             L+H+ S LP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + +DVF+  Q+R +P +F+
Sbjct  190   LIHVFSKLPRDLNFIDHTSNIGWKEFQRAKPVIIDPGLYMKKKADVFWIPQRRSVPTAFK  249

Query  1160  VFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIIN  981
             +F GS++  LSR  +++ I G +N PRT+LMY SN  SS   YF TV+CN+ +F  T +N
Sbjct  250   LFTGSAWMALSRSLVEYSIWGWDNLPRTVLMYYSNFISSPEGYFHTVVCNAEEFKNTTVN  309

Query  980   HNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEIL--HRSPG  813
             H+L Y+S ++  ++    L   D   MI S A FA  F   +P+LD+ID+E+L  H  P 
Sbjct  310   HDLHYISWDNPPKQHPHYLTMDDLDRMIASDAPFARKFYADEPVLDRIDAELLSRHAGPD  369

Query  812   KPVPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              P PGGWC G G++G   C+V G+   L+PG GA RL++    L +  +F  +QC
Sbjct  370   APTPGGWCAGTGDNGSDPCSVVGNTSFLQPGRGAVRLQRLVTSLLSDEKFHPRQC  424



>ref|XP_010552730.1| PREDICTED: xylosyltransferase 1 [Tarenaya hassleriana]
Length=396

 Score =   341 bits (875),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 165/349 (47%), Positives = 230/349 (66%), Gaps = 4/349 (1%)
 Frame = -2

Query  1688  PPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRA  1509
             PPS AYYI+G  GD  RI RLL AVYHPRN YLLHL   A   +R  L   + +V    A
Sbjct  47    PPSFAYYITGGRGDKDRIFRLLLAVYHPRNRYLLHLSADATDDERLTLVTDLKSVAAVNA  106

Query  1508  ARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLHI  1329
               NV V+G AD +   G S  +STLH  SILL++  +W+WFI LS+ DYPL+TQDDL H+
Sbjct  107   FGNVDVLGKADRLSHMGGSHTASTLHAVSILLKLDPSWNWFIQLSAFDYPLLTQDDLSHV  166

Query  1328  LSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFRG  1149
              S + ++L+F++HTS +GW+ESQ+++PI+VDP LYLA  + +F AT++RP PD+F+VF G
Sbjct  167   FSSVNRNLSFIDHTSDLGWKESQRIQPIVVDPALYLARRTQLFTATEKRPTPDAFKVFTG  226

Query  1148  SSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNLQ  969
             S + +LSR FL++CI G +N PR LLMY +N   S+  YF TV+CN+ +F  + IN +L+
Sbjct  227   SPWIVLSRSFLEYCIFGWDNLPRILLMYFNNVVLSEECYFHTVICNAPEFRNSAINGDLR  286

Query  968   YVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPGG  795
             Y+  +S  + E   LN SD+  M +SG+AFA  F++ DP+LD ID EIL R   +  PG 
Sbjct  287   YMIWDSPPKMEPHFLNVSDYEQMAQSGSAFARQFQQDDPVLDMIDREILKRGRYRVTPGA  346

Query  794   WCLGNGE--SGRCAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
             WC  +G   +  C+ W + +V++PG  AK+LE+    L      Q+ QC
Sbjct  347   WCSRHGSWWTDSCSQWDNVNVVKPGPQAKKLEETITNLLDDWNSQANQC  395



>ref|XP_011100343.1| PREDICTED: xylosyltransferase 1-like [Sesamum indicum]
Length=436

 Score =   342 bits (878),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 166/350 (47%), Positives = 238/350 (68%), Gaps = 6/350 (2%)
 Frame = -2

Query  1691  RPPSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFR  1512
              PP +AY ISG+ GDS R++R L AVYHPRN Y+LH+D  AP  +R  L +SV     F 
Sbjct  85    EPPRLAYLISGTKGDSQRMMRTLQAVYHPRNQYILHMDLEAPPKERLNLTISVKNDLTFN  144

Query  1511  AARNVHVMGNADFVYSKGSSSMSSTLHGASILLRISSNWDWFINLSSADYPLVTQDDLLH  1332
                NVHVM  ++ V  KG + ++ TL   ++LL+ S NWDWFINLS++DYPLVTQDDLL+
Sbjct  145   EVENVHVMAQSNLVTYKGPTMIACTLQAIALLLKESLNWDWFINLSASDYPLVTQDDLLY  204

Query  1331  ILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFRVFR  1152
             +LS + ++LNF+ HT   GW+ +Q+ KPII+DPGLYL++ SD+ + TQ+R LP SF++F 
Sbjct  205   VLSNVSRNLNFIEHTQIYGWKLNQRAKPIIIDPGLYLSKKSDIAWTTQRRSLPTSFKLFT  264

Query  1151  GSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIINHNL  972
             GS++ IL+R F+++CI G +N PRT+LMY +N  SS   YF TV+CN+ +F  T I+H+L
Sbjct  265   GSAWVILTRSFVEYCIWGWDNLPRTILMYYANFISSPEGYFHTVICNTEEFQHTAISHDL  324

Query  971   QYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKPVPG  798
              Y++ ++  ++  R L   DF  MI S A FA  F + DP+LD+ID E+L R+  +   G
Sbjct  325   HYIAWDTPPKQHPRSLTLKDFSKMINSSAPFARKFHKDDPVLDKIDKELLGRT-NRFARG  383

Query  797   GWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              WC+G+ + G   C+V GD  V RPG GA+RL++   +L +    +S+QC
Sbjct  384   AWCIGSSDGGADPCSVRGDDSVFRPGPGAERLQELMKKLLSEDS-RSKQC  432



>gb|ACO87683.1| b-1-3-galactosyl-o-glycosyl-glycoprotein [Brachypodium sylvaticum]
Length=424

 Score =   342 bits (876),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 236/353 (67%), Gaps = 9/353 (3%)
 Frame = -2

Query  1685  PSIAYYISGSAGDSGRIVRLLFAVYHPRNHYLLHLDRSAPKSDRDLLALSVNTVPLFRAA  1506
             P IAY +SGSA D+  + R+L A+YHPRN Y+LHLD  AP SDR  LA ++   P   AA
Sbjct  71    PRIAYLVSGSARDAPALRRVLLALYHPRNLYILHLDAEAPDSDRADLAAALAAHPAISAA  130

Query  1505  RNVHVMGNADFVYSKGSSSMSSTLHGASILL-----RISSNWDWFINLSSADYPLVTQDD  1341
              NV V+  A+ V  +G + ++STLH A+ LL        S+WDWFINLS++DYPLVTQDD
Sbjct  131   GNVRVVEKANLVTYRGPTMVASTLHAAAALLWGDSGAGGSDWDWFINLSASDYPLVTQDD  190

Query  1340  LLHILSYLPKDLNFVNHTSYIGWRESQKLKPIIVDPGLYLAEDSDVFYATQQRPLPDSFR  1161
             LLH+ S LP+DLNF++HTS IGW+E Q+ KP+I+DPGLY+ + +DVF+  Q+R +P +F+
Sbjct  191   LLHVFSKLPRDLNFIDHTSNIGWKEFQRAKPVIIDPGLYMKKKADVFWIPQRRSVPTAFK  250

Query  1160  VFRGSSYSILSRKFLDFCILGTENFPRTLLMYLSNTPSSDAVYFPTVLCNSRQFNRTIIN  981
             +F GS++  LSR  +++ I G +N PRT+LMY SN  SS   YF TV+CN+ +F  T +N
Sbjct  251   LFTGSAWMALSRPLVEYSIWGWDNLPRTVLMYYSNFISSPEGYFHTVVCNAEEFKNTTVN  310

Query  980   HNLQYVSLNS--RKEARVLNSSDFLDMIRSGAAFASPFKERDPILDQIDSEILHRSPGKP  807
             H+L Y+S ++  ++    L   D   M+ S A FA  F   DP+LD+ID+EIL R P  P
Sbjct  311   HDLHYISWDNPPKQHPHYLTIDDLDRMVASDAPFARKFHADDPVLDKIDAEILSRGPDMP  370

Query  806   VPGGWCLGNGESGR--CAVWGDADVLRPGVGAKRLEKHFIELFAGGRFQSQQC  654
              PGGWC G  E+G   C+  G+A +L+PG GA RL++    L +  +F  +QC
Sbjct  371   TPGGWCAGTQENGSDPCSAIGNATLLQPGRGAVRLQRLTTSLLSEEKFHPRQC  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5916198060420