BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18752_g1_i1 len=1026 path=[1004:0-861 2105:862-863 1868:864-869
1874:870-1025]

Length=1026
                                                                      Score     E

gb|EYU41598.1|  hypothetical protein MIMGU_mgv1a011586mg                388   2e-131   
ref|XP_006339092.1|  PREDICTED: bifunctional monodehydroascorbate...    387   8e-131   
ref|XP_004249474.1|  PREDICTED: alpha carbonic anhydrase 7-like         386   9e-131   
ref|XP_011077301.1|  PREDICTED: alpha carbonic anhydrase 7-like         387   1e-130   
ref|XP_009775004.1|  PREDICTED: alpha carbonic anhydrase 7-like         386   1e-130   
ref|XP_010098808.1|  hypothetical protein L484_022573                   384   8e-130   
ref|XP_009592985.1|  PREDICTED: alpha carbonic anhydrase 7-like         383   2e-129   
emb|CDP15287.1|  unnamed protein product                                379   3e-127   
gb|EYU38572.1|  hypothetical protein MIMGU_mgv1a011717mg                376   9e-127   
ref|XP_002519458.1|  carbonic anhydrase, putative                       368   1e-123   Ricinus communis
ref|XP_008227262.1|  PREDICTED: bifunctional monodehydroascorbate...    367   5e-123   
ref|XP_004143278.1|  PREDICTED: bifunctional monodehydroascorbate...    365   2e-122   
ref|XP_007027463.1|  Alpha carbonic anhydrase 7 isoform 1               366   2e-122   
ref|XP_004515925.1|  PREDICTED: bifunctional monodehydroascorbate...    363   1e-121   
ref|XP_010050504.1|  PREDICTED: alpha carbonic anhydrase 7-like         362   7e-121   
ref|XP_008362138.1|  PREDICTED: bifunctional monodehydroascorbate...    360   2e-120   
gb|KHN39018.1|  Bifunctional monodehydroascorbate reductase and c...    359   8e-120   
ref|XP_003535188.1|  PREDICTED: bifunctional monodehydroascorbate...    357   3e-119   
ref|XP_007144378.1|  hypothetical protein PHAVU_007G151300g             357   4e-119   
ref|XP_010050537.1|  PREDICTED: alpha carbonic anhydrase 7-like         355   3e-118   
ref|XP_008227274.1|  PREDICTED: bifunctional monodehydroascorbate...    353   1e-117   
ref|XP_008462491.1|  PREDICTED: bifunctional monodehydroascorbate...    353   1e-117   
gb|KCW89335.1|  hypothetical protein EUGRSUZ_A01626                     349   1e-116   
ref|XP_008227264.1|  PREDICTED: bifunctional monodehydroascorbate...    350   3e-116   
ref|XP_010050524.1|  PREDICTED: alpha carbonic anhydrase 7-like         350   4e-116   
ref|XP_007213463.1|  hypothetical protein PRUPE_ppa024299mg             349   9e-116   
gb|AFK33933.1|  unknown                                                 348   1e-115   
ref|XP_010050514.1|  PREDICTED: alpha carbonic anhydrase 7-like         348   1e-115   
gb|KEH42158.1|  eukaryotic-type carbonic anhydrase                      347   3e-115   
ref|XP_002268233.1|  PREDICTED: alpha carbonic anhydrase 7              347   3e-115   Vitis vinifera
ref|XP_011018803.1|  PREDICTED: alpha carbonic anhydrase 7-like         342   2e-113   
ref|XP_006381381.1|  hypothetical protein POPTR_0006s12380g             342   2e-113   
ref|XP_010241820.1|  PREDICTED: alpha carbonic anhydrase 7-like         342   4e-113   
ref|XP_010050530.1|  PREDICTED: alpha carbonic anhydrase 7-like         342   6e-113   
ref|XP_008241384.1|  PREDICTED: bifunctional monodehydroascorbate...    338   1e-111   
gb|KHG29611.1|  Bifunctional monodehydroascorbate reductase and c...    338   2e-111   
ref|XP_006594167.1|  PREDICTED: bifunctional monodehydroascorbate...    337   4e-111   
gb|AFK36418.1|  unknown                                                 336   1e-110   
gb|KHN48240.1|  Bifunctional monodehydroascorbate reductase and c...    334   4e-110   
gb|KEH42156.1|  eukaryotic-type carbonic anhydrase                      333   8e-110   
ref|XP_008227263.1|  PREDICTED: bifunctional monodehydroascorbate...    331   4e-109   
ref|XP_004172039.1|  PREDICTED: bifunctional monodehydroascorbate...    328   2e-108   
ref|XP_011094588.1|  PREDICTED: alpha carbonic anhydrase 7-like         328   7e-108   
ref|XP_010267256.1|  PREDICTED: alpha carbonic anhydrase 7-like         327   3e-107   
gb|KHG27075.1|  Bifunctional monodehydroascorbate reductase and c...    327   4e-107   
ref|XP_007203913.1|  hypothetical protein PRUPE_ppa016859mg             326   4e-106   
ref|XP_006339307.1|  PREDICTED: bifunctional monodehydroascorbate...    319   5e-105   
ref|XP_004304476.1|  PREDICTED: bifunctional monodehydroascorbate...    320   1e-104   
ref|XP_008810946.1|  PREDICTED: alpha carbonic anhydrase 7-like         320   2e-104   
ref|XP_007027464.1|  Alpha carbonic anhydrase 7 isoform 2               318   3e-104   
ref|XP_007016796.1|  Alpha carbonic anhydrase 7                         319   4e-104   
ref|XP_003537009.2|  PREDICTED: bifunctional monodehydroascorbate...    320   4e-104   
ref|XP_007211988.1|  hypothetical protein PRUPE_ppa010973mg             317   4e-104   
ref|XP_009622096.1|  PREDICTED: alpha carbonic anhydrase 7-like         318   1e-103   
ref|XP_010916592.1|  PREDICTED: alpha carbonic anhydrase 7-like         317   1e-103   
gb|KGN59000.1|  hypothetical protein Csa_3G742880                       317   2e-103   
ref|XP_010046439.1|  PREDICTED: alpha carbonic anhydrase 7-like         317   2e-103   
ref|XP_008442725.1|  PREDICTED: bifunctional monodehydroascorbate...    317   2e-103   
gb|KHN39017.1|  Bifunctional monodehydroascorbate reductase and c...    317   3e-103   
ref|XP_009400916.1|  PREDICTED: alpha carbonic anhydrase 7-like         317   3e-103   
ref|XP_010696305.1|  PREDICTED: alpha carbonic anhydrase 7-like         315   1e-102   
gb|KEH24050.1|  eukaryotic-type carbonic anhydrase                      315   2e-102   
ref|XP_010043780.1|  PREDICTED: alpha carbonic anhydrase 7-like         315   2e-102   
ref|XP_008802055.1|  PREDICTED: alpha carbonic anhydrase 7-like         314   2e-102   
ref|XP_007016793.1|  Alpha carbonic anhydrase 7                         313   4e-102   
ref|XP_009391366.1|  PREDICTED: alpha carbonic anhydrase 7-like         313   6e-102   
ref|XP_009767316.1|  PREDICTED: alpha carbonic anhydrase 7-like         312   1e-101   
gb|KDP44024.1|  hypothetical protein JCGZ_05491                         312   1e-101   
ref|XP_004300792.1|  PREDICTED: bifunctional monodehydroascorbate...    312   2e-101   
gb|KHG14539.1|  Bifunctional monodehydroascorbate reductase and c...    311   4e-101   
ref|XP_004168624.1|  PREDICTED: bifunctional monodehydroascorbate...    311   5e-101   
ref|XP_002282495.2|  PREDICTED: alpha carbonic anhydrase 7              310   1e-100   Vitis vinifera
ref|XP_002529418.1|  carbonic anhydrase, putative                       310   2e-100   Ricinus communis
ref|XP_004306263.1|  PREDICTED: bifunctional monodehydroascorbate...    311   3e-100   
ref|XP_011040911.1|  PREDICTED: alpha carbonic anhydrase 7-like         308   7e-100   
ref|XP_011090098.1|  PREDICTED: alpha carbonic anhydrase 7              308   8e-100   
ref|XP_004137981.1|  PREDICTED: bifunctional monodehydroascorbate...    310   1e-99    
gb|KDP44023.1|  hypothetical protein JCGZ_05490                         306   5e-99    
ref|XP_007144381.1|  hypothetical protein PHAVU_007G151500g             306   5e-99    
ref|XP_007144380.1|  hypothetical protein PHAVU_007G151500g             306   6e-99    
ref|XP_010098809.1|  hypothetical protein L484_022574                   304   8e-99    
ref|XP_009399717.1|  PREDICTED: alpha carbonic anhydrase 7-like         305   1e-98    
ref|XP_006473002.1|  PREDICTED: bifunctional monodehydroascorbate...    304   3e-98    
ref|XP_010916593.1|  PREDICTED: alpha carbonic anhydrase 7-like         303   3e-98    
gb|KDO81077.1|  hypothetical protein CISIN_1g038655mg                   303   6e-98    
ref|XP_011090042.1|  PREDICTED: alpha carbonic anhydrase 7-like         303   8e-98    
ref|XP_006845947.1|  hypothetical protein AMTR_s00157p00092470          301   1e-97    
ref|XP_006433902.1|  hypothetical protein CICLE_v10003227mg             302   1e-97    
gb|KDO73356.1|  hypothetical protein CISIN_1g039445mg                   302   2e-97    
ref|XP_002529419.1|  carbonic anhydrase, putative                       301   2e-97    Ricinus communis
ref|XP_006384924.1|  hypothetical protein POPTR_0004s22280g             301   2e-97    
ref|XP_006424533.1|  hypothetical protein CICLE_v10029790mg             301   3e-97    
ref|XP_003520661.2|  PREDICTED: bifunctional monodehydroascorbate...    301   3e-97    
ref|XP_006488639.1|  PREDICTED: bifunctional monodehydroascorbate...    301   4e-97    
ref|XP_009377054.1|  PREDICTED: alpha carbonic anhydrase 7-like         301   6e-97    
ref|XP_011044411.1|  PREDICTED: alpha carbonic anhydrase 7-like         300   1e-96    
ref|XP_004494904.1|  PREDICTED: bifunctional monodehydroascorbate...    299   1e-96    
ref|XP_009621603.1|  PREDICTED: alpha carbonic anhydrase 7              299   2e-96    
ref|XP_009377055.1|  PREDICTED: alpha carbonic anhydrase 4-like         301   3e-96    
gb|KHG05281.1|  Bifunctional monodehydroascorbate reductase and c...    298   6e-96    
ref|XP_008810960.1|  PREDICTED: alpha carbonic anhydrase 7-like         297   7e-96    
ref|XP_009358738.1|  PREDICTED: alpha carbonic anhydrase 4-like         300   8e-96    
ref|XP_008387558.1|  PREDICTED: bifunctional monodehydroascorbate...    298   1e-95    
ref|XP_010262876.1|  PREDICTED: alpha carbonic anhydrase 7-like         298   1e-95    
ref|XP_008383977.1|  PREDICTED: bifunctional monodehydroascorbate...    299   2e-95    
ref|XP_006488640.1|  PREDICTED: bifunctional monodehydroascorbate...    295   8e-95    
ref|XP_009132759.1|  PREDICTED: alpha carbonic anhydrase 2-like         295   9e-95    
ref|XP_008241447.1|  PREDICTED: bifunctional monodehydroascorbate...    295   1e-94    
gb|KDO73355.1|  hypothetical protein CISIN_1g046862mg                   294   2e-94    
ref|XP_009595413.1|  PREDICTED: bifunctional monodehydroascorbate...    294   2e-94    
ref|XP_008778933.1|  PREDICTED: alpha carbonic anhydrase 7-like         294   2e-94    
ref|XP_010272832.1|  PREDICTED: alpha carbonic anhydrase 7-like         293   3e-94    
ref|XP_009380700.1|  PREDICTED: alpha carbonic anhydrase 7-like         293   3e-94    
emb|CDP07086.1|  unnamed protein product                                293   4e-94    
ref|XP_010696307.1|  PREDICTED: alpha carbonic anhydrase 7-like         293   4e-94    
ref|XP_006604587.1|  PREDICTED: bifunctional monodehydroascorbate...    293   5e-94    
ref|XP_008351630.1|  PREDICTED: bifunctional monodehydroascorbate...    293   6e-94    
emb|CDY23976.1|  BnaC03g17150D                                          292   9e-94    
ref|XP_006577712.1|  PREDICTED: bifunctional monodehydroascorbate...    292   1e-93    
gb|KHN18685.1|  Bifunctional monodehydroascorbate reductase and c...    292   1e-93    
ref|XP_006424534.1|  hypothetical protein CICLE_v10030314mg             291   2e-93    
ref|XP_009113037.1|  PREDICTED: alpha carbonic anhydrase 2-like         291   2e-93    
ref|XP_007202419.1|  hypothetical protein PRUPE_ppa009714mg             291   4e-93    
emb|CDY45963.1|  BnaA09g13030D                                          290   5e-93    
dbj|BAD09854.1|  putative dioscorin class A precursor                   290   5e-93    Oryza sativa Japonica Group [Japonica rice]
emb|CDY45480.1|  BnaC09g12980D                                          290   6e-93    
ref|XP_006303231.1|  hypothetical protein CARUB_v10012300mg             290   7e-93    
ref|XP_008244285.1|  PREDICTED: bifunctional monodehydroascorbate...    290   1e-92    
ref|XP_010279581.1|  PREDICTED: alpha carbonic anhydrase 4-like         289   1e-92    
ref|XP_010269790.1|  PREDICTED: alpha carbonic anhydrase 4-like         289   1e-92    
ref|XP_009776894.1|  PREDICTED: bifunctional monodehydroascorbate...    288   2e-92    
ref|XP_004303634.1|  PREDICTED: bifunctional monodehydroascorbate...    289   2e-92    
ref|XP_002314288.2|  hypothetical protein POPTR_0009s01540g             289   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_009367040.1|  PREDICTED: alpha carbonic anhydrase 7-like         289   2e-92    
ref|XP_009782909.1|  PREDICTED: bifunctional monodehydroascorbate...    288   3e-92    
ref|XP_008360674.1|  PREDICTED: bifunctional monodehydroascorbate...    288   3e-92    
ref|XP_009363226.1|  PREDICTED: alpha carbonic anhydrase 4-like         288   4e-92    
ref|XP_010475599.1|  PREDICTED: alpha carbonic anhydrase 7-like         288   7e-92    
ref|XP_010036307.1|  PREDICTED: alpha carbonic anhydrase 4-like         288   1e-91    
ref|XP_003541987.1|  PREDICTED: bifunctional monodehydroascorbate...    287   1e-91    
ref|XP_006354411.1|  PREDICTED: bifunctional monodehydroascorbate...    287   1e-91    
ref|XP_002278828.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    286   1e-91    Vitis vinifera
ref|XP_008443579.1|  PREDICTED: bifunctional monodehydroascorbate...    286   2e-91    
ref|XP_006659489.1|  PREDICTED: bifunctional monodehydroascorbate...    286   2e-91    
gb|KFK43125.1|  hypothetical protein AALP_AA1G083600                    286   2e-91    
ref|XP_009356885.1|  PREDICTED: alpha carbonic anhydrase 7-like         286   2e-91    
ref|XP_008364026.1|  PREDICTED: bifunctional monodehydroascorbate...    285   3e-91    
ref|NP_172287.1|  alpha carbonic anhydrase 7                            286   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KFK32339.1|  hypothetical protein AALP_AA6G228800                    285   4e-91    
emb|CDP14170.1|  unnamed protein product                                285   7e-91    
ref|XP_008359452.1|  PREDICTED: bifunctional monodehydroascorbate...    285   7e-91    
ref|XP_010458032.1|  PREDICTED: alpha carbonic anhydrase 7              285   9e-91    
ref|XP_009148224.1|  PREDICTED: alpha carbonic anhydrase 7-like         283   2e-90    
ref|XP_008226047.1|  PREDICTED: bifunctional monodehydroascorbate...    283   3e-90    
ref|XP_007206520.1|  hypothetical protein PRUPE_ppa019410mg             283   3e-90    
gb|KGN64826.1|  hypothetical protein Csa_1G120420                       283   3e-90    
ref|XP_009103655.1|  PREDICTED: alpha carbonic anhydrase 2              283   3e-90    
ref|XP_004139553.1|  PREDICTED: bifunctional monodehydroascorbate...    283   4e-90    
ref|XP_008462825.1|  PREDICTED: bifunctional monodehydroascorbate...    282   5e-90    
ref|XP_010646590.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    282   6e-90    
ref|XP_008241448.1|  PREDICTED: bifunctional monodehydroascorbate...    283   7e-90    
ref|XP_010488326.1|  PREDICTED: alpha carbonic anhydrase 7              282   1e-89    
ref|XP_008462817.1|  PREDICTED: bifunctional monodehydroascorbate...    281   1e-89    
emb|CDX95095.1|  BnaC05g05760D                                          281   1e-89    
emb|CDY04545.1|  BnaA07g13710D                                          281   1e-89    
ref|XP_004160914.1|  PREDICTED: bifunctional monodehydroascorbate...    281   2e-89    
ref|XP_010109499.1|  hypothetical protein L484_007519                   281   2e-89    
ref|XP_006409842.1|  hypothetical protein EUTSA_v10017075mg             281   2e-89    
ref|XP_004293093.1|  PREDICTED: bifunctional monodehydroascorbate...    288   2e-89    
gb|AAD29832.1|  putative carbonic anhydrase                             280   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036662.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    280   4e-89    
ref|XP_002892434.1|  carbonic anhydrase family protein                  280   4e-89    
ref|XP_007202870.1|  hypothetical protein PRUPE_ppa015691mg             280   5e-89    
ref|XP_010510674.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    280   5e-89    
ref|XP_008385339.1|  PREDICTED: bifunctional monodehydroascorbate...    280   6e-89    
gb|KDP26093.1|  hypothetical protein JCGZ_21126                         280   7e-89    
ref|XP_004973661.1|  PREDICTED: bifunctional monodehydroascorbate...    280   7e-89    
ref|XP_004251153.1|  PREDICTED: alpha carbonic anhydrase 7              279   1e-88    
ref|XP_008462808.1|  PREDICTED: bifunctional monodehydroascorbate...    278   2e-88    
emb|CDX93593.1|  BnaA06g04550D                                          286   4e-88    
ref|XP_006340169.1|  PREDICTED: bifunctional monodehydroascorbate...    278   4e-88    
ref|XP_011033188.1|  PREDICTED: alpha carbonic anhydrase 4-like         280   5e-88    
ref|XP_006421163.1|  hypothetical protein CICLE_v10005610mg             277   5e-88    
ref|XP_010414580.1|  PREDICTED: alpha carbonic anhydrase 2-like         277   7e-88    
ref|XP_010510675.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    276   1e-87    
ref|XP_002445625.1|  hypothetical protein SORBIDRAFT_07g022890          277   1e-87    Sorghum bicolor [broomcorn]
ref|XP_002323272.2|  hypothetical protein POPTR_0016s04300g             276   2e-87    Populus trichocarpa [western balsam poplar]
ref|XP_006294831.1|  hypothetical protein CARUB_v10023883mg             275   2e-87    
ref|XP_008462835.1|  PREDICTED: bifunctional monodehydroascorbate...    276   2e-87    
emb|CDX84811.1|  BnaA03g14190D                                          275   2e-87    
ref|XP_007028635.1|  Alpha carbonic anhydrase 4, putative               276   2e-87    
ref|XP_009148066.1|  PREDICTED: alpha carbonic anhydrase 7-like         275   3e-87    
ref|XP_010470128.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    275   3e-87    
ref|XP_006340168.1|  PREDICTED: bifunctional monodehydroascorbate...    275   6e-87    
ref|XP_006489872.1|  PREDICTED: bifunctional monodehydroascorbate...    275   6e-87    
ref|XP_010521744.1|  PREDICTED: alpha carbonic anhydrase 7-like         275   7e-87    
ref|XP_010470127.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    275   7e-87    
ref|XP_010510673.1|  PREDICTED: alpha carbonic anhydrase 2-like         274   9e-87    
ref|XP_003574630.1|  PREDICTED: alpha carbonic anhydrase 7-like         273   2e-86    
gb|EYU20767.1|  hypothetical protein MIMGU_mgv1a019017mg                272   2e-86    
gb|ABK22387.1|  unknown                                                 273   2e-86    Picea sitchensis
gb|KGN64825.1|  hypothetical protein Csa_1G120410                       272   3e-86    
ref|XP_002445624.1|  hypothetical protein SORBIDRAFT_07g022880          273   4e-86    Sorghum bicolor [broomcorn]
ref|XP_008464600.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    273   5e-86    
gb|EMT00558.1|  Bifunctional monodehydroascorbate reductase and c...    273   5e-86    
ref|XP_002445628.1|  hypothetical protein SORBIDRAFT_07g022910          272   6e-86    Sorghum bicolor [broomcorn]
gb|EYU18694.1|  hypothetical protein MIMGU_mgv11b010420mg               271   8e-86    
ref|XP_008462774.1|  PREDICTED: bifunctional monodehydroascorbate...    272   1e-85    
ref|XP_006292541.1|  hypothetical protein CARUB_v10018775mg             271   1e-85    
ref|XP_008464591.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    271   2e-85    
ref|NP_001147028.1|  carbonic anhydrase precursor                       271   2e-85    Zea mays [maize]
gb|ADW27480.1|  carbonic anhydrase                                      271   2e-85    
emb|CDP11563.1|  unnamed protein product                                270   3e-85    
ref|XP_010434249.1|  PREDICTED: alpha carbonic anhydrase 4-like         270   3e-85    
ref|XP_010090219.1|  hypothetical protein L484_016558                   269   4e-85    
ref|XP_004139442.1|  PREDICTED: bifunctional monodehydroascorbate...    270   6e-85    
ref|XP_004139554.1|  PREDICTED: bifunctional monodehydroascorbate...    269   7e-85    
ref|XP_010439535.1|  PREDICTED: alpha carbonic anhydrase 4              269   7e-85    
emb|CDP14169.1|  unnamed protein product                                268   9e-85    
gb|KCW47832.1|  hypothetical protein EUGRSUZ_K01571                     269   2e-84    
ref|XP_004160913.1|  PREDICTED: bifunctional monodehydroascorbate...    268   2e-84    
ref|XP_011075357.1|  PREDICTED: alpha carbonic anhydrase 4-like         268   2e-84    
gb|KDO48229.1|  hypothetical protein CISIN_1g025618mg                   267   3e-84    
ref|NP_193831.1|  alpha carbonic anhydrase 4                            267   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004973745.1|  PREDICTED: bifunctional monodehydroascorbate...    268   3e-84    
gb|KCW47834.1|  hypothetical protein EUGRSUZ_K01571                     268   4e-84    
ref|XP_004506042.1|  PREDICTED: bifunctional monodehydroascorbate...    266   7e-84    
ref|XP_010451325.1|  PREDICTED: alpha carbonic anhydrase 4-like         266   9e-84    
ref|XP_010036660.1|  PREDICTED: alpha carbonic anhydrase 4-like         266   1e-83    
dbj|BAK03530.1|  predicted protein                                      266   1e-83    
ref|XP_011048097.1|  PREDICTED: alpha carbonic anhydrase 4-like         266   3e-83    
ref|XP_010109502.1|  hypothetical protein L484_007522                   266   3e-83    
emb|CDX76404.1|  BnaA08g09960D                                          265   4e-83    
tpg|DAA48425.1|  TPA: carbonic anhydrase                                266   4e-83    
ref|XP_004166480.1|  PREDICTED: bifunctional monodehydroascorbate...    263   5e-83    
ref|XP_004139552.1|  PREDICTED: bifunctional monodehydroascorbate...    264   5e-83    
gb|KHN02302.1|  Bifunctional monodehydroascorbate reductase and c...    267   6e-83    
ref|XP_010555357.1|  PREDICTED: alpha carbonic anhydrase 4              264   7e-83    
gb|KGN58999.1|  hypothetical protein Csa_3G742870                       265   7e-83    
ref|XP_002278815.1|  PREDICTED: alpha carbonic anhydrase 4-like         265   8e-83    Vitis vinifera
ref|XP_004168623.1|  PREDICTED: bifunctional monodehydroascorbate...    264   9e-83    
ref|XP_007204039.1|  hypothetical protein PRUPE_ppa021069mg             263   1e-82    
ref|XP_002869915.1|  carbonic anhydrase family protein                  264   1e-82    
ref|XP_008664513.1|  PREDICTED: bifunctional monodehydroascorbate...    265   1e-82    
ref|XP_008241381.1|  PREDICTED: bifunctional monodehydroascorbate...    264   2e-82    
ref|XP_004973662.1|  PREDICTED: bifunctional monodehydroascorbate...    263   2e-82    
emb|CDY27409.1|  BnaC03g64490D                                          263   2e-82    
ref|XP_002308927.2|  hypothetical protein POPTR_0006s04600g             263   2e-82    Populus trichocarpa [western balsam poplar]
ref|NP_001149032.1|  carbonic anhydrase precursor                       263   3e-82    Zea mays [maize]
gb|AAF79837.1|AC026875_17  T6D22.16                                     262   3e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007162791.1|  hypothetical protein PHAVU_001G180900g             262   3e-82    
ref|XP_010050605.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    263   3e-82    
emb|CAM59682.1|  a-type carbonic anhydrase                              262   4e-82    Lotus japonicus
ref|XP_006417733.1|  hypothetical protein EUTSA_v10008451mg             262   5e-82    
emb|CDX94018.1|  BnaC07g36520D                                          262   6e-82    
emb|CDX93595.1|  BnaA06g04530D                                          261   8e-82    
dbj|BAK02152.1|  predicted protein                                      261   9e-82    
dbj|BAK01826.1|  predicted protein                                      261   9e-82    
ref|XP_003539200.1|  PREDICTED: bifunctional monodehydroascorbate...    261   1e-81    
ref|XP_009148063.1|  PREDICTED: alpha carbonic anhydrase 5              261   1e-81    
ref|XP_002308928.2|  hypothetical protein POPTR_0006s04610g             261   2e-81    Populus trichocarpa [western balsam poplar]
ref|XP_004493458.1|  PREDICTED: bifunctional monodehydroascorbate...    261   2e-81    
ref|XP_006413835.1|  hypothetical protein EUTSA_v10027157mg             260   2e-81    
ref|XP_008241380.1|  PREDICTED: bifunctional monodehydroascorbate...    261   2e-81    
emb|CDX95097.1|  BnaC05g05740D                                          260   3e-81    
ref|XP_010450977.1|  PREDICTED: alpha carbonic anhydrase 8              261   4e-81    
emb|CBI33385.3|  unnamed protein product                                260   4e-81    
ref|XP_006417731.1|  hypothetical protein EUTSA_v10009315mg             259   4e-81    
ref|XP_007150177.1|  hypothetical protein PHAVU_005G133000g             259   4e-81    
ref|XP_006365755.1|  PREDICTED: bifunctional monodehydroascorbate...    259   5e-81    
ref|XP_011015725.1|  PREDICTED: alpha carbonic anhydrase 4-like         261   5e-81    
ref|XP_011048125.1|  PREDICTED: alpha carbonic anhydrase 4-like         260   6e-81    
ref|XP_011015541.1|  PREDICTED: alpha carbonic anhydrase 4-like         258   6e-81    
gb|EMT14740.1|  Bifunctional monodehydroascorbate reductase and c...    259   6e-81    
ref|XP_010036663.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    258   9e-81    
ref|XP_004493459.1|  PREDICTED: bifunctional monodehydroascorbate...    259   1e-80    
gb|KHN38743.1|  Bifunctional monodehydroascorbate reductase and c...    258   1e-80    
ref|XP_009137160.1|  PREDICTED: alpha carbonic anhydrase 4-like         258   1e-80    
emb|CDY65169.1|  BnaC05g49130D                                          258   2e-80    
ref|XP_009407045.1|  PREDICTED: alpha carbonic anhydrase 7-like         258   2e-80    
ref|XP_010488317.1|  PREDICTED: alpha carbonic anhydrase 5              258   2e-80    
ref|XP_003553396.1|  PREDICTED: bifunctional monodehydroascorbate...    257   4e-80    
ref|XP_002445622.1|  hypothetical protein SORBIDRAFT_07g022860          257   4e-80    
ref|XP_010050600.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    258   5e-80    
ref|XP_010475597.1|  PREDICTED: alpha carbonic anhydrase 5-like         257   5e-80    
gb|KEH16352.1|  eukaryotic-type carbonic anhydrase                      256   8e-80    
ref|XP_004242097.1|  PREDICTED: bifunctional monodehydroascorbate...    256   8e-80    
gb|KCW89334.1|  hypothetical protein EUGRSUZ_A01625                     255   9e-80    
ref|XP_010696309.1|  PREDICTED: alpha carbonic anhydrase 7-like         256   1e-79    
ref|XP_002880942.1|  hypothetical protein ARALYDRAFT_320571             255   1e-79    
ref|XP_007212368.1|  hypothetical protein PRUPE_ppa014779mg             254   1e-79    
ref|XP_008231952.1|  PREDICTED: bifunctional monodehydroascorbate...    255   2e-79    
ref|XP_008383978.1|  PREDICTED: bifunctional monodehydroascorbate...    256   2e-79    
ref|XP_006284932.1|  hypothetical protein CARUB_v10006231mg             254   2e-79    
gb|KHN14952.1|  Bifunctional monodehydroascorbate reductase and c...    255   3e-79    
ref|XP_010458030.1|  PREDICTED: alpha carbonic anhydrase 5              255   4e-79    
gb|KHN10833.1|  Bifunctional monodehydroascorbate reductase and c...    253   4e-79    
ref|XP_007028632.1|  Carbonic anhydrase, putative                       254   6e-79    
ref|XP_009358737.1|  PREDICTED: alpha carbonic anhydrase 7-like         254   1e-78    
ref|XP_006391784.1|  hypothetical protein EUTSA_v10023909mg             253   1e-78    
ref|XP_003520509.1|  PREDICTED: bifunctional monodehydroascorbate...    253   1e-78    
gb|EEC83720.1|  hypothetical protein OsI_29556                          253   2e-78    
gb|EMT11024.1|  Bifunctional monodehydroascorbate reductase and c...    253   2e-78    
ref|XP_003538184.1|  PREDICTED: bifunctional monodehydroascorbate...    252   4e-78    
gb|AFW61791.1|  hypothetical protein ZEAMMB73_990747                    251   4e-78    
sp|Q9FM99.2|ATCA8_ARATH  RecName: Full=Alpha carbonic anhydrase 8...    252   6e-78    
ref|XP_010443286.1|  PREDICTED: alpha carbonic anhydrase 8-like         254   6e-78    
gb|KFK43123.1|  hypothetical protein AALP_AA1G083400                    251   8e-78    
dbj|BAD09858.1|  putative dioscorin class A precursor                   251   9e-78    
ref|XP_010530484.1|  PREDICTED: alpha carbonic anhydrase 7-like         248   2e-77    
ref|XP_002892432.1|  carbonate dehydratase/ zinc ion binding protein    250   2e-77    
gb|AFK49331.1|  unknown                                                 248   3e-77    
ref|XP_006401345.1|  hypothetical protein EUTSA_v10014359mg             250   3e-77    
ref|XP_006304810.1|  hypothetical protein CARUB_v10012428mg             249   3e-77    
ref|XP_002529417.1|  carbonic anhydrase, putative                       249   5e-77    
gb|EEE68846.1|  hypothetical protein OsJ_27636                          249   5e-77    
ref|XP_004506040.1|  PREDICTED: bifunctional monodehydroascorbate...    250   5e-77    
ref|XP_004142716.1|  PREDICTED: bifunctional monodehydroascorbate...    250   5e-77    
ref|XP_006845943.1|  hypothetical protein AMTR_s00157p00085110          248   2e-76    
dbj|BAJ99342.1|  predicted protein                                      248   2e-76    
ref|NP_172285.2|  alpha carbonic anhydrase 5                            247   3e-76    
gb|KFK28694.1|  hypothetical protein AALP_AA7G034200                    247   3e-76    
ref|XP_010050579.1|  PREDICTED: alpha carbonic anhydrase 7-like         247   6e-76    
sp|Q84UV8.1|NEC3_NICLS  RecName: Full=Bifunctional monodehydroasc...    246   7e-76    
ref|XP_006351243.1|  PREDICTED: bifunctional monodehydroascorbate...    245   1e-75    
sp|F4IHR4.2|ATCA2_ARATH  RecName: Full=Alpha carbonic anhydrase 2...    244   1e-75    
gb|ABO36620.1|  eukaryotic-type carbonic anhydrase family protein       245   2e-75    
emb|CAN60024.1|  hypothetical protein VITISV_006907                     244   2e-75    
ref|XP_009770757.1|  PREDICTED: alpha carbonic anhydrase 4-like         244   4e-75    
ref|XP_011044414.1|  PREDICTED: LOW QUALITY PROTEIN: alpha carbon...    243   1e-74    
dbj|BAK00887.1|  predicted protein                                      242   4e-74    
ref|XP_010696308.1|  PREDICTED: alpha carbonic anhydrase 7-like         242   4e-74    
emb|CDX79018.1|  BnaA01g10850D                                          240   9e-74    
ref|NP_001061831.1|  Os08g0423500                                       241   1e-73    
ref|XP_009599195.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    240   1e-73    
ref|XP_007162157.1|  hypothetical protein PHAVU_001G129100g             240   1e-73    
ref|NP_180388.2|  alpha carbonic anhydrase 2                            238   3e-73    
ref|XP_003625103.1|  Bifunctional monodehydroascorbate reductase ...    239   3e-73    
ref|XP_006845945.1|  hypothetical protein AMTR_s00157p00088030          239   3e-73    
gb|EYU18692.1|  hypothetical protein MIMGU_mgv1a011638mg                239   3e-73    
ref|XP_009122630.1|  PREDICTED: alpha carbonic anhydrase 3              239   4e-73    
ref|XP_010449136.1|  PREDICTED: alpha carbonic anhydrase 4-like         239   4e-73    
ref|XP_006301790.1|  hypothetical protein CARUB_v10022254mg             239   4e-73    
gb|EAZ07037.1|  hypothetical protein OsI_29284                          239   5e-73    
ref|XP_009134167.1|  PREDICTED: alpha carbonic anhydrase 4-like         238   5e-73    
dbj|BAC99799.1|  putative dioscorin                                     239   6e-73    
ref|XP_011075358.1|  PREDICTED: alpha carbonic anhydrase 7-like         239   6e-73    
ref|XP_010439534.1|  PREDICTED: alpha carbonic anhydrase 4-like         238   7e-73    
gb|EPS62533.1|  hypothetical protein M569_12260                         236   1e-72    
ref|XP_002532668.1|  carbonic anhydrase, putative                       236   2e-72    
ref|XP_004973744.1|  PREDICTED: bifunctional monodehydroascorbate...    237   3e-72    
gb|AFK47340.1|  unknown                                                 237   3e-72    
ref|XP_004306265.1|  PREDICTED: bifunctional monodehydroascorbate...    241   4e-72    
ref|XP_006286119.1|  hypothetical protein CARUB_v10007668mg             236   5e-72    
emb|CDY41393.1|  BnaCnng10290D                                          236   5e-72    
ref|XP_008241449.1|  PREDICTED: bifunctional monodehydroascorbate...    236   8e-72    
ref|XP_007132283.1|  hypothetical protein PHAVU_011G081900g             236   1e-71    
ref|XP_006398874.1|  hypothetical protein EUTSA_v10014397mg             235   1e-71    
ref|XP_006660137.1|  PREDICTED: bifunctional monodehydroascorbate...    235   2e-71    
ref|XP_002532664.1|  carbonic anhydrase, putative                       234   2e-71    
ref|NP_193832.1|  alpha carbonic anhydrase 6                            234   3e-71    
ref|XP_002873139.1|  carbonic anhydrase family protein                  234   4e-71    
emb|CDY56563.1|  BnaCnng30610D                                          233   6e-71    
ref|XP_003560592.1|  PREDICTED: alpha carbonic anhydrase 7-like         234   8e-71    
ref|XP_006286833.1|  hypothetical protein CARUB_v10003788mg             233   8e-71    
ref|XP_009599194.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    233   1e-70    
ref|XP_006659407.1|  PREDICTED: bifunctional monodehydroascorbate...    232   2e-70    
ref|XP_007028639.1|  Carbonic anhydrase, putative                       232   3e-70    
ref|XP_004241280.1|  PREDICTED: bifunctional monodehydroascorbate...    231   4e-70    
ref|XP_006296034.1|  hypothetical protein CARUB_v10025180mg             230   5e-70    
ref|XP_006660200.1|  PREDICTED: bifunctional monodehydroascorbate...    232   6e-70    
ref|XP_011075611.1|  PREDICTED: alpha carbonic anhydrase 7-like         231   7e-70    
ref|XP_002869914.1|  carbonic anhydrase family protein                  229   1e-69    
gb|ABK28680.1|  unknown                                                 229   2e-69    
ref|XP_010434246.1|  PREDICTED: alpha carbonic anhydrase 4-like         229   2e-69    
ref|NP_196038.1|  alpha carbonic anhydrase 3                            229   3e-69    
ref|XP_004242096.1|  PREDICTED: bifunctional monodehydroascorbate...    229   3e-69    
gb|EEE68706.1|  hypothetical protein OsJ_27361                          229   6e-69    
gb|KFK24865.1|  hypothetical protein AALP_AA8G035000                    228   7e-69    
ref|XP_008442729.1|  PREDICTED: bifunctional monodehydroascorbate...    229   1e-68    
ref|NP_001175588.1|  Os08g0424100                                       227   2e-68    
gb|EMS55408.1|  Bifunctional monodehydroascorbate reductase and c...    227   2e-68    
gb|EAZ07038.1|  hypothetical protein OsI_29285                          226   5e-68    
ref|XP_002532665.1|  carbonic anhydrase, putative                       225   6e-68    
ref|XP_008442726.1|  PREDICTED: bifunctional monodehydroascorbate...    225   9e-68    
emb|CAA53781.1|  storage protein                                        225   1e-67    
ref|XP_010423620.1|  PREDICTED: alpha carbonic anhydrase 3              225   2e-67    
ref|XP_008677173.1|  PREDICTED: carbonic anhydrase isoform X1           225   5e-67    
ref|XP_010490921.1|  PREDICTED: alpha carbonic anhydrase 3-like         223   5e-67    
gb|ACN85320.1|  unknown                                                 224   5e-67    
gb|ACN85304.1|  unknown                                                 224   5e-67    
ref|XP_009125546.1|  PREDICTED: alpha carbonic anhydrase 3-like i...    223   6e-67    
gb|ACN85275.1|  unknown                                                 223   1e-66    
ref|XP_004965905.1|  PREDICTED: bifunctional monodehydroascorbate...    223   2e-66    
gb|KHN18684.1|  Bifunctional monodehydroascorbate reductase and c...    219   3e-66    
gb|EMS63276.1|  Bifunctional monodehydroascorbate reductase and c...    222   4e-66    
ref|XP_010904591.1|  PREDICTED: alpha carbonic anhydrase 7-like         221   1e-65    
gb|EMS68433.1|  hypothetical protein TRIUR3_33908                       218   3e-65    
gb|ACT36293.1|  dioscorin precursor                                     218   3e-65    
gb|EMT14744.1|  Bifunctional monodehydroascorbate reductase and c...    221   3e-65    
ref|XP_009125547.1|  PREDICTED: alpha carbonic anhydrase 3-like i...    218   4e-65    
ref|XP_010090214.1|  hypothetical protein L484_016553                   219   6e-65    
gb|ACT36290.1|  dioscorin precursor                                     218   9e-65    
gb|ACT36289.1|  dioscorin precursor                                     217   1e-64    
ref|XP_006843475.1|  hypothetical protein AMTR_s00053p00197030          216   2e-64    
gb|ACN85335.1|  unknown                                                 217   2e-64    
gb|ACT36288.1|  dioscorin precursor                                     216   3e-64    
emb|CAO98738.1|  dioscorin 5 precursor                                  216   3e-64    
gb|ACT36292.1|  dioscorin precursor                                     216   4e-64    
gb|ACT36291.1|  dioscorin precursor                                     215   5e-64    
pir||S57767  dioscorin class B - Dioscorea cayenensis (fragment)        214   1e-63 
gb|AEN14505.1|  dioscorin A3                                            213   2e-63    
ref|XP_010558882.1|  PREDICTED: alpha carbonic anhydrase 7-like         214   2e-63    
emb|CAO98739.1|  dioscorin 6 precursor                                  213   3e-63    
dbj|BAD18020.1|  tuber storage protein                                  213   4e-63    
emb|CAO98736.1|  dioscorin 3 precursor                                  213   5e-63    
emb|CAO98737.1|  dioscorin 4 precursor                                  213   5e-63    
gb|AAF63334.1|AF245019_1  dioscorin A                                   213   6e-63    
dbj|BAD18021.1|  tuber storage protein                                  213   7e-63    
emb|CAO98734.1|  dioscorin 1 precursor                                  213   7e-63    
emb|CAO98735.1|  dioscorin 2 precursor                                  212   1e-62    
emb|CDY61773.1|  BnaAnng17740D                                          225   1e-62    
ref|XP_008784764.1|  PREDICTED: alpha carbonic anhydrase 7-like         212   1e-62    
gb|EMT14743.1|  Bifunctional monodehydroascorbate reductase and c...    210   3e-62    
emb|CDY35256.1|  BnaA01g07750D                                          223   4e-62    
gb|ACN85281.1|  unknown                                                 212   4e-62    
ref|XP_009795833.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    209   5e-62    
gb|EMT10087.1|  Bifunctional monodehydroascorbate reductase and c...    210   5e-62    
gb|EMT00557.1|  Bifunctional monodehydroascorbate reductase and c...    209   4e-61    
gb|AAF44711.1|AF243526_1  dioscorin B                                   208   4e-61    
gb|AAF60191.1|AF242551_1  dioscorin A                                   208   5e-61    
gb|KHN11228.1|  Bifunctional monodehydroascorbate reductase and c...    206   3e-60    
ref|XP_010322405.1|  PREDICTED: bifunctional monodehydroascorbate...    203   2e-59    
emb|CDX76409.1|  BnaA08g09910D                                          203   3e-59    
ref|XP_010312400.1|  PREDICTED: alpha carbonic anhydrase 4              201   4e-59    
gb|EEC83601.1|  hypothetical protein OsI_29288                          202   7e-59    
gb|KEH42020.1|  eukaryotic-type carbonic anhydrase                      202   1e-58    
ref|XP_009776976.1|  PREDICTED: alpha carbonic anhydrase 7-like         199   1e-58    
ref|XP_007150181.1|  hypothetical protein PHAVU_005G133400g             201   1e-58    
gb|KEH42022.1|  eukaryotic-type carbonic anhydrase                      201   2e-58    
gb|KEH42021.1|  eukaryotic-type carbonic anhydrase                      199   4e-58    
ref|XP_004149223.1|  PREDICTED: bifunctional monodehydroascorbate...    200   5e-58    
ref|XP_010326158.1|  PREDICTED: alpha carbonic anhydrase 7-like         197   6e-58    
ref|XP_004161225.1|  PREDICTED: bifunctional monodehydroascorbate...    199   1e-57    
gb|AFW87496.1|  hypothetical protein ZEAMMB73_893265                    199   4e-57    
ref|XP_004494036.1|  PREDICTED: bifunctional monodehydroascorbate...    197   5e-57    
gb|EYU18693.1|  hypothetical protein MIMGU_mgv1a011955mg                197   7e-57    
ref|XP_010036672.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    197   7e-57    
gb|KDP29186.1|  hypothetical protein JCGZ_16575                         192   1e-56    
ref|XP_002528758.1|  carbonic anhydrase, putative                       196   2e-56    
ref|XP_008243568.1|  PREDICTED: bifunctional monodehydroascorbate...    196   2e-56    
ref|XP_007027757.1|  Alpha carbonic anhydrase 1, putative               196   2e-56    
ref|XP_002438666.1|  hypothetical protein SORBIDRAFT_10g023940          194   3e-56    
ref|NP_001140512.1|  uncharacterized protein LOC100272575 precursor     195   4e-56    
gb|EYU38639.1|  hypothetical protein MIMGU_mgv1a011347mg                195   5e-56    
ref|XP_004978704.1|  PREDICTED: bifunctional monodehydroascorbate...    193   3e-55    
gb|EEE68707.1|  hypothetical protein OsJ_27363                          206   3e-55    
gb|KHN46012.1|  Bifunctional monodehydroascorbate reductase and c...    192   4e-55    
ref|XP_009374764.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    192   5e-55    
ref|NP_001066181.1|  Os12g0153500                                       192   5e-55    
ref|XP_006430188.1|  hypothetical protein CICLE_v10013720mg             192   6e-55    
ref|XP_010918699.1|  PREDICTED: alpha carbonic anhydrase 7-like         192   7e-55    
ref|NP_001242755.1|  uncharacterized protein LOC100797401 precursor     191   1e-54    
ref|XP_006281537.1|  hypothetical protein CARUB_v10027638mg             192   1e-54    
emb|CAM59683.1|  a-type carbonic anhydrase                              191   2e-54    
ref|XP_008677673.1|  PREDICTED: uncharacterized protein LOC100384...    191   2e-54    
ref|XP_007144395.1|  hypothetical protein PHAVU_007G152600g             191   2e-54    
ref|XP_010325903.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    191   3e-54    
ref|XP_007203398.1|  hypothetical protein PRUPE_ppa021144mg             189   4e-54    
emb|CDF47511.1|  bifunctional monodehydroascorbate reductase and ...    186   4e-54    
ref|XP_002309427.2|  hypothetical protein POPTR_0006s22940g             189   4e-54    
ref|XP_004954966.1|  PREDICTED: bifunctional monodehydroascorbate...    190   5e-54    
ref|XP_006481762.1|  PREDICTED: bifunctional monodehydroascorbate...    189   7e-54    
ref|XP_009387987.1|  PREDICTED: alpha carbonic anhydrase 7-like         189   1e-53    
gb|EAZ09357.1|  hypothetical protein OsI_31629                          189   2e-53    
ref|XP_002864450.1|  hypothetical protein ARALYDRAFT_331944             189   3e-53    
dbj|BAD09855.1|  putative dioscorin class A precursor                   186   3e-53    
gb|KHG12744.1|  Bifunctional monodehydroascorbate reductase and c...    187   4e-53    
ref|XP_002449009.1|  hypothetical protein SORBIDRAFT_05g003270          187   4e-53    
ref|XP_006341109.1|  PREDICTED: bifunctional monodehydroascorbate...    187   4e-53    
ref|XP_009413153.1|  PREDICTED: alpha carbonic anhydrase 7-like         187   5e-53    
ref|XP_008442846.1|  PREDICTED: bifunctional monodehydroascorbate...    187   5e-53    
ref|XP_008387081.1|  PREDICTED: bifunctional monodehydroascorbate...    186   6e-53    
ref|NP_200444.1|  alpha carbonic anhydrase 8                            189   7e-53    
gb|EAZ44968.1|  hypothetical protein OsJ_29611                          187   9e-53    
gb|AAF79839.1|AC026875_19  T6D22.14                                     199   1e-52    
ref|XP_008784028.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    186   2e-52    
gb|KGN59002.1|  hypothetical protein Csa_3G743390                       186   2e-52    
ref|XP_004959504.1|  PREDICTED: bifunctional monodehydroascorbate...    186   2e-52    
ref|XP_010520706.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    186   3e-52    
gb|ACU22677.1|  unknown                                                 182   3e-52    
gb|EMS54273.1|  Bifunctional monodehydroascorbate reductase and c...    186   5e-52    
ref|XP_011004239.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    184   5e-52    
ref|XP_002965610.1|  hypothetical protein SELMODRAFT_84347              183   6e-52    
ref|XP_008810944.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    185   6e-52    
ref|XP_010418826.1|  PREDICTED: alpha carbonic anhydrase 2-like         181   8e-52    
ref|XP_009796023.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    184   1e-51    
ref|XP_006664349.1|  PREDICTED: bifunctional monodehydroascorbate...    184   1e-51    
ref|XP_002323427.2|  hypothetical protein POPTR_0016s08050g             183   2e-51    
ref|XP_009606839.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    183   2e-51    



>gb|EYU41598.1| hypothetical protein MIMGU_mgv1a011586mg [Erythranthe guttata]
Length=277

 Score =   388 bits (997),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/265 (68%), Positives = 220/265 (83%), Gaps = 4/265 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            LI+  ++ L   S  AQEVEDEREFDYAE  EKGPR+WG +K+EWAAC+NG MQSP+DMS
Sbjct  14   LIVACLVLLAAKSIHAQEVEDEREFDYAEKGEKGPRKWGHIKEEWAACNNGTMQSPVDMS  73

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            + RV+II+      ++ Y+ +NATVRNRGHDI I+W GDAGS++INGT++ L+ AHWHSP
Sbjct  74   NARVRIISKPE---KRIYRVSNATVRNRGHDIQIQWSGDAGSILINGTEFSLRYAHWHSP  130

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RD  609
            SEHTINGRRY +ELHMVH NTD N+T +IAV+G+LYKIGKPD FLSKLMRNISS++D +D
Sbjct  131  SEHTINGRRYDMELHMVHLNTDSNVTTKIAVVGILYKIGKPDKFLSKLMRNISSIVDNKD  190

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             +  +GM +P+DIK+RSKR+YRYMGSLTVPPCTEGVIWT+NKKV+T SR+Q+ LLREAVH
Sbjct  191  EQVNIGMINPNDIKLRSKRYYRYMGSLTVPPCTEGVIWTLNKKVKTVSREQVNLLREAVH  250

Query  790  DYAERNARPLQALNRREIYLLSPAG  864
            DYAE NARPLQ  N+R IYL  P  
Sbjct  251  DYAEVNARPLQPHNKRGIYLYGPGA  275



>ref|XP_006339092.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=269

 Score =   387 bits (993),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 182/262 (69%), Positives = 217/262 (83%), Gaps = 6/262 (2%)
 Frame = +1

Query  76   ILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
            +L  ++F      +AQEVEDEREFDY E SEKGP+ WG+LKKEW AC+NG+MQSPIDMSH
Sbjct  9    VLFIIIFFSATFIKAQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEMQSPIDMSH  68

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPS  435
            ERV+II       ++HYK  NATV+NRGHDI+++WHGDAGSV INGT+Y L+ AHWHSPS
Sbjct  69   ERVRIIQKPD---KRHYKLCNATVKNRGHDISLQWHGDAGSVSINGTNYPLQQAHWHSPS  125

Query  436  EHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DV  612
            EHT+NGRRY +E+HMVH N  +N TN+I VIGVLYKIGKPD FLSKL+RNISSMID+ D 
Sbjct  126  EHTVNGRRYDMEMHMVHLN--ENATNKIVVIGVLYKIGKPDRFLSKLIRNISSMIDKKDE  183

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
             K  GM DP +IK+ S+++YRYMGSLTVPPCTEGVIWTI KKVRT SR Q+K+LREAVHD
Sbjct  184  VKNAGMIDPREIKIGSRKYYRYMGSLTVPPCTEGVIWTIKKKVRTVSRAQVKMLREAVHD  243

Query  793  YAERNARPLQALNRREIYLLSP  858
            YAERN RPLQ+ N+R IYL++P
Sbjct  244  YAERNGRPLQSKNKRPIYLMAP  265



>ref|XP_004249474.1| PREDICTED: alpha carbonic anhydrase 7-like [Solanum lycopersicum]
Length=269

 Score =   386 bits (992),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 182/262 (69%), Positives = 216/262 (82%), Gaps = 6/262 (2%)
 Frame = +1

Query  76   ILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
            IL  ++F      +AQEVEDEREFDY E SEKGP+ WG+LKKEW AC+NG+MQSPIDMSH
Sbjct  9    ILFIIIFFSTTFIKAQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEMQSPIDMSH  68

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPS  435
            ERV+II       ++HYK  NATV+NRGHDI+++WHGDAGSV INGT+Y L+ AHWHSPS
Sbjct  69   ERVRIIQKPD---KRHYKLCNATVKNRGHDISLQWHGDAGSVTINGTNYPLQQAHWHSPS  125

Query  436  EHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DV  612
            EHT+NGRRY +E+HMVH N  +N TN+I VIGVLYKIGKPD FLSKL+RNISSMID+ D 
Sbjct  126  EHTVNGRRYDMEMHMVHLN--ENATNKIVVIGVLYKIGKPDRFLSKLIRNISSMIDKKDE  183

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
             K  GM DP +IK+ S+++YRYMGSLTVPPCTEGVIWTI KKVRT SR Q+K+LREAVHD
Sbjct  184  VKNAGMIDPREIKIGSRKYYRYMGSLTVPPCTEGVIWTIKKKVRTVSRAQVKMLREAVHD  243

Query  793  YAERNARPLQALNRREIYLLSP  858
            YAE+N RPLQ  N+R IYL++P
Sbjct  244  YAEKNGRPLQPKNKRPIYLMAP  265



>ref|XP_011077301.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=278

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/265 (69%), Positives = 220/265 (83%), Gaps = 5/265 (2%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            ++T  LI+ F+L   P S  AQEV+DEREF+YA  S+ GP +WG++KKEWAAC+NG +QS
Sbjct  11   IITPLLIVLFIL-AGPKSIDAQEVDDEREFEYAANSDMGPGKWGQIKKEWAACNNGSLQS  69

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PIDMS+ERV+II+      ++ Y+ ANATVRNRGHDI ++W GDAGS+ INGT+Y L++A
Sbjct  70   PIDMSNERVRIISRSE---KRTYRAANATVRNRGHDIQMQWFGDAGSIFINGTEYPLRNA  126

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHTINGRRY LELH+VH NTD N+ N+IAVIGV YKIGKP+ FLSKLM NI SM
Sbjct  127  HWHSPSEHTINGRRYDLELHLVHLNTDPNVKNKIAVIGVFYKIGKPNQFLSKLMTNIRSM  186

Query  598  ID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLL  774
            ID +D EK LGM DP DIK+RSKR+YRYMGSLTVPPCTEGVIWTINKKV+T SR Q+KLL
Sbjct  187  IDKKDEEKILGMIDPEDIKIRSKRYYRYMGSLTVPPCTEGVIWTINKKVKTVSRDQVKLL  246

Query  775  REAVHDYAERNARPLQALNRREIYL  849
            REAVHDYAE NARPLQ  + R++YL
Sbjct  247  REAVHDYAEENARPLQPKHNRDVYL  271



>ref|XP_009775004.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana sylvestris]
Length=272

 Score =   386 bits (991),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 225/275 (82%), Gaps = 6/275 (2%)
 Frame = +1

Query  43   MRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            MR+   ++  ++  FVLF    S RAQEVEDEREFDYA  SEKGPR WG++KKEW AC+N
Sbjct  1    MRQQRYLSVLVMFYFVLFFFSTSIRAQEVEDEREFDYAVKSEKGPRMWGKMKKEWEACNN  60

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G+MQSPID+S+ERV+II       +++YK  NATV+NRGHDI+++WHGDAGS++INGT+Y
Sbjct  61   GEMQSPIDLSNERVRIIRKPE---KRNYKLCNATVKNRGHDISLQWHGDAGSLLINGTEY  117

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
             L+ AHWHSPSEHT+NGRRYA+E+HMVH N  +N TN+IAVIGVLYK GKPD FLS+L+R
Sbjct  118  PLQQAHWHSPSEHTVNGRRYAMEMHMVHLN--ENATNKIAVIGVLYKFGKPDKFLSRLIR  175

Query  583  NISSMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRK  759
            NISSMID+ D  K  GM +P +IK+ S+R+YRY+GSLTVPPCTEGVIW+I KKVRT SR 
Sbjct  176  NISSMIDKKDEVKNAGMINPREIKIGSRRYYRYLGSLTVPPCTEGVIWSIKKKVRTISRD  235

Query  760  QIKLLREAVHDYAERNARPLQALNRREIYLLSPAG  864
            Q+KLLREAVHDYA  NARP+Q LN+R +YL++P  
Sbjct  236  QVKLLREAVHDYAASNARPMQPLNKRPVYLMAPGA  270



>ref|XP_010098808.1| hypothetical protein L484_022573 [Morus notabilis]
 gb|EXB75896.1| hypothetical protein L484_022573 [Morus notabilis]
Length=280

 Score =   384 bits (987),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 174/261 (67%), Positives = 222/261 (85%), Gaps = 2/261 (1%)
 Frame = +1

Query  73   LILCFVLFLHPA-STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            L+L  +LF H + S +AQEVEDE EFDY+  SEKGP RWGELKKEW+AC NG MQSPID+
Sbjct  15   LVLVIILFSHSSKSVKAQEVEDESEFDYSRRSEKGPDRWGELKKEWSACKNGGMQSPIDL  74

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            S++RVKII     ++ + Y P+NATV+NRGHDI+I+WHG AGS+ INGT+YFL+ AHWHS
Sbjct  75   SNQRVKIIPKLG-KLTRSYTPSNATVKNRGHDISIQWHGKAGSIKINGTEYFLQQAHWHS  133

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
            PSEHTINGRR+ +ELHMVHQ+TD+ + N IAVIGVLYK+G+PD+FLSKLM++I+++ D+ 
Sbjct  134  PSEHTINGRRFHMELHMVHQSTDKTVKNNIAVIGVLYKLGRPDSFLSKLMKDITAISDKK  193

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             EK +G+ DPS+IK+  KR+YRYMGSLTVPPCTEGVIWTI+KK+RT S++Q++LLR AVH
Sbjct  194  EEKHMGIIDPSEIKLGGKRYYRYMGSLTVPPCTEGVIWTISKKIRTVSKQQVELLRVAVH  253

Query  790  DYAERNARPLQALNRREIYLL  852
            DYAE NARP+Q +NRR+I+L 
Sbjct  254  DYAEENARPVQPINRRDIHLF  274



>ref|XP_009592985.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana tomentosiformis]
Length=272

 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 224/275 (81%), Gaps = 6/275 (2%)
 Frame = +1

Query  43   MRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            MR    ++  +I+ F+LFL   S RAQEVEDEREFDYA  SEKGPR WG+LKKEW AC+ 
Sbjct  1    MREQRYLSFVVIIYFLLFLPATSIRAQEVEDEREFDYAAKSEKGPRMWGKLKKEWDACNK  60

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G+MQSPID+S+ERV+II       +++YK  NATV+NRGHDI+++WHG+AGSV+INGT+Y
Sbjct  61   GEMQSPIDLSNERVRIIRKPE---KRNYKLCNATVKNRGHDISLQWHGNAGSVLINGTEY  117

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
             L+ AHWHSPSEHT+NGRRYA+E+HMVH N  +N TN+IAVIGVLYK GKPD FLSKL+R
Sbjct  118  PLQQAHWHSPSEHTVNGRRYAMEMHMVHLN--ENATNKIAVIGVLYKFGKPDKFLSKLIR  175

Query  583  NISSMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRK  759
            NISSMID+ D  K  GM +P +IK+ S+++YRY+GSLTVPPC EGVIW+I KKVRT SR 
Sbjct  176  NISSMIDKKDEVKNAGMINPREIKIGSRKYYRYLGSLTVPPCIEGVIWSIKKKVRTISRD  235

Query  760  QIKLLREAVHDYAERNARPLQALNRREIYLLSPAG  864
            Q+KLLREAVHDYA  NARP+Q LN+R +YL++P  
Sbjct  236  QVKLLREAVHDYAASNARPMQPLNKRPVYLMAPGA  270



>emb|CDP15287.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   379 bits (972),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/286 (65%), Positives = 219/286 (77%), Gaps = 18/286 (6%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            S+++   ++   +L     ST+AQEVEDEREFDYAEGS+KGP+RWG+LKKEWAACSNG  
Sbjct  14   SVILLLLVVTSILLLFGATSTKAQEVEDEREFDYAEGSKKGPKRWGKLKKEWAACSNGAF  73

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPIDMS+ERV++I+      R  YKP NAT++NRGHDI+++W GDAGS+ INGT Y L+
Sbjct  74   QSPIDMSNERVRLISKPE---RPIYKPTNATIKNRGHDISLQWGGDAGSIAINGTVYPLR  130

Query  412  SAHWHSPSEHTINGRR--------------YALELHMVHQNTDQNLTNQIAVIGVLYKIG  549
             AHWHSPSEHTI GRR              Y LELHMVH +TD NL N+IAVIGVLYKIG
Sbjct  131  QAHWHSPSEHTIRGRRHLSLFSGFLRSFFRYDLELHMVHLSTDPNLKNKIAVIGVLYKIG  190

Query  550  KPDAFLSKLMRNISSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWT  726
            KPD FLSKL   IS+MID +D ++ L + DP  I+M SKR+YRYMGSLTVPPCTEGVIWT
Sbjct  191  KPDKFLSKLTSYISTMIDEKDEQRSLDVVDPRQIEMHSKRYYRYMGSLTVPPCTEGVIWT  250

Query  727  INKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSPAG  864
            IN+KVRT SR Q+ LLREAVHDYAERNARP+Q  N R+IYL  PA 
Sbjct  251  INRKVRTVSRDQVMLLREAVHDYAERNARPIQQQNGRDIYLYGPAA  296



>gb|EYU38572.1| hypothetical protein MIMGU_mgv1a011717mg [Erythranthe guttata]
Length=272

 Score =   376 bits (966),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 177/264 (67%), Positives = 209/264 (79%), Gaps = 4/264 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            L++  VL     S  AQEVEDEREFDY++  EKGPR+WGE+KKEW AC+NG  QSPIDMS
Sbjct  7    LLMFIVLLFGAKSINAQEVEDEREFDYSKKGEKGPRKWGEIKKEWGACNNGSFQSPIDMS  66

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERV I +      +++Y+  NAT++NRGHDI IEW GDAGS+ IN T+Y L+ AHWHSP
Sbjct  67   NERVVIFSRPE---KRNYRLTNATIKNRGHDIQIEWFGDAGSIFINNTEYPLRQAHWHSP  123

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RD  609
            SEHTINGRRY +ELH+VH NTD N+ N+I V G+LY+IGKPD FLSKLM+NISSMID +D
Sbjct  124  SEHTINGRRYDMELHLVHLNTDPNVKNRITVTGILYEIGKPDKFLSKLMKNISSMIDKKD  183

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             E  +G  DP  IK+RSK  YRYMGSLTVPPCT+GVIWTINKKV+T SR QIKLLREAVH
Sbjct  184  EEITVGKIDPDKIKLRSKMFYRYMGSLTVPPCTQGVIWTINKKVKTVSRDQIKLLREAVH  243

Query  790  DYAERNARPLQALNRREIYLLSPA  861
            DYAE NARPLQ  NRR++YL  P 
Sbjct  244  DYAEENARPLQPKNRRDVYLYRPG  267



>ref|XP_002519458.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF42872.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score =   368 bits (945),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 216/269 (80%), Gaps = 4/269 (1%)
 Frame = +1

Query  46   RRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNG  225
            R  +  T + ++  +LF H    +AQEVEDEREFDY +GSEKGP +WGELKKEWA+C NG
Sbjct  5    RAYMFFTIATLISVLLFSH--QVKAQEVEDEREFDYIQGSEKGPEKWGELKKEWASCKNG  62

Query  226  DMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHG-DAGSVIINGTDY  402
             +QSPIDMS++RVKII     +++++Y+  N+TV+NRGHDI+++W G  AGSV INGT Y
Sbjct  63   TLQSPIDMSNQRVKIIPKSG-DLKRNYRSCNSTVKNRGHDISLQWEGHKAGSVNINGTGY  121

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
            FL+  HWHSPSEHTINGRRY +ELHMVH++TD N+ N+IAV G+LYKIG+PDAFLSKL+ 
Sbjct  122  FLQQCHWHSPSEHTINGRRYDMELHMVHESTDPNVKNKIAVTGILYKIGQPDAFLSKLLG  181

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
            N+ SM D   ++ +GM +P++IKM  KR+YRY GSLTVPPCTEGVIWTINKK+RT S  Q
Sbjct  182  NVISMTDHKQDRNMGMINPNEIKMGGKRYYRYEGSLTVPPCTEGVIWTINKKIRTVSIDQ  241

Query  763  IKLLREAVHDYAERNARPLQALNRREIYL  849
            +K LREAVHDYAE+N+RP+Q LN RE+ L
Sbjct  242  VKALREAVHDYAEKNSRPVQPLNEREVQL  270



>ref|XP_008227262.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Prunus mume]
Length=281

 Score =   367 bits (942),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 171/259 (66%), Positives = 207/259 (80%), Gaps = 2/259 (1%)
 Frame = +1

Query  76   ILCFVLF-LHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            +L  VLF  +     AQEVEDEREFDY +GS KGP++WGE+KKEWAAC NG MQSPID+S
Sbjct  14   VLFLVLFSQYSTPVTAQEVEDEREFDYLQGSGKGPKQWGEMKKEWAACKNGGMQSPIDLS  73

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
             +RVK+I  +  ++   YKP NATV+NRGHDI+IEW GDAGS+ INGT+Y LK  HWHSP
Sbjct  74   SQRVKLIP-NLGKLNTAYKPCNATVKNRGHDISIEWVGDAGSLKINGTEYLLKQCHWHSP  132

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDV  612
            SEH+INGRRY +ELHMVH + D N+TN+IAV+  LYKIG+PD+FLSKL R+I SM D+  
Sbjct  133  SEHSINGRRYDMELHMVHLSPDPNVTNKIAVVAALYKIGRPDSFLSKLTRDIKSMTDQKE  192

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
            E+  G+ DP+ IK+  K +YRYMGSLTVPPCTEGVIWTINKK+RT SR Q+KL R AVHD
Sbjct  193  ERSAGIIDPNKIKIPGKSYYRYMGSLTVPPCTEGVIWTINKKIRTVSRDQVKLFRVAVHD  252

Query  793  YAERNARPLQALNRREIYL  849
            YAE NARP+Q LN REI++
Sbjct  253  YAETNARPVQPLNLREIHV  271



>ref|XP_004143278.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN48196.1| hypothetical protein Csa_6G446560 [Cucumis sativus]
Length=276

 Score =   365 bits (938),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/269 (62%), Positives = 214/269 (80%), Gaps = 3/269 (1%)
 Frame = +1

Query  58   LVTGSLILCFVL--FLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
              +  ++  F+L  F+H +S  AQEVEDEREFDYAEGS+KGP  WGE+KKEW AC+NGD+
Sbjct  3    FCSTPIVFFFILLYFIHSSSISAQEVEDEREFDYAEGSQKGPGHWGEIKKEWEACNNGDL  62

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+S +RVKI+     E+++ Y P NATV+NRGHDI++ W+G  GS+ ING  Y L+
Sbjct  63   QSPIDLSSQRVKIVP-QLGELKRSYYPCNATVKNRGHDISVYWYGKPGSIEINGDVYDLQ  121

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
             +HWHSPSEH++NGRRY LELHMVHQ++D  + N+IAV+G LY IG+PD F+++L R I 
Sbjct  122  QSHWHSPSEHSVNGRRYDLELHMVHQSSDPTVKNKIAVVGQLYTIGQPDPFITQLSREIL  181

Query  592  SMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
             M+DR  EK++G+ +P+DIK   K++YRY+GSLTVPPCTEGVIWT+NKK+RT SR+Q++L
Sbjct  182  GMVDRKHEKKVGVMNPADIKFGGKKYYRYLGSLTVPPCTEGVIWTMNKKIRTVSREQVRL  241

Query  772  LREAVHDYAERNARPLQALNRREIYLLSP  858
            LREAVHDYAE NARPLQ LN REI L  P
Sbjct  242  LREAVHDYAEFNARPLQPLNSREIGLYRP  270



>ref|XP_007027463.1| Alpha carbonic anhydrase 7 isoform 1 [Theobroma cacao]
 gb|EOY07965.1| Alpha carbonic anhydrase 7 isoform 1 [Theobroma cacao]
Length=282

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 208/268 (78%), Gaps = 2/268 (1%)
 Frame = +1

Query  49   RSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            + I V+  LI   +   + AS  AQEVEDEREFDY E S KGP +WG+LKKEW AC NG 
Sbjct  6    KPIFVSVFLIFAVLFLSYSASVSAQEVEDEREFDYLENSGKGPSQWGDLKKEWVACKNGG  65

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHG-DAGSVIINGTDYF  405
            +QSPIDMS  RVK+I     E++K YKP +A V+NRGHDI+++W   DAGS+  NGT+YF
Sbjct  66   LQSPIDMSSLRVKVINKSG-ELKKRYKPCHAIVKNRGHDISLQWPNYDAGSIKTNGTEYF  124

Query  406  LKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRN  585
            L+ AHWHSPSEHTINGRRYALELHMVHQ  D N+ N +AV+G+LYK G PDAFLSKL+ N
Sbjct  125  LQQAHWHSPSEHTINGRRYALELHMVHQCKDPNVKNNLAVVGLLYKFGAPDAFLSKLIGN  184

Query  586  ISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
            I+SM D   E+ +G+ DPS IKM  K++YRYMGSLTVPPCTEGVIWT+NKK+RT SR Q+
Sbjct  185  ITSMNDHVQERYMGLIDPSLIKMGGKKYYRYMGSLTVPPCTEGVIWTMNKKIRTVSRDQV  244

Query  766  KLLREAVHDYAERNARPLQALNRREIYL  849
            + LR AVHDYAE NARP+Q LNRREI L
Sbjct  245  RALRIAVHDYAEANARPVQPLNRREIEL  272



>ref|XP_004515925.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=279

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/273 (62%), Positives = 215/273 (79%), Gaps = 1/273 (0%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            ++ +   LIL  +L      T AQEVEDE EFDY + S+KGP RWGELKKEWA+C NG +
Sbjct  8    TMFLPNLLILVTILIHSTTLTIAQEVEDESEFDYIKESKKGPSRWGELKKEWASCKNGKL  67

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+S  RV+I+T +  +++K+YKP NAT++NRGHDI ++W GDAGS+ INGT++FL 
Sbjct  68   QSPIDLSSHRVRIVT-NLGKLKKYYKPQNATIKNRGHDIEVKWEGDAGSININGTEFFLH  126

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHTINGRRY +ELHMVH++   N  ++IAVIG+LYKIG+PD  L+KL + I 
Sbjct  127  QCHWHSPSEHTINGRRYDMELHMVHESPKINGKSKIAVIGLLYKIGRPDPVLTKLSKYIK  186

Query  592  SMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
            SMID + E+ +G+ DPSDIK  SK++YRY GSLTVPPCTEGVIWTINKK+R  SR Q++L
Sbjct  187  SMIDNEAERSIGVIDPSDIKFGSKKYYRYRGSLTVPPCTEGVIWTINKKIRRVSRDQMEL  246

Query  772  LREAVHDYAERNARPLQALNRREIYLLSPAGKK  870
            LREAVHD+AE+NARP+Q LNRREI L  P  K+
Sbjct  247  LREAVHDHAEKNARPVQFLNRREIQLYGPKRKE  279



>ref|XP_010050504.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
Length=283

 Score =   362 bits (928),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 173/269 (64%), Positives = 213/269 (79%), Gaps = 8/269 (3%)
 Frame = +1

Query  73   LILCFVLF--LHPAS----TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
            L+  F LF  L P+S    + A EVEDEREFDY  GSEKGP+ WGEL+KEW AC  G+ Q
Sbjct  9    LLSAFSLFFLLAPSSAATLSTAGEVEDEREFDYIAGSEKGPKHWGELRKEWEACKKGETQ  68

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWH-GDAGSVIINGTDYFLK  411
            SPID+S  RVK+I      +++ YKP+NAT++NRGHDI+++W  G+ GSV INGT+YFL+
Sbjct  69   SPIDLSSRRVKVIPKLGG-IQRSYKPSNATLKNRGHDISLQWDVGNVGSVKINGTEYFLQ  127

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHTINGRRY +ELHMVH +TD N+ N IAV+G+LYK G+PDAFLSKLM N+ 
Sbjct  128  QCHWHSPSEHTINGRRYEMELHMVHVSTDPNVENNIAVVGLLYKTGRPDAFLSKLMGNLW  187

Query  592  SMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
            SM+D++ E+ +G+FDP  IKM  K + RYMGSLTVPPCTEGVIWTINKK+ T S+ QIKL
Sbjct  188  SMVDQEGERTMGVFDPRKIKMGGKSYLRYMGSLTVPPCTEGVIWTINKKIGTVSKDQIKL  247

Query  772  LREAVHDYAERNARPLQALNRREIYLLSP  858
            LREAVHD+AE+NARP+Q LNRREI+L  P
Sbjct  248  LREAVHDHAEKNARPVQPLNRREIHLYQP  276



>ref|XP_008362138.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=279

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/259 (64%), Positives = 204/259 (79%), Gaps = 2/259 (1%)
 Frame = +1

Query  79   LCFVLFLHPA-STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
             C V FL  A S  AQEVEDEREFDY +GS KGP++WG  KKEW+AC NG MQSPID+S 
Sbjct  13   FCLVFFLCSATSITAQEVEDEREFDYLQGSGKGPKQWGAXKKEWSACKNGGMQSPIDLSS  72

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPS  435
             RV ++  +  ++   Y P NATV+NRGHDI+I W G+AGS+ INGT Y LK +HWHSPS
Sbjct  73   HRVTLVP-NLGKLNISYNPCNATVKNRGHDISIYWEGNAGSIHINGTQYLLKQSHWHSPS  131

Query  436  EHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVE  615
            EH++NGRRY +ELHMVH ++D N+TN+IAV+GVLYKIG+PD+FLSKL  ++ SM+D+  E
Sbjct  132  EHSVNGRRYDMELHMVHLSSDPNVTNKIAVVGVLYKIGRPDSFLSKLTGHVKSMMDQTEE  191

Query  616  KELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDY  795
            + +G  DP +IK+R K +YRYMGSLTVPPCTEGVIWTINKK+RT SR Q+KL R AVHDY
Sbjct  192  RNIGTIDPREIKIRKKNYYRYMGSLTVPPCTEGVIWTINKKIRTVSRDQVKLFRVAVHDY  251

Query  796  AERNARPLQALNRREIYLL  852
            AE NARP+Q LN REI + 
Sbjct  252  AEMNARPVQPLNLREIQVF  270



>gb|KHN39018.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=278

 Score =   359 bits (921),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 205/262 (78%), Gaps = 1/262 (0%)
 Frame = +1

Query  70   SLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            +LI+   + LH     AQEVEDE EFDY +GSEKGP  WGELKKEW  C +G MQSPID+
Sbjct  13   NLIILVTILLHSTWINAQEVEDESEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDL  72

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            S  RV+++     E++K+YKP NATV+NRGHDI ++W GDAGS+ INGT++FL   HWHS
Sbjct  73   SSHRVRVVPKLG-ELKKYYKPQNATVKNRGHDIELKWEGDAGSININGTEFFLHQCHWHS  131

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
            PSEHTINGRRY LELHMVH++   N   +IAV+G+ YKIG+PD+ L+KL + I +M+D +
Sbjct  132  PSEHTINGRRYDLELHMVHESKRINGKGKIAVVGLFYKIGRPDSVLNKLSKFIKTMVDEE  191

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             EK +G FDPS IK+  K++YRYMGSLTVPPCTEGVIWTINKK+RT SR Q+ LLREAVH
Sbjct  192  EEKNIGAFDPSKIKLGGKKYYRYMGSLTVPPCTEGVIWTINKKIRTVSRAQVNLLREAVH  251

Query  790  DYAERNARPLQALNRREIYLLS  855
            D+AE+NARP+Q LNRR I L +
Sbjct  252  DHAEKNARPIQPLNRRGIQLYA  273



>ref|XP_003535188.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=278

 Score =   357 bits (917),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 205/262 (78%), Gaps = 1/262 (0%)
 Frame = +1

Query  70   SLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            +LI+   + LH     AQEVEDE EFDY +GSEKGP  WGELKKEW  C +G MQSPID+
Sbjct  13   NLIILVTILLHSTWINAQEVEDESEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDL  72

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            S  RV+++     E++K+YKP NATV+NRGHDI ++W GDAGS+ INGT++FL   HWHS
Sbjct  73   SSHRVRVVPKLG-ELKKYYKPQNATVKNRGHDIELKWEGDAGSININGTEFFLHQCHWHS  131

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
            PSEHTINGRRY LELHMVH++   N   +IAV+G+ YKIG+PD+ L+KL + I +M+D +
Sbjct  132  PSEHTINGRRYDLELHMVHESKRINGKGKIAVVGLFYKIGRPDSVLNKLSKFIKTMVDEE  191

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             EK +G+FDPS IK+  K++YRYMGSLTVPPC EGVIWTINKK+RT SR Q+ LLREAVH
Sbjct  192  EEKNIGVFDPSKIKLGGKKYYRYMGSLTVPPCIEGVIWTINKKIRTVSRAQVNLLREAVH  251

Query  790  DYAERNARPLQALNRREIYLLS  855
            D+AE+NARP+Q LNRR I L +
Sbjct  252  DHAEKNARPIQPLNRRGIQLYA  273



>ref|XP_007144378.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
 gb|ESW16372.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
Length=279

 Score =   357 bits (916),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/268 (63%), Positives = 209/268 (78%), Gaps = 2/268 (1%)
 Frame = +1

Query  70   SLILCFVLFLHPAS-TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            +LI+  ++ LH      AQEVEDE EFDY +GSEKGP RWGELKKEW  C +G MQSPID
Sbjct  13   NLIILAIIVLHSTPWISAQEVEDESEFDYLKGSEKGPSRWGELKKEWETCKSGKMQSPID  72

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            +S  RVK++     E++KHYKP NATV+NRGHDI ++W  DAGS+ IN TD+FL   HWH
Sbjct  73   LSSHRVKVVPKLG-ELKKHYKPQNATVKNRGHDIELKWGEDAGSININATDFFLHQCHWH  131

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR  606
            SPSEHTINGRRY LELHMVH++  +N   +IAV+G+L+KIG+PD  LSKL   I SM + 
Sbjct  132  SPSEHTINGRRYDLELHMVHESKSKNGKTKIAVVGILFKIGRPDPILSKLSEIIKSMGEN  191

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            +VEK++G+FDPS+IK+  K++YRY+GSLTVPPCTEGVIWTINKK++T SR Q+ LLREAV
Sbjct  192  EVEKKIGVFDPSEIKLGGKKYYRYIGSLTVPPCTEGVIWTINKKIKTVSRAQVNLLREAV  251

Query  787  HDYAERNARPLQALNRREIYLLSPAGKK  870
            HD+AE N+RP QALN+R I L  P  K+
Sbjct  252  HDHAELNSRPRQALNKRGIQLYGPKRKE  279



>ref|XP_010050537.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89340.1| hypothetical protein EUGRSUZ_A01633 [Eucalyptus grandis]
Length=283

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/270 (62%), Positives = 210/270 (78%), Gaps = 4/270 (1%)
 Frame = +1

Query  58   LVTGSLILCFVLFLH--PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            ++  S  L F+L L    AS+   EVEDEREFDY   S+KGPR WGEL+KEW AC  G+M
Sbjct  8    ILCSSFTLFFLLALRSVAASSMPGEVEDEREFDYIPKSKKGPRHWGELRKEWEACKKGEM  67

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWH-GDAGSVIINGTDYFL  408
            QSPID+S  RVK+I     E+++ YKP+ A ++NRGHDI+++W  G AGS+ INGT +FL
Sbjct  68   QSPIDLSSRRVKVIPKLG-EIKRSYKPSKAILKNRGHDISLQWDLGSAGSIKINGTRHFL  126

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            +  HWHSPSEHTINGRRY LELHMVH  TD ++ N+IAV+G+LYK G+P+AFLSKLM N+
Sbjct  127  QQFHWHSPSEHTINGRRYELELHMVHVTTDPDVKNKIAVVGLLYKTGQPNAFLSKLMGNV  186

Query  589  SSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
             SM+D+  E+++G  DP +IKM  K + RYMGSLTVPPCTEGVIWTINKK+ T S+ QIK
Sbjct  187  RSMVDKKGERKMGAIDPREIKMGGKSYLRYMGSLTVPPCTEGVIWTINKKIGTVSKDQIK  246

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSP  858
            LLREAVHDYAE+N+RP+Q LNRREI+L  P
Sbjct  247  LLREAVHDYAEKNSRPVQPLNRREIHLYQP  276



>ref|XP_008227274.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=282

 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = +1

Query  100  HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITT  279
            +  S  AQEVEDEREFDY + S KGP++WGE+KKEWAAC NG MQSPID+S +RVK+I  
Sbjct  24   YSTSVEAQEVEDEREFDYLQRSGKGPKQWGEMKKEWAACKNGVMQSPIDLSSQRVKLIP-  82

Query  280  HHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRR  459
            +  ++   YKP NATV+NRGHDI++EW G+AGS+ INGT+Y LK  HWHSPSEH+INGRR
Sbjct  83   NLGKLNTTYKPCNATVKNRGHDISMEWMGNAGSIQINGTEYLLKQCHWHSPSEHSINGRR  142

Query  460  YALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDP  639
             A+ELHMVH + D N+TN+IAV+GVLYKIG+ ++FLSKL R++ SM D+  ++ +GM DP
Sbjct  143  NAMELHMVHLSLDPNVTNKIAVVGVLYKIGRANSFLSKLTRDVKSMTDQKEKRNMGMIDP  202

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
              IK+  K +YRYMGSLTVPPCTEGVIWTI+KK+RT SR Q+KL R AVHDYAE NARP+
Sbjct  203  RKIKIGGKNYYRYMGSLTVPPCTEGVIWTIDKKIRTVSRDQVKLFRFAVHDYAEMNARPV  262

Query  820  QALNRREI  843
            Q LN REI
Sbjct  263  QPLNLREI  270



>ref|XP_008462491.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=276

 Score =   353 bits (906),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 205/254 (81%), Gaps = 1/254 (0%)
 Frame = +1

Query  100  HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITT  279
            H +S  AQEVEDER+FDY E S+KGP  WGE+KKEW AC+NGD+QSPID+S ERVKI+  
Sbjct  19   HSSSISAQEVEDERDFDYVEWSQKGPGHWGEIKKEWEACNNGDLQSPIDLSSERVKIVP-  77

Query  280  HHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRR  459
               E++++Y P NATV+NRGHDI++ W+G  GS+ ING  Y L+ +HWHSPSEH+INGRR
Sbjct  78   QLGELKRNYYPCNATVKNRGHDISVYWYGKPGSIEINGVVYDLQQSHWHSPSEHSINGRR  137

Query  460  YALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDP  639
            Y LELHMVHQ++D  + N+IAV+G LY IG+PD F+++L R I  M+DR  EK++G+ +P
Sbjct  138  YDLELHMVHQSSDPTVKNKIAVVGQLYTIGQPDPFITQLSREILGMVDRKHEKKVGVMNP  197

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
            +DIK   +++YRY+GSLTVPPCTEGVIWT+NKK+RT SR+Q++LLREAVHDYAE NARPL
Sbjct  198  ADIKFGGRKYYRYLGSLTVPPCTEGVIWTMNKKIRTVSREQVRLLREAVHDYAEFNARPL  257

Query  820  QALNRREIYLLSPA  861
            Q LN REI L  P 
Sbjct  258  QPLNSREIGLYRPT  271



>gb|KCW89335.1| hypothetical protein EUGRSUZ_A01626, partial [Eucalyptus grandis]
Length=249

 Score =   349 bits (896),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 199/243 (82%), Gaps = 2/243 (1%)
 Frame = +1

Query  133  DEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKP  312
            DEREFDY  GSEKGP+ WGEL+KEW AC  G+ QSPID+S  RVK+I      +++ YKP
Sbjct  1    DEREFDYIAGSEKGPKHWGELRKEWEACKKGETQSPIDLSSRRVKVIPKLGG-IQRSYKP  59

Query  313  ANATVRNRGHDIAIEWH-GDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQ  489
            +NAT++NRGHDI+++W  G+ GSV INGT+YFL+  HWHSPSEHTINGRRY +ELHMVH 
Sbjct  60   SNATLKNRGHDISLQWDVGNVGSVKINGTEYFLQQCHWHSPSEHTINGRRYEMELHMVHV  119

Query  490  NTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRH  669
            +TD N+ N IAV+G+LYK G+PDAFLSKLM N+ SM+D++ E+ +G+FDP  IKM  K +
Sbjct  120  STDPNVENNIAVVGLLYKTGRPDAFLSKLMGNLWSMVDQEGERTMGVFDPRKIKMGGKSY  179

Query  670  YRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYL  849
             RYMGSLTVPPCTEGVIWTINKK+ T S+ QIKLLREAVHD+AE+NARP+Q LNRREI+L
Sbjct  180  LRYMGSLTVPPCTEGVIWTINKKIGTVSKDQIKLLREAVHDHAEKNARPVQPLNRREIHL  239

Query  850  LSP  858
              P
Sbjct  240  YQP  242



>ref|XP_008227264.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=282

 Score =   350 bits (898),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/271 (61%), Positives = 206/271 (76%), Gaps = 2/271 (1%)
 Frame = +1

Query  70   SLILCFV-LFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            S  L FV LF +  S  AQEVEDEREFDY   S KGP++WGE+K+EWAAC NG +QSPID
Sbjct  12   SYFLFFVFLFSYFTSLAAQEVEDEREFDYLHESGKGPKQWGEIKEEWAACKNGSLQSPID  71

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            +S  RVK+I  H   ++  YKP NAT++NRGHDI+++W  +AGS+ INGT+YFLK  HWH
Sbjct  72   LSSHRVKLIP-HLGNLKTSYKPDNATLKNRGHDISVQWETNAGSIEINGTEYFLKQCHWH  130

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR  606
            SPSEH+IN R Y +ELHM+H + D N+TN+IAVI VLYKIG+ ++FLS L R++ SMID 
Sbjct  131  SPSEHSINNRSYDMELHMIHISPDLNVTNKIAVIAVLYKIGRANSFLSTLTRHVKSMIDE  190

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            + E  +GM DP  IK+  K +YRYMGSLTVPPCTEGVIWTI KK+RT SR Q+KL REAV
Sbjct  191  NHEISIGMTDPRKIKIGGKNYYRYMGSLTVPPCTEGVIWTITKKIRTVSRDQVKLFREAV  250

Query  787  HDYAERNARPLQALNRREIYLLSPAGKKLEK  879
            HDYAE NARP+Q LN REI++   + +   K
Sbjct  251  HDYAEVNARPVQPLNLREIHVYDHSSRSTNK  281



>ref|XP_010050524.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89338.1| hypothetical protein EUGRSUZ_A01630 [Eucalyptus grandis]
Length=283

 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 201/246 (82%), Gaps = 2/246 (1%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            E EDEREFDY  GSEKGP  WGEL+K+W AC  G+MQSPID+S ERV+++     E+ ++
Sbjct  32   EAEDEREFDYIPGSEKGPMHWGELRKDWEACKKGEMQSPIDLSSERVQVMPKLG-EIERN  90

Query  304  YKPANATVRNRGHDIAIEWH-GDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHM  480
            +KP+NAT++NRGHDI+++W  G+AGS+ INGT+YFL+  HWHSPSEHTINGRRYALELHM
Sbjct  91   HKPSNATLKNRGHDISLQWDTGNAGSIKINGTEYFLQQCHWHSPSEHTINGRRYALELHM  150

Query  481  VHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRS  660
            VH +TD N+ N I V+G+LYK G PDAFLSKLM ++ SMID++ E+++G  DP +IKM  
Sbjct  151  VHVSTDPNVKNNITVVGLLYKTGVPDAFLSKLMGSVWSMIDKEDERKMGTIDPREIKMGG  210

Query  661  KRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRRE  840
            K + RY GSLTVPPCTEGVIWTINKK+ T S+ QIKLLREAVHDYAE+NARP+Q LNRRE
Sbjct  211  KNYLRYTGSLTVPPCTEGVIWTINKKMGTVSKDQIKLLREAVHDYAEKNARPVQQLNRRE  270

Query  841  IYLLSP  858
            I+   P
Sbjct  271  IHFYQP  276



>ref|XP_007213463.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
 gb|EMJ14662.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
Length=282

 Score =   349 bits (895),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 166/277 (60%), Positives = 208/277 (75%), Gaps = 2/277 (1%)
 Frame = +1

Query  49   RSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            R I ++  L   F LF +  S  AQEVEDEREFDY   S KGP++WGE+K+EWAAC NG 
Sbjct  7    RPISISYFLFFVF-LFSYFTSLAAQEVEDEREFDYLHESGKGPKQWGEIKEEWAACKNGS  65

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFL  408
            +QSPID+S  RVK+I  H   ++  YKP NAT++NRGHDI+I+W  +AGS+ INGT+YFL
Sbjct  66   LQSPIDLSSHRVKLIP-HLGNLKTGYKPDNATLKNRGHDISIQWETNAGSIEINGTEYFL  124

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            K  HWHSPSEH+IN R Y +ELHM+H + D N+TN+IAVI VLYKIG+ ++FLS L R++
Sbjct  125  KQCHWHSPSEHSINNRSYDMELHMIHISPDLNVTNKIAVIAVLYKIGRANSFLSTLTRHV  184

Query  589  SSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
             SMID + E  +GM DP  I++  K +YRYMGSLTVPPCTEGVIWTI KK+RT SR Q+K
Sbjct  185  KSMIDENHEISIGMTDPRKIRIGGKNYYRYMGSLTVPPCTEGVIWTITKKIRTVSRDQVK  244

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSPAGKKLEK  879
            L REAVHDYAE NARP+Q LN REI++   + +   K
Sbjct  245  LFREAVHDYAEVNARPVQPLNLREIHVYDHSSRSTNK  281



>gb|AFK33933.1| unknown [Medicago truncatula]
Length=279

 Score =   348 bits (894),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 205/253 (81%), Gaps = 1/253 (0%)
 Frame = +1

Query  112  TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHE  291
            T AQEVEDE EFDY + S+ GP  WG++KKEWA C +G MQSPIDMS  RVK++     +
Sbjct  28   TIAQEVEDEHEFDYTKDSKIGPSHWGKIKKEWATCKDGKMQSPIDMSSHRVKVVPKLG-K  86

Query  292  MRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALE  471
            +++HYKP NAT++NRGHDI ++W  DAGS+ INGT++FL   HWH+PSEHTINGRRY LE
Sbjct  87   LKRHYKPRNATIKNRGHDIEVKWKEDAGSININGTEFFLHQCHWHAPSEHTINGRRYDLE  146

Query  472  LHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIK  651
            LHMVH++   N  +++AVIG++YKIG+PD  LSKL + I +M+D +VE+ +G+FDPS+IK
Sbjct  147  LHMVHESAKVNGKSKLAVIGLMYKIGRPDRLLSKLSKYIKTMMDNEVERSIGVFDPSEIK  206

Query  652  MRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALN  831
            +  K++YRY+GSLTVPPCTEGVIWTINKKVR+ SR Q++LLREAVHD+AE+NARP+Q LN
Sbjct  207  LGGKKYYRYIGSLTVPPCTEGVIWTINKKVRSVSRAQLELLREAVHDHAEKNARPVQLLN  266

Query  832  RREIYLLSPAGKK  870
            RREI L  P  K+
Sbjct  267  RREIQLYGPKRKE  279



>ref|XP_010050514.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89336.1| hypothetical protein EUGRSUZ_A01627 [Eucalyptus grandis]
Length=283

 Score =   348 bits (894),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 198/246 (80%), Gaps = 2/246 (1%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            E EDEREFDY  GSEKGP  WGEL+K+W AC  G+MQSPID+S + VK++     E+ + 
Sbjct  32   ETEDEREFDYIAGSEKGPMHWGELRKDWEACKKGEMQSPIDLSSQGVKVMPKLG-EIDRS  90

Query  304  YKPANATVRNRGHDIAIEWH-GDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHM  480
            YKP+NAT+ NRGHDI+++W  G+AGS+ INGT+YFL+  HWHSPSEHTINGRRYALELHM
Sbjct  91   YKPSNATLMNRGHDISLQWDTGNAGSIKINGTEYFLQQCHWHSPSEHTINGRRYALELHM  150

Query  481  VHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRS  660
            VH +TD N+ N IAVIG+LYK G PDAFLSKLM ++ SMID++ E+++G  DP +IKM  
Sbjct  151  VHVSTDPNVKNNIAVIGLLYKTGVPDAFLSKLMGSVWSMIDKEDERKMGTIDPREIKMGG  210

Query  661  KRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRRE  840
            K + RY GSLTVPPCTEGVIWTINKK+ T S+ QIKLLREAVHDYAE NARP+Q LNRRE
Sbjct  211  KNYLRYTGSLTVPPCTEGVIWTINKKMGTVSKDQIKLLREAVHDYAENNARPVQQLNRRE  270

Query  841  IYLLSP  858
            I+   P
Sbjct  271  IHFYQP  276



>gb|KEH42158.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=279

 Score =   347 bits (891),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/253 (62%), Positives = 205/253 (81%), Gaps = 1/253 (0%)
 Frame = +1

Query  112  TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHE  291
            T AQEVEDE EFDY + S+ GP  WG++KKEWA C +G MQSPIDMS  RVK++     +
Sbjct  28   TIAQEVEDEHEFDYTKDSKIGPSHWGKIKKEWATCKDGKMQSPIDMSSHRVKVVPKLG-K  86

Query  292  MRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALE  471
            +++HYKP NAT++NRGHDI ++W  DAGS+ INGT++FL   HWH+PSEHTINGRRY LE
Sbjct  87   LKRHYKPHNATIKNRGHDIEVKWKEDAGSININGTEFFLHQCHWHAPSEHTINGRRYDLE  146

Query  472  LHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIK  651
            LHMVH++   N  +++AVIG++YKIG+PD  LSKL + I +M+D +VE+ +G+FDPS+IK
Sbjct  147  LHMVHESAKVNGKSKLAVIGLMYKIGRPDRLLSKLSKYIKTMMDNEVERSIGVFDPSEIK  206

Query  652  MRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALN  831
            +  K++YRY+GSLTVPPCTEGVIWTINKK+R+ SR Q++LLREAVHD+AE+NARP+Q LN
Sbjct  207  LGGKKYYRYIGSLTVPPCTEGVIWTINKKIRSVSRAQLELLREAVHDHAEKNARPVQLLN  266

Query  832  RREIYLLSPAGKK  870
            RREI L  P  K+
Sbjct  267  RREIQLYGPKRKE  279



>ref|XP_002268233.1| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI30161.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   347 bits (889),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 205/254 (81%), Gaps = 5/254 (2%)
 Frame = +1

Query  97   LHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIIT  276
            +H     AQEVEDEREF+Y EGSEKGP+ WGELK+EWAAC+NGD+QSPID+S++RVK+I 
Sbjct  21   VHSTRIIAQEVEDEREFEYIEGSEKGPKHWGELKEEWAACNNGDLQSPIDLSNQRVKVIP  80

Query  277  THHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGR  456
                +++++YK  NATV+NRGHDI+++W GDAGS+ INGT+Y L+  HWH+PSEH+INGR
Sbjct  81   KLG-DLKRNYKLCNATVKNRGHDISLQWVGDAGSIRINGTEYKLQQGHWHAPSEHSINGR  139

Query  457  RYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFD  636
            RY LELHMVH + D N    IAV+G++YK G+PD FLSK+M NI+SM D+  ++++G+  
Sbjct  140  RYDLELHMVHVSPDNN----IAVVGLIYKTGQPDKFLSKMMSNITSMADKMEQRKMGVIH  195

Query  637  PSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARP  816
            P DIKM  +++Y+YMGSLTVPPCTEGV W INKK+RT SR+Q+K LR AVHDYAE NARP
Sbjct  196  PGDIKMGGRKYYKYMGSLTVPPCTEGVTWIINKKIRTVSREQVKQLRLAVHDYAEMNARP  255

Query  817  LQALNRREIYLLSP  858
            +Q LN RE+ L  P
Sbjct  256  VQPLNLREVQLYGP  269



>ref|XP_011018803.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=277

 Score =   342 bits (878),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/270 (60%), Positives = 204/270 (76%), Gaps = 9/270 (3%)
 Frame = +1

Query  46   RRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNG  225
            R  +L   +LI  F L + P S  AQEVEDEREFDY EGSEKGP  WG++K+EWA C  G
Sbjct  5    RTYVLCCCTLI--FALVVSPLSVTAQEVEDEREFDYTEGSEKGPAHWGDIKEEWADCKTG  62

Query  226  DMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHG--DAGSVIINGTD  399
             +QSPIDMS  RVK++    + M+++Y+P NAT++NRGHDI ++W G   AGS+ +N T 
Sbjct  63   RLQSPIDMSDRRVKMVQKKDN-MKRNYRPFNATLKNRGHDIMVQWEGRDKAGSIQLNCTR  121

Query  400  YFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLM  579
            YFL+  HWHSPSEHTINGRRY +ELHM+H   +Q    +IAV+G LYKIGKPDAFLSKL+
Sbjct  122  YFLRQCHWHSPSEHTINGRRYDMELHMIHTTPEQ----KIAVVGYLYKIGKPDAFLSKLL  177

Query  580  RNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRK  759
             +I SM D+  E+ +G+ DP +IK   K++YRYMGSLT PPC +GVIWTINKK+RT S+ 
Sbjct  178  NDIVSMTDQKSERNIGIVDPREIKFGGKKYYRYMGSLTTPPCKQGVIWTINKKIRTISKD  237

Query  760  QIKLLREAVHDYAERNARPLQALNRREIYL  849
            Q++ LR AVHDYAE+NARPLQ LN+REI+ 
Sbjct  238  QVRALRVAVHDYAEKNARPLQPLNQREIHF  267



>ref|XP_006381381.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
 gb|ERP59178.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
Length=277

 Score =   342 bits (878),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 199/265 (75%), Gaps = 7/265 (3%)
 Frame = +1

Query  61   VTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSP  240
            V  S  L FVL   P S  AQEVEDEREFDY EGSEKGP  WG++K EWA C  G +QSP
Sbjct  8    VLCSCTLIFVLVFSPLSVTAQEVEDEREFDYTEGSEKGPAHWGDIKTEWADCKTGSLQSP  67

Query  241  IDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHG--DAGSVIINGTDYFLKS  414
            IDMS  RVK++    + ++++Y+P NAT++NRGHDI ++W G   AGS+ ING  YFL+ 
Sbjct  68   IDMSDRRVKMVQKTEN-IKRNYRPFNATLKNRGHDIMVQWEGFDKAGSIQINGARYFLQQ  126

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISS  594
             HWHSPSEHTINGR Y +ELHM+H   +Q    +IAVIG LYK GKPDAFLSKL+ +I S
Sbjct  127  CHWHSPSEHTINGRSYDMELHMLHTTPEQ----KIAVIGYLYKTGKPDAFLSKLLNDIVS  182

Query  595  MIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLL  774
            M D+ +E+ +G+ DP +IK   K++YRYMGSLT PPC +GVIWTINKK+RT S+ Q++ L
Sbjct  183  MTDQKMERNIGIVDPREIKFGGKKYYRYMGSLTTPPCKQGVIWTINKKIRTISKDQVRAL  242

Query  775  REAVHDYAERNARPLQALNRREIYL  849
            R AVHDYAE+NARPLQ LN+REI+ 
Sbjct  243  RVAVHDYAEKNARPLQPLNQREIHF  267



>ref|XP_010241820.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=282

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 202/267 (76%), Gaps = 1/267 (0%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            + T  L+   +L  +  +    EVEDEREFDY EGS KGP  WGEL +EWAAC NGDMQS
Sbjct  8    MSTFGLVCLLLLIFNTEAATFHEVEDEREFDYLEGSGKGPDHWGELHEEWAACKNGDMQS  67

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PID+ +ERV+++      +++ YKP+NA ++NRGHDIA+EW   AGS+ ING DY L+  
Sbjct  68   PIDLLNERVQLVPGLG-RLKRSYKPSNAILKNRGHDIALEWGEGAGSININGXDYVLEQC  126

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHT+NG+R+ LELHMVH + D    NQIAVIG+LYKIG+PD FLS+L + I S+
Sbjct  127  HWHSPSEHTLNGKRFDLELHMVHVSPDNTTANQIAVIGILYKIGRPDDFLSELKKGIWSI  186

Query  598  IDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLR  777
             D   E  +G+ DP  IK+ S+++YRYMGSLTVPPCT+GVIWTIN KVRT S+ Q+K LR
Sbjct  187  ADSKNEVGVGVVDPRHIKIGSRKYYRYMGSLTVPPCTQGVIWTINTKVRTVSKGQVKALR  246

Query  778  EAVHDYAERNARPLQALNRREIYLLSP  858
            +AVHDYAE+NARPLQ LN+REI+L  P
Sbjct  247  DAVHDYAEQNARPLQPLNKREIHLYRP  273



>ref|XP_010050530.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89339.1| hypothetical protein EUGRSUZ_A01632 [Eucalyptus grandis]
Length=283

 Score =   342 bits (876),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 197/246 (80%), Gaps = 2/246 (1%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            E EDEREFDY  GSEKGP  WGEL+ +W AC  G+MQSPID+S ERV+++     E+ + 
Sbjct  32   ETEDEREFDYIPGSEKGPMHWGELRNDWEACKKGEMQSPIDLSSERVQVMPKLG-EIERS  90

Query  304  YKPANATVRNRGHDIAIEWH-GDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHM  480
            +KP+NAT++NRGHDI+++W  G+AGS+ IN T+YFL+  HWHSPSEHTINGRRYALELHM
Sbjct  91   HKPSNATLKNRGHDISLQWDTGNAGSIKINSTEYFLQQCHWHSPSEHTINGRRYALELHM  150

Query  481  VHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRS  660
            VH +TD N+ N IAV+G+LYK G PDAFLSKLM ++ SM +++ E+++G  DP +IKM  
Sbjct  151  VHVSTDPNVKNNIAVVGLLYKTGVPDAFLSKLMGSVWSMSEKEDERKMGTIDPREIKMGG  210

Query  661  KRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRRE  840
            K + RYMGSLT PPCTEGVIWTINKK+ T S+ QIKLLREAVHDYAE+NARP+Q LN RE
Sbjct  211  KNYLRYMGSLTTPPCTEGVIWTINKKMGTVSKDQIKLLREAVHDYAEKNARPVQQLNTRE  270

Query  841  IYLLSP  858
            I+   P
Sbjct  271  IHFYQP  276



>ref|XP_008241384.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=288

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 209/266 (79%), Gaps = 8/266 (3%)
 Frame = +1

Query  73   LILCFVLF------LHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
            +I CF++F      L  +  +AQEVEDER+FDY EGS+KGP  WGE+KKEWAAC +G MQ
Sbjct  13   IIYCFLVFVLLFTHLTISVVKAQEVEDERDFDYVEGSKKGPAYWGEIKKEWAACKHGGMQ  72

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKS  414
            SPID+  +  +I+ +   E+++ YKP+NAT++NRGHDI +EW G+AGS+ ING  YFLK 
Sbjct  73   SPIDLPGKSFQILPSLV-ELKRTYKPSNATLKNRGHDIKLEWAGNAGSIEINGIQYFLKQ  131

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISS  594
            +HWHSPSEH+ING+RY +ELHMV+Q+ D  + +  AV+GVLY+IG+PDAFLSKL R+I+S
Sbjct  132  SHWHSPSEHSINGKRYDMELHMVYQSPDPKVESNTAVVGVLYQIGRPDAFLSKLTRDIAS  191

Query  595  MIDRDVEKELGMFDPSDI-KMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
            M D+ +E+ +G+ DP++I ++  K +YRY+GSLT+PPCTEGVIW ++K+  T SR+QI L
Sbjct  192  MTDKKIERSVGVIDPAEIVELDGKNYYRYIGSLTIPPCTEGVIWIMSKQFGTVSREQIDL  251

Query  772  LREAVHDYAERNARPLQALNRREIYL  849
            LR +V+DYAE NARPLQ LNRR I L
Sbjct  252  LRVSVYDYAETNARPLQPLNRRIIRL  277



>gb|KHG29611.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=278

 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 201/268 (75%), Gaps = 2/268 (1%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
             V+  LI  F+   + AS  A E E+EREFDY E SEKGP  WG+LK EW+AC NG +QS
Sbjct  11   FVSACLIFTFLFLSYSASVSADEEENEREFDYLENSEKGPSHWGDLKMEWSACKNGVLQS  70

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGD-AGSVIINGTDYFLKS  414
            PID+S +R KI+     E++K YKP +A +RNRGHDI+++WH   AG + ING++Y L+ 
Sbjct  71   PIDLSSQRAKIVNKAG-ELKKTYKPCDAILRNRGHDISLKWHNCFAGLININGSEYSLQQ  129

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISS  594
             HWHSPSEHTING RYALELHMVH +TD N  + +AVIG+LYK+G PDAFLSKL+ N++S
Sbjct  130  VHWHSPSEHTINGARYALELHMVHHSTDPNFNHSVAVIGLLYKLGAPDAFLSKLITNVTS  189

Query  595  MIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLL  774
            M D   E+E+G+ DP+ I +  K++YRY+GSLTVPPCTEGVIWT+NK +RT S  Q+  L
Sbjct  190  MADEMQEREVGVIDPNMIGIDGKQYYRYIGSLTVPPCTEGVIWTMNKMIRTVSIDQVLAL  249

Query  775  REAVHDYAERNARPLQALNRREIYLLSP  858
            R AVHDYAE NARP+Q LN R+I L +P
Sbjct  250  RLAVHDYAESNARPVQPLNHRQIELHNP  277



>ref|XP_006594167.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=282

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 202/263 (77%), Gaps = 4/263 (2%)
 Frame = +1

Query  70   SLILCFVLFLHPAS-TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            ++I+   + LH  +   AQEVEDE EFDY +GSEKGP  WGELKKEW  C +G MQSPID
Sbjct  18   NMIILVTILLHSTTWISAQEVEDESEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPID  77

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            +S  RV+++     E++K+Y P NAT++NRGHDI ++W  DAGS+ INGT++FL   HWH
Sbjct  78   LSSHRVRVVPKLG-ELKKYYTPQNATIKNRGHDIELKWE-DAGSININGTEFFLHQCHWH  135

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR  606
            SPSEHTINGRRY LELHMVH++ +     + AV+G+ YKIG+PD  L KL + I +M+  
Sbjct  136  SPSEHTINGRRYDLELHMVHESKNIKGKTKFAVVGLFYKIGRPDPVLKKLSKFIKTMVYG  195

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            + EK +G+FDPS IK+  K++YRYMGSLTVPPCTEGVIWTINKK+RT SR Q+KLLREAV
Sbjct  196  E-EKNIGVFDPSKIKLGGKKYYRYMGSLTVPPCTEGVIWTINKKIRTVSRAQVKLLREAV  254

Query  787  HDYAERNARPLQALNRREIYLLS  855
            HD+AE+NARP+Q +NRR I L +
Sbjct  255  HDHAEKNARPIQPINRRGIQLYA  277



>gb|AFK36418.1| unknown [Lotus japonicus]
Length=280

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 198/252 (79%), Gaps = 2/252 (1%)
 Frame = +1

Query  118  AQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMR  297
            AQEVEDE EF+Y +G+EKGP  WG +KKEW  C  G MQSPID+S  RV+++  +  E++
Sbjct  30   AQEVEDESEFNYIQGNEKGPSNWGTMKKEWKTCKTGKMQSPIDLSSHRVRVVP-NLGELK  88

Query  298  KHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELH  477
            K YKP NATV+NRGHDI ++W  DAGS+IINGT++FL  +HWH+PSEHTINGRRY LELH
Sbjct  89   KFYKPQNATVKNRGHDIEVKWEADAGSIIINGTEFFLHQSHWHTPSEHTINGRRYELELH  148

Query  478  MVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM-IDRDVEKELGMFDPSDIKM  654
            MVH++   N  ++IAV+GV+Y IG+PD  L+KL + I SM  D + EK +G+ DPS+IK+
Sbjct  149  MVHESRKINGKSKIAVVGVMYNIGQPDPVLNKLSKYIKSMGSDHEAEKSIGVMDPSEIKL  208

Query  655  RSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNR  834
              K++YRY+GSLT+PPCTEGVIWTINKK+R+ S+ QI  LREAVH++A+RNARP Q+LNR
Sbjct  209  GGKKYYRYVGSLTIPPCTEGVIWTINKKIRSVSKAQINFLREAVHNHAQRNARPAQSLNR  268

Query  835  REIYLLSPAGKK  870
            R I L  P  K+
Sbjct  269  RGIQLYGPKRKE  280



>gb|KHN48240.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=282

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 201/263 (76%), Gaps = 4/263 (2%)
 Frame = +1

Query  70   SLILCFVLFLHPAS-TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            ++I+   + LH  +   AQEVEDE EFDY +GSEKGP  WG LKKEW  C +G MQSPID
Sbjct  18   NMIILVTILLHSTTWISAQEVEDESEFDYIKGSEKGPSHWGGLKKEWETCKSGKMQSPID  77

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            +S  RV+++     E++K+Y P NAT++NRGHDI ++W  DAGS+ INGT++FL   HWH
Sbjct  78   LSSHRVRVVPKLG-ELKKYYTPQNATIKNRGHDIELKWE-DAGSININGTEFFLHQCHWH  135

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR  606
            SPSEHTINGRRY LELHMVH++ +     + AV+G+ YKIG+PD  L KL + I +M+  
Sbjct  136  SPSEHTINGRRYDLELHMVHESKNIKGKTKFAVVGLFYKIGRPDPVLKKLSKFIKTMVYG  195

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            + EK +G+FDPS IK+  K++YRYMGSLTVPPCTEGVIWTINKK+RT SR Q+KLLREAV
Sbjct  196  E-EKNIGVFDPSKIKLGGKKYYRYMGSLTVPPCTEGVIWTINKKIRTVSRAQVKLLREAV  254

Query  787  HDYAERNARPLQALNRREIYLLS  855
            HD+AE+NARP+Q +NRR I L +
Sbjct  255  HDHAEKNARPIQPINRRGIQLYA  277



>gb|KEH42156.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=286

 Score =   333 bits (855),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 206/272 (76%), Gaps = 9/272 (3%)
 Frame = +1

Query  37   YTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAAC  216
            YT+R S+++        ++ L+  S RAQEVEDEREFDY EGSEKGP  WGELK+EWAAC
Sbjct  9    YTLRTSLMI-------LIILLYTTSIRAQEVEDEREFDYIEGSEKGPHHWGELKEEWAAC  61

Query  217  SNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGT  396
             +GDMQSPID+S+ERVKII  +   ++  YK +NAT+ NRGHDIA+ W GDAGS+ INGT
Sbjct  62   KHGDMQSPIDLSNERVKIIPNYRQVIKTKYKSSNATIINRGHDIAVFWRGDAGSISINGT  121

Query  397  DYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL  576
             +FL   HWHSPSEH+INGR+Y LE+HMVH + +    N+IAV+G  +KIG+P++FLS+L
Sbjct  122  KFFLHQCHWHSPSEHSINGRKYDLEMHMVHISPNPK-GNKIAVVGAFFKIGRPNSFLSQL  180

Query  577  MRNISSMIDRDVEKE-LGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTAS  753
              +I  M+D + E+  +G  DPS I+ + K +YRY+GSLT PPCTEGV+W ++KK+RT S
Sbjct  181  EEDIKHMVDEEEEERVIGDKDPSQIQTKGKIYYRYVGSLTTPPCTEGVMWNLDKKIRTVS  240

Query  754  RKQIKLLREAVHDYAERNARPLQALNRREIYL  849
            + Q+ LLR+AVHD+AE NARP Q  N R+I+L
Sbjct  241  KAQVDLLRQAVHDHAEMNARPRQPHNNRDIHL  272



>ref|XP_008227263.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Prunus mume]
Length=263

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/259 (61%), Positives = 193/259 (75%), Gaps = 20/259 (8%)
 Frame = +1

Query  76   ILCFVLF-LHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            +L  VLF  +     AQEVEDEREFDY +GS KGP++WGE+KKEWAAC NG MQSPID+S
Sbjct  14   VLFLVLFSQYSTPVTAQEVEDEREFDYLQGSGKGPKQWGEMKKEWAACKNGGMQSPIDLS  73

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
             +RVK+I  +  ++   YKP NATV+NRGHDI+IEW GDAGS+ INGT+Y LK  HWHSP
Sbjct  74   SQRVKLIP-NLGKLNTAYKPCNATVKNRGHDISIEWVGDAGSLKINGTEYLLKQCHWHSP  132

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDV  612
            SEH+INGRRY +ELHMVH + D N+TN+IAV+  LYKIG+PD+FLSKL R+I SM D+  
Sbjct  133  SEHSINGRRYDMELHMVHLSPDPNVTNKIAVVAALYKIGRPDSFLSKLTRDIKSMTDQKE  192

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
            E+  G+ DP+ IK+  K +YRYMGSLTVPPCTEGVIWTINKK                  
Sbjct  193  ERSAGIIDPNKIKIPGKSYYRYMGSLTVPPCTEGVIWTINKK------------------  234

Query  793  YAERNARPLQALNRREIYL  849
            YAE NARP+Q LN REI++
Sbjct  235  YAETNARPVQPLNLREIHV  253



>ref|XP_004172039.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like, partial [Cucumis sativus]
Length=248

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 190/231 (82%), Gaps = 1/231 (0%)
 Frame = +1

Query  100  HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITT  279
            H +S  AQEVEDEREFDYAEGS+KGP  WGE+KKEW AC+NGD+QSPID+S +RVKI+  
Sbjct  19   HSSSISAQEVEDEREFDYAEGSQKGPGHWGEIKKEWEACNNGDLQSPIDLSSQRVKIVP-  77

Query  280  HHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRR  459
               E+++ Y P NATV+NRGHDI++ W+G  GS+ ING  Y L+ +HWHSPSEH++NGRR
Sbjct  78   QLGELKRSYYPCNATVKNRGHDISVYWYGKPGSIEINGDVYDLQQSHWHSPSEHSVNGRR  137

Query  460  YALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDP  639
            Y LELHMVHQ++D  + N+IAV+G LY IG+PD F+++L R I  M+DR  EK++G+ +P
Sbjct  138  YDLELHMVHQSSDPTVKNKIAVVGQLYTIGQPDPFITQLSREILGMVDRKHEKKVGVMNP  197

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
            +DIK   K++YRY+GSLTVPPCTEGVIWT+NKK+RT SR+Q++LLREAVHD
Sbjct  198  ADIKFGGKKYYRYLGSLTVPPCTEGVIWTMNKKIRTVSREQVRLLREAVHD  248



>ref|XP_011094588.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=279

 Score =   328 bits (842),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 200/272 (74%), Gaps = 5/272 (2%)
 Frame = +1

Query  49   RSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            +   +   + + F +        AQEV+DE EF+Y + S KGP  WG++K+EW  C+ G 
Sbjct  5    KCTYILAPIFVAFFVLFGTKPINAQEVDDESEFNYDQNSAKGPINWGKIKEEWGGCNTGI  64

Query  229  MQSPIDMSHER-VKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYF  405
            MQSPID+S +R V+II+   H    +YKPA+A ++NRGHDI I+W  DAGS+ INGT+Y 
Sbjct  65   MQSPIDISGDRMVRIIS---HPQTPNYKPAHALLKNRGHDIQIQWLDDAGSLSINGTEYC  121

Query  406  LKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRN  585
            L+ AHWHSPSEHT NG+RYALELH+VH+ TD  + N+IAVIGV YK G+PD FLSKL  N
Sbjct  122  LRYAHWHSPSEHTYNGKRYALELHLVHKATDPVVENKIAVIGVFYKTGQPDPFLSKLTTN  181

Query  586  ISSMI-DRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
            I+SM   +D ++ LG  DP ++++ S+R+YRYMGSLTVPPCTEGVIWTINKKV+T S +Q
Sbjct  182  ITSMARKKDDQRSLGPVDPKEVQICSRRYYRYMGSLTVPPCTEGVIWTINKKVKTVSMEQ  241

Query  763  IKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            +KLLR+ VHDYAE NARPLQ LN R I L  P
Sbjct  242  VKLLRKVVHDYAEHNARPLQPLNSRRISLYGP  273



>ref|XP_010267256.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=282

 Score =   327 bits (838),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 196/250 (78%), Gaps = 1/250 (0%)
 Frame = +1

Query  109  STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHH  288
            S  +QEVEDEREFDY EGS KGP  WGEL +EWAAC NGDMQSPID+ ++RV++I     
Sbjct  25   SAASQEVEDEREFDYLEGSGKGPDHWGELHEEWAACKNGDMQSPIDLLNKRVQVIPALG-  83

Query  289  EMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYAL  468
             M++ YKP+ AT++NRGHDIA++W G  GS+ INGTDY L+ +HWHSPSEHTINGRR+ L
Sbjct  84   RMKRSYKPSIATLKNRGHDIALQWVGGGGSININGTDYVLQQSHWHSPSEHTINGRRFDL  143

Query  469  ELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDI  648
            ELHMVH  +D    N+IAVIG+LYKIG+PD FLS+LM+ I S+ D   E  +G+ DP  I
Sbjct  144  ELHMVHVTSDTKAVNKIAVIGILYKIGRPDDFLSELMKGIWSIADSKGEVNVGVVDPRHI  203

Query  649  KMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQAL  828
            K+ S+++YRYMGSLTVPPCT+GVIWTINKKVRT +R Q+K LR AVHDYAE N+RPLQ L
Sbjct  204  KIGSRKYYRYMGSLTVPPCTQGVIWTINKKVRTVTRGQVKALRVAVHDYAEENSRPLQLL  263

Query  829  NRREIYLLSP  858
            N R I L  P
Sbjct  264  NNRNIQLYRP  273



>gb|KHG27075.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=274

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 201/268 (75%), Gaps = 8/268 (3%)
 Frame = +1

Query  73   LILCF--VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            L+ CF  +L LH  S R+QE+EDE EFDY   S KGP RWGE+  EW ACSNG MQSPID
Sbjct  9    LVCCFFILLALHSFSVRSQEIEDESEFDYGANSTKGPARWGEIHAEWGACSNGTMQSPID  68

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            MS+ERV I++ H   ++K YKP+NAT+RNRGHD+ + W  +AG++ I G +Y L   HWH
Sbjct  69   MSNERVNIVS-HLGRLKKSYKPSNATLRNRGHDMMLRWEDEAGAIEIKGREYVLHQCHWH  127

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-  603
            SPSEHTINGRRY LELHMVH++ D     ++AVIG++YKIG+PD+FLS LM ++ ++ D 
Sbjct  128  SPSEHTINGRRYDLELHMVHESAD----GKVAVIGIMYKIGRPDSFLSSLMDHLEAITDI  183

Query  604  RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREA  783
             D E+ +G+ DP  IK  S+++YRY+GSLT+PPCTE V+W+I +KVRT +R+Q++ LR A
Sbjct  184  TDGERAVGVIDPRHIKFGSRKYYRYVGSLTIPPCTENVVWSIVRKVRTVTREQVRFLRVA  243

Query  784  VHDYAERNARPLQALNRREIYLLSPAGK  867
            VHD ++ NARPLQ++N+R I L  P  K
Sbjct  244  VHDESDSNARPLQSINKRSIQLFRPDDK  271



>ref|XP_007203913.1| hypothetical protein PRUPE_ppa016859mg [Prunus persica]
 gb|EMJ05112.1| hypothetical protein PRUPE_ppa016859mg [Prunus persica]
Length=340

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 197/267 (74%), Gaps = 4/267 (1%)
 Frame = +1

Query  49   RSILVTGSLILCFVLFLHP--ASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            + I +    ++  +LF+H   +   AQEVEDER+FDY EGS+KGP  WGE+KKEWAAC +
Sbjct  6    KPIFIISCFLVFVLLFMHSTISVVEAQEVEDERDFDYVEGSKKGPAYWGEIKKEWAACKH  65

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G MQSPID+  +  +I+ +   E+++ YKP+NAT++NRGHDI IEW GDAGS+ INGTDY
Sbjct  66   GGMQSPIDLPRKSFQILPSLV-ELKRIYKPSNATLKNRGHDIKIEWEGDAGSIKINGTDY  124

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
            F K  HWH+PSEH+ING RY LELHMVHQ+TD  + N IAV+  LY IG P+ FLSK+ +
Sbjct  125  FFKQCHWHTPSEHSINGIRYDLELHMVHQSTDPKIRNSIAVLAFLYHIGNPNLFLSKVNK  184

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
            +I S +    E  LG+ DP +IK  S   YRY+GSLT PPC EGVIWTIN+KV+  SR+Q
Sbjct  185  DIMSEVATK-EVHLGVIDPREIKWTSFSFYRYVGSLTSPPCAEGVIWTINEKVKHVSREQ  243

Query  763  IKLLREAVHDYAERNARPLQALNRREI  843
            ++LL+EAV DYAE N RPLQ LN REI
Sbjct  244  VELLQEAVDDYAEMNTRPLQPLNDREI  270



>ref|XP_006339307.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=228

 Score =   319 bits (818),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 181/223 (81%), Gaps = 6/223 (3%)
 Frame = +1

Query  76   ILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
            +L  ++F      +AQEVEDEREFDY E SEKGP+ WG+LKKEW AC+NG+MQSPIDMSH
Sbjct  9    VLFIIIFFSATFIKAQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEMQSPIDMSH  68

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPS  435
            ERV+II       ++HYK  NATV+NRGHDI+++WHGDAGSV INGT+Y L+ AHWHSPS
Sbjct  69   ERVRIIQKPD---KRHYKLCNATVKNRGHDISLQWHGDAGSVSINGTNYPLQQAHWHSPS  125

Query  436  EHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDV  612
            EHT+NGRRY +E+HMVH N  +N TN+I V  VLYKIGKPD FLSKL+RNISSMID +D 
Sbjct  126  EHTVNGRRYDMEMHMVHLN--ENATNKIVVSEVLYKIGKPDRFLSKLIRNISSMIDKKDE  183

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKV  741
             K  GM DP +IK+ S+++YRYMGSLTVPPCTEGVIWTI KKV
Sbjct  184  VKNAGMIDPREIKIGSRKYYRYMGSLTVPPCTEGVIWTIKKKV  226



>ref|XP_004304476.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 193/256 (75%), Gaps = 2/256 (1%)
 Frame = +1

Query  94   FLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKII  273
             LHP    AQEVEDEREFDY + SEKGP+ WGEL++EWAAC NG +QSP+D+  E V++ 
Sbjct  24   ILHPTPITAQEVEDEREFDYLKDSEKGPKHWGELREEWAACKNGTLQSPVDLLSEIVEV-  82

Query  274  TTHHHEMRKHYKPANATVRNRGHDIAIEWH-GDAGSVIINGTDYFLKSAHWHSPSEHTIN  450
              +  E+R  Y+P+NAT+RNRGHDI+I+W  GDAGS+ INGTDY+L   HWHSP+EHTIN
Sbjct  83   HPNKGEVRLKYRPSNATIRNRGHDISIQWKLGDAGSMEINGTDYWLDQCHWHSPTEHTIN  142

Query  451  GRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGM  630
            G+ + LELHMVH   D  + N I V+  LYKIGKPD FLS++ ++I SMID   E+  G+
Sbjct  143  GKIFDLELHMVHLIPDAKVENNIVVVAYLYKIGKPDKFLSEVSKDIKSMIDVKEERHRGL  202

Query  631  FDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNA  810
             DP +++    + Y+Y GSLTVPPCTEGV W I+KK+ T SR+Q++LLREAVHD AE NA
Sbjct  203  VDPRNVRKGGAKFYKYKGSLTVPPCTEGVTWIIHKKLTTVSREQMELLREAVHDSAELNA  262

Query  811  RPLQALNRREIYLLSP  858
            RPLQALNRR+++   P
Sbjct  263  RPLQALNRRDVHFHGP  278



>ref|XP_008810946.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=284

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/248 (60%), Positives = 192/248 (77%), Gaps = 6/248 (2%)
 Frame = +1

Query  118  AQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMR  297
            +QEVEDE+EF Y EGS  GP  WGE+ KEWAAC+NGDMQSPID++HERVKI       ++
Sbjct  27   SQEVEDEKEFSYEEGSPNGPDHWGEIHKEWAACNNGDMQSPIDLTHERVKIFPGLGR-LK  85

Query  298  KHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELH  477
            + YK +NAT++NRGHDI ++W    G + INGT+Y L   HWHSPSEH+ING+RY LE+H
Sbjct  86   RSYKASNATLKNRGHDIMLKWAEGGGWIRINGTEYQLMQCHWHSPSEHSINGKRYDLEIH  145

Query  478  MVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFDPSDIKM  654
            MVHQ++DQ    + AV+G++YKIG+PD FLS+LM +I  + D  + E  +GM DP DIK+
Sbjct  146  MVHQSSDQ----KNAVVGIMYKIGRPDTFLSELMEHIKEIADAEEKETNVGMVDPRDIKI  201

Query  655  RSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNR  834
             S+++YRYMGSLT PPCT+GV+WTI KKVRT SR+Q++LLREAVHD A+ NARP+Q +N 
Sbjct  202  GSRKYYRYMGSLTTPPCTQGVVWTITKKVRTVSREQVRLLREAVHDNAKNNARPIQPINE  261

Query  835  REIYLLSP  858
            REI   +P
Sbjct  262  REIQFYTP  269



>ref|XP_007027464.1| Alpha carbonic anhydrase 7 isoform 2 [Theobroma cacao]
 gb|EOY07966.1| Alpha carbonic anhydrase 7 isoform 2 [Theobroma cacao]
Length=242

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 182/236 (77%), Gaps = 2/236 (1%)
 Frame = +1

Query  49   RSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            + I V+  LI   +   + AS  AQEVEDEREFDY E S KGP +WG+LKKEW AC NG 
Sbjct  6    KPIFVSVFLIFAVLFLSYSASVSAQEVEDEREFDYLENSGKGPSQWGDLKKEWVACKNGG  65

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEW-HGDAGSVIINGTDYF  405
            +QSPIDMS  RVK+I     E++K YKP +A V+NRGHDI+++W + DAGS+  NGT+YF
Sbjct  66   LQSPIDMSSLRVKVINKSG-ELKKRYKPCHAIVKNRGHDISLQWPNYDAGSIKTNGTEYF  124

Query  406  LKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRN  585
            L+ AHWHSPSEHTINGRRYALELHMVHQ  D N+ N +AV+G+LYK G PDAFLSKL+ N
Sbjct  125  LQQAHWHSPSEHTINGRRYALELHMVHQCKDPNVKNNLAVVGLLYKFGAPDAFLSKLIGN  184

Query  586  ISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTAS  753
            I+SM D   E+ +G+ DPS IKM  K++YRYMGSLTVPPCTEGVIWT+NKKV  +S
Sbjct  185  ITSMNDHVQERYMGLIDPSLIKMGGKKYYRYMGSLTVPPCTEGVIWTMNKKVSKSS  240



>ref|XP_007016796.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34415.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 201/265 (76%), Gaps = 7/265 (3%)
 Frame = +1

Query  70   SLILCFVLFL-HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            + I   VL L +     +QEVEDE EFDY E S +GP RWGE+  EW+ACSNG MQSPID
Sbjct  10   ACIFSIVLVLQYSCPATSQEVEDESEFDYNENSPRGPARWGEIHPEWSACSNGSMQSPID  69

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            MS+ERV I++ H   +++ YKP+NAT++NRGHD+ + W GDAG++ INGT+Y LK  HWH
Sbjct  70   MSNERVNIVS-HLGRLKRSYKPSNATLKNRGHDMMLRWDGDAGAIEINGTEYALKQCHWH  128

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-  603
            SPSEHTINGRRY LE+H+VH++ D     ++AVIG++YKIG+PD+FLS L+ +++S+ D 
Sbjct  129  SPSEHTINGRRYDLEVHLVHESAD----GKVAVIGIMYKIGRPDSFLSSLLDHLASITDI  184

Query  604  RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREA  783
             + E   G+ DP  IK+ S+++YRY+GSLTVPPC E V+W+I +KVRT +R+Q++LLR A
Sbjct  185  TEGESVAGVIDPRHIKIGSRKYYRYIGSLTVPPCDENVVWSIVRKVRTVTREQVRLLRVA  244

Query  784  VHDYAERNARPLQALNRREIYLLSP  858
            VHD ++ NARPLQ +N+R + L  P
Sbjct  245  VHDASDTNARPLQPINKRSVQLFRP  269



>ref|XP_003537009.2| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=296

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/288 (55%), Positives = 206/288 (72%), Gaps = 9/288 (3%)
 Frame = +1

Query  25   LASFYTMRRSILVTGSLILCFVLFLHPASTRAQ--EVEDEREFDYAEGSEKGPRRWGELK  198
            L S    R +  +   L++ F++ L   STRAQ  E+EDEREFDY   SEKGPR WGE+K
Sbjct  12   LTSMKLQRVNTYIIPHLLVLFMILLASTSTRAQVEELEDEREFDYIGASEKGPRHWGEMK  71

Query  199  KEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGS  378
            KEW++C NG +QSPID+S  RVKII     +   +Y   NAT+ NRGHDIA+ W  DAGS
Sbjct  72   KEWSSCKNGHLQSPIDLSCARVKIIP-RCRQPDIYYTATNATIINRGHDIAVYWKDDAGS  130

Query  379  VIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIG-KP  555
            V +NGT+YFLK  HWHSPSEH++NGRRY LE+HMVH + D    N+I V+G LYK G +P
Sbjct  131  VYLNGTEYFLKQCHWHSPSEHSMNGRRYDLEMHMVHVSPD----NKIFVVGALYKFGHRP  186

Query  556  DAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINK  735
            D FLS+L ++I  ++D +VE+E+G  +PS ++ R   +YRY+GSLT PPCTEGVIW I++
Sbjct  187  DRFLSQLEKDIKHLVDNEVEREIGETNPSGLQTRGNAYYRYVGSLTTPPCTEGVIWNIDR  246

Query  736  KVRTASRKQIKLLREAVHDYAERNARPLQ-ALNRREIYLLSPAGKKLE  876
            K+RT S +Q++LLREAVHD+AERNARP+Q   NR  +Y  S +  K E
Sbjct  247  KIRTVSEEQVRLLREAVHDHAERNARPMQRRYNRDILYFRSKSRAKPE  294



>ref|XP_007211988.1| hypothetical protein PRUPE_ppa010973mg [Prunus persica]
 gb|EMJ13187.1| hypothetical protein PRUPE_ppa010973mg [Prunus persica]
Length=228

 Score =   317 bits (812),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 180/219 (82%), Gaps = 1/219 (0%)
 Frame = +1

Query  193  LKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDA  372
            +KKEWAAC NG MQSPID+S +RVK+I  +  ++   YKP+NATV+NRGHDI+IEW GDA
Sbjct  1    MKKEWAACKNGGMQSPIDLSSQRVKLIP-NLGKLNTAYKPSNATVKNRGHDISIEWVGDA  59

Query  373  GSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGK  552
            GS+ INGT+Y LK  HWHSPSEH+INGRRY +ELHMVH + + N+TN+IAV+  LYKIG+
Sbjct  60   GSLKINGTEYLLKQCHWHSPSEHSINGRRYDMELHMVHLSPNPNVTNKIAVVAALYKIGR  119

Query  553  PDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTIN  732
            PD+FL+KL R+I SM D+  E+ +G+ DP+ IK+  K +YRYMGSLTVPPCTEGVIWTIN
Sbjct  120  PDSFLTKLTRDIQSMTDQKEERSVGIIDPNKIKIPGKSYYRYMGSLTVPPCTEGVIWTIN  179

Query  733  KKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYL  849
            KK+RT SR Q+KL R AVHDYAE NARP+Q LN REI++
Sbjct  180  KKIRTVSRDQVKLFRVAVHDYAETNARPVQPLNLREIHV  218



>ref|XP_009622096.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana tomentosiformis]
Length=280

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 200/272 (74%), Gaps = 5/272 (2%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVED-EREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            S+LV    +L   L L+  S   QE E+ E EF Y EG EKGP +WGELK+EW AC NG 
Sbjct  9    SVLVMFGSLLYLPLLLNATSISPQEAENHEVEFHYWEGHEKGPSKWGELKREWEACKNGK  68

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFL  408
            MQSPID+S  +VKII     + +K YKP+N+T++NRGHDI+ +W GDAGS+ INGT+Y L
Sbjct  69   MQSPIDISSYKVKIIKNM--DNKKVYKPSNSTIKNRGHDISFKWQGDAGSIWINGTEYPL  126

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            +  HWHSPSEHTINGRRY LE+HMVHQ   + + N+I V  VLYK GKPD FL  L R+I
Sbjct  127  QQVHWHSPSEHTINGRRYPLEMHMVHQTNGEKVKNKIVVNAVLYKFGKPDPFLFGLRRHI  186

Query  589  SSMIDRD-VEKELGMFDPSD-IKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
            SSMID++  E++LG  DP+  I   +K++YRYMGSLT PPCTEGV W +NKKV+T SR Q
Sbjct  187  SSMIDQEGEERKLGKIDPNYIISSPTKKYYRYMGSLTTPPCTEGVTWIVNKKVQTVSRGQ  246

Query  763  IKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            + LLR+AVHD AERNARP+Q  N REI+LL P
Sbjct  247  VMLLRKAVHDSAERNARPVQPHNEREIHLLLP  278



>ref|XP_010916592.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=275

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 191/270 (71%), Gaps = 7/270 (3%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
             L+  S+ L  + F   +   +QEVEDE++F Y  GSE GP  WGEL  EW+AC  G +Q
Sbjct  6    FLLLSSIFLAILFFFSTSPVTSQEVEDEKDFSYESGSETGPEHWGELHTEWSACGKGKLQ  65

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKS  414
            SPID+S ERV+++     ++R  Y+PA+A ++NRGHDI I+W    G + INGT Y LK 
Sbjct  66   SPIDLSDERVQVVH-QLGQLRSSYRPADAVMKNRGHDIEIKWENHTGGIWINGTKYDLKQ  124

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISS  594
             HWHSPSEHTIN  RY+LELHMVHQ TD    N+ AV+G+LYKIG+PD FL+K+ + I  
Sbjct  125  LHWHSPSEHTINRHRYSLELHMVHQTTD----NKTAVVGILYKIGRPDPFLAKMEKYIKK  180

Query  595  MID--RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
            M D     E++LGM DP D+K  S+++YRYMGSLT PPCTEGV+WTI +KVRT S+ Q+ 
Sbjct  181  MEDMAESEEEKLGMVDPRDVKKGSRKYYRYMGSLTTPPCTEGVVWTIIRKVRTVSKHQVN  240

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSP  858
            LLREAVHD+AE NARPLQ LN R + L  P
Sbjct  241  LLREAVHDHAEMNARPLQLLNNRPVGLYRP  270



>gb|KGN59000.1| hypothetical protein Csa_3G742880 [Cucumis sativus]
Length=275

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 194/251 (77%), Gaps = 2/251 (1%)
 Frame = +1

Query  106  ASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHH  285
             S  AQEVEDE EFDY +GS+KGP +WG++K+EW  C+NG+MQSPID+S++RVK++  H 
Sbjct  20   TSAIAQEVEDESEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVK-HL  78

Query  286  HEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYA  465
             +++  YKP+ A ++NRGHDI+++W  DAGS+ INGTDY L+ AHWHSPSEHT+NGRRY 
Sbjct  79   GQLKNKYKPSIAIIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYD  138

Query  466  LELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSD  645
            LE+H+VHQ+++ N    IAV+G  YKIG+PD+FLSKL R I ++ ++  E + G+ +P  
Sbjct  139  LEVHLVHQSSNPNAKYPIAVVGFFYKIGRPDSFLSKLNRKIKALNEKK-EIKAGIINPRW  197

Query  646  IKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQA  825
            IK    ++YRY+GSLTVPPCTEGVIW I KK+ T SRKQ+KLLR AVHD AE+NARP+Q 
Sbjct  198  IKNGGMKYYRYIGSLTVPPCTEGVIWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQP  257

Query  826  LNRREIYLLSP  858
             N R I L  P
Sbjct  258  HNGRHIDLYDP  268



>ref|XP_010046439.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85766.1| hypothetical protein EUGRSUZ_B02522 [Eucalyptus grandis]
Length=278

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 202/272 (74%), Gaps = 9/272 (3%)
 Frame = +1

Query  58   LVTGSLILC---FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            L+   ++LC    VL LH   T ++EVEDE EF+Y  GSE+GP RWGE+++EW  CS+G 
Sbjct  3    LLATRIVLCTIFLVLALHVGLTTSEEVEDESEFNYDAGSERGPARWGEIRREWGMCSSGS  62

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFL  408
            MQSPID+S ERV+++  H   +++ YK +NAT++NRGHDI + W G AGS+ +NGT Y L
Sbjct  63   MQSPIDLSSERVQVVA-HLGRLKRCYKASNATLKNRGHDITLRWEGGAGSIYVNGTWYLL  121

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            K  HWHSPSEH +NGRR+ LELHMVH    ++L  ++AV+G++YK+G+PD FLS +M++I
Sbjct  122  KQCHWHSPSEHAVNGRRFDLELHMVH----ESLNGKVAVVGIMYKLGRPDTFLSMMMKHI  177

Query  589  SSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
              + D  + EK +G+ +P  IK+ S+++YRY+GSLTVPPCTE V+WTI +KVRT +R+Q+
Sbjct  178  EDIADIHEAEKAVGIVNPKRIKIGSRKYYRYVGSLTVPPCTENVLWTIVQKVRTVAREQV  237

Query  766  KLLREAVHDYAERNARPLQALNRREIYLLSPA  861
            KLLR+AV D +E NARPLQ +N R + L  P 
Sbjct  238  KLLRKAVRDDSEFNARPLQPINIRSVQLFRPT  269



>ref|XP_008442725.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=274

 Score =   317 bits (811),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 197/260 (76%), Gaps = 3/260 (1%)
 Frame = +1

Query  79   LCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHE  258
            L F +F+   S  AQEVEDE EFDY +GS+KGP +WG++K+EW  C NG+MQSPID+S++
Sbjct  11   LVFFIFIL-TSAIAQEVEDESEFDYRKGSKKGPSKWGDIKREWEKCKNGNMQSPIDLSNK  69

Query  259  RVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSE  438
            RVK++ +   +++  YKP+ A ++NRGHDI+++W  DAGS+ INGT+Y L+ AHWHSPSE
Sbjct  70   RVKVVKSLG-QLKNKYKPSIAIIKNRGHDISVKWEEDAGSIEINGTEYLLQQAHWHSPSE  128

Query  439  HTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEK  618
            HT+NGR Y LE+H+VHQ+++ N    IAV+G  YKIG+PD+FLSKL R I ++ ++  E 
Sbjct  129  HTLNGRSYDLEVHLVHQSSNPNAKYPIAVVGFFYKIGRPDSFLSKLTRKIKALNEKK-ET  187

Query  619  ELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYA  798
            + G+ +P  IK    ++YRY+GSLTVPPCTEGVIW INKK+ T S KQ+KLLR AVHD A
Sbjct  188  KAGIINPRWIKNGGMKYYRYIGSLTVPPCTEGVIWNINKKIGTVSGKQVKLLRSAVHDSA  247

Query  799  ERNARPLQALNRREIYLLSP  858
            E+NARP+Q  N R + L  P
Sbjct  248  EKNARPIQPHNGRHVVLYDP  267



>gb|KHN39017.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=296

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/288 (55%), Positives = 204/288 (71%), Gaps = 9/288 (3%)
 Frame = +1

Query  25   LASFYTMRRSILVTGSLILCFVLFLHPASTRAQ--EVEDEREFDYAEGSEKGPRRWGELK  198
            L S    R +  +   L + F++ L   STRAQ  E+EDEREFDY   SEKGPR WGE+K
Sbjct  12   LTSMKLQRVNTYIIPHLFVLFIILLASTSTRAQVEELEDEREFDYIGASEKGPRHWGEMK  71

Query  199  KEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGS  378
            KEW++C NG +QSPID+S  RVKII     +   +Y   NAT+ NRGHDIA+ W  DAGS
Sbjct  72   KEWSSCKNGHLQSPIDLSCARVKIIP-RCRQPDIYYTATNATIINRGHDIAVYWKDDAGS  130

Query  379  VIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIG-KP  555
            V +NGT+YFLK  HWHSPSEH++NGRRY LE+HMVH + D    N+I V+G LYK G +P
Sbjct  131  VYLNGTEYFLKQCHWHSPSEHSMNGRRYDLEMHMVHVSPD----NKIFVVGALYKFGHRP  186

Query  556  DAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINK  735
            D FLS+L ++I  ++D +VE+ +G  +PS ++ R   +YRY+GSLT PPCTEGVIW I++
Sbjct  187  DRFLSQLEKDIKHLVDNEVERAIGETNPSGLQTRGNAYYRYVGSLTTPPCTEGVIWNIDR  246

Query  736  KVRTASRKQIKLLREAVHDYAERNARPLQ-ALNRREIYLLSPAGKKLE  876
            K+RT S +Q++LLREAVHD+AERNARP+Q   NR  +Y  S +  K E
Sbjct  247  KIRTVSEEQVRLLREAVHDHAERNARPMQRRYNRDILYFRSKSRAKPE  294



>ref|XP_009400916.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=282

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 197/252 (78%), Gaps = 6/252 (2%)
 Frame = +1

Query  118  AQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMR  297
            +QEVEDE EF Y EGS  GP+RWGE+++EWA C+NGDMQSPID+ HERVK++      +R
Sbjct  29   SQEVEDESEFSYEEGSPNGPQRWGEIREEWAICNNGDMQSPIDLLHERVKVLPGLGR-LR  87

Query  298  KHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELH  477
            + Y+ ANAT++NRGHDI +EW  +AG + I+GTDY LK  HWHSPSEH+ING+R+ALELH
Sbjct  88   RSYRAANATLKNRGHDIMLEWPEEAGRIHIDGTDYELKQCHWHSPSEHSINGKRFALELH  147

Query  478  MVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-DRDVEKELGMFDPSDIKM  654
            MVHQ+ D+    ++AV+G++YKIG+PD+FL++LM  I  +  +++ E+ +G  DP  IK+
Sbjct  148  MVHQSADE----RVAVVGIMYKIGRPDSFLTELMEYIEEIAGNKEEERVVGFVDPRYIKI  203

Query  655  RSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNR  834
             S+++YRYMGSLT PPC +GV+WTI++K+RT S+ Q+ LLREAVHD AE NARPLQ LN 
Sbjct  204  GSRKYYRYMGSLTTPPCKQGVVWTISEKIRTVSKDQVSLLREAVHDDAENNARPLQPLNG  263

Query  835  REIYLLSPAGKK  870
            REI   +P  +K
Sbjct  264  REIQFYTPRLRK  275



>ref|XP_010696305.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=276

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 187/250 (75%), Gaps = 5/250 (2%)
 Frame = +1

Query  106  ASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHH  285
            AS   QEV+DEREFDY  GSE GP RWGE++ EWA CS G+MQSPID+   RVK+ T   
Sbjct  24   ASVLCQEVDDEREFDYIRGSEMGPERWGEIRPEWATCSTGEMQSPIDLLDARVKV-TPRS  82

Query  286  HEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYA  465
             E+ + Y+P  A +RNRGHDI +EW  D+  + INGT+Y L+ +HWHSPSEHTING+RY 
Sbjct  83   AEINRLYRPTRAMLRNRGHDIELEWEDDSSRIQINGTEYILRQSHWHSPSEHTINGKRYD  142

Query  466  LELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSD  645
            +ELHMVHQ+ D    NQ AVIG+LYKIGKP+ FLSKLM NI  + +  +E ++G+ +PS 
Sbjct  143  MELHMVHQSRD----NQTAVIGLLYKIGKPNHFLSKLMNNIRLISETTLELDVGIINPSR  198

Query  646  IKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQA  825
            IKM  +++YRY+GSLT PPCTEGVIWT+N ++ T S +Q+ LLREAVHD+AE NARPLQ 
Sbjct  199  IKMGGRKYYRYLGSLTTPPCTEGVIWTLNTQIGTVSEEQVSLLREAVHDHAEENARPLQR  258

Query  826  LNRREIYLLS  855
             N R + L +
Sbjct  259  TNGRNMRLYA  268



>gb|KEH24050.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=278

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/277 (54%), Positives = 197/277 (71%), Gaps = 5/277 (2%)
 Frame = +1

Query  46   RRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNG  225
            R++  +   ++L   +  +   TRA    D+ E+ Y E S KGPR WG+LK+EWAAC  G
Sbjct  3    RQNHFLFSIVLLSITILFYSTLTRAS---DDPEYGYNEKSAKGPRHWGDLKREWAACK-G  58

Query  226  DMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYF  405
            +MQSPID+S +RV ++     +++++YKP +AT+ NRGHD+A+ W GD G + INGT YF
Sbjct  59   EMQSPIDLSSDRVSVMIPEFGDLKRNYKPQHATISNRGHDVAVTWEGDVGYIDINGTHYF  118

Query  406  LKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRN  585
            L+ +HWH PSEHTINGRRY LELHMVH +T  + TN+ AV+GVLYK G PD FLSKL+  
Sbjct  119  LQQSHWHWPSEHTINGRRYDLELHMVHVSTQPDGTNKTAVVGVLYKYGSPDPFLSKLVNY  178

Query  586  ISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
            I  + D + EK +G+ DPS I   +K +YRYMGSLT PPCTEG+IWTIN K+RT SR Q+
Sbjct  179  IIEVPDEEEEKSIGVIDPSKIFKSAKMYYRYMGSLTAPPCTEGIIWTINNKIRTVSRGQV  238

Query  766  KLLREAVHD-YAERNARPLQALNRREIYLLSPAGKKL  873
            KLL+ +V   YA+RNARP+Q LN+REI L  P  K +
Sbjct  239  KLLKNSVLKYYAKRNARPVQILNQREIELYDPKAKNI  275



>ref|XP_010043780.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85764.1| hypothetical protein EUGRSUZ_B02520 [Eucalyptus grandis]
Length=278

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 142/277 (51%), Positives = 204/277 (74%), Gaps = 9/277 (3%)
 Frame = +1

Query  58   LVTGSLILC---FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
             +   ++LC    VL LH   T+++EVE+E +F+Y   S++GP RWGE+++EW  C NG 
Sbjct  3    FLATQILLCTIFLVLALHVGLTKSEEVENESQFNYDARSDRGPARWGEIRREWEMCRNGS  62

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFL  408
            MQSPID+S ERV+++      +++ YK +NAT++NRGHDI + W GDAGS+ +NGT Y L
Sbjct  63   MQSPIDLSSERVQVMA-RLGRLKRSYKASNATLKNRGHDIMLRWDGDAGSIYVNGTQYLL  121

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            K +HWHSPSEH +NGRR+ LELHMVH + +     ++AV+GV+YK+G+PD FLS +M++I
Sbjct  122  KQSHWHSPSEHAVNGRRFDLELHMVHDSPE----GKVAVVGVMYKLGRPDTFLSTMMKHI  177

Query  589  SSMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
              + D    E+ +G+ +P  IK+ S+++YRY+GSLTVPPCT+ V+WTI +KVRT +R+Q+
Sbjct  178  QGIADTHGAERTVGIVNPKHIKIGSRKYYRYVGSLTVPPCTQNVLWTIVRKVRTVTREQV  237

Query  766  KLLREAVHDYAERNARPLQALNRREIYLLSPAGKKLE  876
            KLLREAV D +E NARPLQ +N+R + L SP   +LE
Sbjct  238  KLLREAVRDDSEFNARPLQPINKRPVQLFSPTNDELE  274



>ref|XP_008802055.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=275

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 195/272 (72%), Gaps = 7/272 (3%)
 Frame = +1

Query  49   RSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            +  L   S+ L  + F   +   +QEVEDE+EF Y  GSE GP RWGEL +EW+AC  G 
Sbjct  4    QGFLYPCSIFLAILFFFSTSPVASQEVEDEKEFSYEIGSETGPERWGELHEEWSACGKGK  63

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFL  408
            +QSPID+S ERV+++      +R  Y PA+A ++NRGHDI I+W    G V INGT Y L
Sbjct  64   LQSPIDLSDERVQVLH-QSGPLRSSYHPADAVMKNRGHDIEIKWENQTGGVWINGTKYVL  122

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            K  HWHSPSEHTINGRRY+LELHMVHQ+ D+    +IAV+G+LYKIG+PD FL+K+   I
Sbjct  123  KQLHWHSPSEHTINGRRYSLELHMVHQSADE----KIAVVGILYKIGRPDPFLAKMEDYI  178

Query  589  SSMIDRDVEK--ELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
              M D +  +  +LG+ DP D+K  S+++YRYMGSLT PPCTEGV+WTI +KVRT +++Q
Sbjct  179  KKMEDMEESEEEKLGLVDPGDVKKGSRKYYRYMGSLTTPPCTEGVVWTIIRKVRTVAKQQ  238

Query  763  IKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            + LLREAVHD+AE+NARPLQ +N R + L  P
Sbjct  239  VNLLREAVHDHAEKNARPLQLINDRSLGLYRP  270



>ref|XP_007016793.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34412.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   313 bits (803),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 201/267 (75%), Gaps = 11/267 (4%)
 Frame = +1

Query  70   SLILCFVLFLH---PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSP  240
            + I   +L L    PA++R  EVE E EFDY E S +GP RWGE+  EW ACSNG MQSP
Sbjct  10   ACIFSIILVLQYSCPATSR--EVEYESEFDYNENSARGPARWGEIHPEWRACSNGSMQSP  67

Query  241  IDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAH  420
            IDMS+ERV I++ H   +++ YKP NAT+RNRGHD+ + W GDAG++ INGT+Y LK  H
Sbjct  68   IDMSNERVNIVS-HLGRLKRSYKPCNATLRNRGHDMMLRWDGDAGAIEINGTEYALKQCH  126

Query  421  WHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI  600
            WHSPSEHTINGRRY LE+H+VH++ D    +++AVIG++YKIG+PD+FLS L+ +++S+ 
Sbjct  127  WHSPSEHTINGRRYDLEVHLVHESAD----DKVAVIGIMYKIGRPDSFLSSLLDHLASIT  182

Query  601  D-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLR  777
            D  + E   G+ DP  IK+ S+++YRY+GSLTVPPC E V+W+I +KVRT +R+Q++LLR
Sbjct  183  DITEGESVAGVIDPRHIKIGSRKYYRYIGSLTVPPCDENVVWSIVRKVRTVTREQVRLLR  242

Query  778  EAVHDYAERNARPLQALNRREIYLLSP  858
             AVHD ++ NARPLQ +N+R + L  P
Sbjct  243  VAVHDASDTNARPLQPINKRSVQLFRP  269



>ref|XP_009391366.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 195/273 (71%), Gaps = 7/273 (3%)
 Frame = +1

Query  43   MRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            M ++ LV  S  + F L L      +QEVEDE+EF Y  GSE GP  WGE+ K+W AC +
Sbjct  1    MEQNKLVVISSFVAFFL-LQATLAASQEVEDEKEFSYVTGSELGPEHWGEIHKDWVACGD  59

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G MQSPID+SH+RV+I+    H +R+ Y+PA A V NRGHDI ++W  +AG + INGT Y
Sbjct  60   GHMQSPIDLSHKRVRILPNLGH-LRRSYRPAMAIVENRGHDIMLKWEDEAGVIWINGTKY  118

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
             LK  HWHSPSEHTINGRRY+LELHMVH++ D+N    IAV+G+LYK+G+ D FL+KL R
Sbjct  119  ALKQLHWHSPSEHTINGRRYSLELHMVHESADKN----IAVVGILYKMGRHDPFLAKLER  174

Query  583  NISSMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRK  759
             I  + D+ D E+  GM DP  I+  S+++YRYMGSLT PPCTEGV+WTI KKVRT SR+
Sbjct  175  YIKKIADKHDAEEVAGMVDPRHIRKGSRKYYRYMGSLTTPPCTEGVVWTIIKKVRTVSRE  234

Query  760  QIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            Q+ LLREAVHD +E NARP Q +N R +    P
Sbjct  235  QVALLREAVHDDSEMNARPTQQINGRIVGFYRP  267



>ref|XP_009767316.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana sylvestris]
Length=280

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 189/254 (74%), Gaps = 5/254 (2%)
 Frame = +1

Query  106  ASTRAQEVED-EREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
             S   QE E+ E EF Y EG EKGP +WGELK+EW  C NG MQSPID+S  +VK I   
Sbjct  27   TSISPQEAENHEVEFHYREGHEKGPSKWGELKREWEVCKNGRMQSPIDISTYKVKFIKNI  86

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRY  462
             H  +K YK +N+T++NRGHDI+++WHGDAGS+ +NGT Y L+  HWHSPSEHTINGRRY
Sbjct  87   DH--KKVYKLSNSTIKNRGHDISLKWHGDAGSIWVNGTQYPLQQVHWHSPSEHTINGRRY  144

Query  463  ALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD-VEKELGMFDP  639
             LE+HMVHQ+  + + N+I V  VLYK GKPD FL  L R+ISSMID++  E++LG  DP
Sbjct  145  PLEMHMVHQSNVEKVKNKIIVNAVLYKFGKPDPFLFSLRRHISSMIDQEGKERKLGKIDP  204

Query  640  SD-IKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARP  816
            +  I   SKR+YRYMGSLT PPCTEGV W +NKKV+T SR Q+ LLR+AVHD AE+NARP
Sbjct  205  NYIISSPSKRYYRYMGSLTTPPCTEGVTWIVNKKVQTVSRGQVMLLRKAVHDSAEKNARP  264

Query  817  LQALNRREIYLLSP  858
            +Q  N REI LL P
Sbjct  265  VQPHNEREIRLLLP  278



>gb|KDP44024.1| hypothetical protein JCGZ_05491 [Jatropha curcas]
Length=274

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 199/266 (75%), Gaps = 10/266 (4%)
 Frame = +1

Query  76   ILCFVLFL----HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPI  243
            +LCF  F+    H   + +QEVEDEREF Y + SE GP RWGEL  EW+ CSNG MQSPI
Sbjct  8    LLCFTFFISLLFHALPSSSQEVEDEREFSYEKNSETGPERWGELHPEWSTCSNGTMQSPI  67

Query  244  DMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHW  423
            D+ +ERV++++ H  ++++ YKP+NAT++NRGHD+ +EW   AG++ INGT+Y L+  HW
Sbjct  68   DLLNERVEVVS-HLGKLKRSYKPSNATLKNRGHDMMLEWENGAGTIEINGTEYVLRQCHW  126

Query  424  HSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID  603
            HSPSEHTI+G R+ALELHMVH++ D     ++AV+G++Y IG+PD+FLS L   +  +  
Sbjct  127  HSPSEHTIDGGRFALELHMVHESQD----GKVAVVGIMYIIGRPDSFLSSLTEKLREVSG  182

Query  604  RDVEKE-LGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLRE  780
             + E+  +G+ +P DIK+ S+++YRY+GSLTVPPCTE V+WTI++KVRT +++Q++LLR 
Sbjct  183  TEEEETVVGIVNPKDIKIGSRKYYRYIGSLTVPPCTENVVWTISRKVRTVTKEQVELLRV  242

Query  781  AVHDYAERNARPLQALNRREIYLLSP  858
            AVHD A+ NARPLQ  N R + L  P
Sbjct  243  AVHDEADTNARPLQPTNGRSVQLYRP  268



>ref|XP_004300792.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=283

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 189/249 (76%), Gaps = 2/249 (1%)
 Frame = +1

Query  100  HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITT  279
            HP    AQEVEDE EFDY + S KGP  WG+L+++WAAC NG MQSPID+  E V++   
Sbjct  24   HPTPITAQEVEDETEFDYLKDSGKGPEHWGDLREDWAACKNGTMQSPIDLRSEIVQV-RP  82

Query  280  HHHEMRKHYKPANATVRNRGHDIAIEWH-GDAGSVIINGTDYFLKSAHWHSPSEHTINGR  456
            +  E++  YKP+NAT+RNRGHDI+I+W  GDAGSV INGTDY+L   HWHSPSEHTING+
Sbjct  83   NKGEVKLKYKPSNATIRNRGHDISIQWKLGDAGSVEINGTDYWLIQGHWHSPSEHTINGK  142

Query  457  RYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFD  636
            R+ LELHMVH   D N+ N IAV+  LYKIGKPD FLS++ ++I S+I+   E+ +G+ D
Sbjct  143  RFDLELHMVHLIPDANVENNIAVLAYLYKIGKPDKFLSEVSKDIKSLINVKEERHIGVVD  202

Query  637  PSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARP  816
            P +++  S   Y+Y GSLTVPPCTEGV W ++K++ T SR+Q++LLREAV D AE NARP
Sbjct  203  PRNVRKGSANFYKYKGSLTVPPCTEGVTWIVDKELTTVSREQVELLREAVDDSAETNARP  262

Query  817  LQALNRREI  843
            LQALN R++
Sbjct  263  LQALNGRKV  271



>gb|KHG14539.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=289

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 204/281 (73%), Gaps = 6/281 (2%)
 Frame = +1

Query  28   ASFYTMRRSILVTGSLILCFVLFLHPASTRA---QEVEDEREFDYAEGSEKGPRRWGELK  198
            +S    ++ I +   LI   VLFL  +++ A   +EVEDEREFDY E S KGP  WG+LK
Sbjct  9    SSMKGQKQPIFIPLFLIFS-VLFLCFSASVAHNDEEVEDEREFDYNENSSKGPLHWGDLK  67

Query  199  KEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHG-DAG  375
             EWAAC NG MQSPID++++RVKIIT    ++ K+YKPA + ++NRGHDI+++W    AG
Sbjct  68   TEWAACKNGAMQSPIDLTNDRVKIITKSV-KLEKNYKPAESIIKNRGHDISLQWPDHKAG  126

Query  376  SVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKP  555
            S+II+G +Y L   HWHSPSEHTING+RYALE HMVH+  D N+ + +AV  +LY+ G P
Sbjct  127  SIIIDGIEYVLLQVHWHSPSEHTINGKRYALEAHMVHKAADPNVKSSLAVSALLYEDGLP  186

Query  556  DAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINK  735
            + FL KL+ NI+ MID   ++ +G+ DP+ I++    +YRY+GSLTVPPCTE VIW INK
Sbjct  187  NDFLQKLISNITDMIDVVQQRSMGVTDPNLIEIDDVEYYRYIGSLTVPPCTENVIWIINK  246

Query  736  KVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            K+ T S++Q+  +REAVHDYAE+NARP+QA N RE+ L  P
Sbjct  247  KIATVSKEQVHAIREAVHDYAEQNARPVQANNEREMELHGP  287



>ref|XP_004168624.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=280

 Score =   311 bits (796),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 143/244 (59%), Positives = 190/244 (78%), Gaps = 2/244 (1%)
 Frame = +1

Query  127  VEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHY  306
            VEDE EFDY +GS+KGP +WG++K+EW  C+NG+MQSPID+S++RVK++  H  +++  Y
Sbjct  32   VEDESEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVK-HLGQLKNKY  90

Query  307  KPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVH  486
            KP+ A ++NRGHDI+++W  DAGS+ INGTDY L+ AHWHSPSEHT+NGRRY LE+H+VH
Sbjct  91   KPSIAIIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHLVH  150

Query  487  QNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKR  666
            Q+++ N    IAV+G  YKIG+PD+FLSKL R I ++ ++  E + G+ +P  IK    +
Sbjct  151  QSSNPNAKYPIAVVGFFYKIGRPDSFLSKLNRKIKALNEKK-EIKAGIINPRWIKNGGMK  209

Query  667  HYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIY  846
            +YRY+GSLTVPPCTEGVIW I KK+ T SRKQ+KLLR AVHD AE+NARP+Q  N R I 
Sbjct  210  YYRYIGSLTVPPCTEGVIWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNGRHID  269

Query  847  LLSP  858
            L  P
Sbjct  270  LYDP  273



>ref|XP_002282495.2| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI16339.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 199/266 (75%), Gaps = 9/266 (3%)
 Frame = +1

Query  73   LILC---FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPI  243
            ++LC    VL LH     +QEVEDE+EFDY +GS+KGP +WGE+ +EW+ C +G+MQSPI
Sbjct  8    ILLCSFFIVLVLHACPAISQEVEDEKEFDYEKGSDKGPDKWGEIHEEWSTCKHGNMQSPI  67

Query  244  DMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHW  423
            D+ HERV++++ H   +++ YKP+ AT++NRGHD+ + W GDAGS+ INGT Y LK  HW
Sbjct  68   DLLHERVQVVS-HLGRLQRSYKPSQATLKNRGHDMKLSWEGDAGSIQINGTKYELKQCHW  126

Query  424  HSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID  603
            HSPSEHT+NG+R+ LELHM+H+      + + +V+G++YKIG+ D+FLS L  ++ ++ D
Sbjct  127  HSPSEHTVNGKRFDLELHMLHETP----SGKTSVVGIMYKIGRADSFLSTLTDHLEALSD  182

Query  604  R-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLRE  780
              D E+++G+ DP  IK+ S+++YRYMGSLT PPCTE VIWTI  KVRT +R+Q+ LLR 
Sbjct  183  SSDQERDVGVVDPRHIKIGSRKYYRYMGSLTTPPCTEDVIWTIVNKVRTVTREQVNLLRV  242

Query  781  AVHDYAERNARPLQALNRREIYLLSP  858
            AVHD +  NARP+Q +NRR ++   P
Sbjct  243  AVHDDSGSNARPIQPINRRSVHFYRP  268



>ref|XP_002529418.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32944.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 196/256 (77%), Gaps = 10/256 (4%)
 Frame = +1

Query  100  HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITT  279
            H   T +QEVE+EREFDY +  E+GP RWGEL +EW ACSNG MQSPIDM +ERV++++ 
Sbjct  20   HTLPTTSQEVENEREFDYEKNGERGPARWGELHEEWRACSNGSMQSPIDMLNERVEVVS-  78

Query  280  HHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRR  459
            H   + + Y+P+NAT++NRGHD+ +EW   AG++ INGT+Y L+  HWHSPSEHT++GRR
Sbjct  79   HLGRLNRSYEPSNATLKNRGHDMMLEWENGAGTIEINGTEYILRQCHWHSPSEHTLDGRR  138

Query  460  YALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL---MRNISSMIDRDVEKELGM  630
            +ALELHMVH++ D     ++AV+GV+Y IG+PD+FL  L   +R+IS     + E+ +G+
Sbjct  139  FALELHMVHESPD----GKVAVVGVMYTIGRPDSFLLSLTDHLRSISGT--EEEERVVGI  192

Query  631  FDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNA  810
             +P DIK+ S+++YRYMGSLTVPPCTE VIWTI KKVRT +R+Q+ LLR AVHD ++ NA
Sbjct  193  INPKDIKIGSRKYYRYMGSLTVPPCTENVIWTIVKKVRTVTREQVSLLRVAVHDESDTNA  252

Query  811  RPLQALNRREIYLLSP  858
            RPLQ +N R ++L  P
Sbjct  253  RPLQQINGRSVHLYRP  268



>ref|XP_004306263.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=348

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 187/250 (75%), Gaps = 2/250 (1%)
 Frame = +1

Query  103  PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
            P S  AQEVEDE EFDY + SEKGP+ WGEL++EW AC  G +QSP+D+  E V++   +
Sbjct  91   PTSITAQEVEDESEFDYLKDSEKGPKHWGELREEWGACKTGRLQSPVDLHSEIVEV-HPN  149

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWH-GDAGSVIINGTDYFLKSAHWHSPSEHTINGRR  459
            + E+R  Y+P+ A ++NRGHDI+I+W  G AGSV INGTDY+L   HWHSPSEHTING R
Sbjct  150  NGEVRLKYRPSYAIIKNRGHDISIQWKLGAAGSVEINGTDYWLDQCHWHSPSEHTINGNR  209

Query  460  YALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDP  639
            + LELHMVH+    N+ N I V+  LYK GKPD FLS++ ++I SMID + E+  G+ DP
Sbjct  210  FDLELHMVHRIPGPNVGNNIVVVAYLYKTGKPDMFLSQVSQDIKSMIDVEAERHRGVVDP  269

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
             D+K    + Y+Y GSLTVPPCTEGV W I+KK+ T SRKQ++LLREAVHDYAE NARPL
Sbjct  270  RDVKNGGAKFYKYKGSLTVPPCTEGVTWIIHKKLTTVSRKQMELLREAVHDYAELNARPL  329

Query  820  QALNRREIYL  849
            QALN R+++ 
Sbjct  330  QALNGRDVHF  339



>ref|XP_011040911.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   308 bits (788),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 191/266 (72%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            +    VL  H     +QEVEDE EFDY    EKGP +WG +  EW ACSNG MQSPID+ 
Sbjct  12   ITFLLVLVSHILPIASQEVEDEEEFDYNPDGEKGPAQWGRIHPEWGACSNGSMQSPIDLL  71

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERV I++ H   + + YKP NAT+RNRGHD+ ++W   AG++ INGT+Y L   HWHSP
Sbjct  72   NERVDIVS-HLGRLNRSYKPGNATLRNRGHDMMLKWESGAGTIEINGTEYVLNQCHWHSP  130

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RD  609
            SEHTING+R ALE+HMVH++ D     ++AV+G+LYKIG+PD+FLS L   + S+    +
Sbjct  131  SEHTINGKRLALEVHMVHESLD----GKVAVVGILYKIGRPDSFLSSLTEQLQSVAGTNE  186

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             +  +G+ DP +IK+ S+++YRY+GSLT+PPCTE V+WTI KKVRTA+R+Q++LLR AVH
Sbjct  187  RDTVVGIVDPRNIKIGSRKYYRYLGSLTIPPCTENVLWTIVKKVRTATREQVRLLRVAVH  246

Query  790  DYAERNARPLQALNRREIYLLSPAGK  867
            D ++ NARPLQ LN R + L  P  K
Sbjct  247  DDSDTNARPLQPLNSRPVKLFVPEDK  272



>ref|XP_011090098.1| PREDICTED: alpha carbonic anhydrase 7 [Sesamum indicum]
Length=271

 Score =   308 bits (788),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/279 (52%), Positives = 206/279 (74%), Gaps = 16/279 (6%)
 Frame = +1

Query  25   LASFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKE  204
            L +F+ +  SI +   L+ C         TRAQEV+DEREF Y E SE GP  WGE++ E
Sbjct  4    LTAFFKL--SIFIPLLLVACL--------TRAQEVDDEREFSYEENSEIGPAHWGEIRPE  53

Query  205  WAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVI  384
            W  CS+G+MQSPID+ +ERV++++ H  ++++ YKP+N T+ NRGHD+ + W G AG + 
Sbjct  54   WKECSSGEMQSPIDLLNERVEVVS-HLGKLKRSYKPSNTTLINRGHDMMLRWPGGAGHIN  112

Query  385  INGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAF  564
            INGT Y LK  HWHSPSEHTI+GRR+ +E+H+VHQ+ D    N+IAVIG++YKIG+PD+F
Sbjct  113  INGTLYQLKQCHWHSPSEHTISGRRFDMEVHLVHQSDD----NRIAVIGIMYKIGRPDSF  168

Query  565  LSKLMRNISSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKV  741
            LS + RN+ ++ + RDVEK +G+ DP  IK+ S+++YRY+GSLT PPCT+ VIWTI +KV
Sbjct  169  LSMMKRNLKAVAEMRDVEKTIGIIDPKLIKLGSRKYYRYIGSLTTPPCTQNVIWTIVRKV  228

Query  742  RTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            RT +R+Q++L+R+ VHD +E NARP+Q ++ R + L  P
Sbjct  229  RTVTREQVELIRDVVHDDSEANARPIQPVHERLVELYRP  267



>ref|XP_004137981.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=352

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 190/244 (78%), Gaps = 2/244 (1%)
 Frame = +1

Query  127  VEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHY  306
            VE+E EFDY +GS+KGP +WG++K+EW  C+NG+MQSPID+S++RVK++  H  +++  Y
Sbjct  104  VENESEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVK-HLGQLKNKY  162

Query  307  KPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVH  486
            KP+ A ++NRGHDI+++W  DAGS+ INGTDY L+ AHWHSPSEHT+NGRRY LE+H+VH
Sbjct  163  KPSIAIIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHLVH  222

Query  487  QNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKR  666
            Q+++ N    IAV+G  YKIG+PD+FLSKL R I ++ ++  E + G+ +P  IK    +
Sbjct  223  QSSNPNAKYPIAVVGFFYKIGRPDSFLSKLNRKIKALNEKK-EIKAGIINPRWIKNGGMK  281

Query  667  HYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIY  846
            +YRY+GSLTVPPCTEGVIW I KK+ T SRKQ+KLLR AVHD AE+NARP+Q  N R I 
Sbjct  282  YYRYIGSLTVPPCTEGVIWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNGRHID  341

Query  847  LLSP  858
            L  P
Sbjct  342  LYDP  345


 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (61%), Gaps = 9/107 (8%)
 Frame = +1

Query  37   YTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAAC  216
            +++   I++T +L+   VL   P            EFDY  GS KGP +WG +K+EW+ C
Sbjct  8    FSLAFLIILTSTLLWASVLSHQPGEVC--------EFDYIGGSNKGPTKWGAIKEEWSKC  59

Query  217  SNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIE  357
            +NG MQSPID+S   + ++ +    + + Y P +AT+RNRGHDI++E
Sbjct  60   NNGKMQSPIDLSTNTINVVNS-LGPLNREYNPFSATLRNRGHDISVE  105



>gb|KDP44023.1| hypothetical protein JCGZ_05490 [Jatropha curcas]
Length=275

 Score =   306 bits (783),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 195/257 (76%), Gaps = 7/257 (3%)
 Frame = +1

Query  91   LFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKI  270
            L LH     +QE+EDE++FDY EG EKGP RWGEL  EW+AC+NG MQSPID+ +ERV++
Sbjct  19   LLLHTLPISSQEIEDEKDFDYYEG-EKGPSRWGELHPEWSACNNGSMQSPIDLLNERVEV  77

Query  271  ITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTIN  450
            ++ H  ++++ YK +NAT++NRGHD+ +EW   AG   INGT+Y LK  HWHSPSEH++N
Sbjct  78   VS-HLGKLKREYKSSNATLKNRGHDMMMEWENGAGITEINGTEYILKQCHWHSPSEHSVN  136

Query  451  GRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-DRDVEKELG  627
            G R+ALELHMVH++ D     ++AVIGV+Y IG+PD+FLS + +++ S+   R ++  +G
Sbjct  137  GVRFALELHMVHESLD----GKVAVIGVMYIIGRPDSFLSSVDKHLRSVAGTRKLQTVVG  192

Query  628  MFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERN  807
            M +P  IK+RS+++YRY GSLTVPPCTE V+WTI  KVRT SR+Q++LLR AVHD ++ N
Sbjct  193  MVNPKSIKLRSRKYYRYKGSLTVPPCTENVLWTIVTKVRTVSREQVRLLRVAVHDESDTN  252

Query  808  ARPLQALNRREIYLLSP  858
            ARP+Q +N R + L  P
Sbjct  253  ARPIQLMNGRSVQLYKP  269



>ref|XP_007144381.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
 gb|ESW16375.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
Length=295

 Score =   306 bits (785),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 191/250 (76%), Gaps = 9/250 (4%)
 Frame = +1

Query  106  ASTRAQEVE---DEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIIT  276
            ASTRA++VE   DEREFDY  GSEKGP  WGELKKEW+AC +G MQSPID+S  RVKII 
Sbjct  38   ASTRAEDVEETVDEREFDYMRGSEKGPGYWGELKKEWSACKHGVMQSPIDLSCARVKIIP  97

Query  277  THHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGR  456
                ++   Y  +NAT+ NRGHD+A+ W GDAGS+ INGT++FLK  HWHSPSEH+INGR
Sbjct  98   -RCQQLYTDYFSSNATIINRGHDLAVYWKGDAGSIHINGTEFFLKQCHWHSPSEHSINGR  156

Query  457  RYALELHMVHQNTDQNLTNQIAVIGVLYKIG-KPDAFLSKLMRNISSMIDRDVEKELGMF  633
            +Y LE+HMVH + ++    +I V+G  YKIG +PD FLS+L + I  ++D +VE+E+G  
Sbjct  157  KYDLEMHMVHVSQEK----KILVVGAFYKIGHRPDRFLSQLEKEIVHLVDEEVEREIGER  212

Query  634  DPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNAR  813
            +PS I+ R   +YRY+GSLT PPCTEGVIW I++K+RT S  Q++LLREAVHD+A+RN+R
Sbjct  213  NPSGIQTRGNMYYRYLGSLTTPPCTEGVIWNIDRKIRTVSEAQVRLLREAVHDHAQRNSR  272

Query  814  PLQALNRREI  843
            P Q  N+R+I
Sbjct  273  PRQPRNQRDI  282



>ref|XP_007144380.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
 gb|ESW16374.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
Length=280

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 191/250 (76%), Gaps = 9/250 (4%)
 Frame = +1

Query  106  ASTRAQEVE---DEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIIT  276
            ASTRA++VE   DEREFDY  GSEKGP  WGELKKEW+AC +G MQSPID+S  RVKII 
Sbjct  23   ASTRAEDVEETVDEREFDYMRGSEKGPGYWGELKKEWSACKHGVMQSPIDLSCARVKIIP  82

Query  277  THHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGR  456
                ++   Y  +NAT+ NRGHD+A+ W GDAGS+ INGT++FLK  HWHSPSEH+INGR
Sbjct  83   -RCQQLYTDYFSSNATIINRGHDLAVYWKGDAGSIHINGTEFFLKQCHWHSPSEHSINGR  141

Query  457  RYALELHMVHQNTDQNLTNQIAVIGVLYKIG-KPDAFLSKLMRNISSMIDRDVEKELGMF  633
            +Y LE+HMVH + ++    +I V+G  YKIG +PD FLS+L + I  ++D +VE+E+G  
Sbjct  142  KYDLEMHMVHVSQEK----KILVVGAFYKIGHRPDRFLSQLEKEIVHLVDEEVEREIGER  197

Query  634  DPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNAR  813
            +PS I+ R   +YRY+GSLT PPCTEGVIW I++K+RT S  Q++LLREAVHD+A+RN+R
Sbjct  198  NPSGIQTRGNMYYRYLGSLTTPPCTEGVIWNIDRKIRTVSEAQVRLLREAVHDHAQRNSR  257

Query  814  PLQALNRREI  843
            P Q  N+R+I
Sbjct  258  PRQPRNQRDI  267



>ref|XP_010098809.1| hypothetical protein L484_022574 [Morus notabilis]
 gb|EXB75897.1| hypothetical protein L484_022574 [Morus notabilis]
Length=243

 Score =   304 bits (779),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = +1

Query  163  SEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGH  342
            SEKGPR WGELKKEW AC +G +QSPID+ + RVK+I     +++ +YKPANAT++NRGH
Sbjct  4    SEKGPRHWGELKKEWKACKHGKLQSPIDLLNHRVKVIPKLG-DIKMNYKPANATIKNRGH  62

Query  343  DIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIA  522
            DI+I W  DAGS+ INGTDYFL+  HWHSPSEH+INGRR  LELH+VH + D  +  +IA
Sbjct  63   DISIVWLDDAGSIQINGTDYFLQQCHWHSPSEHSINGRRLDLELHIVHSSPDVKIERRIA  122

Query  523  VIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPP  702
            VI +LYK GKPD FLSK  +++ S+ D   E   G+ DP ++KM   ++YRY+GSLT+PP
Sbjct  123  VIAMLYKFGKPDRFLSKFTKDMVSITDTKQEVHKGVIDPRELKMGGLKYYRYIGSLTIPP  182

Query  703  CTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            CTEGVIWT+NK++ T SR+Q+ LLREAVHD+AE NARPLQ LN R+I++  P
Sbjct  183  CTEGVIWTMNKRISTVSREQVSLLREAVHDHAEMNARPLQPLNERDIHICGP  234



>ref|XP_009399717.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 193/265 (73%), Gaps = 8/265 (3%)
 Frame = +1

Query  73   LILCF--VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            ++  F  +  L      ++EVEDE+EF Y +GSE GP  WGE+ K+WAAC  G MQSPID
Sbjct  8    IVFSFLAIFTLQSVLVASREVEDEKEFSYEKGSETGPEHWGEIHKDWAACGKGHMQSPID  67

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            ++H+RV+I+  H   +R+ Y PA A ++NRGHDI ++W  +AG + INGT+Y LK  HWH
Sbjct  68   LTHKRVQILP-HLGRLRRSYHPAEAILKNRGHDIMLKWEEEAGGLWINGTEYALKQLHWH  126

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR  606
            SPSEHT++GRRY+LE+HMVH++TD    N+ AV+G+LY IG+ D FL+KL R I  + D+
Sbjct  127  SPSEHTVDGRRYSLEMHMVHESTD----NKTAVVGILYTIGRHDPFLAKLERYIEKIADK  182

Query  607  -DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREA  783
             + E+ +GM DP  IK  S+++YRYMGSLT PPCTEGV+WTI KKVRT +R+Q+ LLREA
Sbjct  183  HEAEEAVGMVDPRHIKRGSRKYYRYMGSLTTPPCTEGVVWTIVKKVRTVTREQVALLREA  242

Query  784  VHDYAERNARPLQALNRREIYLLSP  858
            VHD +E NARP Q +N R I L  P
Sbjct  243  VHDDSEMNARPTQKINDRMIGLYRP  267



>ref|XP_006473002.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 196/260 (75%), Gaps = 10/260 (4%)
 Frame = +1

Query  88   VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVK  267
            V+ L   S  ++EV++E+EF+Y +G E GP RWGE+  EW+AC NG MQSPID+ +ERV+
Sbjct  16   VILLLSGSAMSKEVDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVE  75

Query  268  IITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTI  447
            +++ H   +++ YKP+NAT+RNRGHDI ++W G AG+++INGT Y L+  HWHSPSEHTI
Sbjct  76   VVS-HLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPSEHTI  134

Query  448  NGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL---MRNISSMIDRDVEK  618
            +G+R+ALE HMVH++ D     ++AV+G++YKIG+PD+FL+ +   +RNIS   +RD   
Sbjct  135  DGKRFALEAHMVHESHD----GKVAVVGIVYKIGRPDSFLASISDHLRNISGSNERDA--  188

Query  619  ELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYA  798
             +G+ DP  IK+ S ++YRY+GSLTVPPCTE V WTI +KVR+ +R+Q++LLR AVHD +
Sbjct  189  TVGVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRLLRVAVHDES  248

Query  799  ERNARPLQALNRREIYLLSP  858
              NARPLQ +N R + L  P
Sbjct  249  NTNARPLQPINMRSVKLYKP  268



>ref|XP_010916593.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=270

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 185/271 (68%), Gaps = 9/271 (3%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
             L+  S+ L  + F + +   +   EDEREF Y  GS++GP  WGELK  W+AC  G +Q
Sbjct  6    FLLLSSIFLAILFFFNTSPVTSCSQEDEREFSYVRGSKRGPEHWGELKNSWSACGTGKLQ  65

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKS  414
            SPID+S ERV+++     E+R  Y PANA ++NRGHDI IEW    G + INGT Y L+ 
Sbjct  66   SPIDLSDERVRVLP-QLGELRSSYHPANAVMKNRGHDIEIEWKNQTGGIWINGTKYVLQQ  124

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL---MRN  585
             HWH PSEHTINGRRY+LELHMVHQ  D    N+ AV+G+LYKIG+PD FL+K+   ++ 
Sbjct  125  LHWHLPSEHTINGRRYSLELHMVHQTAD----NKTAVVGILYKIGRPDPFLAKMEDYLKK  180

Query  586  ISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
            +  + + + EK LGM DP D++  S  +YRYMGSLT PPCTEGV+W I +KVRT +++Q+
Sbjct  181  VEDLAELEEEK-LGMVDPRDVRKGSSEYYRYMGSLTAPPCTEGVVWIIIRKVRTVTQQQV  239

Query  766  KLLREAVHDYAERNARPLQALNRREIYLLSP  858
             LLREAVHD    NARPLQ +N R + L  P
Sbjct  240  NLLREAVHDDVGMNARPLQPINNRSVGLYRP  270



>gb|KDO81077.1| hypothetical protein CISIN_1g038655mg [Citrus sinensis]
Length=275

 Score =   303 bits (776),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 196/260 (75%), Gaps = 10/260 (4%)
 Frame = +1

Query  88   VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVK  267
            V+ L   S  ++EV++E+EF+Y +G E GP RWGE+  EW+AC NG MQSPID+ +ERV+
Sbjct  16   VILLLSGSAMSKEVDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVE  75

Query  268  IITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTI  447
            +++ H   +++ YKP+NAT+RNRGHDI ++W G AG+++INGT Y L+  HWHSPSEHTI
Sbjct  76   VVS-HLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPSEHTI  134

Query  448  NGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL---MRNISSMIDRDVEK  618
            +G+R+ALE HMVH++ D     ++AV+G++YKIG+PD+FL+ +   +RNIS   +RD   
Sbjct  135  DGKRFALEAHMVHESHD----GKVAVVGIVYKIGRPDSFLASISDHLRNISGSNERDA--  188

Query  619  ELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYA  798
             +G+ DP  IK+ S ++YRY+GSLTVPPCTE V WTI +KVR+ +R+Q+++LR AVHD +
Sbjct  189  TVGVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDES  248

Query  799  ERNARPLQALNRREIYLLSP  858
              NARPLQ +N R + L  P
Sbjct  249  NTNARPLQPINMRSVKLYKP  268



>ref|XP_011090042.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=274

 Score =   303 bits (775),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 137/275 (50%), Positives = 205/275 (75%), Gaps = 6/275 (2%)
 Frame = +1

Query  49   RSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            RS   +  ++L  VL      TRAQEV+DER+F Y E SE GP  WG+++ EW+ C++G 
Sbjct  4    RSFSQSSFIVLVLVLPSFACFTRAQEVDDERQFSYEEDSEIGPSNWGKIRPEWSQCNSGR  63

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFL  408
            +QSPID+ ++RV+ ++ H   ++++Y P+NAT+ NRGHD+ + W  DAG + INGT Y L
Sbjct  64   LQSPIDLLNQRVEEVS-HLGRLKRNYNPSNATLINRGHDMMLRWRNDAGHIQINGTLYHL  122

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            +  HWHSPSEHTING+R+ +E H+VH++ D+    + AVIG++YKIG+PDAFLS L R+ 
Sbjct  123  RQCHWHSPSEHTINGKRFDMETHLVHESDDK----RTAVIGIMYKIGRPDAFLSMLKRDF  178

Query  589  SSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
             ++++ RDVE+ +G+ +P  +++ S+++YRYMGSLTVPPCT+ +IWT+ KKVRT +R+Q+
Sbjct  179  EAIVETRDVERTVGVVNPKLVELGSRKYYRYMGSLTVPPCTQDIIWTMVKKVRTVTREQV  238

Query  766  KLLREAVHDYAERNARPLQALNRREIYLLSPAGKK  870
            +L+REAVHD +E NARP+Q +N R I L +P  ++
Sbjct  239  ELIREAVHDESEMNARPIQPMNERPINLYTPKDRE  273



>ref|XP_006845947.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
 gb|ERN07622.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
Length=253

 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 184/246 (75%), Gaps = 7/246 (3%)
 Frame = +1

Query  127  VEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHY  306
            VEDEREFDY E SE+GP+ WGEL  EW ACSNGDMQSPID+ HERV+++       RK Y
Sbjct  2    VEDEREFDYLEDSERGPKHWGELYPEWRACSNGDMQSPIDLLHERVEVLPNLGRLQRK-Y  60

Query  307  KPANATVRNRGHDIAIEW-HGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            KPA A ++NRGHDI ++W    AG++ IN T+Y LK  HWHSPSEHT NG RY LE+H+V
Sbjct  61   KPAKAILKNRGHDIMLKWGKSGAGTLEINQTEYVLKQCHWHSPSEHTFNGSRYHLEVHLV  120

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFDPSDIKMRS  660
            HQ+ D     + AV+G+ YKIG+PD FL +LM NISS+ D ++ E ++G+ DP  IKM S
Sbjct  121  HQSKD----GKNAVVGITYKIGRPDTFLKELMGNISSIADSKNAEAQVGVVDPRHIKMGS  176

Query  661  KRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRRE  840
            +++YRYMGSLT PPCT+GV W I KKVRT SR+Q++LLR AVHD AE NARP Q +N+R 
Sbjct  177  RKYYRYMGSLTTPPCTQGVAWNIVKKVRTVSREQLRLLRAAVHDEAEANARPTQPINKRV  236

Query  841  IYLLSP  858
            + L +P
Sbjct  237  VDLYTP  242



>ref|XP_006433902.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
 gb|ESR47142.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
Length=275

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 194/260 (75%), Gaps = 10/260 (4%)
 Frame = +1

Query  88   VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVK  267
            V+ L   S  ++E ++E+EF+Y +G E GP RWGE+  EW+AC NG MQSPID+ +ERV 
Sbjct  16   VILLLSGSAMSKEFDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERV-  74

Query  268  IITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTI  447
            ++ +H   +++ YKP+NAT+RNRGHDI ++W G AG+++INGT Y L+  HWHSPSEHTI
Sbjct  75   VVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPSEHTI  134

Query  448  NGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL---MRNISSMIDRDVEK  618
            +G+R+ALE HMVH++ D     ++AV+G++YKIG+PD+FL+ +   +RNIS   +RD   
Sbjct  135  DGKRFALEAHMVHESHD----GKVAVVGIVYKIGRPDSFLASISDHLRNISGSNERDA--  188

Query  619  ELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYA  798
             +G+ DP  IK+ S ++YRY+GSLTVPPCTE V WTI +KVR+ +R+Q+++LR AVHD +
Sbjct  189  TVGVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDES  248

Query  799  ERNARPLQALNRREIYLLSP  858
              NARPLQ LN R + L  P
Sbjct  249  NTNARPLQPLNMRSVKLYKP  268



>gb|KDO73356.1| hypothetical protein CISIN_1g039445mg [Citrus sinensis]
Length=275

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 198/272 (73%), Gaps = 12/272 (4%)
 Frame = +1

Query  58   LVTGSLILCF--VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            L T  L  CF  VL L      +QEV+DE+EF+Y E  ++GP +WGEL KEW+AC  G M
Sbjct  4    LATQLLFSCFFLVLLLLSCPAVSQEVDDEKEFNYEEEGQRGPSKWGELHKEWSACKKGTM  63

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+ +ERV++++ H   +++ YKP+ AT++NRGHD+ ++WHG AG+++INGT+Y LK
Sbjct  64   QSPIDLLNERVQVVS-HLGRLKRSYKPSYATLKNRGHDMMLQWHGGAGTLLINGTEYVLK  122

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL---MR  582
              HWHSPSEHTI+G R+ALE HMVH++ D     +IAV+G++YKIG+PD+ L+ +   +R
Sbjct  123  QCHWHSPSEHTIDGERFALEAHMVHESQD----GKIAVVGIMYKIGRPDSLLASISDHLR  178

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
             I+   +R  E  +G+ DP  IK+ S+++YRY+GSLT PPCTE VIWTI +KVRT +R+Q
Sbjct  179  QIAGSNER--ETVVGVIDPRGIKLGSRKYYRYIGSLTTPPCTENVIWTIVRKVRTVTREQ  236

Query  763  IKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            +KLLR AVHD +  NARP Q +N R I L  P
Sbjct  237  VKLLRVAVHDDSGTNARPQQPINLRTIKLYRP  268



>ref|XP_002529419.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32945.1| carbonic anhydrase, putative [Ricinus communis]
Length=272

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 188/254 (74%), Gaps = 7/254 (3%)
 Frame = +1

Query  100  HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITT  279
            H   T +QEVEDE EFDY   SEKGP RWGEL  EW ACSNG MQSPID+ +ERV+I++ 
Sbjct  21   HSILTSSQEVEDEHEFDY-RNSEKGPNRWGELHHEWGACSNGSMQSPIDLFNERVEIVS-  78

Query  280  HHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRR  459
            +   + + YKP+NAT++NRGHD+ ++W   AG++ INGT+Y LK  HWHSPSEHT+NG+ 
Sbjct  79   YLGRLIRSYKPSNATLKNRGHDMMLQWETGAGTLRINGTEYILKQCHWHSPSEHTVNGKS  138

Query  460  YALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFD  636
            YALELHMVH++ D     +IAV+G++Y IG+PD+FLS L   +  +   R+ E   G  +
Sbjct  139  YALELHMVHESLD----GKIAVVGIMYTIGRPDSFLSSLTDRLQLVAGTREYETAAGTVN  194

Query  637  PSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARP  816
            P DIK+ S+++YRYMGSLTVPPCTE V+WTI +KVRT +R+Q++LLR AVHD +  NARP
Sbjct  195  PKDIKIGSRKYYRYMGSLTVPPCTENVLWTIVRKVRTVTREQVRLLRVAVHDESNSNARP  254

Query  817  LQALNRREIYLLSP  858
            +Q +N R + L  P
Sbjct  255  IQGINGRSVQLYRP  268



>ref|XP_006384924.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
 gb|ERP62721.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
Length=274

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 191/266 (72%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            +    VL  H     +QE+EDE EFDY   SE+GP  WG +  EW ACSNG MQSPID+ 
Sbjct  12   ITFFLVLVSHILPITSQELEDETEFDYNPYSERGPAHWGRIHPEWVACSNGSMQSPIDLL  71

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERV I++ +   + + YKP NAT+RNRGHDI ++W   AG++ INGT+Y LK  HWHSP
Sbjct  72   NERVDIVS-YLGRLNRSYKPGNATLRNRGHDIMLKWESGAGTIEINGTEYVLKQCHWHSP  130

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-DRD  609
            SEHTI+G+R+ALE HMVH++ D     ++AV+G+LYKIG+PD+FLS L   + S+    +
Sbjct  131  SEHTIDGKRFALEAHMVHESLD----GKVAVVGILYKIGRPDSFLSSLTEQLESVAGTNE  186

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             +  +G+ DP +I++ S+++YRY+GSLT PPCTE V+WTI KKVRTA+R+Q++LLR AVH
Sbjct  187  RDTVVGVVDPRNIEIGSRKYYRYLGSLTTPPCTENVLWTIVKKVRTATREQVRLLRVAVH  246

Query  790  DYAERNARPLQALNRREIYLLSPAGK  867
            D ++ NARPLQ LN R + L  P  K
Sbjct  247  DDSDTNARPLQPLNGRSVKLFVPEDK  272



>ref|XP_006424533.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
 gb|ESR37773.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
Length=275

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 197/272 (72%), Gaps = 12/272 (4%)
 Frame = +1

Query  58   LVTGSLILCF--VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            L T  L  CF  VL L      +QEV+DE+EF+Y E  ++GP +WGEL KEW+ C  G M
Sbjct  4    LATQLLFSCFFLVLLLLSCPAVSQEVDDEKEFNYEEEGQRGPSKWGELHKEWSDCKKGTM  63

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+ +ERV++++ H   +++ YKP+ AT++NRGHD+ ++WHG AG+++INGT+Y LK
Sbjct  64   QSPIDLLNERVQVVS-HLGRLKRSYKPSYATLKNRGHDMMLQWHGGAGTLLINGTEYVLK  122

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL---MR  582
              HWHSPSEHTING R+ALE HMVH++ D     +IAV+G++YKIG+PD+ L+ +   +R
Sbjct  123  QCHWHSPSEHTINGERFALEAHMVHESQD----GKIAVVGIMYKIGRPDSLLASIADHLR  178

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
             I+   +R  E  +G+ DP  IK+ S+++YRY+GSLT PPCTE VIWTI +KVRT +R+Q
Sbjct  179  QIAGSDER--ETVVGVIDPRGIKLGSRKYYRYIGSLTTPPCTENVIWTIVRKVRTVTREQ  236

Query  763  IKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            +KLLR AVHD +  NARP Q +N R I L  P
Sbjct  237  VKLLRVAVHDDSGTNARPQQPINLRTIKLYRP  268



>ref|XP_003520661.2| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=276

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/251 (58%), Positives = 184/251 (73%), Gaps = 5/251 (2%)
 Frame = +1

Query  106  ASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHH  285
             STRA    DE  + Y E S  GPR WG+LK+EWAAC  G +QSPID+S   V++I    
Sbjct  21   VSTRAL---DEPGYGYNEKSANGPRYWGDLKEEWAACKIGKIQSPIDLSTNGVEVIPKLG  77

Query  286  HEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYA  465
                 +YKP +ATV NRGHD+A+ W GDAGS+ INGT +FL+ AHWH PSEHTINGRRY 
Sbjct  78   GLKYWNYKPQHATVSNRGHDVAVIWGGDAGSIDINGTPFFLQQAHWHWPSEHTINGRRYD  137

Query  466  LELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSD  645
            LELHMVH +   + TN+ AV+G+LYK G PD  LSKL + I+ + + D EK +G+ DPS 
Sbjct  138  LELHMVHVSPQPDGTNKTAVVGILYKYGSPDPLLSKLGKYITEIPEEDEEKSVGVIDPSK  197

Query  646  IKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQA  825
            I   SK +YRYMGSLTVPPCTEG+IWT++KKVRT SR Q+KL+++ +H Y ++NARPLQ+
Sbjct  198  IMKGSKMYYRYMGSLTVPPCTEGIIWTVDKKVRTVSRGQVKLVKDTLHGYVKKNARPLQS  257

Query  826  LNRREI--YLL  852
            LN+REI  Y+L
Sbjct  258  LNQREIKFYIL  268



>ref|XP_006488639.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   301 bits (770),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/272 (52%), Positives = 198/272 (73%), Gaps = 12/272 (4%)
 Frame = +1

Query  58   LVTGSLILCF--VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            L T  L+ CF  VL L      +QE +DE+EF+Y E  ++GP +WGEL KEW+AC  G M
Sbjct  4    LATQLLLSCFFLVLLLLSCPALSQEADDEKEFNYEEEGQRGPSKWGELHKEWSACKKGTM  63

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+ +ERV++++ H   +++ YKP+ AT++NRGHD+ ++WHG AG+++INGT+Y LK
Sbjct  64   QSPIDLLNERVQVVS-HLGRLKRSYKPSYATLKNRGHDMMLQWHGGAGTLLINGTEYVLK  122

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL---MR  582
              HWHSPSEHTI+G R+ALE HMVH++ D     +IAV+G++YKIG+PD+ L+ +   +R
Sbjct  123  QCHWHSPSEHTIDGERFALEAHMVHESQD----GKIAVVGIMYKIGRPDSLLASISDHLR  178

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
             I+   +R  E  +G+ DP  IK+ S+++YRY+GSLT PPCTE VIWTI +KVRT +R+Q
Sbjct  179  QIAGSNER--ETVVGVIDPRGIKLGSRKYYRYIGSLTTPPCTENVIWTIVRKVRTVTREQ  236

Query  763  IKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            +KLLR AVHD +  NARP Q +N R + L  P
Sbjct  237  VKLLRVAVHDDSGTNARPQQPINLRTVKLYRP  268



>ref|XP_009377054.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=285

 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 193/251 (77%), Gaps = 3/251 (1%)
 Frame = +1

Query  100  HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITT  279
            H  S  AQEVEDER FDY EGS+KGP  WG++K+EWAAC NG +QSPID+S  RV  I +
Sbjct  24   HSTSVTAQEVEDERNFDYIEGSKKGPAFWGDIKREWAACKNGRLQSPIDLSSLRVTTIPS  83

Query  280  HHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRR  459
                ++  YK +NAT++NRGHDI +EW G +GS+ ++G +Y L+ +HWHSPSEH+INGRR
Sbjct  84   LVG-LKTTYKSSNATLKNRGHDIKLEWAGYSGSIEVDGIEYHLQQSHWHSPSEHSINGRR  142

Query  460  YALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDP  639
            YA+ELHMV+Q+ D  + N + V+GVLY+IG+P+AFLSKLMR+++ M D   E+ +G+ DP
Sbjct  143  YAMELHMVYQSPDPKVENNVVVVGVLYQIGRPNAFLSKLMRDVAFMTDEKTERSIGVIDP  202

Query  640  SD--IKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNAR  813
                +++    +Y+Y+GSLT+PPCTEGVIW I+K++ T S++QI LLR AV+DYAE NAR
Sbjct  203  PAEIVQLNGNNYYKYIGSLTIPPCTEGVIWIISKQLGTVSKEQIDLLRAAVYDYAEMNAR  262

Query  814  PLQALNRREIY  846
            P+Q LN R+I+
Sbjct  263  PVQPLNLRKIF  273



>ref|XP_011044411.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/274 (51%), Positives = 195/274 (71%), Gaps = 12/274 (4%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
            +L   +  L  V  + PA++  QEVEDE +F+Y    EKGP  WG +  EW ACSNG MQ
Sbjct  8    LLFLITFFLVLVSRILPATS--QEVEDEADFNYDPNGEKGPANWGRIHPEWGACSNGSMQ  65

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKS  414
            SPID+  ERV +++ H   + + YKPANAT+RNRGHD+ ++W G AGS+ INGT+Y LK 
Sbjct  66   SPIDLLSERVDVVS-HLGRLSRSYKPANATLRNRGHDMMLKWEGAAGSIEINGTEYLLKQ  124

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRN---  585
             HWHSPSEHTING+R ALE+HMVH++ D     ++AV+G++Y IG+PD+FLS L +    
Sbjct  125  CHWHSPSEHTINGKRLALEVHMVHESLD----GKVAVVGIMYMIGRPDSFLSSLTKQLQL  180

Query  586  ISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
            ++   +RD     G+ DP +IK+ S+++YRYMGSLT+PPCTE V+WTI +KVRTA+R+Q+
Sbjct  181  VAGTYERDTVA--GVVDPRNIKIGSRKYYRYMGSLTIPPCTENVLWTIVRKVRTATREQV  238

Query  766  KLLREAVHDYAERNARPLQALNRREIYLLSPAGK  867
            ++LR AVHD ++ NAR +Q +N R + L  P  K
Sbjct  239  RMLRVAVHDESDTNARQIQPINSRTVKLFRPEDK  272



>ref|XP_004494904.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=274

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 181/246 (74%), Gaps = 4/246 (2%)
 Frame = +1

Query  142  EFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANA  321
            E+ Y E S KGP+ WG+LKKEWAAC  G+MQSPID+S +RV +I  +  ++ + YKP +A
Sbjct  28   EYGYKEKSAKGPKHWGDLKKEWAAC-KGEMQSPIDLSSDRVSVIP-NLGKLNRSYKPQHA  85

Query  322  TVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQ  501
            T+ NRGHDIA+ W  DAGS+ INGT YFL++ HWH PSEHTINGRRY LELHMVH +   
Sbjct  86   TISNRGHDIAVSWEADAGSIDINGTQYFLQTTHWHWPSEHTINGRRYDLELHMVHVSPQP  145

Query  502  NLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDI-KMRSKRHYRY  678
            +  N+  V+GVLYK G PD FLSKL + I  + D + EK +G+ DPS I KM    +YRY
Sbjct  146  DGINKTTVVGVLYKFGSPDPFLSKLGKYIMDIPDEEEEKSIGIIDPSKILKMGGSMYYRY  205

Query  679  MGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD-YAERNARPLQALNRREIYLLS  855
            MGSLT PPCTEGVIWTINKK+RT SR Q+KLL+ +V   YA+RNARP+Q LN+REI L  
Sbjct  206  MGSLTAPPCTEGVIWTINKKIRTVSRGQVKLLKNSVLKYYAKRNARPVQILNQREIELYD  265

Query  856  PAGKKL  873
            P  K +
Sbjct  266  PKTKNI  271



>ref|XP_009621603.1| PREDICTED: alpha carbonic anhydrase 7 [Nicotiana tomentosiformis]
Length=273

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 196/267 (73%), Gaps = 6/267 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            L L F+       TR+ EV+DE EF Y E SEKGP  WGE+  EW+ C++G +QSPID+ 
Sbjct  11   LFLSFLFLASALLTRSHEVDDESEFTYDEESEKGPAHWGEIHTEWSMCNSGKLQSPIDLL  70

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERV++++ H   +R+ YKP+N+T+ NRGHD+ + W G AG + INGT Y L  AHWHSP
Sbjct  71   NERVEVVS-HLGRLRRSYKPSNSTLLNRGHDMMLRWEGGAGHIEINGTRYQLNQAHWHSP  129

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-DRD  609
            SEHTING+R+ LE+H+VH++ D     + AV+G++YKIG+ D+FLSK+  ++ ++   + 
Sbjct  130  SEHTINGKRFDLEVHLVHESND----GKTAVVGIMYKIGRADSFLSKIEDDLKALAHTKG  185

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
            VE+ +G+ DP  +K+ S+++YRY+GSLTVPPCT+ V+WTI +KVRT +R+Q+KL+REAVH
Sbjct  186  VERNIGIIDPKQVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTREQMKLIREAVH  245

Query  790  DYAERNARPLQALNRREIYLLSPAGKK  870
            D +E N+RP+QA N+R I L  P   K
Sbjct  246  DESETNSRPVQAANKRPIRLYRPNDPK  272



>ref|XP_009377055.1| PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]
Length=337

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 188/263 (71%), Gaps = 4/263 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            ++  F+L+ HP    A+ ++ E EFDY EG+EKGP+ WGELKKEW AC +G  Q+PID+ 
Sbjct  14   VLAIFLLYWHPIPITAKPLDQEIEFDYTEGNEKGPQHWGELKKEWVACKDGKSQAPIDLV  73

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
              +   +     ++ + +KP++AT++N GH IA+EW GDAGS+ INGT+YFL   HWH+P
Sbjct  74   ENQAAKVIPTLRDLTQRHKPSDATLKNEGHYIALEWEGDAGSIQINGTEYFLNECHWHTP  133

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDV  612
            SEHTING RY LELHMVH+  D+   N +AVI  LY++G P+ FL K+ ++I SMI R  
Sbjct  134  SEHTINGVRYDLELHMVHRGADK---NSVAVIAFLYQVGPPNPFLLKVNKDILSMIGRK-  189

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
            EK+LG+ +P DI  RS R +RY+GSLT PPCTEGVIWT+N++V   SR+Q++LL++ V D
Sbjct  190  EKQLGVINPRDIIWRSLRFHRYIGSLTTPPCTEGVIWTVNERVNIVSREQLELLKQVVDD  249

Query  793  YAERNARPLQALNRREIYLLSPA  861
            YA  NARPLQ  N R I L  P+
Sbjct  250  YAVMNARPLQLANGRGIKLYVPS  272



>gb|KHG05281.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=286

 Score =   298 bits (764),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 189/260 (73%), Gaps = 3/260 (1%)
 Frame = +1

Query  79   LCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHE  258
            + F+ F    +   +EVEDEREFDY E   KGP  WG+LKKEWAAC NG +QSPID++++
Sbjct  28   VLFLCFSASVAHNDEEVEDEREFDYNENGAKGPHHWGDLKKEWAACKNGAIQSPIDLTND  87

Query  259  RVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSE  438
            RVKIIT    ++ K+YKPA + ++NRGHDI+ +    AGS+ I+G +Y L   HWHSPSE
Sbjct  88   RVKIITKSV-KIEKNYKPAESIIKNRGHDISPD--HKAGSITIDGIEYVLLQVHWHSPSE  144

Query  439  HTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEK  618
            HTING+RYALE HMVH+  D N+ + +AV  +LY+ G P+ FL KL+ NI+ M D   ++
Sbjct  145  HTINGKRYALEAHMVHKAADPNVKSGLAVSALLYEDGSPNDFLCKLISNITDMTDEVQQR  204

Query  619  ELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYA  798
             +G+ DP+ I++    +YRY+GSLTVPPCTE VIW INKK+ T S++Q+  +REAVHDYA
Sbjct  205  SMGVTDPNLIEIDGVEYYRYIGSLTVPPCTESVIWIINKKIATVSKEQVHTIREAVHDYA  264

Query  799  ERNARPLQALNRREIYLLSP  858
            E+NARP+Q  N RE+ L SP
Sbjct  265  EQNARPVQPHNEREMELHSP  284



>ref|XP_008810960.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=263

 Score =   297 bits (761),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 180/234 (77%), Gaps = 6/234 (3%)
 Frame = +1

Query  160  GSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRG  339
            GS  GP  WGE+ KEWAAC+NGDMQSPID++HERVKI       +++ YK +NAT++NRG
Sbjct  24   GSPNGPDHWGEIHKEWAACNNGDMQSPIDLTHERVKIFPGLG-RLKRSYKASNATLKNRG  82

Query  340  HDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQI  519
            HDI ++W    G + INGT+Y L   HWHSPSEH+ING+R+ LE+HMVHQ++DQ    + 
Sbjct  83   HDIMLKWAEGGGWIRINGTEYQLMQCHWHSPSEHSINGKRFDLEIHMVHQSSDQ----KN  138

Query  520  AVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTV  696
            AV+G++YKIG+PD FLS+LM +I  + D  + E  +GM DP DIK+ S+++YRYMGSLT 
Sbjct  139  AVVGIMYKIGRPDTFLSELMEHIKEIADAEEKETNVGMVDPRDIKIGSRKYYRYMGSLTT  198

Query  697  PPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            PPCT+GV+WTI KKVRT SR+Q++LLREAVHD AE NARP+Q +N REI   +P
Sbjct  199  PPCTQGVVWTITKKVRTVSREQVRLLREAVHDNAENNARPIQPINEREIQFYTP  252



>ref|XP_009358738.1| PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]
Length=339

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 185/258 (72%), Gaps = 4/258 (2%)
 Frame = +1

Query  76   ILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
            +   +L+LHP +  A+ ++ E EFDY EGSEKGP+ WGELKKEW AC +G  QSPID+  
Sbjct  15   LTIILLYLHPIALTAKPLDQEIEFDYREGSEKGPQHWGELKKEWTACKDGKSQSPIDLME  74

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPS  435
            +    +     ++  H+KP+ AT++N GH +A+EW GDAGS+ INGT+YFLK  HWH+PS
Sbjct  75   DGATKVIPTFRDLTMHHKPSGATLKNDGHYVALEWEGDAGSIQINGTNYFLKQCHWHTPS  134

Query  436  EHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVE  615
            EHTING RY LELHMVH++ D+   N +AVI  LY++G P+ FL K+ ++I S+I    E
Sbjct  135  EHTINGIRYDLELHMVHRSADK---NSVAVIAFLYQVGPPNPFLLKVSKDILSVIGTK-E  190

Query  616  KELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDY  795
            K LG+ +PS+IK  S R YRY+GSLT PPCTEGVIWT+N+ V   SR+Q++LL++ V DY
Sbjct  191  KHLGVINPSEIKWPSLRFYRYVGSLTTPPCTEGVIWTVNEGVNIVSRRQLELLKQVVDDY  250

Query  796  AERNARPLQALNRREIYL  849
            A  NARPLQ  N R I L
Sbjct  251  AVMNARPLQPANDRGIKL  268



>ref|XP_008387558.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=299

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 183/261 (70%), Gaps = 6/261 (2%)
 Frame = +1

Query  85   FVLFLHP--ASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHE  258
            F   L P  +ST     + E  FDY EGSEKGP  WGELK+EWAAC +G  QSPI +   
Sbjct  19   FFPHLDPETSSTVVFGADQEIAFDYREGSEKGPEHWGELKQEWAACKDGRSQSPIGLDES  78

Query  259  RVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSE  438
            R   +     ++   YKP++AT++N GH IA+EW GDAGS+ I+ +DYFLK  HWH+PSE
Sbjct  79   RATKVIQSSRDLTVSYKPSDATLKNEGHYIALEWEGDAGSIQIDDSDYFLKRCHWHTPSE  138

Query  439  HTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEK  618
            HT+NG RY LELHMVHQ+ DQ   N IAV+  LY++G+P+AFLSK+ ++I S +    EK
Sbjct  139  HTVNGARYDLELHMVHQSADQ---NNIAVVAFLYEVGQPNAFLSKINQDI-SFVTSTKEK  194

Query  619  ELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYA  798
            +LG+ DP +IK  S R YRYMGSLT PPCTEGVIWT+N+KV   SR+Q+ LL+EAV+DYA
Sbjct  195  KLGVIDPREIKWDSSRFYRYMGSLTTPPCTEGVIWTVNEKVDIVSREQLDLLKEAVYDYA  254

Query  799  ERNARPLQALNRREIYLLSPA  861
              NARPLQ    R+I L  P+
Sbjct  255  AANARPLQRDEGRDIKLYGPS  275



>ref|XP_010262876.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=294

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 186/240 (78%), Gaps = 5/240 (2%)
 Frame = +1

Query  76   ILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
            +   V  LH   T +QEVEDE+EFDY EGS KGP +WGE+  EWA C NG+MQSPID+ +
Sbjct  36   VFLLVFILHSGPTTSQEVEDEQEFDYVEGSGKGPEQWGEIHPEWALCKNGEMQSPIDLLN  95

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPS  435
            +RV+I++ H   ++++Y+P+NAT++NRGHDI ++W   AG + INGT Y L+  HWHSPS
Sbjct  96   KRVQIVS-HLGRLKRNYRPSNATIKNRGHDIMLKWVDGAGWIEINGTQYVLQQCHWHSPS  154

Query  436  EHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDV  612
            EHTING+R+ LE+HMVHQ+   N T   +V+G++YKIG+PD FLSK+M  I+S+ + ++ 
Sbjct  155  EHTINGKRFDLEVHMVHQSISDNKT---SVVGIMYKIGRPDTFLSKIMGYINSIAETKEK  211

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
            E  +G+ DP +IK+ S+++YRYMGSLTVPPCT+ V+WTI +KVRT SR+Q++LLREAV D
Sbjct  212  ETVVGVVDPKNIKLGSRKYYRYMGSLTVPPCTQDVVWTIVRKVRTVSREQVRLLREAVDD  271



>ref|XP_008383977.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=339

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 183/255 (72%), Gaps = 4/255 (2%)
 Frame = +1

Query  85   FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERV  264
             +L+LHP +  A+ ++ E EFDY EGSEKGP+ WGELKKEW AC +G  QSPID+  +  
Sbjct  18   ILLYLHPIALTAKPLDQEIEFDYREGSEKGPQHWGELKKEWTACKDGKSQSPIDLMEDGA  77

Query  265  KIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHT  444
              +     ++  H+KP+ AT++N GH IA+EW GDAGS+ INGT+YFLK  HWH+PSEHT
Sbjct  78   TKVIPTFRDLTMHHKPSGATLKNEGHYIALEWEGDAGSIQINGTNYFLKQCHWHTPSEHT  137

Query  445  INGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKEL  624
            ING RY LELHMVH++ D+   N +AVI  LY++G P+ FL K+ ++I S+I    EK L
Sbjct  138  INGIRYDLELHMVHRSADK---NSVAVIAFLYQVGPPNPFLLKVSKDILSVIGTK-EKHL  193

Query  625  GMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAER  804
            G+ +PS+IK  S R YRY+GSLT PPCTE VIWT+N+ V   SR+Q++LL++ V DYA  
Sbjct  194  GVINPSEIKWPSLRFYRYVGSLTTPPCTEAVIWTVNEGVSIVSRRQLELLKQVVDDYAVM  253

Query  805  NARPLQALNRREIYL  849
            NARPLQ  N R I L
Sbjct  254  NARPLQPXNDRGIKL  268



>ref|XP_006488640.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   295 bits (755),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 194/265 (73%), Gaps = 8/265 (3%)
 Frame = +1

Query  73   LILCF--VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            L  CF  VL L   +  +QEV+DE EF+Y EG E GP +WG+L  EW+AC NG MQSPID
Sbjct  9    LFCCFFVVLLLLSGTAISQEVDDEIEFNYEEGGENGPSKWGQLHSEWSACKNGRMQSPID  68

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            + +ERV++++ H   +++ YKP+NAT++NRGHD+ ++W G AG++ INGT+Y L+  HWH
Sbjct  69   LLNERVQVVS-HLGRLKRSYKPSNATLKNRGHDMMLQWEGGAGTLRINGTEYVLQQCHWH  127

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-D  603
            SPSEHTING+R+ALE HMVH + D     +IAV+G++YKIG+PD+FL  +  +++ +   
Sbjct  128  SPSEHTINGQRFALEAHMVHVSQD----GKIAVVGIVYKIGRPDSFLESISDHLTQVAGS  183

Query  604  RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREA  783
             + E  +G+ DP  IK+ S+++YRY+GSLT+PPCTE V+WTI +KVRT +R+Q++ LR A
Sbjct  184  NERETVVGVIDPRGIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTVTREQVRSLRVA  243

Query  784  VHDYAERNARPLQALNRREIYLLSP  858
            VHD ++ NARP Q +N R +    P
Sbjct  244  VHDESDTNARPQQPINLRIVKSYRP  268



>ref|XP_009132759.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=268

 Score =   295 bits (754),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 185/262 (71%), Gaps = 7/262 (3%)
 Frame = +1

Query  79   LCFVLFLHPASTRAQ-EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
            L F+L    + + AQ EVEDE EF Y    E GP +WG+LK EW  C  G+MQSPID+ +
Sbjct  9    LLFILLTIISCSNAQREVEDESEFSYEGNQENGPEKWGKLKPEWKMCGKGEMQSPIDLMN  68

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPS  435
            +RVKI++ H   + + YKPANAT+RNRGHD+ + +    GS+ IN  +Y L   HWHSPS
Sbjct  69   KRVKIVS-HLGRLTRDYKPANATLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPS  127

Query  436  EHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDV  612
            EHTINGRR+ALELHMVH++    +   +AV+ VLYKIG+PD+FLS L   + ++ D  + 
Sbjct  128  EHTINGRRFALELHMVHES----INGSMAVVTVLYKIGRPDSFLSLLENKLCAITDHNEA  183

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
            E  +GM DP DIK  S+++YRY+GSLT+PPCT+ VIWT+ KKVRT SR Q+KLLR AVHD
Sbjct  184  EINIGMIDPKDIKFGSRKYYRYIGSLTIPPCTQNVIWTVIKKVRTVSRNQVKLLRVAVHD  243

Query  793  YAERNARPLQALNRREIYLLSP  858
            Y++ NARP+Q  N R + L  P
Sbjct  244  YSDTNARPVQPTNMRTVKLYRP  265



>ref|XP_008241447.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=274

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 176/241 (73%), Gaps = 4/241 (2%)
 Frame = +1

Query  136  EREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPA  315
            E +FDY  G+EKGP  WGELKKEWAAC  G +QSPID+S +R   +     +++  YKP 
Sbjct  29   EIQFDYRNGNEKGPEHWGELKKEWAACKYGKLQSPIDLSDDRATKVIPSLEDLQMSYKPC  88

Query  316  NATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNT  495
            NAT++N GH IA+EW GDAGSV INGTDYFLK  HWH+PSEH+ING RY LELHM+HQ+ 
Sbjct  89   NATMKNEGHYIAMEWEGDAGSVKINGTDYFLKQCHWHTPSEHSINGIRYDLELHMLHQSP  148

Query  496  DQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYR  675
            D    N  AV+ +L+KIG P+  LSK+   + SMI    E +L + DPS+IK  S + YR
Sbjct  149  D---PNNKAVVALLFKIGSPNPLLSKVHNGLESMIFTK-ETQLELTDPSEIKWSSLKFYR  204

Query  676  YMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLS  855
            Y+GSLT PPCTEGVIWT+N+ V T S++Q++LL++AVHDYA+ NARP Q  N R+I L S
Sbjct  205  YIGSLTTPPCTEGVIWTVNEMVNTVSKEQLELLKQAVHDYAKMNARPSQPFNDRDIILYS  264

Query  856  P  858
            P
Sbjct  265  P  265



>gb|KDO73355.1| hypothetical protein CISIN_1g046862mg [Citrus sinensis]
Length=275

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 193/265 (73%), Gaps = 8/265 (3%)
 Frame = +1

Query  73   LILCF--VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            L  CF  VL L   +  +QEV+DE EF+Y EG E GP +WG+L  EW+AC NG MQSPID
Sbjct  9    LFCCFFVVLLLLSGTAISQEVDDEIEFNYEEGGENGPSKWGQLHSEWSACKNGRMQSPID  68

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            + +ERV++++ H   +++ YKP+NAT++NRGHD+ ++W G AG++ INGT+Y L+  HWH
Sbjct  69   LLNERVQVVS-HLGRLKRSYKPSNATLKNRGHDMMLQWEGGAGTLRINGTEYVLQQCHWH  127

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-D  603
            SPSEHTING+R+ALE HMVH + D     +IAV+G++YKIG+PD+FL  +  +++ +   
Sbjct  128  SPSEHTINGQRFALEAHMVHVSQD----GKIAVVGIMYKIGRPDSFLESISDHLTQVAGS  183

Query  604  RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREA  783
             + E   G+ DP  IK+ S+++YRY+GSLT+PPCTE V+WTI +KVRT +R+Q++ LR A
Sbjct  184  NERETVAGVIDPRGIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTVTREQVRSLRVA  243

Query  784  VHDYAERNARPLQALNRREIYLLSP  858
            VHD ++ NARP Q +N R +    P
Sbjct  244  VHDESDTNARPQQPINLRIVKSYRP  268



>ref|XP_009595413.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana tomentosiformis]
Length=269

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 196/270 (73%), Gaps = 7/270 (3%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPAS-TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            +  T SL +   LFL  A   R+ EV+DE EF Y E +E GP  WG++  EW  C+ G +
Sbjct  1    MAATKSLFIISFLFLSSAFLARSAEVDDESEFSYDEKNENGPANWGKIYPEWNTCNTGKL  60

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+ ++RV++++ +  ++RKHYKP+NAT+ NRGHD+ + W G AG + INGT Y LK
Sbjct  61   QSPIDLLNKRVEVVS-NLGKLRKHYKPSNATLLNRGHDMMLRWEGGAGHLKINGTKYQLK  119

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWH+PSEHTING+R+ LE H+VH++ D     + AVIG++YKIG+PD FLS + +++ 
Sbjct  120  QCHWHTPSEHTINGKRFNLEAHLVHESDD----GKTAVIGIMYKIGRPDFFLSMIEKDLK  175

Query  592  SMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
            ++ + + +E+ +G  DP+ IKM  K++YRY+GSLTVPPCTE V+WTI++KV+T +++Q+K
Sbjct  176  ALANTKGIERAIGTIDPNLIKMDGKKYYRYIGSLTVPPCTEDVVWTIDRKVKTITKRQMK  235

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSP  858
            L+REAVHD +E NARP Q +NRR I    P
Sbjct  236  LIREAVHDESETNARPAQPVNRRPIKFYKP  265



>ref|XP_008778933.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=273

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/278 (52%), Positives = 196/278 (71%), Gaps = 11/278 (4%)
 Frame = +1

Query  46   RRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNG  225
            RR +L+  +++  F+L   P +T A+EV DEREF Y   SE GP  WG++ ++WA C+ G
Sbjct  3    RRKLLIISTVVAVFLLRCIPRTT-AEEVGDEREFSYESDSEHGPENWGKIHEDWAICNKG  61

Query  226  DMQSPIDMSHERVKIITTHHH--EMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTD  399
             MQSP+D+  +RV++   HHH   +R+ Y+ A A V+NRGHDI ++W  D G++ IN T 
Sbjct  62   QMQSPLDLLDKRVQV---HHHLGPLRRTYRAALAVVKNRGHDIMVKWEEDPGAIWINETM  118

Query  400  YFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLM  579
            Y LK  HWH+PSEHT+NGRRYA+E+HMVH++ DQ    ++AV+G+LYKIG+PD+FL ++ 
Sbjct  119  YTLKQLHWHAPSEHTLNGRRYAVEMHMVHESADQ----KVAVVGILYKIGRPDSFLEEVE  174

Query  580  RNISSMIDRDVEKE-LGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASR  756
              I  + D   E+E LGM +P   K  S+++YRY+GSLTVPPCTEGV+WTI KKVRT SR
Sbjct  175  EEIMKIGDLTGEEEVLGMVNPRHAKWGSRKYYRYLGSLTVPPCTEGVVWTIIKKVRTVSR  234

Query  757  KQIKLLREAVHDYAERNARPLQALNRREIYLLSPAGKK  870
            KQ+  LREAVHD  E NARP+Q +N R + L  P   K
Sbjct  235  KQVDRLREAVHDDFEMNARPIQEINERTVSLYRPPNFK  272



>ref|XP_010272832.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
 ref|XP_010272833.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=270

 Score =   293 bits (751),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 190/259 (73%), Gaps = 8/259 (3%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            L++   L   P +T  +EVEDEREF+Y EGS  GP  WGE+ +EWAAC NG+MQSPID+S
Sbjct  12   LLVIPSLLFSPVTT--EEVEDEREFNYVEGSGVGPEHWGEIHEEWAACGNGEMQSPIDLS  69

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
             ++V+++  H  ++++ Y+P+ A + NRGHDI I+W   AGS+ INGT YFL+  HWHSP
Sbjct  70   EKKVEVLH-HLGKLKRRYRPSRAVLVNRGHDIMIKWVERAGSIYINGTRYFLRHCHWHSP  128

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD-  609
            SEHTING RYALE HMVH+++D+    ++AV+G+LYK G+PD FLS +   +    D++ 
Sbjct  129  SEHTINGVRYALEGHMVHESSDK----KVAVVGILYKFGRPDRFLSMMENYVFKTADKEG  184

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             E+ELG+ +P  IK+    +YRYMGSLT PPCTEGV+WTI KKV+T S++Q++LLR AVH
Sbjct  185  AEEELGIVNPKRIKLGGTEYYRYMGSLTTPPCTEGVVWTILKKVKTVSKEQVELLRMAVH  244

Query  790  DYAERNARPLQALNRREIY  846
            D +E NARP Q  N R ++
Sbjct  245  DDSEMNARPTQPTNYRSVH  263



>ref|XP_009380700.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=273

 Score =   293 bits (751),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 189/271 (70%), Gaps = 9/271 (3%)
 Frame = +1

Query  49   RSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            + +   G LI   +     AS   QEVEDE+EF Y  GS+ GP  WGE+  EWAAC  G 
Sbjct  5    KPVFFFGVLIAALLQSFPVAS---QEVEDEKEFSYQRGSQIGPEHWGEIHHEWAACGKGR  61

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFL  408
             QSPID+S ERV++       +R+ Y+PA+A ++NRGHDI ++W  +AG + INGT+Y L
Sbjct  62   TQSPIDLSDERVQVFPCLG-RLRRSYRPADAILKNRGHDIMLKWEDEAGGIWINGTEYGL  120

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            K  HWHSPSEHTINGRRY +E+HMVH++ D    N+IAV+G+LYKIG  D FL++L R I
Sbjct  121  KQMHWHSPSEHTINGRRYPMEMHMVHESAD----NKIAVVGILYKIGHRDPFLAELERYI  176

Query  589  SSMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
              + D+ + E+ +GM DP  ++  S+++YRY GSLT PPCTEGV WTI KKVRT SR+Q+
Sbjct  177  ERISDKHEAEEVVGMVDPRHVRKGSRKYYRYTGSLTTPPCTEGVAWTIIKKVRTVSREQL  236

Query  766  KLLREAVHDYAERNARPLQALNRREIYLLSP  858
             LLREAVHD +E NARP Q +N+R + L  P
Sbjct  237  ALLREAVHDGSEMNARPTQKMNKRIVGLYRP  267



>emb|CDP07086.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/276 (50%), Positives = 197/276 (71%), Gaps = 8/276 (3%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPAS--TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            L   +L  CF +    A    RA+EVEDE+EF Y E S +GP  WGE+++EW+ C++G M
Sbjct  4    LTRKALFCCFFVCTTFACNLARAEEVEDEKEFSYDERSHRGPAHWGEIRQEWSMCNHGSM  63

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+   RV+++++    + + YKP+NAT+ NRGHD+ + W  DAG + INGT Y L+
Sbjct  64   QSPIDLLDARVQVVSSLG-RLHREYKPSNATLVNRGHDMMLRWVDDAGHIHINGTLYHLR  122

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEH+ING+RY LE H+VH+     L  +IAVIG++Y+IG+ D+FLS +   + 
Sbjct  123  QCHWHSPSEHSINGKRYDLEAHLVHEA----LNGRIAVIGIIYEIGRSDSFLSMMENKLK  178

Query  592  SMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
            ++ D RD+EK +G+ DP  IK+ S+++YRY+GSLT+PPCT+ V+WTI KKVRT +R Q+K
Sbjct  179  ALADTRDLEKVVGVIDPKQIKLGSRKYYRYIGSLTIPPCTQNVVWTIVKKVRTVTRDQVK  238

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSPAGKKLE  876
            ++REAVHD +E NARPLQ L+ R I +  P  K+ E
Sbjct  239  MIREAVHDESEANARPLQPLHNRPIRMYRPHAKEEE  274



>ref|XP_010696307.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=279

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 177/249 (71%), Gaps = 4/249 (2%)
 Frame = +1

Query  109  STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHH  288
            ST AQEV+DE EFDY  GSE+GP RWG +++EWA C  G  QSPID+ H RV++I     
Sbjct  24   STTAQEVDDETEFDYLRGSERGPDRWGHIREEWATCRTGRYQSPIDLLHRRVQVIPKSA-  82

Query  289  EMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYAL  468
            E+ K YK  NATVRNRGHDI IEW G+   + INGT Y L+  HWHSPSEHTING R+A 
Sbjct  83   EIVKFYKAGNATVRNRGHDIMIEWEGEDSKIQINGTTYILRQCHWHSPSEHTINGSRFAA  142

Query  469  ELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDI  648
            ELH+VHQ  D    N IAVIG+LYK+GKP+ FL+ LM  +  + +       G  +P +I
Sbjct  143  ELHLVHQTPDN---NSIAVIGLLYKLGKPNRFLTTLMEKLELVPNALDLTNAGEINPGEI  199

Query  649  KMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQAL  828
            K+R +++YRYMGSLT PPCTEGV+WT+++++ T S  Q+  +RE VHD AERNARP+Q L
Sbjct  200  KLRGRKYYRYMGSLTTPPCTEGVLWTLDRRIATISEGQVAKMREVVHDDAERNARPVQPL  259

Query  829  NRREIYLLS  855
            N R++ L +
Sbjct  260  NGRKVGLYT  268



>ref|XP_006604587.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=277

 Score =   293 bits (750),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 189/276 (68%), Gaps = 5/276 (2%)
 Frame = +1

Query  43   MRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            M+R   ++ ++ L  +LF    ST    + DE E+ Y E S  GP+ WG+LK+EWAAC  
Sbjct  1    MQRQSHISVAISLICILF---CSTLTSAL-DEPEYGYNEKSANGPQHWGDLKEEWAACKI  56

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G +QSPID+S   V++I         +YKP +ATV NRGHD+A+ W GDAGS+ INGT +
Sbjct  57   GQIQSPIDLSTNGVEVIPKLGGLKYWNYKPQHATVSNRGHDVAVIWEGDAGSIEINGTPF  116

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
            FL+ AHWH P+EHTINGRRY LELHMVH +   + TN+ AV+GVLYK G PD  LSKL +
Sbjct  117  FLQQAHWHWPAEHTINGRRYDLELHMVHVSPQPDGTNKTAVVGVLYKYGSPDPLLSKLGK  176

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
             I    + D EK +G+ DPS+I   SK +YRYMGSLT PPCTE +IWT++KKVRT SR Q
Sbjct  177  YIMDTPEEDDEKSVGVVDPSEIMKGSKMYYRYMGSLTAPPCTEDIIWTVDKKVRTVSRGQ  236

Query  763  IKLLREAVHD-YAERNARPLQALNRREIYLLSPAGK  867
            +KLL++ V   YA+ NARPLQ LN+R I L  P  K
Sbjct  237  VKLLKDTVLKYYAKWNARPLQPLNQRAIQLYVPKTK  272



>ref|XP_008351630.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   293 bits (749),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 183/258 (71%), Gaps = 7/258 (3%)
 Frame = +1

Query  85   FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERV  264
            F+   + A   + EV DE  F Y EG+ KGP++WG++  +W  C NG MQSPID+  +RV
Sbjct  23   FLTICNAALEDSDEVGDETAFTYLEGTGKGPKKWGQIDPQWKVCDNGKMQSPIDLLDQRV  82

Query  265  KIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHT  444
            ++      ++++ YKPA A V+NRGHDI + W+GDAG   INGTDY L   HWHSPSEHT
Sbjct  83   QVFPKLG-KLKRXYKPAPAIVKNRGHDITMRWNGDAGKTKINGTDYRLLQCHWHSPSEHT  141

Query  445  INGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKEL  624
             NG RYALE H+VH ++    T +IAVIG++YK G+PD FLSKL  +I S+   +V+  +
Sbjct  142  FNGSRYALEFHIVHVSS----TGKIAVIGIVYKYGRPDPFLSKLFHHIKSVGKEEVD--I  195

Query  625  GMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAER  804
            G+ +P DIK  S+++YRY+GSLTVPPCTEGVIWTI KKVRT SR+Q++ LREAVHD  E 
Sbjct  196  GIINPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSREQVRALREAVHDGYEA  255

Query  805  NARPLQALNRREIYLLSP  858
            NARP Q L+ R + L +P
Sbjct  256  NARPTQELDGRPVLLYTP  273



>emb|CDY23976.1| BnaC03g17150D [Brassica napus]
Length=272

 Score =   292 bits (748),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 181/251 (72%), Gaps = 6/251 (2%)
 Frame = +1

Query  109  STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHH  288
            S   +EVEDE EF Y    E GP +WG+LK EW  C  G+MQSPID+ H+RV+I++ H  
Sbjct  24   SNAQREVEDESEFSYERNQENGPEKWGKLKPEWKMCGKGEMQSPIDLLHKRVRIVS-HLG  82

Query  289  EMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYAL  468
             + + YKPANAT+RNRGHD+ + +    GS+ IN  +Y L   HWHSPSEHTINGRR+AL
Sbjct  83   RLTRDYKPANATLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPSEHTINGRRFAL  142

Query  469  ELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFDPSD  645
            ELHMVH++ + +L    AV+ VLYKIG+PD+FLS L   + ++ D  + E  +GM DP D
Sbjct  143  ELHMVHESANGSL----AVVTVLYKIGRPDSFLSLLENKLCAITDHNEAEVNIGMIDPKD  198

Query  646  IKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQA  825
            IK  S+++YRY+GSLT+PPCT+ VIWT+ KKVRT +R Q+KLLR AVHDY++ NARP+Q 
Sbjct  199  IKFGSRKYYRYIGSLTIPPCTQNVIWTVIKKVRTVARHQVKLLRVAVHDYSDTNARPVQP  258

Query  826  LNRREIYLLSP  858
             N+R + L  P
Sbjct  259  TNKRPVKLYKP  269



>ref|XP_006577712.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=277

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 189/273 (69%), Gaps = 5/273 (2%)
 Frame = +1

Query  43   MRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            M+R   ++ ++ L  +LF     ++     DE E+ Y E SE GP+ WG+LK+EWA C  
Sbjct  1    MQRQSHISVAISLICILF----CSKLTRALDEPEYGYNEKSENGPQHWGDLKEEWADCKI  56

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G MQSPID+S   V++I         +YKP +A V NRGHD+A+ W  DAGS+ INGT +
Sbjct  57   GQMQSPIDLSTNGVEVIPKLGGLKYWNYKPQHAIVSNRGHDVAVMWEDDAGSIDINGTLF  116

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
            FL+ AHWH P+EHTINGRRY LELHMVH +T  + TN+ AV+G+LYK G PD  LSKL +
Sbjct  117  FLQQAHWHWPAEHTINGRRYDLELHMVHVSTQPDGTNKTAVVGILYKYGSPDPLLSKLGK  176

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
             I  + + D EK +G+ DPS+I   SK +YRYMGSLT PPCTE +IWT++KKVRT SR Q
Sbjct  177  YIMEIPEEDEEKSVGVIDPSEIIKGSKMYYRYMGSLTAPPCTEDIIWTVDKKVRTVSRGQ  236

Query  763  IKLLREAVHD-YAERNARPLQALNRREIYLLSP  858
            +KLL++ V + YA+ NARPLQ +N+REI L  P
Sbjct  237  VKLLKDTVLNYYAKWNARPLQFINQREIQLYVP  269



>gb|KHN18685.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=277

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 189/273 (69%), Gaps = 5/273 (2%)
 Frame = +1

Query  43   MRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            M+R   ++ ++ L  +LF     ++     DE E+ Y E SE GP+ WG+LK+EWA C  
Sbjct  1    MQRQSHISVAISLICILF----CSKLTRALDEPEYGYNEKSENGPQHWGDLKEEWADCKI  56

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G MQSPID+S   V++I         +YKP +A V NRGHD+A+ W  DAGS+ INGT +
Sbjct  57   GQMQSPIDLSTNGVEVIPKLGGLKYWNYKPQHAIVSNRGHDVAVMWEDDAGSIDINGTLF  116

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
            FL+ AHWH P+EHTINGRRY LELHMVH +T  + TN+ AV+G+LYK G PD  LSKL +
Sbjct  117  FLQQAHWHWPAEHTINGRRYDLELHMVHVSTQPDGTNKTAVVGILYKYGSPDPLLSKLGK  176

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
             I  + + D EK +G+ DPS+I   SK +YRYMGSLT PPCTE +IWT++KKVRT SR Q
Sbjct  177  YIMEIPEEDEEKSVGVIDPSEIIKGSKMYYRYMGSLTAPPCTEDIIWTVDKKVRTVSRGQ  236

Query  763  IKLLREAVHD-YAERNARPLQALNRREIYLLSP  858
            +KLL++ V + YA+ NARPLQ +N+REI L  P
Sbjct  237  VKLLKDTVLNYYAKWNARPLQFINQREIQLYVP  269



>ref|XP_006424534.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
 gb|ESR37774.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
Length=275

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 192/265 (72%), Gaps = 8/265 (3%)
 Frame = +1

Query  73   LILCF--VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPID  246
            L  CF  VL L   +  +QEV+DE EF+Y EG E GP +WGEL  +W+AC NG MQSPID
Sbjct  9    LFCCFFVVLLLLSGTAISQEVDDEIEFNYEEGGENGPSKWGELHSKWSACKNGRMQSPID  68

Query  247  MSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWH  426
            + +ERV++++ H   +++ YKP+NAT++NRGHD+ ++W G AG++ ING +Y L+  HWH
Sbjct  69   LLNERVQVVS-HLGRLKRSYKPSNATLKNRGHDMMLQWEGGAGTLRINGIEYVLQQCHWH  127

Query  427  SPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-D  603
            SPSEHTING+R+ALE HMVH + D     +IAV+G++YKIG+PD+FL  +  +++ +   
Sbjct  128  SPSEHTINGQRFALEAHMVHVSQD----GKIAVVGIMYKIGRPDSFLESISDHLTQVAGS  183

Query  604  RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREA  783
             + E   G+ DP  IK+ S+++YRY+GSLT+PPCTE V+WTI +KVRT +R+Q++ LR A
Sbjct  184  NERETVAGVIDPRGIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTVTREQVRSLRVA  243

Query  784  VHDYAERNARPLQALNRREIYLLSP  858
            VHD ++ NARP Q +N R +    P
Sbjct  244  VHDESDTNARPQQPINLRIVKSYRP  268



>ref|XP_009113037.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=271

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 185/262 (71%), Gaps = 5/262 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            ++L  ++ +   S   +EVEDE EF Y    E GP +WG+LK EW  C  G+MQSPID+ 
Sbjct  12   ILLTIIVTMISCSNAQREVEDESEFSYMRNQENGPEKWGKLKPEWKMCGKGEMQSPIDLM  71

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            H+RV+I++ H   + ++YKP+NAT+RNRGHD+ + +   + S+ IN  +Y L   HWHSP
Sbjct  72   HKRVRIVS-HLGRLTRNYKPSNATLRNRGHDMMVRFEEGSSSIKINNVEYQLHQLHWHSP  130

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDV  612
            SEHTINGRR+ALELHMVH++    L   +AV+ VLYKIG+PD+FL+ L   +S+M D + 
Sbjct  131  SEHTINGRRFALELHMVHES----LNGSLAVVTVLYKIGRPDSFLNLLENKLSAMTDPNE  186

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
            EK +GM DP  IK  S+++YRY+GSLT+PPCT+ VIWT+ K+V+T +R Q+KLLR AVHD
Sbjct  187  EKNIGMIDPRGIKFGSRKYYRYIGSLTIPPCTQNVIWTVVKEVKTVARNQVKLLRVAVHD  246

Query  793  YAERNARPLQALNRREIYLLSP  858
            ++  NARP+Q  N R +    P
Sbjct  247  HSNTNARPVQPTNMRVVKFNRP  268



>ref|XP_007202419.1| hypothetical protein PRUPE_ppa009714mg [Prunus persica]
 gb|EMJ03618.1| hypothetical protein PRUPE_ppa009714mg [Prunus persica]
Length=281

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 192/276 (70%), Gaps = 23/276 (8%)
 Frame = +1

Query  31   SFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWA  210
            SF+T+ R++L                     EV DE +F Y EG+ KGP++WG++   W 
Sbjct  22   SFFTICRAVL----------------DQPDDEVGDEIKFTYIEGTGKGPKKWGQIDPHWK  65

Query  211  ACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIIN  390
             C NG +QSPID+  +RV++   +  ++++ YKPA ATV+NRGHD+ + W GDAG + IN
Sbjct  66   VCDNGKLQSPIDLLDQRVQVFP-NLGKLKRDYKPAPATVKNRGHDVTVRWKGDAGKININ  124

Query  391  GTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLS  570
            GTD+ L   HWHSPSEHT NG RYALELH++H ++    T++IAVIG++YK G+PD FLS
Sbjct  125  GTDFGLLQCHWHSPSEHTFNGSRYALELHVIHLSS----THKIAVIGIVYKYGRPDPFLS  180

Query  571  KLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTA  750
            KL+ +I S+  ++V+  +GM +  DIK  S+++YRY+GSLTVPPCTEGVIWTI KKVRT 
Sbjct  181  KLLHHIKSVGTKEVD--IGMINSGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTV  238

Query  751  SRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            SR+Q++ LREAVHD  E NARP Q L+ R + L +P
Sbjct  239  SREQVRALREAVHDGFEANARPTQQLDGRPVLLYTP  274



>emb|CDY45963.1| BnaA09g13030D [Brassica napus]
Length=271

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 185/262 (71%), Gaps = 5/262 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            ++L  ++ +   S   +EVEDE EF Y    E GP +WG+LK EW  C  G+MQSPID+ 
Sbjct  12   ILLTIIVTMISCSNAQREVEDESEFSYMRNQENGPEKWGKLKPEWKMCGKGEMQSPIDLM  71

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            H+RV+I++ H   + ++YKP+NAT+RNRGHD+ + +   + S+ IN  +Y L   HWHSP
Sbjct  72   HKRVRIVS-HLGRLTRNYKPSNATLRNRGHDMMVRFEEGSSSIKINNVEYQLHQLHWHSP  130

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDV  612
            SEHTINGRR+ALELHMVH++    L   +AV+ VLYKIG+PD+FL+ L   +S+M D + 
Sbjct  131  SEHTINGRRFALELHMVHES----LNGSLAVVTVLYKIGRPDSFLNLLENKLSAMTDPNE  186

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
            EK +GM DP  IK  S+++YRY+GSLT+PPCT+ VIWT+ K+V+T +R Q+K+LR AVHD
Sbjct  187  EKNIGMIDPRGIKFGSRKYYRYIGSLTIPPCTQNVIWTVVKEVKTVARNQVKILRVAVHD  246

Query  793  YAERNARPLQALNRREIYLLSP  858
            ++  NARP+Q  N R +    P
Sbjct  247  HSNTNARPVQPTNMRVVKFNRP  268



>dbj|BAD09854.1| putative dioscorin class A precursor [Oryza sativa Japonica Group]
 gb|EAZ07303.1| hypothetical protein OsI_29552 [Oryza sativa Indica Group]
 gb|EAZ43045.1| hypothetical protein OsJ_27633 [Oryza sativa Japonica Group]
Length=275

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 184/253 (73%), Gaps = 6/253 (2%)
 Frame = +1

Query  103  PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
            PA+   +E + E EF Y  G EKGP  WG+LK EWA C  G+MQSPID+SHERVK++   
Sbjct  22   PAARAQEETDHEEEFTYISGDEKGPEHWGKLKPEWAQCGAGEMQSPIDLSHERVKLVRDL  81

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRY  462
             + +   Y+ A A++ NRGHDI + + GDAGSV+INGT Y+L+  HWHSP+EH+++GRRY
Sbjct  82   GY-LDDSYRAAEASIVNRGHDIMVRFDGDAGSVVINGTAYYLRQLHWHSPTEHSVDGRRY  140

Query  463  ALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DVEKELGMFDP  639
             +ELHMVH++ ++    + AVIG+LY++G+PD FL K+   +  + D+ D E+++GM DP
Sbjct  141  DMELHMVHESAEK----KAAVIGLLYEVGRPDRFLQKMEPYLKMIADKEDREEKVGMIDP  196

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
               + R+  +YRYMGSLT PPCT+GV+WTI K+VRT SR Q+ LLREAVHD  E NARPL
Sbjct  197  RGARGRASVYYRYMGSLTTPPCTQGVVWTIVKRVRTVSRYQLDLLREAVHDEMENNARPL  256

Query  820  QALNRREIYLLSP  858
            QA+N R+I +  P
Sbjct  257  QAVNNRDISIFRP  269



>emb|CDY45480.1| BnaC09g12980D [Brassica napus]
Length=271

 Score =   290 bits (742),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 185/262 (71%), Gaps = 5/262 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            ++L  ++ +   S   +EVEDE EF Y    E GP +WG+LK EW  C  G+MQSPID+ 
Sbjct  12   ILLTIIVTMISCSNAQREVEDESEFSYMRNQENGPEKWGKLKPEWKMCGKGEMQSPIDLM  71

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            H+RV+I++ H   + ++YKP+NAT+RNRGHD+ + +   + S+ IN  +Y L   HWHSP
Sbjct  72   HKRVRIVS-HLGRLTRNYKPSNATLRNRGHDMMVRFEEGSSSIRINNVEYQLHQLHWHSP  130

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDV  612
            SEHTINGRR+ALELHMVH++    L   +AV+ VLYKIG+PD+FL+ L   +S+M D + 
Sbjct  131  SEHTINGRRFALELHMVHES----LNGSLAVVTVLYKIGRPDSFLNLLENKLSAMTDPNE  186

Query  613  EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHD  792
            EK +GM DP  IK  S+++YRY+GSLT+PPCT+ VIWT+ K+V+T +R Q+K+LR AVHD
Sbjct  187  EKNIGMIDPRGIKFGSRKYYRYIGSLTIPPCTQNVIWTVVKEVKTVARNQVKILRVAVHD  246

Query  793  YAERNARPLQALNRREIYLLSP  858
            ++  NARP+Q  N R +    P
Sbjct  247  HSNTNARPVQPTNMRVVKFNRP  268



>ref|XP_006303231.1| hypothetical protein CARUB_v10012300mg [Capsella rubella]
 gb|EOA36129.1| hypothetical protein CARUB_v10012300mg [Capsella rubella]
Length=276

 Score =   290 bits (742),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/279 (48%), Positives = 192/279 (69%), Gaps = 6/279 (2%)
 Frame = +1

Query  25   LASFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKE  204
            + ++ ++R    V    I  F + +  A++   EVEDE EF+Y E  EKGP RWGELK E
Sbjct  1    MVTYPSIRCIFFVALFSIFTFNVLISSAASSHGEVEDEHEFNYKENDEKGPERWGELKPE  60

Query  205  WAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVI  384
            W  C  G+MQSPID+ +ERV I++ H   + + Y+P+NAT++NRGHDI I++   AG++ 
Sbjct  61   WEMCGKGEMQSPIDLMNERVNIVS-HLGRLNRDYEPSNATLKNRGHDIMIKFEDGAGNIK  119

Query  385  INGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAF  564
            ING +Y L+  HWHSPSEHTINGRR ALELHMVH+  +     ++AV+ VLYKIG+ D F
Sbjct  120  INGFEYELQQLHWHSPSEHTINGRRLALELHMVHEGKN----GRMAVVTVLYKIGRADTF  175

Query  565  LSKLMRNISSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKV  741
            +  L   +  + +  + EK +GM DP+ IK+ S+++YRY GSLT PPCT+ + WT+ +K+
Sbjct  176  IRSLENELEGIAEMEEAEKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNITWTVVRKI  235

Query  742  RTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            RT +RKQ+KLLR AVHD +  NARP+Q  N+R +++  P
Sbjct  236  RTVTRKQVKLLRVAVHDDSNSNARPVQPTNKRTVHMYRP  274



>ref|XP_008244285.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=277

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/276 (50%), Positives = 192/276 (70%), Gaps = 23/276 (8%)
 Frame = +1

Query  31   SFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWA  210
            SF+T+ R++L                     EV +E +F Y EG+ KGP++WG++   W 
Sbjct  22   SFFTICRAVL----------------DQPNDEVGNETKFTYIEGTGKGPKKWGQIDPHWK  65

Query  211  ACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIIN  390
             C NG +QSPID+  +RV++   +  ++++ YKPA ATV+NRGHDI + W GDAG + IN
Sbjct  66   VCDNGKLQSPIDLLDQRVQVFP-NLGKLKRDYKPAPATVKNRGHDITVRWKGDAGKININ  124

Query  391  GTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLS  570
            GTD+ L   HWHSPSEHT NG RYALELH++H ++    T++IAVIG++YK G+PD FLS
Sbjct  125  GTDFGLLQCHWHSPSEHTFNGSRYALELHVIHLSS----THKIAVIGIVYKYGRPDPFLS  180

Query  571  KLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTA  750
            KL+ ++ S+  ++V+  +GM +  DIK  S+++YRY+GSLTVPPCTEGVIWTI KKVRT 
Sbjct  181  KLLHHVKSVGTKEVD--IGMINSGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTV  238

Query  751  SRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            SR+Q++ LREAVHD  E NARP Q L+ R + L +P
Sbjct  239  SREQVRALREAVHDGFEANARPTQQLDGRPVLLYTP  274



>ref|XP_010279581.1| PREDICTED: alpha carbonic anhydrase 4-like [Nelumbo nucifera]
Length=270

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 183/255 (72%), Gaps = 9/255 (4%)
 Frame = +1

Query  103  PASTRA--QEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIIT  276
            P +TRA   E+EDE EF Y EGSEKGP  WGE+   W  C NG+MQSPID+  +RV++++
Sbjct  21   PITTRAAASELEDEHEFTYEEGSEKGPEHWGEIDPHWRVCGNGEMQSPIDLLDKRVEVVS  80

Query  277  THHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGR  456
                ++++ Y+PA A V NRGHDI IEW GDAG + IN TDY+LK  HWHSPSEHT N  
Sbjct  81   GLG-KLKRDYRPAPAAVMNRGHDIMIEWKGDAGKININRTDYYLKQCHWHSPSEHTFNKS  139

Query  457  RYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFD  636
            RY LELH+VH N+    + +IAVIG+ YK G+ D FL++L+    S+    VE ++G+ +
Sbjct  140  RYNLELHLVHINS----SGRIAVIGITYKYGRHDPFLARLIPYFGSV--GSVENDVGIIN  193

Query  637  PSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARP  816
            P DIK  S+++YRYMGSLTVPPCTEGVIWT+ KKVRTAS +Q++ +R+AVHD  E+NARP
Sbjct  194  PGDIKFGSRKYYRYMGSLTVPPCTEGVIWTMVKKVRTASEEQVRAIRDAVHDGFEQNARP  253

Query  817  LQALNRREIYLLSPA  861
             Q  N R + L +P 
Sbjct  254  TQQQNGRTVLLYTPG  268



>ref|XP_010269790.1| PREDICTED: alpha carbonic anhydrase 4-like [Nelumbo nucifera]
Length=274

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 175/247 (71%), Gaps = 7/247 (3%)
 Frame = +1

Query  118  AQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMR  297
            A E EDE EF Y EGSE+GP  WG+++ +W  C  G+MQSPID+ HERV++ +     ++
Sbjct  28   ATEQEDEHEFTYKEGSERGPEHWGDIQSDWKICKKGEMQSPIDLLHERVQVFSGLG-RLK  86

Query  298  KHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELH  477
            + Y+PA A  +NRGHDI IEW GDAG + ING +Y LK  HWHSPSEHT NG RY LELH
Sbjct  87   RDYQPAPAAAKNRGHDIMIEWKGDAGKININGINYSLKQCHWHSPSEHTFNGSRYKLELH  146

Query  478  MVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMR  657
            MVH N+       IAVIG+ YK G+ D FL K++ +I S+     EK+LG+ +P DIK  
Sbjct  147  MVHINS----CGGIAVIGITYKYGRHDHFLDKIIASIGSVGSE--EKDLGIINPGDIKFG  200

Query  658  SKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRR  837
            S+++YRYMGSLTVPPCTEGVIWTI KKVRT SR+Q++ LR+AV D  E NARP+Q  N R
Sbjct  201  SRKYYRYMGSLTVPPCTEGVIWTIEKKVRTVSREQVRALRDAVDDGYEENARPIQQKNGR  260

Query  838  EIYLLSP  858
             + L  P
Sbjct  261  TVLLYRP  267



>ref|XP_009776894.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3, partial [Nicotiana sylvestris]
Length=260

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 187/255 (73%), Gaps = 6/255 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            L   F+        R+ EV+DE EF Y E SEKGP  WGE+  EW+ C++G +QSPID+ 
Sbjct  11   LFFSFLFLTSALLARSHEVDDESEFTYDEESEKGPSHWGEIHSEWSMCNSGKLQSPIDLL  70

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERV+I++ H   + + YKP+N+T+ NRGHD+ + W G AG + INGT Y L  AHWHSP
Sbjct  71   NERVEIVS-HLGRLHRSYKPSNSTLLNRGHDMMLRWEGGAGHIKINGTQYQLNQAHWHSP  129

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-DRD  609
            SEHTINGRR+ LE+H+VH++ D     + AV+G++YKIG+ D+FLS +  ++ ++   + 
Sbjct  130  SEHTINGRRFDLEVHLVHESND----GKTAVVGIMYKIGRADSFLSMIEDDLKALAHTKG  185

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
            VE+ +G+ DP  +K+ S+++YRY+GSLTVPPCT+ V+WTI +KVRT +R+Q+KL+REAVH
Sbjct  186  VERNIGVIDPKQVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTREQMKLIREAVH  245

Query  790  DYAERNARPLQALNR  834
            D +E N+RP+QA N+
Sbjct  246  DESETNSRPVQAANK  260



>ref|XP_004303634.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=286

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/273 (51%), Positives = 187/273 (68%), Gaps = 11/273 (4%)
 Frame = +1

Query  55   ILVTGSLILC----FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            +L+ G+LIL     F +    A   + EV DE  F Y EG+ KGP++WG++   W AC N
Sbjct  15   LLILGALILSSHPSFFIICRAALDDSGEVGDELPFAYVEGTGKGPKKWGDIDPHWKACDN  74

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G MQSPID+   RV++   +  ++++ YKP+ ATVRNRGHDI + W  DAG + IN TDY
Sbjct  75   GKMQSPIDLLDSRVQVFP-NLGKLKRDYKPSPATVRNRGHDITVRWKKDAGKININSTDY  133

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
             L   HWHSP+EHT NG RYALELH++H ++      +IAVIG++YK G+PD FLSKL  
Sbjct  134  NLVQCHWHSPAEHTFNGSRYALELHIIHTSS----IGKIAVIGIVYKYGRPDPFLSKLFH  189

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
            +I+S+   +V+  +G+ +P DIK  S+++YRY+GSLTVPPCTEGVIWTI KKVRT S +Q
Sbjct  190  HINSVGKEEVD--IGVINPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSMEQ  247

Query  763  IKLLREAVHDYAERNARPLQALNRREIYLLSPA  861
            ++ +RE VHD  E NARP Q  N R + L +P 
Sbjct  248  VRAIRETVHDGYEANARPTQQFNGRPVLLYTPG  280



>ref|XP_002314288.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
 gb|EEE88243.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
Length=277

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 183/249 (73%), Gaps = 10/249 (4%)
 Frame = +1

Query  130  EDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYK  309
            EDE +F+Y    EKGP  WG +  EW ACSNG MQSPID+  ERV +++ H   + + YK
Sbjct  34   EDEADFNYDPNGEKGPANWGRIHPEWGACSNGSMQSPIDLLSERVDVVS-HLGRLSRSYK  92

Query  310  PANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQ  489
            PANAT+RNRGHD+ ++W G AGS+ INGT+Y LK  HWHSPSEHTING+R ALE+HMVH+
Sbjct  93   PANATLRNRGHDMMLKWEGAAGSIEINGTEYLLKQCHWHSPSEHTINGKRLALEVHMVHE  152

Query  490  NTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI---DRDVEKELGMFDPSDIKMRS  660
            + D     ++AV+G++Y IG+PD+FLS L + + S+    +RD     G+ DP +IK+ S
Sbjct  153  SLD----GKVAVVGIMYMIGRPDSFLSSLTKQLQSVAGTYERDTVA--GVVDPRNIKIGS  206

Query  661  KRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRRE  840
            +++YRY+GSLT+PPCTE V+WTI +KVRTA+R+Q+++LR AVHD ++ NAR +Q +N R 
Sbjct  207  RKYYRYIGSLTIPPCTENVLWTIVRKVRTATREQVRMLRVAVHDESDTNARQIQPINSRT  266

Query  841  IYLLSPAGK  867
            + L  P  K
Sbjct  267  VKLFRPEDK  275



>ref|XP_009367040.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 194/270 (72%), Gaps = 7/270 (3%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            ++++  S ++  VL L+     + EVEDEREF+Y E SEKGP RWGE+++EW+ CS G M
Sbjct  6    TLILFCSFLIVLVL-LNSCQASSDEVEDEREFNYKEDSEKGPARWGEIRQEWSMCSKGSM  64

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+  +RV++++ +   ++  Y+P NAT++NRGHD+ ++W  DAG + +NGT Y LK
Sbjct  65   QSPIDLLDDRVEVVS-NFGILQGSYRPCNATLKNRGHDMMLKWEADAGFIQLNGTLYKLK  123

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHS SEHTING+R+ LE H+VH+++    T +IAV G+LYKIG PD FLS +M +++
Sbjct  124  QCHWHSSSEHTINGKRFDLEAHLVHESS----TGKIAVTGILYKIGAPDPFLSSMMDSLA  179

Query  592  SMIDRDVEKEL-GMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
             +     E+E+ G  DP  IK RS ++YRY+GSLT+PPCT+ V WTI+++VRT S++Q+K
Sbjct  180  EVSGTSEEEEVVGTVDPKKIKTRSTKYYRYIGSLTIPPCTQNVTWTIDQEVRTVSKEQVK  239

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSP  858
             LR AVHD ++ NARP+Q  N R + +  P
Sbjct  240  FLRVAVHDDSKTNARPVQQRNGRVVQVYRP  269



>ref|XP_009782909.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana sylvestris]
Length=270

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 190/269 (71%), Gaps = 6/269 (2%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
            +  T  L + F+        R+ EV+DE EF Y E SE GP +WG++  EW+ C+ G +Q
Sbjct  3    MAATKILFISFLFLSSAFLARSAEVDDESEFSYDEKSENGPAKWGKIHPEWSTCNTGKLQ  62

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKS  414
            SPID+ ++RV++++ +  ++  HYKP+NAT+ NRGHD+ + W G  G + INGT Y LK 
Sbjct  63   SPIDLLNKRVEVVS-NLGKLCTHYKPSNATLLNRGHDMMLRWEGGGGYLKINGTKYQLKQ  121

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISS  594
             HWH+PSEHTING+R+ LE H+VH++ D     + AVIG++YKIG+PD+FLS + +++ +
Sbjct  122  CHWHTPSEHTINGKRFNLEAHLVHESDD----GKTAVIGIMYKIGRPDSFLSMIEKDLKA  177

Query  595  MID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
            +   + VE+ +G  DP  IKM  K +YRY+GSLTVPPCTE V+WTI++KV+T +++Q+KL
Sbjct  178  LASTKGVERAIGTIDPKLIKMDGKTYYRYIGSLTVPPCTEDVVWTIDRKVKTITKRQMKL  237

Query  772  LREAVHDYAERNARPLQALNRREIYLLSP  858
            +REAVHD +E NARP Q +NRR I    P
Sbjct  238  IREAVHDESETNARPAQPVNRRPIKFYKP  266



>ref|XP_008360674.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 178/247 (72%), Gaps = 6/247 (2%)
 Frame = +1

Query  118  AQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMR  297
            + EV DE  F Y EG+ KGP++WGE+   W  C  G +QSPID+  +RV++   H  +++
Sbjct  33   SDEVGDETPFTYLEGTGKGPKKWGEIDPHWKVCDTGKLQSPIDLLDQRVQVFP-HLGKLK  91

Query  298  KHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELH  477
            + YKPA ATV+NRGHDI + W+GDAG + INGTDY L   HWHSPSEHT NG RYALE H
Sbjct  92   RGYKPAPATVKNRGHDITMRWNGDAGKININGTDYRLLQCHWHSPSEHTFNGSRYALEFH  151

Query  478  MVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMR  657
            +VH ++    T +IAVIG++YK G+PD  LSKL  +I S +  + E ++G+ +P DIK  
Sbjct  152  VVHLSS----TGKIAVIGIVYKYGRPDPLLSKLFHHIKS-VGIEEEVDIGIINPGDIKFG  206

Query  658  SKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRR  837
            S+++YRY+GSLTVPPCTEGVIWTI KKVRT SR+Q+  LREAVHD  E NARP Q L+ R
Sbjct  207  SRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSREQVHALREAVHDGFEMNARPTQELDGR  266

Query  838  EIYLLSP  858
             + L +P
Sbjct  267  PVLLYTP  273



>ref|XP_009363226.1| PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]
Length=280

 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 180/258 (70%), Gaps = 7/258 (3%)
 Frame = +1

Query  85   FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERV  264
            F      A   + EV DE  F Y EG+ KGP++WG++  +W  C NG MQSPI++  +RV
Sbjct  23   FFTICSAALEDSDEVGDETAFTYLEGTGKGPKKWGQIDPQWKVCDNGKMQSPINLLDQRV  82

Query  265  KIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHT  444
            K+      ++++ YKPA A V+NRGHDI + W+GDAG + INGTDY L   HWHSPSEHT
Sbjct  83   KVFPKLG-KLKREYKPAPAIVKNRGHDITMRWNGDAGKIKINGTDYRLLQCHWHSPSEHT  141

Query  445  INGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKEL  624
             NG RYALE H+VH ++    T +IAVIG++YK G+PD  LSKL  +I S+   +V+  +
Sbjct  142  FNGSRYALEFHIVHVSS----TRKIAVIGIVYKYGRPDPLLSKLFHHIKSVGKEEVD--I  195

Query  625  GMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAER  804
            G+ +P DIK  S+++YRY+GSLTVPPCTEGVIWTI KKVRT SR+Q+  LREAVHD  E 
Sbjct  196  GIINPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSREQVHALREAVHDGYEA  255

Query  805  NARPLQALNRREIYLLSP  858
            NARP Q L+ R + L +P
Sbjct  256  NARPTQELDGRPVLLYTP  273



>ref|XP_010475599.1| PREDICTED: alpha carbonic anhydrase 7-like [Camelina sativa]
Length=277

 Score =   288 bits (736),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/277 (50%), Positives = 188/277 (68%), Gaps = 8/277 (3%)
 Frame = +1

Query  37   YTMRRSILVTGSLILCFVL--FLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWA  210
            Y   R I      I  F +   +  A++   EVEDE EF+Y +  EKGP RWGELK EW 
Sbjct  4    YPSIRCIFFVALFISIFTINVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGELKPEWE  63

Query  211  ACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIIN  390
             C  G+MQSPID+ +ERV II +H   + + Y+P+NAT++NRGHDI +++   AGS+ IN
Sbjct  64   LCGKGEMQSPIDLMNERV-IIGSHLGRLNRDYQPSNATLKNRGHDIMLKFEDGAGSIKIN  122

Query  391  GTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLS  570
            G  Y L+  HWHSPSEHT+NGRR+ALELHMVH+        ++AV+ VLYKIG+ D F+ 
Sbjct  123  GFQYELQQLHWHSPSEHTVNGRRFALELHMVHEGKK----GRMAVVTVLYKIGRADTFIR  178

Query  571  KLMRNISSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRT  747
             L   +  + +  D EK +G+ DP+ IK+ S+++YRY GSLT PPCT+ V WT+ KKVRT
Sbjct  179  SLENELEGIAEMEDAEKNVGVIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWTVVKKVRT  238

Query  748  ASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
             +RKQ+KLLR AVHD +  NARP+Q +N+R +++  P
Sbjct  239  VTRKQVKLLRVAVHDDSNSNARPVQPINKRTVHMYRP  275



>ref|XP_010036307.1| PREDICTED: alpha carbonic anhydrase 4-like [Eucalyptus grandis]
 gb|KCW47833.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=299

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 185/270 (69%), Gaps = 7/270 (3%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
             IL +  +     L L  +S    EV+DE  F Y EG+ KGP+ WG++   W AC  G +
Sbjct  31   GILRSSFVFFALGLLLTLSSASESEVDDETPFTYIEGTGKGPKEWGQIDPRWQACGMGKL  90

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+ +ERV++   +  ++++ YKPA A VRNRGHDI + W GDAG + INGT Y L 
Sbjct  91   QSPIDLLNERVQVFP-NLGKLKRDYKPAPAIVRNRGHDITVMWKGDAGKININGTYYKLL  149

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHT NG RY LELHMVH ++      +IAVIG++YK G+PD FL+KL+ +I+
Sbjct  150  QCHWHSPSEHTFNGSRYDLELHMVHLSSH----GEIAVIGIVYKYGRPDPFLTKLLEHIT  205

Query  592  SMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
             +   D +  LG+ +P  IK  S++++RY+GSLTVPPCTEGV+WTI +KVRT SRKQ++ 
Sbjct  206  VVGKEDTD--LGVINPGIIKFGSRKYFRYIGSLTVPPCTEGVVWTIVRKVRTVSRKQVEA  263

Query  772  LREAVHDYAERNARPLQALNRREIYLLSPA  861
            LREAVHD  E NARP Q L+ R ++L +P 
Sbjct  264  LREAVHDGYEANARPTQQLDGRAVWLYTPG  293



>ref|XP_003541987.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
 gb|KHN21504.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=274

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 192/268 (72%), Gaps = 8/268 (3%)
 Frame = +1

Query  55   ILVTGSLILC-FVLFLHPA-STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            +L T  LI C F  FL  +    +QEVEDE EF Y E SE GP  WG++  EW+ C+NG 
Sbjct  1    MLATLVLICCLFTAFLFLSLPVMSQEVEDESEFSYDEKSENGPSNWGDIHPEWSLCNNGS  60

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFL  408
            MQSPID+ +ERV+I++ H   ++ +Y+P+NAT++NRGHDI +EW   AG + IN T+Y L
Sbjct  61   MQSPIDLLNERVQIVS-HLGRLQMNYQPSNATIKNRGHDIKLEWVAGAGYLQINETEYVL  119

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            K  HWHSPSEHTI+G+R  LELHMVH+      + Q AVIG+LYKIG PD+FLS L  ++
Sbjct  120  KQCHWHSPSEHTIDGKRLDLELHMVHETP----SGQSAVIGMLYKIGSPDSFLSSLTDHL  175

Query  589  SSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
             ++ D  + E+ +G+ DP  IK+  K++YRY+GSLT+PPCTE V WTI +K+++ S++Q+
Sbjct  176  KAISDTTEAERVVGVVDPRQIKIFYKQYYRYIGSLTIPPCTENVSWTIIRKIQSVSKEQV  235

Query  766  KLLREAVHDYAERNARPLQALNRREIYL  849
            +LLR AVHD ++ NARPLQ +N R + L
Sbjct  236  RLLRVAVHDESDTNARPLQLINNRLVKL  263



>ref|XP_006354411.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=295

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/240 (59%), Positives = 176/240 (73%), Gaps = 8/240 (3%)
 Frame = +1

Query  142  EFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANA  321
            +FDY E S+KGP +WG+L KEW  C NG MQSPID+S  RVK +    H   KHYKP N+
Sbjct  57   KFDYNERSKKGPSKWGDLNKEWETCKNGKMQSPIDISSCRVKNMRKLGH--MKHYKPTNS  114

Query  322  TVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQ  501
            T+RNRGHDI++ WHGDAGS+++N T+Y L   HWHSPSEHTINGRRYALELHMVHQ   +
Sbjct  115  TIRNRGHDISLHWHGDAGSILMNNTNYSLIQIHWHSPSEHTINGRRYALELHMVHQ---E  171

Query  502  NLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD-VEKELGMFDPSDI--KMRSKRHY  672
             +  ++ V  VLYK GKPD F+  L  +I SMID++  E+ LGM +P  I   +  + +Y
Sbjct  172  QVDKKVVVNAVLYKFGKPDPFIFILKGHILSMIDQEGEERSLGMINPKYITNNIYRESYY  231

Query  673  RYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLL  852
             Y GSLT+PPCTEGV W +NKKV T SR Q+ LLR+AVHD+AERNARP+Q  N+R+I LL
Sbjct  232  EYKGSLTIPPCTEGVTWLVNKKVETVSRFQVNLLRKAVHDHAERNARPVQPHNKRKIQLL  291



>ref|XP_002278828.1| PREDICTED: alpha carbonic anhydrase 4 isoform X1 [Vitis vinifera]
 emb|CBI33384.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 186/252 (74%), Gaps = 6/252 (2%)
 Frame = +1

Query  106  ASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHH  285
            A++   E EDE +F Y E + KGP+RWG++  +W AC NG MQSPID+   RV+++  + 
Sbjct  25   ATSSESETEDETQFSYIEDTGKGPKRWGQINPDWKACGNGAMQSPIDLLDARVQVLP-NL  83

Query  286  HEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYA  465
             ++++ YKPA A V+NRGHD+ +EW G AG + INGT + L+  HWHSPSEHT NG RY 
Sbjct  84   EKLKRDYKPAPAVVKNRGHDVTVEWKGYAGKININGTYFKLQQCHWHSPSEHTFNGSRYN  143

Query  466  LELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSD  645
            LELH++H ++D+    +IAVIG+ YK G+ D FL++++R+I S+   + EKELG+ +P D
Sbjct  144  LELHVIHLSSDE----KIAVIGITYKYGRADPFLTRMLRHIDSLPVGE-EKELGIVNPGD  198

Query  646  IKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQA  825
            IK  S+++YRY+GSLTVPPCTEGVIWTI+KKVRTA+R+Q++ LR+AV D  E NARP Q 
Sbjct  199  IKFGSRKYYRYIGSLTVPPCTEGVIWTISKKVRTATREQVRALRKAVQDGYEANARPSQE  258

Query  826  LNRREIYLLSPA  861
            ++ R + L  P+
Sbjct  259  VDGRTVLLYKPS  270



>ref|XP_008443579.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=277

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 189/270 (70%), Gaps = 6/270 (2%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHP----ASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNG  225
            L   S  L F+ FL      AS  + ++++E EFDY  GS KGP +WG +K+EWA C+ G
Sbjct  4    LSQSSFTLAFLTFLTSTLLWASVISHQLQEECEFDYIGGSNKGPTKWGAIKREWANCNYG  63

Query  226  DMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYF  405
             MQSPID+S + ++++ +   ++ K Y P  A ++NRGHD+++ W G+AGS+ INGT YF
Sbjct  64   KMQSPIDLSTKTIQVVNSMG-QLNKRYIPFGAILKNRGHDVSVGWEGNAGSIEINGTQYF  122

Query  406  LKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRN  585
            LK  HWHSPSEHTING+RY LELH+VHQ+++ N    +AV+  LY+IG PD+FLSK+ R 
Sbjct  123  LKQTHWHSPSEHTINGKRYDLELHVVHQSSNPNAKYPLAVVSFLYEIGPPDSFLSKVSRE  182

Query  586  ISSMI-DRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
            I  +   +  + +LG  +P++I+     +YRY+GSLTVPPCTEGVIW+INK++ T S++Q
Sbjct  183  IKELSHGKKDQMKLGSINPNEIRRGGINYYRYVGSLTVPPCTEGVIWSINKQIGTVSQEQ  242

Query  763  IKLLREAVHDYAERNARPLQALNRREIYLL  852
            + LLR  V   AE+NARP+Q LN R++  L
Sbjct  243  VMLLRSVVEHCAEKNARPIQPLNGRQVVQL  272



>ref|XP_006659489.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Oryza brachyantha]
Length=276

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 184/253 (73%), Gaps = 6/253 (2%)
 Frame = +1

Query  103  PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
            PA+   +E E E EF Y  G EKGP  WG++K EWA C  G+MQSPID+SHERV ++   
Sbjct  23   PAARAQEETEREDEFTYTSGEEKGPEHWGKIKPEWAQCGAGEMQSPIDLSHERVTLVRDL  82

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRY  462
             + +   Y+ A A++ NRGHDI + + GDAGSV+INGT Y+L+  HWHSP+EH+++GRRY
Sbjct  83   GY-LDHSYRAAEASIVNRGHDIMVRFDGDAGSVVINGTAYYLRQLHWHSPTEHSVDGRRY  141

Query  463  ALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DVEKELGMFDP  639
             +ELHMVH++ ++    + AVIG+LY++G+PD FL K+   +  + D+ D E+++G+ DP
Sbjct  142  DMELHMVHESAEK----KAAVIGLLYEVGRPDRFLQKMEPYLRMIADKEDKEEKVGVIDP  197

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
               + R+  +YRYMGSLT PPCTEGVIWTI K+VRT S+ Q++LLREAVHD  E NARPL
Sbjct  198  RGARGRASVYYRYMGSLTTPPCTEGVIWTIVKRVRTVSKYQLELLREAVHDNMENNARPL  257

Query  820  QALNRREIYLLSP  858
            QA+N R++ +  P
Sbjct  258  QAVNNRDVSIFRP  270



>gb|KFK43125.1| hypothetical protein AALP_AA1G083600 [Arabis alpina]
Length=272

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 188/263 (71%), Gaps = 6/263 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            LI+  V+ L  A+T   EVEDE EF+Y +  EKGP RWG+LK EW  C  G++QSPID+ 
Sbjct  13   LIISTVVSLSNAATSHGEVEDEHEFNYKKNDEKGPERWGKLKPEWEMCGKGEIQSPIDLM  72

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERV I++ H   + ++YKP+NAT++NRGHDI + +   AGS+ ING+ Y L+  HWHSP
Sbjct  73   NERVNIVS-HLGRLNRNYKPSNATLKNRGHDIMLRFENGAGSIKINGSQYELQQLHWHSP  131

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM-IDRD  609
            SEH++NGRR+ALELHMVH+  +     ++AV+ VLYKIG+ D FL  L + +  + +  +
Sbjct  132  SEHSVNGRRFALELHMVHEAKN----GRMAVVTVLYKIGRADTFLGSLEKELEGIAVLEE  187

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             EK  G+ DP  IK+ S+++YRY+GSLT PPCT+ V W++ +KVRT +RKQ++LLR AVH
Sbjct  188  AEKNAGIIDPKKIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKVRTVTRKQVRLLRVAVH  247

Query  790  DYAERNARPLQALNRREIYLLSP  858
            D  + NARP+Q +N+R + L  P
Sbjct  248  DDQDTNARPVQPINKRMVKLYRP  270



>ref|XP_009356885.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/261 (51%), Positives = 189/261 (72%), Gaps = 7/261 (3%)
 Frame = +1

Query  70   SLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            S +   VL L+     ++EVED+REF+Y E SEKGP RWGE+++EW+ CS G MQSPID+
Sbjct  12   SFLFALVL-LNSRHATSEEVEDQREFNYEEDSEKGPLRWGEIRQEWSMCSKGSMQSPIDL  70

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            S +RV++++ H   ++ +Y+P NAT++NRGHD+ ++W  DAG +++NGT Y LK  HWH+
Sbjct  71   SDDRVELVS-HLGILKSNYRPCNATLKNRGHDMMLKWETDAGFILLNGTLYKLKQCHWHA  129

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
             SEHTING+R+ LE+H+VH++     T  IAV GVLY+IG PD FLS +M  ++ + D  
Sbjct  130  SSEHTINGKRFDLEVHLVHESA----TGNIAVTGVLYRIGAPDPFLSSIMDYLADVSDTT  185

Query  610  VEKE-LGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
             E+E +GM DP  +K  S ++YRY+GSLT PPCT+ VIWTI ++V T S +Q+K LR AV
Sbjct  186  EEEEVVGMVDPRQMKTSSTKYYRYIGSLTTPPCTQNVIWTIAREVSTVSEEQVKSLRVAV  245

Query  787  HDYAERNARPLQALNRREIYL  849
            HD ++ NARP+Q  NRR + L
Sbjct  246  HDDSDTNARPVQPRNRRIVQL  266



>ref|XP_008364026.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=246

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 175/242 (72%), Gaps = 6/242 (2%)
 Frame = +1

Query  133  DEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKP  312
            DE  F Y EG+ KGP++WGE+   W  C  G +QSPID+  +RV++   H  ++++ YKP
Sbjct  4    DETPFTYLEGTGKGPKKWGEIDPHWKVCDTGKLQSPIDLLDQRVQVFP-HLGKLKRGYKP  62

Query  313  ANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQN  492
            A ATV+NRGHDI + W+GDAG + INGTDY L   HWHSPSEHT NG RYALE H+VH +
Sbjct  63   APATVKNRGHDITMRWNGDAGKININGTDYRLLQCHWHSPSEHTFNGSRYALEFHVVHLS  122

Query  493  TDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHY  672
            +    T +IAVIG++YK G+PD  LSKL  +I S +  + E ++G+ +P DIK  S+++Y
Sbjct  123  S----TGKIAVIGIVYKYGRPDPLLSKLFHHIKS-VGIEEEVDIGIINPGDIKFGSRKYY  177

Query  673  RYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLL  852
            RY+GSLTVPPCTEGVIWTI KKVRT SR+Q+  LREAVHD  E NARP Q L+ R + L 
Sbjct  178  RYIGSLTVPPCTEGVIWTIVKKVRTVSREQVHALREAVHDGFEMNARPTQELDGRPVLLY  237

Query  853  SP  858
            +P
Sbjct  238  TP  239



>ref|NP_172287.1| alpha carbonic anhydrase 7 [Arabidopsis thaliana]
 sp|Q8L817.1|ATCA7_ARATH RecName: Full=Alpha carbonic anhydrase 7; Short=AtaCA7; Short=AtalphaCA7; 
AltName: Full=Alpha carbonate dehydratase 7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM67440.1| putative storage protein [Arabidopsis thaliana]
 gb|AEE28240.1| alpha carbonic anhydrase 7 [Arabidopsis thaliana]
Length=275

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 181/246 (74%), Gaps = 6/246 (2%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            EVEDEREF+Y +  EKGP RWGELK EW  C  G+MQSPID+ +ERV I++ H   + + 
Sbjct  33   EVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSPIDLMNERVNIVS-HLGRLNRD  91

Query  304  YKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            Y P+NAT++NRGHDI +++   AG++ ING +Y L+  HWHSPSEHTINGRR+ALELHMV
Sbjct  92   YNPSNATLKNRGHDIMLKFEDGAGTIKINGFEYELQQLHWHSPSEHTINGRRFALELHMV  151

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFDPSDIKMRS  660
            H+  ++    ++AV+ VLYKIG+ D F+  L + +  + +  + EK +GM DP+ IK+ S
Sbjct  152  HEGRNR----RMAVVTVLYKIGRADTFIRSLEKELEGIAEMEEAEKNVGMIDPTKIKIGS  207

Query  661  KRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRRE  840
            +++YRY GSLT PPCT+ V W++ +KVRT +RKQ+KLLR AVHD A  NARP+Q  N+R 
Sbjct  208  RKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVHDDANSNARPVQPTNKRI  267

Query  841  IYLLSP  858
            ++L  P
Sbjct  268  VHLYRP  273



>gb|KFK32339.1| hypothetical protein AALP_AA6G228800 [Arabis alpina]
Length=271

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 189/268 (71%), Gaps = 12/268 (4%)
 Frame = +1

Query  76   ILCFVLFL------HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            I CF L L        A +  +EVEDER+F Y +  E GP +WG+LK EW  C  G++QS
Sbjct  6    IQCFFLVLLTIVSCSSAQSNLREVEDERDFSYEQNKETGPEKWGKLKPEWKMCGKGELQS  65

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PID++++RVK++  H   + K YKP+NAT++NRGHD+ + +  ++GS+ INGT+Y L   
Sbjct  66   PIDLTNDRVKLVY-HLGRLTKDYKPSNATLKNRGHDMMLRFEEESGSIKINGTEYQLLQL  124

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHTINGRR+ALELHMVH    +++   +AV+ +LYKIG+PD+FL  +   + ++
Sbjct  125  HWHSPSEHTINGRRFALELHMVH----ESINGTMAVLTILYKIGRPDSFLRLMENKLGAV  180

Query  598  IDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLL  774
             D+ + EK +GM DP  I++ S++ YRY+GSLT PPCT+ V WTI KK+RT +++QI+LL
Sbjct  181  TDQHEGEKNVGMIDPQKIEIGSRKFYRYIGSLTTPPCTQNVTWTIVKKIRTVTKEQIRLL  240

Query  775  REAVHDYAERNARPLQALNRREIYLLSP  858
            R AVHD +  NARP+Q  N R ++L  P
Sbjct  241  RVAVHDDSNTNARPVQPTNMRVVHLFRP  268



>emb|CDP14170.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   285 bits (728),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 178/245 (73%), Gaps = 6/245 (2%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            EVEDE  F Y EG+ KGP+ WG +  +W  C  G +QSPID+  ERV+I      ++++ 
Sbjct  33   EVEDESPFTYEEGTGKGPKNWGHIDPQWQVCDKGKLQSPIDLLDERVQIFPGLG-KLKRG  91

Query  304  YKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            YKPA A ++NRGHDI++EW GDAG ++ NGTDY +   HWHSPSEHT+NG R+ LELH+V
Sbjct  92   YKPAAAVLKNRGHDISVEWRGDAGKIVANGTDYKVLQCHWHSPSEHTLNGTRHNLELHIV  151

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSK  663
            H+++    +  IAV+G+LYKIG+PD+FL+KL+ +I    + D   +LG+  P DIK  S+
Sbjct  152  HRSS----SGGIAVVGILYKIGRPDSFLAKLLHHIKRADEGDA-IDLGVVSPGDIKFGSR  206

Query  664  RHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREI  843
            ++YRY+GSLTVPPCTEGV+WTI KKVRT SR+QI+ +R+ VHD  E NARPLQ  N R +
Sbjct  207  KYYRYIGSLTVPPCTEGVLWTIVKKVRTVSREQIRAIRDVVHDGFEANARPLQQENGRPV  266

Query  844  YLLSP  858
            YL  P
Sbjct  267  YLYRP  271



>ref|XP_008359452.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   285 bits (729),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 192/270 (71%), Gaps = 7/270 (3%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            ++++  S ++  VL L+     + EVEDEREF+Y E SEKGP RWGE+++EW+ CS G M
Sbjct  6    TLILFCSFLIVLVL-LNSCQASSDEVEDEREFNYXEDSEKGPARWGEIRQEWSMCSKGSM  64

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+  +RV++++ +   ++  Y+P NAT++NRGHD+ ++W  DAG + +NGT Y LK
Sbjct  65   QSPIDLLDDRVEVVS-NFGILQGSYRPCNATLKNRGHDMMLKWEADAGFIQLNGTLYKLK  123

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHS SEHTING+R+ LE H+VH+++    T +IAV G+LYKIG PD FLS +M +++
Sbjct  124  QCHWHSSSEHTINGKRFDLEAHLVHESS----TGKIAVTGILYKIGAPDPFLSSMMDSLA  179

Query  592  SMIDRDVEKE-LGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
             +     E+E +G  DP  IK RS ++YRY+GSLT+PPCT+ V WTI ++VRT S +Q++
Sbjct  180  EVSGTSEEEEAVGTVDPKKIKTRSTKYYRYIGSLTIPPCTQNVTWTIVQEVRTVSEEQVE  239

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSP  858
             LR AVHD ++ NARP+Q  N R + +  P
Sbjct  240  FLRVAVHDDSKTNARPVQPRNGRVVQVYRP  269



>ref|XP_010458032.1| PREDICTED: alpha carbonic anhydrase 7 [Camelina sativa]
Length=276

 Score =   285 bits (728),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/279 (48%), Positives = 188/279 (67%), Gaps = 6/279 (2%)
 Frame = +1

Query  25   LASFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKE  204
            + S+ + R    V    I    + +  A++   EVEDE EF+Y +  EKGP RWGELK E
Sbjct  1    MVSYPSTRCIFFVALFSIFTINVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGELKPE  60

Query  205  WAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVI  384
            W  C  G+MQSPID+ +ERV I  +H   + + Y+P+NAT++NRGHDI +++   AGS+ 
Sbjct  61   WEMCGKGEMQSPIDLMNERVNI-GSHLGRLNRDYQPSNATLKNRGHDIMLKFEDGAGSIK  119

Query  385  INGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAF  564
            ING  Y L+  HWHSPSEHT+NGRR+ALELHMVH+        ++AV+ VLYKIG+ D F
Sbjct  120  INGFQYELQQLHWHSPSEHTVNGRRFALELHMVHEGKK----GRMAVVTVLYKIGRADTF  175

Query  565  LSKLMRNISSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKV  741
            +  L   +  + +  + EK +GM DP+ IK+ S+++YRY GSLT PPCT+ V WT+ +KV
Sbjct  176  IRSLENELEGIAEMEEAEKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWTVVRKV  235

Query  742  RTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            RT +RKQ+KLLR AVHD +  NARP+Q  N+R +++  P
Sbjct  236  RTVTRKQVKLLRVAVHDDSNSNARPVQPTNKRTVHMYRP  274



>ref|XP_009148224.1| PREDICTED: alpha carbonic anhydrase 7-like [Brassica rapa]
Length=272

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 189/264 (72%), Gaps = 7/264 (3%)
 Frame = +1

Query  73   LILCFVLF-LHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            + + F LF    A+T   EVEDEREF+Y +  +KGP RWGE+K EW  C  G++QSPIDM
Sbjct  12   VFIIFTLFSFSTAATSNGEVEDEREFNYKKNDDKGPDRWGEIKPEWEMCGKGELQSPIDM  71

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
             +ERVKI++ H   + + Y+ +NAT++NRGHDI +++   AGS+ ING  Y L+  HWHS
Sbjct  72   MNERVKIVS-HLGRLIRDYEASNATIKNRGHDIMLKFEDGAGSIKINGFQYELQQLHWHS  130

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-R  606
            PSEHT+NGRR+ALELHMVH+  +     ++AV+ VLYKIG+ D F+  L + + ++ D  
Sbjct  131  PSEHTVNGRRFALELHMVHEGKN----GRMAVVTVLYKIGRADTFIRSLEKELEAITDLD  186

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            D EK + M DP  IK+ S+++YRY+GSLT PPCT+ V W++ +K+RT +R+Q++LLR AV
Sbjct  187  DAEKHVRMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAV  246

Query  787  HDYAERNARPLQALNRREIYLLSP  858
            HD +  NARP+Q +N+R ++L  P
Sbjct  247  HDDSLTNARPVQPINKRMVHLYRP  270



>ref|XP_008226047.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Prunus mume]
Length=275

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/271 (49%), Positives = 192/271 (71%), Gaps = 7/271 (3%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            ++++  S ++  V  L   +T + EVEDEREF+Y + SEKGP RWGE+++EW+ C+ G M
Sbjct  6    TLILVCSFLIVLVWLLSCQAT-SDEVEDEREFNYEDDSEKGPARWGEIRQEWSMCNKGSM  64

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+  +RV++++     ++  Y+P NAT++NRGHDI ++W  DAG + INGT Y LK
Sbjct  65   QSPIDLLDDRVEVVSDLGR-LQGSYRPCNATLKNRGHDIMLKWEADAGFIRINGTLYQLK  123

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHT+N + + LE+H++HQ+     T +IAV G+LYKIG+PD FL+ +M  ++
Sbjct  124  QCHWHSPSEHTVNDKSFDLEVHLLHQSP----TGKIAVTGILYKIGEPDPFLTSIMDYLA  179

Query  592  SMI-DRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
             +    + +K +GM DP  IK  S ++YRY+GSLT+PPCT+ VIWTI +KVR+ S +Q+K
Sbjct  180  DISGTSEKQKVVGMVDPKQIKTGSIKYYRYIGSLTIPPCTQDVIWTIVEKVRSVSSEQVK  239

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSPA  861
            LLR AVHD ++ NARP+Q  N R + L  P 
Sbjct  240  LLRVAVHDESDTNARPVQPRNGRVVQLCKPT  270



>ref|XP_007206520.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
 gb|EMJ07719.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
Length=275

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 193/273 (71%), Gaps = 11/273 (4%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            ++++  S ++  VL L   +T + EVEDEREF+Y + SEKGP RWG++++EW+ C+ G M
Sbjct  6    TLILVCSFLIVLVLLLSCQAT-SDEVEDEREFNYEDDSEKGPARWGKIRQEWSMCNKGSM  64

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+  +RV++++     ++  Y+P NAT+ NRGHDI ++W  DAG + INGT Y LK
Sbjct  65   QSPIDLLDDRVEVVSDLGR-LQGSYRPRNATLENRGHDIMLKWEADAGFIRINGTLYQLK  123

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLM---R  582
              HWHSPSEHT+N + + LE+H+VHQ+     T + AV G+LYKIG+PD FL+ +M    
Sbjct  124  QCHWHSPSEHTVNDKSFDLEVHLVHQSP----TGKNAVTGILYKIGEPDPFLTSIMDYLA  179

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
            +IS   ++  +K +GM DP  IK  S ++YRY+GSLT+PPCT+ VIWTI +KVR+ S +Q
Sbjct  180  DISGTCEK--QKVVGMVDPKQIKAGSIKYYRYIGSLTIPPCTQDVIWTIVEKVRSVSSEQ  237

Query  763  IKLLREAVHDYAERNARPLQALNRREIYLLSPA  861
            +KLLR AVHD ++ NARP+Q  NRR + L  P 
Sbjct  238  VKLLRVAVHDGSDTNARPVQPRNRRVVQLYKPT  270



>gb|KGN64826.1| hypothetical protein Csa_1G120420 [Cucumis sativus]
Length=275

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 185/264 (70%), Gaps = 7/264 (3%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            L+  S    F+L   PA   +QEVE++REFDY     +GP  WG+L+ EW  C+ G MQS
Sbjct  9    LLFCSFFFAFILVSWPAM--SQEVENQREFDYNTNGTRGPIHWGDLRPEWHNCNTGQMQS  66

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PID+ ++RV+I++ H  + +  Y  +NAT++NRGHDI ++W   AG + +N T YFL+  
Sbjct  67   PIDLLNQRVRIVS-HFTDFQIDYGSSNATLKNRGHDIMLKWRSAAGHMEVNRTRYFLRQI  125

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHTINGRR+ALE H+VHQ+     T +IAVIG+LY IG+PD FLS + +++  +
Sbjct  126  HWHSPSEHTINGRRFALEAHLVHQSQ----TGKIAVIGILYNIGQPDYFLSTMRQHLVEI  181

Query  598  IDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLR  777
                 +K L M +PS +KMRS  +YRY+GSLTVPPC++ V+WTI +KVRT + +Q+ LLR
Sbjct  182  SGTQRDKLLNMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVTPEQVNLLR  241

Query  778  EAVHDYAERNARPLQALNRREIYL  849
             AVHD +E NARPLQ LN R + L
Sbjct  242  VAVHDDSETNARPLQPLNNRNVQL  265



>ref|XP_009103655.1| PREDICTED: alpha carbonic anhydrase 2 [Brassica rapa]
 emb|CDX71369.1| BnaC04g16040D [Brassica napus]
Length=272

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 185/263 (70%), Gaps = 6/263 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            ++L  ++     S   +EVEDE EF Y +  E GP +WG+LK EW  C  G+MQSPID+ 
Sbjct  12   ILLTIIVTFISCSNAQREVEDESEFSYEQNVENGPEKWGKLKPEWKMCGKGEMQSPIDLM  71

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERV+I++ H   + ++YKP NA+++NRGHD+ + +    GS+ ING +Y L   HWHSP
Sbjct  72   NERVRIVS-HLGRLTRNYKPCNASLKNRGHDMMLRFEERPGSIKINGIEYQLLQLHWHSP  130

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-D  609
            SEHTINGRR+ALELHMVH++    +   +AV+ VLYKIG+ D+FL+ L   +S+M D+ +
Sbjct  131  SEHTINGRRFALELHMVHES----INGSMAVVTVLYKIGRSDSFLTLLENKLSAMTDQNE  186

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             E  +GM DP +IK+ S+++YRY+GSLT PPCT+ + WT+ KKVRT +R Q++LLR AVH
Sbjct  187  AEFNIGMIDPKEIKIGSRKYYRYVGSLTTPPCTQNITWTVVKKVRTVARNQVRLLRVAVH  246

Query  790  DYAERNARPLQALNRREIYLLSP  858
            D +  NARP+Q  N+R + L  P
Sbjct  247  DDSNTNARPVQPTNKRVVKLYRP  269



>ref|XP_004139553.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 ref|XP_004160915.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=274

 Score =   283 bits (723),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 185/264 (70%), Gaps = 7/264 (3%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            L+  S    F+L   PA   +QEVE++REFDY     +GP  WG+L+ EW  C+ G MQS
Sbjct  8    LLFCSFFFAFILVSWPA--MSQEVENQREFDYNTNGTRGPIHWGDLRPEWHNCNTGQMQS  65

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PID+ ++RV+I++ H  + +  Y  +NAT++NRGHDI ++W   AG + +N T YFL+  
Sbjct  66   PIDLLNQRVRIVS-HFTDFQIDYGSSNATLKNRGHDIMLKWRSAAGHMEVNRTRYFLRQI  124

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHTINGRR+ALE H+VHQ+     T +IAVIG+LY IG+PD FLS + +++  +
Sbjct  125  HWHSPSEHTINGRRFALEAHLVHQSQ----TGKIAVIGILYNIGQPDYFLSTMRQHLVEI  180

Query  598  IDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLR  777
                 +K L M +PS +KMRS  +YRY+GSLTVPPC++ V+WTI +KVRT + +Q+ LLR
Sbjct  181  SGTQRDKLLNMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVTPEQVNLLR  240

Query  778  EAVHDYAERNARPLQALNRREIYL  849
             AVHD +E NARPLQ LN R + L
Sbjct  241  VAVHDDSETNARPLQPLNNRNVQL  264



>ref|XP_008462825.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Cucumis melo]
Length=271

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 187/268 (70%), Gaps = 6/268 (2%)
 Frame = +1

Query  46   RRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNG  225
            + S  V    I C  L +   +  +QEVEDE EFDY E  EKGP  WG+LK EW +C  G
Sbjct  3    KLSFHVCFCSIFCAFLLVSRLAI-SQEVEDETEFDYNEEGEKGPTHWGDLKPEWHSCKTG  61

Query  226  DMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYF  405
            +MQSPID+ HERV+I++    ++   YKP NAT++NRGHDI ++    AG +++N T YF
Sbjct  62   EMQSPIDLLHERVRIVSLFT-DIDFDYKPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYF  120

Query  406  LKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRN  585
            L+  HWHSPSEHTING+R+ALE H+VHQ+ + N     AVIGV+YKIG+PD+FLSK+  N
Sbjct  121  LQQIHWHSPSEHTINGKRFALEAHLVHQSQNGNY----AVIGVVYKIGRPDSFLSKMKEN  176

Query  586  ISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
            +  + +   EK L + D S ++M+S  +YRY+GSLT PPC++ V+WTI +KVRT + +QI
Sbjct  177  LEEISNTHEEKALDVIDLSLLEMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTVEQI  236

Query  766  KLLREAVHDYAERNARPLQALNRREIYL  849
            KLLR A HD +  NARPLQ +N R+I L
Sbjct  237  KLLRVAAHDDSNTNARPLQPINDRKIQL  264



>ref|XP_010646590.1| PREDICTED: alpha carbonic anhydrase 4 isoform X2 [Vitis vinifera]
Length=275

 Score =   282 bits (722),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 185/251 (74%), Gaps = 6/251 (2%)
 Frame = +1

Query  109  STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHH  288
            +T ++   DE +F Y E + KGP+RWG++  +W AC NG MQSPID+   RV+++  +  
Sbjct  25   ATSSESETDETQFSYIEDTGKGPKRWGQINPDWKACGNGAMQSPIDLLDARVQVLP-NLE  83

Query  289  EMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYAL  468
            ++++ YKPA A V+NRGHD+ +EW G AG + INGT + L+  HWHSPSEHT NG RY L
Sbjct  84   KLKRDYKPAPAVVKNRGHDVTVEWKGYAGKININGTYFKLQQCHWHSPSEHTFNGSRYNL  143

Query  469  ELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDI  648
            ELH++H ++D+    +IAVIG+ YK G+ D FL++++R+I S+   + EKELG+ +P DI
Sbjct  144  ELHVIHLSSDE----KIAVIGITYKYGRADPFLTRMLRHIDSLPVGE-EKELGIVNPGDI  198

Query  649  KMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQAL  828
            K  S+++YRY+GSLTVPPCTEGVIWTI+KKVRTA+R+Q++ LR+AV D  E NARP Q +
Sbjct  199  KFGSRKYYRYIGSLTVPPCTEGVIWTISKKVRTATREQVRALRKAVQDGYEANARPSQEV  258

Query  829  NRREIYLLSPA  861
            + R + L  P+
Sbjct  259  DGRTVLLYKPS  269



>ref|XP_008241448.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=292

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/277 (51%), Positives = 177/277 (64%), Gaps = 20/277 (7%)
 Frame = +1

Query  67   GSLILCFVLFL-HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPI  243
            G L+  F L   +P   RA+  E+  EF+Y  GS+KGP  WGELKKEW  C +G  QSPI
Sbjct  10   GLLVATFFLLCRNPTPLRAEHSENAIEFEYKAGSKKGPGHWGELKKEWKTCKDGKSQSPI  69

Query  244  DMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHW  423
            D+       + +     +  YKPA A + N G  IAI W GDAGS+ INGTDY L+  HW
Sbjct  70   DLRDGIATKVNSSLEHFKVSYKPAKAMIENEGPVIAIAWEGDAGSISINGTDYILRQCHW  129

Query  424  HSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID  603
            HSPSEH+INGRRY LELHMVH+  +    N +AV+G LYKIGKP+ FLS + + I+SM D
Sbjct  130  HSPSEHSINGRRYDLELHMVHRAKN----NNVAVVGFLYKIGKPNPFLSGVTKEIASMTD  185

Query  604  RDVEKELGMFDPSDI-------------KMR--SKRHYRYMGSLTVPPCTEGVIWTINKK  738
               + +LG+ DP  +             KMR  S + YRYMGSLT PPCTEGV WTINK+
Sbjct  186  VGRDVQLGVIDPRKMKAAQTGFQDAKKRKMRKASSKFYRYMGSLTTPPCTEGVTWTINKQ  245

Query  739  VRTASRKQIKLLREAVHDYAERNARPLQALNRREIYL  849
            V + S+ Q+KLL++ V DYA  NARPLQ LN R+I L
Sbjct  246  VLSVSKSQVKLLQQVVFDYAMMNARPLQPLNGRDIKL  282



>ref|XP_010488326.1| PREDICTED: alpha carbonic anhydrase 7 [Camelina sativa]
Length=276

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/279 (48%), Positives = 187/279 (67%), Gaps = 6/279 (2%)
 Frame = +1

Query  25   LASFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKE  204
            + ++ + R    V    I    + +  A++   EVEDE EF+Y +  EKGP RWGELK E
Sbjct  1    MVNYPSTRCIFFVALFSIFTINVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGELKPE  60

Query  205  WAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVI  384
            W  C  G+MQSPID+ +ERV I  +H   + + Y+P+NAT++NRGHDI ++    AGS+ 
Sbjct  61   WEMCGKGEMQSPIDLMNERVNI-GSHLGRLNRDYQPSNATLKNRGHDIMLKLEDGAGSIK  119

Query  385  INGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAF  564
            ING  Y L+  HWHSPSEHT+NGRR+ALELHMVH+        ++AV+ VLYKIG+ D F
Sbjct  120  INGFQYELQQLHWHSPSEHTVNGRRFALELHMVHEGKK----GRMAVVSVLYKIGRADTF  175

Query  565  LSKLMRNISSMID-RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKV  741
            +  L   +  + +  + EK +GM DP+ IK+ S+++YRY GSLT PPCT+ V WT+ +KV
Sbjct  176  IRSLENELEGIAEMEEAEKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWTVVRKV  235

Query  742  RTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            RT +RKQ+KLLR AVHD +  NARP+Q  N+R +++  P
Sbjct  236  RTVTRKQVKLLRVAVHDDSNSNARPVQPTNKRTVHMYRP  274



>ref|XP_008462817.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 184/264 (70%), Gaps = 7/264 (3%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            L+  S    F+L L PA   +QEVE++REFDY     +GP  WG+++ EW  C  G MQS
Sbjct  9    LLFCSSFFAFLLVLWPA--MSQEVENQREFDYNTNGTRGPAHWGDIRPEWHTCRTGQMQS  66

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PID+ ++RV+I++ H  +++ +Y  +NAT++NRGHDI ++W G AG + +N + YFL+  
Sbjct  67   PIDLLNQRVRIVS-HFTDLKINYSSSNATLKNRGHDIMLQWSGSAGYMEVNRSRYFLRQI  125

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHTINGRR+ALE H+VHQ+     T  IAVIG+LY IG+PD FLS + ++   +
Sbjct  126  HWHSPSEHTINGRRFALEAHLVHQSQ----TGNIAVIGILYNIGQPDYFLSTMRQHFIDI  181

Query  598  IDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLR  777
                 +K L + +PS ++MRS  +YRY+GSLTVPPC++ V+WTI +KVRT +  Q+ LLR
Sbjct  182  STTQRDKLLNVVNPSRLRMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVAPDQVNLLR  241

Query  778  EAVHDYAERNARPLQALNRREIYL  849
             AVHD +  NARPLQ LN R + L
Sbjct  242  VAVHDDSNTNARPLQPLNNRNVQL  265



>emb|CDX95095.1| BnaC05g05760D [Brassica napus]
Length=272

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 189/264 (72%), Gaps = 7/264 (3%)
 Frame = +1

Query  73   LILCFVLF-LHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            + + F LF    A+T   EVEDE EF+Y +  +KGP RWGE+K EW  C  G++QSPID+
Sbjct  12   VFIIFTLFSFSTAATSHGEVEDEHEFNYKKNDDKGPERWGEIKPEWEMCGKGELQSPIDL  71

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
             +ERVKI++ H   + + Y+P+NAT++NRGHDI +++   AGS+ ING  Y L+  HWHS
Sbjct  72   MNERVKIVS-HLGRLIRDYEPSNATIKNRGHDIMLKFKDGAGSIKINGFHYELQQLHWHS  130

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-R  606
            PSEHT+NGRR+ALELHMVH+  +     ++AV+ VLYKIG+ D F+  L + + ++ D  
Sbjct  131  PSEHTVNGRRFALELHMVHEGKN----GRMAVVTVLYKIGRADTFIRSLEKELEAITDLD  186

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            D EK + M DP  IK+ S+++YRY+GSLT PPCT+ V W++ +K+RT +R+Q++LLR AV
Sbjct  187  DAEKHVRMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAV  246

Query  787  HDYAERNARPLQALNRREIYLLSP  858
            HD +  NARP+Q +N+R ++L  P
Sbjct  247  HDDSLTNARPVQPINKRMVHLYRP  270



>emb|CDY04545.1| BnaA07g13710D [Brassica napus]
Length=272

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 184/263 (70%), Gaps = 6/263 (2%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            ++L  ++     S   +EVEDE EF Y +  E GP +WG+LK EW  C  G+MQSPID+ 
Sbjct  12   ILLTIIVTFISCSNAQREVEDESEFSYEQNVENGPEKWGKLKPEWKMCGKGEMQSPIDLM  71

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERV+I++ H   + ++YKP NA+++NRGHD+ + +    GS+ ING  Y L   HWHSP
Sbjct  72   NERVRIVS-HLGRLTRNYKPCNASLKNRGHDMMLRFEERPGSIKINGIIYQLLQLHWHSP  130

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD-  609
            SEHTINGRR+ALELHMVH++    +   +AV+ VLYKIG+ D+FL+ L   +S+M D++ 
Sbjct  131  SEHTINGRRFALELHMVHES----INGSMAVVTVLYKIGRSDSFLTLLENKLSAMTDQNE  186

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             E  +GM DP +IK+ S+++YRY+GSLT PPCT+ + WT+ KKVRT +R Q++LLR AVH
Sbjct  187  AEFNIGMIDPKEIKIGSRKYYRYVGSLTTPPCTQNITWTVVKKVRTVARNQVRLLRVAVH  246

Query  790  DYAERNARPLQALNRREIYLLSP  858
            D +  NARP+Q  N+R + L  P
Sbjct  247  DDSNTNARPVQPTNKRVVKLYRP  269



>ref|XP_004160914.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN64829.1| hypothetical protein Csa_1G120450 [Cucumis sativus]
Length=275

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 183/262 (70%), Gaps = 8/262 (3%)
 Frame = +1

Query  73   LILC---FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPI  243
            L+ C   F   L P    +QEVE++REFDY     +GP  WG L+ EW  C+ G MQSPI
Sbjct  9    LLFCSFFFAFLLVPWPAMSQEVENQREFDYNANGTRGPAHWGVLRPEWHTCNTGQMQSPI  68

Query  244  DMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHW  423
            D+ ++RV+I++ H  +++ +Y  +NAT++NRGHDI ++W G AG + +N T YFL+  HW
Sbjct  69   DLLNQRVRIVS-HFTDLKINYSSSNATLKNRGHDIMLQWSGRAGYMEVNKTQYFLRQIHW  127

Query  424  HSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID  603
            HSPSEHTINGRR+ALE H+VHQ+     T +IAVIG+LY IG+PD FLS +  ++  +  
Sbjct  128  HSPSEHTINGRRFALEAHLVHQSQ----TGKIAVIGILYNIGQPDYFLSTMRPHLIEISG  183

Query  604  RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREA  783
               ++ L + +PS ++MRS  +YRY+GSLTVPPC++ V+WT+ +KVRT + +Q+ LLR A
Sbjct  184  TQRDRLLNVVNPSLLRMRSSLYYRYIGSLTVPPCSQNVLWTLVRKVRTVAPEQVNLLRVA  243

Query  784  VHDYAERNARPLQALNRREIYL  849
            VHD +  NARPLQ LN R + L
Sbjct  244  VHDDSNTNARPLQPLNNRNVQL  265



>ref|XP_010109499.1| hypothetical protein L484_007519 [Morus notabilis]
 gb|EXC22910.1| hypothetical protein L484_007519 [Morus notabilis]
Length=274

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 186/268 (69%), Gaps = 9/268 (3%)
 Frame = +1

Query  58   LVTGSLILCF--VLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            LVT   +  F  +L LH     + EVEDE EF+Y +GSEKGP RWGE++ EW+ CSNG +
Sbjct  4    LVTQIFLCSFFTILVLHFCPALSDEVEDESEFNYEQGSEKGPDRWGEIRPEWSTCSNGTL  63

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWH-GDAGSVIINGTDYFL  408
            QSPID+  +RV++I+ H    +++YKP+NAT++NRGHDI ++W+ G+AG + INGT Y +
Sbjct  64   QSPIDLLDKRVEVIS-HLEITKRNYKPSNATLKNRGHDIMLKWNSGEAGYIEINGTQYLI  122

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            +  HWHSPSEHTING ++ LELH VHQ      T Q  V G+LY+ G+PD FLS +   +
Sbjct  123  QQCHWHSPSEHTINGNKFDLELHAVHQTP----TGQTFVFGILYQFGEPDPFLSSVEDYL  178

Query  589  SSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
              + D   E+ + + DP+ IK+ S+R+Y Y+GSLT PPCTE V+W +  ++RT SR+Q+ 
Sbjct  179  EEISDTG-EEIIVVIDPNKIKIGSQRYYNYIGSLTTPPCTENVVWIVASEIRTVSREQVS  237

Query  769  LLREAVHDYAERNARPLQALNRREIYLL  852
            LLR AVHD ++ NARP+Q  N R + L 
Sbjct  238  LLRVAVHDDSDTNARPIQETNGRTVKLF  265



>ref|XP_006409842.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
 gb|ESQ51295.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
Length=271

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 184/270 (68%), Gaps = 12/270 (4%)
 Frame = +1

Query  70   SLILCFVLFLHPA------STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            S I CF   L         S   +EVEDE EF Y    E GP +WG+LK EW  C  G+M
Sbjct  4    SAIQCFFFLLLTIIVTISFSNAQREVEDESEFSYERNEENGPEKWGKLKPEWKMCGKGEM  63

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+ +ERV+++  H   + + YKP+NAT++NRGHD+ + +   +GS+ INGT+Y L 
Sbjct  64   QSPIDLMNERVRVVY-HLGRLTRDYKPSNATLKNRGHDMMLRFEEGSGSIKINGTEYQLL  122

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHTINGRR+A+ELH+VH++    +  ++AV+ VLYKIG+PD+FL  L   + 
Sbjct  123  QLHWHSPSEHTINGRRFAMELHLVHES----INGRMAVVTVLYKIGRPDSFLRLLENKLL  178

Query  592  SMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
            ++ D+ + EK +G+ DP  IK  S+++YRY+GSLT PPCT+ V WT+ KKVRT S+ Q++
Sbjct  179  AITDQNEKEKNIGLIDPKKIKFGSRKYYRYVGSLTTPPCTQNVTWTVVKKVRTVSKNQVR  238

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSP  858
            LLR AVHD +  NARP+Q  N+R + L  P
Sbjct  239  LLRVAVHDDSNSNARPVQPTNKRVVNLYKP  268



>ref|XP_004293093.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=472

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 192/278 (69%), Gaps = 11/278 (4%)
 Frame = +1

Query  55   ILVTGSLILCF---VLFLHP--ASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACS  219
            +L   SL++ F   VL LH    ++   EVEDE EF Y E SEKGP RWG +++EW+ C+
Sbjct  198  MLKLSSLLILFCSIVLVLHSYQVTSHENEVEDESEFSYDENSEKGPARWGNIRREWSMCN  257

Query  220  NGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTD  399
            NG +QSPI++S +RV +I+     ++  YK  NAT++NRGHDI ++W  DAG + INGT 
Sbjct  258  NGLLQSPINLSDDRVNVIS-DLGALQGSYKACNATLKNRGHDIMLKWQADAGYIPINGTH  316

Query  400  YFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLM  579
            Y ++  HWHSPSEH ING+++ LE HMVH   +      IAVIG+LYKIGKPD FL+++M
Sbjct  317  YSVRQCHWHSPSEHKINGKQFDLEAHMVHDGPN----GSIAVIGILYKIGKPDPFLTQMM  372

Query  580  RNISSMIDRD-VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASR  756
              I  + +    EK +GM DP  IK  S ++YRY+GSLT+PPCT+ V+W +  +VRT S+
Sbjct  373  DYIEDLSESSGEEKVIGMVDPKQIKTVSTKYYRYIGSLTIPPCTQNVLWNLVGEVRTVSK  432

Query  757  KQIKLLREAVHDYAERNARPLQALNRREIYLLSPAGKK  870
            +Q++ LREAVHD +E NARPLQ +N R + L +P+ ++
Sbjct  433  EQVEFLREAVHDESETNARPLQPINTRSVRLYNPSTEE  470



>gb|AAD29832.1| putative carbonic anhydrase [Arabidopsis thaliana]
Length=248

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 183/246 (74%), Gaps = 7/246 (3%)
 Frame = +1

Query  127  VEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHY  306
            VEDE EF Y    E GP +WG+L+ EW  C  G+MQSPID+ ++RV+++T H  ++ +HY
Sbjct  5    VEDEHEFSYEWNQENGPAKWGKLRPEWKMCGKGEMQSPIDLMNKRVRLVT-HLKKLTRHY  63

Query  307  KPANATVRNRGHDIAIEWHGD-AGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            KP NAT++NRGHD+ +++  + +GS+ +NGT+Y L   HWHSPSEHT+NGRR+ALELHMV
Sbjct  64   KPCNATLKNRGHDMMLKFGEEGSGSITVNGTEYKLLQLHWHSPSEHTMNGRRFALELHMV  123

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DVEKELGMFDPSDIKMRS  660
            H+N + +L    AV+ VLYKIG+PD+FL  L   +S++ D+ + EK + + DP DIK+ S
Sbjct  124  HENINGSL----AVVTVLYKIGRPDSFLGLLENKLSAITDQNEAEKYVDVIDPRDIKIGS  179

Query  661  KRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRRE  840
            ++ YRY+GSLT PPCT+ VIWT+ KKVRT ++ Q+KLLR AVHD ++ NARP+Q  N+R 
Sbjct  180  RKFYRYIGSLTTPPCTQNVIWTVVKKVRTVTKNQVKLLRVAVHDNSDTNARPVQPTNKRV  239

Query  841  IYLLSP  858
            + L  P
Sbjct  240  VKLYKP  245



>ref|XP_010036662.1| PREDICTED: alpha carbonic anhydrase 4-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW48290.1| hypothetical protein EUGRSUZ_K02021 [Eucalyptus grandis]
Length=277

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 187/273 (68%), Gaps = 7/273 (3%)
 Frame = +1

Query  40   TMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACS  219
            ++R S      + +   L L  ++    EV DE  F Y EG+ KGP+ WG++   W ACS
Sbjct  5    SIRSSFCFFALVFVAHGLLLTRSTASESEVGDETPFTYIEGTGKGPKEWGQIDPHWRACS  64

Query  220  NGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTD  399
             G +QSPID+  ERV++   +  ++++ YKPA A VRNRGHDI + W G AG + INGT 
Sbjct  65   TGKLQSPIDLLDERVQVFP-NLGKLKRDYKPAPAIVRNRGHDITVMWKGYAGQININGTY  123

Query  400  YFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLM  579
            Y L   HWHSPSEHT NG +Y LELH+VH ++      +IAVIG++YK G+PD FL+KL+
Sbjct  124  YKLLQCHWHSPSEHTFNGSKYDLELHVVHLSSH----GEIAVIGIVYKYGRPDPFLTKLL  179

Query  580  RNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRK  759
             +I   + R  +++LG+ +P  IK  S++++RY+GSLTVPPCTEGV+WTI +KVRT SR+
Sbjct  180  EHIK--VVRKEDRDLGVINPGIIKFGSRKYFRYIGSLTVPPCTEGVVWTIIRKVRTVSRE  237

Query  760  QIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            Q++ LREAVHD  E NARP Q L+RR ++L +P
Sbjct  238  QVEALREAVHDGYEANARPTQRLDRRAVWLYTP  270



>ref|XP_002892434.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68693.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 177/246 (72%), Gaps = 6/246 (2%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            EVEDE EF+Y +  EKGP RWG+LK EW  C  G+MQSPID+ +ERV +++ H   + + 
Sbjct  33   EVEDEHEFNYKKNDEKGPERWGKLKPEWEMCGKGEMQSPIDLMNERVNVVS-HLGRLNRD  91

Query  304  YKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            YKP+NAT++NRGHDI +++   AGS+ ING  Y L+  HWHSPSEHTINGRR+ALELHMV
Sbjct  92   YKPSNATLKNRGHDIMLKFEYGAGSIKINGFRYELQQLHWHSPSEHTINGRRFALELHMV  151

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFDPSDIKMRS  660
            H+        ++AV+ VLYKIG+ D F+  L   +  + +  + EK +GM DP+ IK+ S
Sbjct  152  HEGKK----GRMAVVTVLYKIGRADTFIRSLENELEGIAEMEEAEKNVGMIDPTKIKIGS  207

Query  661  KRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRRE  840
            +++YRY GSLT PPCT+ V W++ +KVRT +RKQ+KLLR AVHD A  NARP+Q  N+R 
Sbjct  208  RKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVHDDANSNARPVQPTNKRM  267

Query  841  IYLLSP  858
            ++L  P
Sbjct  268  VHLYRP  273



>ref|XP_007202870.1| hypothetical protein PRUPE_ppa015691mg, partial [Prunus persica]
 gb|EMJ04069.1| hypothetical protein PRUPE_ppa015691mg, partial [Prunus persica]
Length=261

 Score =   280 bits (715),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 176/253 (70%), Gaps = 18/253 (7%)
 Frame = +1

Query  136  EREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPA  315
            E EFDY  G++KGP  WGELKKEWAAC  G +QSPID+S +R   + +   +++  YKP 
Sbjct  2    EIEFDYRNGNDKGPEHWGELKKEWAACKYGKLQSPIDLSDDRATKVISSSEDLQMSYKPC  61

Query  316  NATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNT  495
            NAT++N GH IA+ W GDAGS+ ING +Y L+  HWHSPSEH+ING+RY +ELHMVH+  
Sbjct  62   NATMKNEGHYIAVIWDGDAGSISINGKEYNLRQCHWHSPSEHSINGKRYDVELHMVHRAK  121

Query  496  DQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDP----------SD  645
            +    + +AV+G LYKIG+P+ F+SK+ + I+SM+D + E +LG+ DP           D
Sbjct  122  N---NSDVAVVGFLYKIGQPNPFISKVKKAIASMMDVEKEVQLGVIDPRKMKKAKLGFQD  178

Query  646  IKMR-----SKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNA  810
             K R     S + YRY GS T PPC+EGV WTINK+V T S  Q+KLL++AV D+AE NA
Sbjct  179  PKKRKMKKASSKFYRYSGSFTTPPCSEGVTWTINKQVHTVSIAQVKLLQQAVFDFAEMNA  238

Query  811  RPLQALNRREIYL  849
            RP+Q LN RE+ L
Sbjct  239  RPVQPLNGREVKL  251



>ref|XP_010510674.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X1 [Camelina 
sativa]
Length=278

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 187/275 (68%), Gaps = 19/275 (7%)
 Frame = +1

Query  76   ILCFVLFLH----------PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNG  225
            I CF+  +            A+   +EVEDEREF Y    E GP +WG+LK EW  C  G
Sbjct  6    IQCFIFLVLTSFVATVWCLSATADYREVEDEREFSYERNKENGPEKWGKLKPEWKLCGKG  65

Query  226  DMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGD---AGSVIINGT  396
            ++QSPID+ ++RV+++T    ++ K YKP NAT+ NRGHD+ + +  +    GS  INGT
Sbjct  66   ELQSPIDLMNKRVRLVT-DFEKLTKDYKPCNATLINRGHDMMLRFEEEEEGPGSFKINGT  124

Query  397  DYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL  576
            +Y L   HWHSPSEHTINGRR+ALELH+VH+N + +L    AV+ VLYKIG+PD+FL  L
Sbjct  125  EYKLLQLHWHSPSEHTINGRRFALELHLVHENINGSL----AVVTVLYKIGRPDSFLESL  180

Query  577  MRNISSMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTAS  753
             + +S + D+ + EK + M DP +I++ S++ YRY+GSLT PPCT+ VIWT+ KKVRT +
Sbjct  181  EKKLSVITDQNEAEKNVEMIDPRNIQIGSRKFYRYLGSLTTPPCTQNVIWTVVKKVRTVT  240

Query  754  RKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            + Q+KLLR AVHD  + NARP+Q +N+R + L  P
Sbjct  241  KSQVKLLRVAVHDNYDTNARPVQPINKRVVKLFRP  275



>ref|XP_008385339.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   280 bits (716),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 188/261 (72%), Gaps = 7/261 (3%)
 Frame = +1

Query  70   SLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            S ++  VL L+     ++EVED+REF+Y E SEKGP RWGE++++W+ CS G MQSPID+
Sbjct  12   SFLIALVL-LNSRHATSEEVEDQREFNYEEDSEKGPVRWGEIRQDWSMCSKGSMQSPIDL  70

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
              +RV++++ H   ++ +Y+P NAT++NRGHD+ ++W  D G +++NGT Y LK  HWH+
Sbjct  71   LDDRVELVS-HLGILKSNYRPCNATLKNRGHDMMLKWEADPGFILLNGTLYKLKQCHWHA  129

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
             SEHTING+R+ LE+H+VH++     T  IAV G+LY+IG PD FLS +M  ++ + D  
Sbjct  130  SSEHTINGKRFDLEVHLVHESA----TGNIAVTGILYRIGAPDPFLSSIMDYLADVSDTT  185

Query  610  VEKE-LGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
             ++E +GM DP  +K  S ++YRY+GSLT PPCT+ VIWTI ++V T S +Q+K LR AV
Sbjct  186  EDEEVVGMVDPRQMKTSSTKYYRYIGSLTTPPCTQNVIWTIAREVSTVSEEQVKALRVAV  245

Query  787  HDYAERNARPLQALNRREIYL  849
            HD ++ NARP+Q  NRR + L
Sbjct  246  HDDSDTNARPVQPRNRRIVQL  266



>gb|KDP26093.1| hypothetical protein JCGZ_21126 [Jatropha curcas]
Length=269

 Score =   280 bits (715),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 181/245 (74%), Gaps = 6/245 (2%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            EV DE  F Y E + KGP+ WG ++ EW  C+NG +QSPID+ ++RV+  ++   ++ + 
Sbjct  24   EVGDESPFTYDEDTGKGPKHWGNIEPEWQVCNNGKLQSPIDLLNKRVQT-SSKLGKLHRC  82

Query  304  YKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            YKPA A+V+NRGHDIA+ W GDAG + INGTDY L+  HWHSPSEHT NG RY LE+H+V
Sbjct  83   YKPAPASVKNRGHDIAVIWKGDAGKIKINGTDYKLQQCHWHSPSEHTFNGSRYELEIHLV  142

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSK  663
            H++++     +IAVIG++YK G+ D FLSKL ++I   ++++ E +LG+ +P +I+  S+
Sbjct  143  HESSE----GKIAVIGIVYKYGRHDPFLSKLFQHIKRTVEKE-EIDLGIVNPGNIRFGSR  197

Query  664  RHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREI  843
            ++YRY GSLT PPCTEGVIWTI KKVRT SR+Q+K LR+AVHD  E NARP Q L+ R +
Sbjct  198  KYYRYNGSLTTPPCTEGVIWTIVKKVRTVSREQVKALRDAVHDGFEANARPSQPLDGRPV  257

Query  844  YLLSP  858
            Y+  P
Sbjct  258  YMYRP  262



>ref|XP_004973661.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=285

 Score =   280 bits (716),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 178/253 (70%), Gaps = 6/253 (2%)
 Frame = +1

Query  103  PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
            P +   QE EDE EF Y    E GP  WG +K EWA CS G MQSPID++HERV ++   
Sbjct  32   PGARAQQETEDEHEFSYDPRDEHGPAHWGRIKAEWANCSAGGMQSPIDLAHERVTLVRAL  91

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRY  462
             + +   Y+PA A++ NRGHDI + + GDAGSV+INGT Y+L+  HWH+P+EHT++GR+Y
Sbjct  92   GY-LDHSYRPAQASIVNRGHDIMVRFKGDAGSVVINGTAYYLRQLHWHAPTEHTVDGRQY  150

Query  463  ALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DVEKELGMFDP  639
             +ELH+VHQ+ +     + AVIGVLY++G  DAFL  L   I  + DR D E+ +G+ DP
Sbjct  151  DMELHLVHQSAE----GKAAVIGVLYEVGAHDAFLHALEPAIHRIADRRDREEPVGVVDP  206

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
               + R+  +YRYMGSLT PPCTEGVIWTI K+VRT S+ Q++LLREAVHD  E+NARPL
Sbjct  207  RGARGRASVYYRYMGSLTTPPCTEGVIWTIVKRVRTVSKYQLELLREAVHDDMEKNARPL  266

Query  820  QALNRREIYLLSP  858
            Q +N R+I +  P
Sbjct  267  QEVNDRDISIFRP  279



>ref|XP_004251153.1| PREDICTED: alpha carbonic anhydrase 7 [Solanum lycopersicum]
Length=276

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/268 (48%), Positives = 188/268 (70%), Gaps = 7/268 (3%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
              L F+   +       EV+DE EF Y   SE GP  WGE+  EW  C+ G +QSPID+ 
Sbjct  13   FFLSFLFLTNAFIATCHEVDDESEFSYDRESENGPTHWGEIHPEWKLCNTGKLQSPIDLL  72

Query  253  HERVKIITTHHHEMRKHYKPAN-ATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            +ERV++++ H   + + YK  + AT+ NRGHD+ + W G AG ++INGT Y L  AHWHS
Sbjct  73   NERVEVVS-HLGRLHRSYKTTSYATLLNRGHDMMLRWEGGAGHIVINGTKYQLNQAHWHS  131

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-DR  606
            PSEHTINGRR+ LE+H+VH++ D     + AV+G++YKIG+ D+FLS +  ++ ++   +
Sbjct  132  PSEHTINGRRFDLEVHLVHESED----GKTAVVGIMYKIGRADSFLSMIESDLKALAHTK  187

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            +VE+++G+ DP  +K+ S+++YRY+GSLTVPPCT+ V+WTI +KVRT +++Q+KL+REAV
Sbjct  188  NVERKIGIIDPKKVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAV  247

Query  787  HDYAERNARPLQALNRREIYLLSPAGKK  870
            HD +E N+RP+QA N+R I L  P   K
Sbjct  248  HDESETNSRPVQATNKRTIRLYRPNDPK  275



>ref|XP_008462808.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 184/264 (70%), Gaps = 7/264 (3%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            L+  S    F+L   PA +  QEVE++REFDY     +GP  WG+L+ EW  C+ G MQS
Sbjct  9    LLFCSFFFAFLLVSWPAMS--QEVENQREFDYNTNGTRGPAHWGDLRPEWHNCNTGRMQS  66

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PID+ ++RV+I++ H  + +  Y+ +NAT++NRGHD+ ++W G AG + +N + YFL+  
Sbjct  67   PIDLLNQRVRIVS-HFTDFQIDYRSSNATLKNRGHDMMLQWSGAAGHMEVNRSRYFLRQI  125

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHT+NG+R+ALE H+VHQ+     T  IAVIG+LY IG+PD FLS + ++   +
Sbjct  126  HWHSPSEHTLNGKRFALEAHLVHQSQ----TGNIAVIGILYNIGQPDYFLSTMRQHFVEI  181

Query  598  IDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLR  777
                 +K L M +PS +KMRS  +YRY+GSLTVPPC++ V+WTI +KVRT + +Q+ LLR
Sbjct  182  SATQRDKLLNMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVAPEQVNLLR  241

Query  778  EAVHDYAERNARPLQALNRREIYL  849
             AVHD +  NARPLQ LN R + L
Sbjct  242  VAVHDDSNTNARPLQPLNNRNVQL  265



>emb|CDX93593.1| BnaA06g04550D [Brassica napus]
Length=547

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 190/264 (72%), Gaps = 7/264 (3%)
 Frame = +1

Query  73   LILCFVLF-LHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            + + F LF    A+T   EVEDEREF+Y +  +KGP RWGE+K EW  C  G++QSPIDM
Sbjct  287  VFIIFSLFSFSTAATSNGEVEDEREFNYKKNDDKGPERWGEIKPEWEMCGKGELQSPIDM  346

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
             +ERVKI++ H   + + Y+P+NAT++NRGHDI +++   AGS+ ING  Y L+  HWHS
Sbjct  347  MNERVKIVS-HLGRLIRDYEPSNATIKNRGHDIMLKFEDGAGSIKINGFQYELQQLHWHS  405

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-R  606
            PSEHT+NGRR+ALELHMVH+  +     ++AV+ VLYKIG+ D F+  L + + ++ D  
Sbjct  406  PSEHTVNGRRFALELHMVHEGKN----GRMAVVTVLYKIGRADTFIRSLEKELEAITDLD  461

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            D EK + M DP  IK+ S+++YRY+GSLT PPCT+ V W++ +K+RT +R+Q++LLR AV
Sbjct  462  DAEKHVRMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAV  521

Query  787  HDYAERNARPLQALNRREIYLLSP  858
            HD +  NARP+Q +N+R ++L  P
Sbjct  522  HDDSLTNARPVQPINKRMVHLYRP  545


 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/294 (47%), Positives = 201/294 (68%), Gaps = 14/294 (5%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            +IL F+     AS+   EVEDE EF+Y +  +KGP RWGE+K EW  C  G++QSPID+ 
Sbjct  14   IILNFISLSTAASSHG-EVEDEHEFNYKKNDDKGPERWGEIKPEWEMCGKGEIQSPIDLM  72

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERVKI++ H   + + Y+ +NAT++NRGHDI +++   AGS+ ING  Y L+  HWHSP
Sbjct  73   NERVKIVS-HLGRLIRDYEASNATIKNRGHDIMLKFEAGAGSIKINGFQYELQQLHWHSP  131

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RD  609
            SEHT+NGRR+ALELHMVH+  +     ++AV+ VLYKIG+ D F+  L + + ++ D  D
Sbjct  132  SEHTVNGRRFALELHMVHEGKN----GRMAVVTVLYKIGRADTFIRSLEKELEAITDLDD  187

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             EK + M DP  IK+ S+++YRY+GSLT PPCT+ V W++ +K+RT +R+Q++LLR AVH
Sbjct  188  AEKHVRMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVH  247

Query  790  DYAERNARPLQALNRREIYLLSPAGKKLEK*TLL*MG*H*RNICIISFVYFSLF  951
            D +  NARP+Q +N+R + L  P  K+  + + +      R I  + F+ FSLF
Sbjct  248  DDSLTNARPVQPINKRVVRLYRPRTKQEMESSPI------RCIFFV-FIIFSLF  294



>ref|XP_006340169.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 188/268 (70%), Gaps = 7/268 (3%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            L L F+   +       EV+DE EF Y   SE GP  WGE+  EW  C++G +QSPID+ 
Sbjct  12   LFLSFLFLTNAFIATCHEVDDESEFSYDRESENGPTHWGEINPEWKMCNSGKLQSPIDLL  71

Query  253  HERVKIITTHHHEMRKHYKPAN-ATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            +ERV++++ H   + + YK ++ AT+ NRGHD+ + W G AG + INGT Y L  AHWHS
Sbjct  72   NERVEVVS-HLGRLHRSYKTSSYATLLNRGHDMMLRWEGGAGHIKINGTKYQLNQAHWHS  130

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-DR  606
            PSEHTINGRR+ LE+H+VH++ D     + AV+G++YKIG+ D FLS +  ++ ++   +
Sbjct  131  PSEHTINGRRFDLEVHLVHESED----GKTAVVGIMYKIGRADPFLSMIESDLKALAHTK  186

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            +VE+ +G+ DP  +K+ S+++YRY+GSLTVPPCT+ V+WTI +KVRT +++Q+KL+REAV
Sbjct  187  NVERNIGVIDPKKVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAV  246

Query  787  HDYAERNARPLQALNRREIYLLSPAGKK  870
            HD +E N+RP+QA N+R I L  P   K
Sbjct  247  HDESETNSRPVQATNKRTIRLYRPNDPK  274



>ref|XP_011033188.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
 ref|XP_011033189.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
Length=330

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/281 (49%), Positives = 186/281 (66%), Gaps = 15/281 (5%)
 Frame = +1

Query  16   SVVLASFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGEL  195
            ++ + SF  +   I+V+ SL +              EVEDE +F Y EG+EKGP+ WG++
Sbjct  58   NINMMSFLLLVSLIIVSYSLTISLAF--------ESEVEDETQFTYEEGTEKGPKNWGKI  109

Query  196  KKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAG  375
               W AC  G MQSPID+   RV++   +   +R+ Y+ A A V+NRGHDI + W GDAG
Sbjct  110  NPHWEACGKGKMQSPIDVLDRRVEVFP-NLGRLRRDYQAAPAAVKNRGHDITVIWKGDAG  168

Query  376  SVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKP  555
             + IN TDY L+  HWHSPSEH  NG R+ LELH+VH ++       IAV+ ++YK G+P
Sbjct  169  KITINDTDYQLQQCHWHSPSEHAFNGTRHDLELHLVHYSSQGG----IAVVAIVYKYGRP  224

Query  556  DAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINK  735
            D FLSKL+R+I+ +  R  E+E+G+ +P DIK  S+++YRY+GSLTVPPCTEGV+WTI K
Sbjct  225  DRFLSKLLRHINHVDHR--EREMGIVNPGDIKFGSRKYYRYIGSLTVPPCTEGVVWTIVK  282

Query  736  KVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            KVRT SR+Q+K LR+AVHD  E NARP Q      +Y  SP
Sbjct  283  KVRTVSREQVKALRDAVHDGFEANARPAQPSTGIPMYEYSP  323



>ref|XP_006421163.1| hypothetical protein CICLE_v10005610mg [Citrus clementina]
 gb|ESR34403.1| hypothetical protein CICLE_v10005610mg [Citrus clementina]
Length=273

 Score =   277 bits (709),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/269 (50%), Positives = 185/269 (69%), Gaps = 8/269 (3%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            + ++  SLIL   L+ +  +    EV+DE  F Y E + KGPR WG++   W  C  G +
Sbjct  8    TFIILASLILSSHLY-NLVNADDSEVDDETAFSYKEETGKGPREWGKINPHWRVCGIGKL  66

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+ ++RV+++     ++++ YKPA A V+NRGHDI + W GDAG + INGT Y L 
Sbjct  67   QSPIDLLNQRVQVLPALG-KLKRDYKPAPAVVKNRGHDICVWWRGDAGKMNINGTVYKLL  125

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWH+PSEHT NG  Y +ELH+VH ++D     ++AV G++Y+ G+PD FLSKL+ +I 
Sbjct  126  QCHWHTPSEHTFNGSSYEMELHLVHLSSD----GKLAVTGIVYEYGRPDPFLSKLLHHIK  181

Query  592  SMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
            S+     EKE+G+ +P DIK  S+++YRY+GSLTVPPCTEGVIWTI KKVRT SR+Q++ 
Sbjct  182  SLGKE--EKEVGIVNPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIGKKVRTVSREQVRA  239

Query  772  LREAVHDYAERNARPLQALNRREIYLLSP  858
            L+E VHD  E+NARP   LN R I+  SP
Sbjct  240  LKEEVHDGYEKNARPTNELNGRPIWFYSP  268



>ref|XP_010414580.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   277 bits (709),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/270 (48%), Positives = 192/270 (71%), Gaps = 12/270 (4%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
            + + G+++ C       A+   +EVEDE EF Y    E GP+ WG+LK EW  C  G+MQ
Sbjct  14   LTILGTIVSC-----SSAAKNDREVEDESEFSYEHNKENGPKNWGKLKPEWNMCGKGEMQ  68

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGD-AGSVIINGTDYFLK  411
            SPID++++RVK+++ H  ++ ++YKP+NAT++NRGHD+ +++  + AGS  INGT+Y L 
Sbjct  69   SPIDLTNKRVKLVS-HLGKLSRNYKPSNATLKNRGHDMMLKFGEEGAGSFKINGTEYKLL  127

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHT+NG+R+ALELHMVH++ + ++    AV+ VLYKIG+P++FL  L + + 
Sbjct  128  QLHWHSPSEHTVNGKRFALELHMVHESKNGSM----AVVTVLYKIGRPNSFLKLLEQKLV  183

Query  592  SMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
            ++ D+ D E+ + M DP+ IK  S+ +YRY+GSLT PPCT+ + WTI KK+RT S+ Q+ 
Sbjct  184  AITDQHDAERNVVMIDPNKIKTESRNYYRYIGSLTTPPCTQNITWTILKKIRTVSKSQVN  243

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSP  858
            LLR AVHD +  NARP+Q  N+R I+L  P
Sbjct  244  LLRVAVHDDSNSNARPVQPTNKRVIHLYRP  273



>ref|XP_010510675.1| PREDICTED: alpha carbonic anhydrase 7-like isoform X2 [Camelina 
sativa]
Length=248

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 178/248 (72%), Gaps = 9/248 (4%)
 Frame = +1

Query  127  VEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHY  306
            +EDEREF Y    E GP +WG+LK EW  C  G++QSPID+ ++RV+++T    ++ K Y
Sbjct  3    IEDEREFSYERNKENGPEKWGKLKPEWKLCGKGELQSPIDLMNKRVRLVT-DFEKLTKDY  61

Query  307  KPANATVRNRGHDIAIEWHGD---AGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELH  477
            KP NAT+ NRGHD+ + +  +    GS  INGT+Y L   HWHSPSEHTINGRR+ALELH
Sbjct  62   KPCNATLINRGHDMMLRFEEEEEGPGSFKINGTEYKLLQLHWHSPSEHTINGRRFALELH  121

Query  478  MVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DVEKELGMFDPSDIKM  654
            +VH+N + +L    AV+ VLYKIG+PD+FL  L + +S + D+ + EK + M DP +I++
Sbjct  122  LVHENINGSL----AVVTVLYKIGRPDSFLESLEKKLSVITDQNEAEKNVEMIDPRNIQI  177

Query  655  RSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNR  834
             S++ YRY+GSLT PPCT+ VIWT+ KKVRT ++ Q+KLLR AVHD  + NARP+Q +N+
Sbjct  178  GSRKFYRYLGSLTTPPCTQNVIWTVVKKVRTVTKSQVKLLRVAVHDNYDTNARPVQPINK  237

Query  835  REIYLLSP  858
            R + L  P
Sbjct  238  RVVKLFRP  245



>ref|XP_002445625.1| hypothetical protein SORBIDRAFT_07g022890 [Sorghum bicolor]
 gb|EES15120.1| hypothetical protein SORBIDRAFT_07g022890 [Sorghum bicolor]
Length=281

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 179/256 (70%), Gaps = 7/256 (3%)
 Frame = +1

Query  109  STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHH  288
            + RAQE E E EF Y  G E GP  WG +K+EWAAC  G +QSPID+SHERV ++ +  +
Sbjct  29   AARAQETEHEEEFSYIPGDEHGPEHWGRIKEEWAACGTGRLQSPIDLSHERVSLVRSLGY  88

Query  289  EMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYAL  468
             +   Y+PA A++ NRGHDI + + GDAGS++INGT Y+LK  HWHSP+EHT++GRRY +
Sbjct  89   -LHHSYRPAEASIVNRGHDIMVRFEGDAGSLVINGTAYYLKQLHWHSPAEHTVDGRRYDM  147

Query  469  ELHMVHQNTDQNLTNQIAVIGVLYKIGK-PDAFLSKLMRNISSMID-RDVEKELGMFDPS  642
            ELH+VH++ D+    + AVI +LY++G+  DAFL  L   I  + D RD E+ +G+ DP 
Sbjct  148  ELHLVHESADK----KAAVIAILYEVGRHEDAFLRHLEPFIRRIADVRDREERVGVVDPR  203

Query  643  DIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQ  822
              +  +  +YRYMGSLT PPCTEGVIWTI K+VR+ S+ Q++LLREAVHD  E NARPLQ
Sbjct  204  RARGTASVYYRYMGSLTAPPCTEGVIWTIVKRVRSVSKYQLELLREAVHDDMENNARPLQ  263

Query  823  ALNRREIYLLSPAGKK  870
              N R I +  P   K
Sbjct  264  EANNRHISIFRPKPDK  279



>ref|XP_002323272.2| hypothetical protein POPTR_0016s04300g [Populus trichocarpa]
 gb|EEF05033.2| hypothetical protein POPTR_0016s04300g [Populus trichocarpa]
Length=283

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/281 (49%), Positives = 187/281 (67%), Gaps = 15/281 (5%)
 Frame = +1

Query  16   SVVLASFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGEL  195
            ++ + SF  +   I+V+ SL +   L          EVEDE +F Y EG+E+GP+ WG++
Sbjct  11   NINMMSFLLLVSLIIVSYSLAISLAL--------ESEVEDETQFTYEEGTEEGPKNWGKI  62

Query  196  KKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAG  375
               W AC  G MQSPID+   RV++   +  ++R+ Y+ A A V+NRGHDI + W GDAG
Sbjct  63   NPHWEACGKGKMQSPIDVLDRRVEVFP-NLGKLRRDYQAAPAAVKNRGHDITVIWKGDAG  121

Query  376  SVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKP  555
             + IN TDY L+  HWHSPSEHT NG R+ LELH+VH ++       IAV+ ++YK G+P
Sbjct  122  KITINDTDYQLQQCHWHSPSEHTFNGSRHDLELHLVHYSSQGG----IAVVAIVYKYGRP  177

Query  556  DAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINK  735
            D FLSKL+R+I+ +  R  E+E+G+ +P DIK  S+++YRY+GSLTVPPCTEGV+WTI  
Sbjct  178  DRFLSKLLRHINHVDHR--EREMGIVNPGDIKFGSRKYYRYVGSLTVPPCTEGVVWTIVM  235

Query  736  KVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            KVRT SR+Q+K LR+AVHD  E NARP Q      +Y   P
Sbjct  236  KVRTVSREQVKALRDAVHDGFEANARPTQPSTGIPMYEYRP  276



>ref|XP_006294831.1| hypothetical protein CARUB_v10023883mg [Capsella rubella]
 gb|EOA27729.1| hypothetical protein CARUB_v10023883mg [Capsella rubella]
Length=259

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 181/253 (72%), Gaps = 19/253 (8%)
 Frame = +1

Query  76   ILCFVLFL-----------HPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            I CF +FL             A+T ++EVE+EREF Y +  E GP +WG++K EWA C  
Sbjct  6    IQCFFIFLVLTSFVTTVSCLSATTDSREVENEREFSYEQNKENGPSKWGKIKPEWAMCGK  65

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDA-GSVIINGTD  399
            GD+QSPID++++RV I+T H  ++ K YKP NAT+ NRGHD+ + + G+  GS ++NGTD
Sbjct  66   GDLQSPIDLTNKRVTIVT-HFQKLTKDYKPCNATLINRGHDMMLRFEGEGPGSFMVNGTD  124

Query  400  -YFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL  576
             Y L   HWHSPSEHTINGRR+ALELH+VH+N + +L    AV+ VLYKIG+PD+FL  L
Sbjct  125  EYKLLQLHWHSPSEHTINGRRFALELHLVHENINGSL----AVVTVLYKIGRPDSFLRSL  180

Query  577  MRNISSMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTAS  753
             + +S + D+ + +K + M DP  IK+ S+++YRY+GSLT PPCT+ VIWTI +KVRT +
Sbjct  181  EKKLSVITDQSEAKKNVEMIDPKSIKIGSRKYYRYLGSLTTPPCTQNVIWTIVRKVRTVT  240

Query  754  RKQIKLLREAVHD  792
            R Q++LLR AVHD
Sbjct  241  RNQVRLLRVAVHD  253



>ref|XP_008462835.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Cucumis melo]
Length=270

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/258 (53%), Positives = 183/258 (71%), Gaps = 7/258 (3%)
 Frame = +1

Query  76   ILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
            I C  L +   +  +QEV DE EFDY E  EKGP  WG+LK EW +C  G+MQSPID+ H
Sbjct  13   IFCAFLLVSRLAI-SQEV-DETEFDYNEEGEKGPTHWGDLKPEWHSCKTGEMQSPIDLLH  70

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPS  435
            ERV+I++    ++   YKP NAT++NRGHDI ++    AG +++N T YFL+  HWHSPS
Sbjct  71   ERVRIVSLFT-DIDFDYKPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPS  129

Query  436  EHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVE  615
            EHTING+R+ALE H+VHQ+ + N     AVIGV+YKIG+PD+FLSK+  N+  + +   E
Sbjct  130  EHTINGKRFALEAHLVHQSQNGNY----AVIGVVYKIGRPDSFLSKMKENLEEISNTHEE  185

Query  616  KELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDY  795
            K L + D S ++M+S  +YRY+GSLT PPC++ V+WTI +KVRT + +QIKLLR A HD 
Sbjct  186  KALDVIDLSLLEMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTVEQIKLLRVAAHDD  245

Query  796  AERNARPLQALNRREIYL  849
            +  NARPLQ +N R+I L
Sbjct  246  SNTNARPLQPINDRKIQL  263



>emb|CDX84811.1| BnaA03g14190D [Brassica napus]
Length=242

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/245 (54%), Positives = 173/245 (71%), Gaps = 9/245 (4%)
 Frame = +1

Query  127  VEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHY  306
            VEDE EF Y    E GP +WG+LK EW  C  G+MQSPID+ ++RVKI++ H   + + Y
Sbjct  3    VEDESEFSYEGNQENGPEKWGKLKPEWKMCGKGEMQSPIDLMNKRVKIVS-HLGRLTRDY  61

Query  307  KPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVH  486
            KPANAT+RNRGHD+ + +    GS+ IN  +Y L   HWHSPSEHTINGRR+ALELHMVH
Sbjct  62   KPANATLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPSEHTINGRRFALELHMVH  121

Query  487  QNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFDPSDIKMRSK  663
                +++   +AV+ VLYKIG+PD+FLS L   + ++ D  + E  +GM DP DIK  S+
Sbjct  122  ----ESINGSMAVVTVLYKIGRPDSFLSLLENKLCAITDHNEAEINIGMIDPKDIKFGSR  177

Query  664  RHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREI  843
            ++YRY+GSLT+PPCT+ VIWT+ KKVRT SR Q+KLLR A   Y++ NARP+Q  N R +
Sbjct  178  KYYRYIGSLTIPPCTQNVIWTVIKKVRTVSRNQVKLLRVA---YSDTNARPVQPTNMRTV  234

Query  844  YLLSP  858
             L  P
Sbjct  235  KLYRP  239



>ref|XP_007028635.1| Alpha carbonic anhydrase 4, putative [Theobroma cacao]
 gb|EOY09137.1| Alpha carbonic anhydrase 4, putative [Theobroma cacao]
Length=279

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 184/269 (68%), Gaps = 11/269 (4%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
            +IL   SL  C++L +  AS    EV +E  F Y EG+ KGP+ WG +   W  C  G +
Sbjct  15   AILCISSL--CYLLPICFASY--AEVGNEIPFTYTEGTGKGPKEWGHINPHWKLCDTGKL  70

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+  E+V+++     ++++ YKPA A V+NRGHDI + W GDAG + INGTDY L 
Sbjct  71   QSPIDLLSEKVQVLPKLG-KLKRDYKPAPAVVKNRGHDITVRWEGDAGKININGTDYKLL  129

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHT NG R+ LELH+VH +       +IAV+ +++K G+PD FL++L  +I 
Sbjct  130  QCHWHSPSEHTFNGTRHELELHIVHLSAH----GEIAVVAIVFKYGRPDRFLARLFHHIK  185

Query  592  SMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
            +M +   EK LGM +P DIK  S+++YRY+GSLTVPPCTEGV+WTI KKVRTA+R+Q++ 
Sbjct  186  TMGNE--EKNLGMVNPGDIKFGSRKYYRYIGSLTVPPCTEGVVWTIVKKVRTATREQVRA  243

Query  772  LREAVHDYAERNARPLQALNRREIYLLSP  858
            LR+AVHD  E NARP Q L+ R +   +P
Sbjct  244  LRDAVHDGFEANARPTQRLDERPVLFYAP  272



>ref|XP_009148066.1| PREDICTED: alpha carbonic anhydrase 7-like [Brassica rapa]
Length=272

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 187/263 (71%), Gaps = 7/263 (3%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            +IL F+     AS+   EVEDE EF+Y +  +KGP RWGE+K EW  C  G++QSPI++ 
Sbjct  14   IILNFISLSTAASSHG-EVEDEHEFNYKKNDDKGPERWGEIKPEWEMCGKGEIQSPIELM  72

Query  253  HERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSP  432
            +ERVKI++ H   + + Y+ +NAT++NRGHDI +++   AGS+ ING  Y L+  HWHSP
Sbjct  73   NERVKIVS-HLGRLIRDYEASNATIKNRGHDIMLKFEAGAGSIKINGFQYELQQLHWHSP  131

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RD  609
            SEHT+NGRR+ALELHMVH+  +     ++AV+ VLYKIG+ D F+  L + + ++ D  D
Sbjct  132  SEHTVNGRRFALELHMVHEGKN----GRMAVVTVLYKIGRADTFIRSLEKELEAITDLDD  187

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
             EK + M DP  IK+ S+++YRY+GSLT PPCT+ V W++ +K+RT +R+Q++LLR AVH
Sbjct  188  AEKHVRMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVH  247

Query  790  DYAERNARPLQALNRREIYLLSP  858
            D +  NARP+Q +N+R + L  P
Sbjct  248  DDSLTNARPVQPINKRVVRLYRP  270



>ref|XP_010470128.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X2 [Camelina 
sativa]
Length=276

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 189/270 (70%), Gaps = 12/270 (4%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
            + + G+++ C       A+   +EVEDE EF Y    E GP+ WG+LK EW  C  G+MQ
Sbjct  14   LTILGTIVSC-----SSAAKNDREVEDESEFSYEHNKENGPKNWGKLKPEWNMCGKGEMQ  68

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGD-AGSVIINGTDYFLK  411
            SPID+ ++RVK+++ H  ++ ++YKP+NAT++NRGHD+ +++  + AGS  INGT+Y L 
Sbjct  69   SPIDLMNKRVKLVS-HLGKLSRNYKPSNATLKNRGHDMMLKFGEEGAGSFKINGTEYRLL  127

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHTING R+ALELHMVH++ + ++    AV+ VLYKIG+P++FL  L   + 
Sbjct  128  QLHWHSPSEHTINGXRFALELHMVHESKNGSM----AVVTVLYKIGRPNSFLKLLEHKLV  183

Query  592  SMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
            ++ D+ D E+ + M DPS IK  S+ +YRY+GSLT PPCT+ + WTI KK+RT S+ Q+ 
Sbjct  184  AITDQHDAERNVVMIDPSKIKTESRNYYRYIGSLTTPPCTQNITWTILKKIRTVSKSQVN  243

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSP  858
            LLR AVHD +  NARP+Q  N+R I+L  P
Sbjct  244  LLRVAVHDDSNSNARPVQPANKRVIHLYRP  273



>ref|XP_006340168.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   275 bits (702),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 186/261 (71%), Gaps = 7/261 (3%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMS  252
            L L F+   +       EV+DE EF Y   SE GP  WGE+  EW  C++G +QSPID+ 
Sbjct  12   LFLSFLFLTNAFIATCHEVDDESEFSYDRESENGPTHWGEINPEWKMCNSGKLQSPIDLL  71

Query  253  HERVKIITTHHHEMRKHYKPAN-ATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            +ERV++++ H   + + YK ++ AT+ NRGHD+ + W G AG + INGT Y L  AHWHS
Sbjct  72   NERVEVVS-HLGRLHRSYKTSSYATLLNRGHDMMLRWEGGAGHIKINGTKYQLNQAHWHS  130

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMI-DR  606
            PSEHTINGRR+ LE+H+VH++ D     + AV+G++YKIG+ D FL+ +  ++ ++   +
Sbjct  131  PSEHTINGRRFDLEVHLVHESED----GKTAVVGIMYKIGRADPFLTMIESDLKALAHTK  186

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            +VE+ +G+ DP  +K+ S+++YRY+GSLTVPPCT+ V+WTI +KVRT +++Q+KL+REAV
Sbjct  187  NVERNIGVIDPKKVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAV  246

Query  787  HDYAERNARPLQALNRREIYL  849
            HD +E N+RP+QA N+R I L
Sbjct  247  HDESETNSRPVQATNKRTIRL  267



>ref|XP_006489872.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=273

 Score =   275 bits (702),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/268 (50%), Positives = 184/268 (69%), Gaps = 8/268 (3%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
             ++  SLIL   L+ +  +    EV+DE  F Y E + KGP  WG++   W  C  G +Q
Sbjct  9    FIILASLILSSHLY-NLVNADDSEVDDETPFSYKEETGKGPSEWGKISPHWRVCGIGKLQ  67

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKS  414
            SPID+ ++RV+++     ++++ YKPA A V+NRGHDI + W GDAG + INGT Y L  
Sbjct  68   SPIDLLNQRVQVLPALG-KLKRDYKPALAVVKNRGHDICVWWRGDAGKMHINGTIYKLLQ  126

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISS  594
             HWH+PSEHTING  Y +ELH+VH ++D     ++AV G++Y+ G+PD FLSKL+ +I S
Sbjct  127  CHWHTPSEHTINGSSYEMELHLVHLSSD----GKLAVTGIVYEYGRPDPFLSKLLHHIKS  182

Query  595  MIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLL  774
            +     EKE+G+ +P DIK  S+++YRY+GSLTVPPCTEGVIWTI KKVRT SR+Q++ L
Sbjct  183  LGKE--EKEVGIVNPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIGKKVRTVSREQVRAL  240

Query  775  REAVHDYAERNARPLQALNRREIYLLSP  858
            +E VHD  E+NARP   LN R I+  SP
Sbjct  241  KEEVHDGYEKNARPTNELNGRPIWFYSP  268



>ref|XP_010521744.1| PREDICTED: alpha carbonic anhydrase 7-like [Tarenaya hassleriana]
Length=274

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 183/264 (69%), Gaps = 7/264 (3%)
 Frame = +1

Query  73   LILCFVLFLHP-ASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            L +C  +  H  A+    E EDE EF+Y    E+GP+ WG+LK EW  C  G MQSPID+
Sbjct  13   LFVCVTVISHSNAAPGDGETEDEHEFNYEMEGERGPKNWGKLKPEWKMCGRGKMQSPIDL  72

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
             ++RV+I++ H   +++ Y+P+NAT++NRGHD+ + +   AG + + G  Y L+  HWHS
Sbjct  73   LNKRVRIVS-HLGRLKRDYRPSNATLKNRGHDMMLRFEDGAGRIHVKGRPYTLRQIHWHS  131

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-  606
            PSEHTING+R+ALELHMVH++ +     + AV+ +LYKIG+PD FL  L   +  + D+ 
Sbjct  132  PSEHTINGKRFALELHMVHESKN----GRFAVVTILYKIGRPDTFLQSLENGLEEVSDKH  187

Query  607  DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
            + EK +G+ DP  IK  S+++YRY+GSLT PPCT+ V+WT+ KKVRT +R+Q++LLR +V
Sbjct  188  EAEKNIGIIDPKKIKFGSRKYYRYIGSLTTPPCTQNVVWTVLKKVRTVTREQVRLLRVSV  247

Query  787  HDYAERNARPLQALNRREIYLLSP  858
            HD +  NARP+Q  N+R +YL  P
Sbjct  248  HDDSNSNARPIQRRNKRRVYLYRP  271



>ref|XP_010470127.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X1 [Camelina 
sativa]
Length=277

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 186/274 (68%), Gaps = 18/274 (7%)
 Frame = +1

Query  76   ILCFVLFLH----------PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNG  225
            I CF+  +            A+T  +EVEDEREF Y    E GP +WG+LK EW  C  G
Sbjct  6    IQCFIFLVLTSFVATVWCLSATTDYREVEDEREFSYERKKENGPEKWGKLKPEWKLCGKG  65

Query  226  DMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGD--AGSVIINGTD  399
            ++QSPID+ ++RV+++T    ++ K YKP NAT+ NRGHD+ + +  +  +GS+ INGT+
Sbjct  66   ELQSPIDLMNKRVRLVT-DFQKLTKDYKPCNATLINRGHDMMLRFEEEEGSGSLKINGTE  124

Query  400  YFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLM  579
            Y L   HWHSPSEHTINGRR+ALELHMVH++ + ++    AV+ VLYKIG+P++FL  L 
Sbjct  125  YKLLQLHWHSPSEHTINGRRFALELHMVHESKNGSM----AVVTVLYKIGRPNSFLKLLE  180

Query  580  RNISSMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASR  756
              + ++ D+ D E+ + M DPS IK  S+ +YRY+GSLT PPCT+ + WTI KK+RT S+
Sbjct  181  HKLVAITDQHDAERNVVMIDPSKIKTESRNYYRYIGSLTTPPCTQNITWTILKKIRTVSK  240

Query  757  KQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
             Q+ LLR AVHD +  NARP+Q  N+R I+L  P
Sbjct  241  SQVNLLRVAVHDDSNSNARPVQPANKRVIHLYRP  274



>ref|XP_010510673.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   274 bits (701),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 189/270 (70%), Gaps = 12/270 (4%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
            + + G+++ C       A+   +EVEDE EF Y    E GP+ WG+LK EW  C  G+MQ
Sbjct  14   LTILGTIVSC-----SSAAENDREVEDESEFSYEHNKENGPKNWGKLKPEWNMCGKGEMQ  68

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGD-AGSVIINGTDYFLK  411
            SPID+ ++RVK+++ H  ++ ++YKP+NAT++NRGHD+ +++  + AGS  INGT+Y L 
Sbjct  69   SPIDLMNKRVKLVS-HLGKLSRNYKPSNATLKNRGHDMMLKFGEEGAGSFKINGTEYKLL  127

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHTINGRR+ALELHMVH++ + ++    AV+ VLYKIG+P++FL  L   + 
Sbjct  128  QLHWHSPSEHTINGRRFALELHMVHESKNGSM----AVVTVLYKIGRPNSFLKLLEHKLV  183

Query  592  SMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIK  768
            ++ D+ D E+ + M DPS IK  S+ +YRY+GSLT PPCT+ + WTI KKV   S+ Q+ 
Sbjct  184  AITDQHDAERNVIMIDPSKIKTESRNYYRYIGSLTTPPCTQNITWTILKKVXXVSKSQVN  243

Query  769  LLREAVHDYAERNARPLQALNRREIYLLSP  858
            LLR AVHD ++ NARP+Q  N+R I+L  P
Sbjct  244  LLRVAVHDDSDSNARPVQPTNKRVIHLYRP  273



>ref|XP_003574630.1| PREDICTED: alpha carbonic anhydrase 7-like [Brachypodium distachyon]
Length=276

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/271 (50%), Positives = 184/271 (68%), Gaps = 6/271 (2%)
 Frame = +1

Query  49   RSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGD  228
            R++LV  S  +  +    PA+   +E + E EF Y+  +E GP  WGE+K+EW+AC  GD
Sbjct  5    RALLVLFSAAVLLLAAAVPAARAQEETDREEEFSYSLDAENGPAHWGEIKEEWSACGKGD  64

Query  229  MQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFL  408
            MQSPID+S  RV ++    + +   Y+PA A++ NRGHDI + + GDAGSV INGT Y+L
Sbjct  65   MQSPIDLSSPRVSLVRGLGY-LNHSYRPAQASIVNRGHDIMVRFEGDAGSVSINGTAYYL  123

Query  409  KSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNI  588
            +  HWHSPSEH++NGRRY +E+HMVH++      N+ AVIGV Y++G  DAFL KL   +
Sbjct  124  RQLHWHSPSEHSLNGRRYDMEMHMVHESAQ----NKAAVIGVFYQVGAHDAFLHKLEPYL  179

Query  589  SSMIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQI  765
              + D+ D E+++G+ DP   + R+  +YRYMGSLT PPC EGVIWTI K+VRT S  Q+
Sbjct  180  EMIADKKDREEKVGLIDPRGARGRASVYYRYMGSLTTPPCAEGVIWTIVKRVRTVSSAQL  239

Query  766  KLLREAVHDYAERNARPLQALNRREIYLLSP  858
            +LLREAVHD  E+NARP Q  N R I +  P
Sbjct  240  ELLREAVHDDMEKNARPRQETNNRVISMFRP  270



>gb|EYU20767.1| hypothetical protein MIMGU_mgv1a019017mg, partial [Erythranthe 
guttata]
Length=240

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/243 (53%), Positives = 166/243 (68%), Gaps = 6/243 (2%)
 Frame = +1

Query  133  DEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKP  312
            DE  F Y   SEKGP++WG+L  EW  C NG  QSPI++ H +    +    +++K YKP
Sbjct  1    DEHPFTYVGESEKGPKKWGQLNPEWQICENGKRQSPINLVHAKSSP-SPSLGKLKKTYKP  59

Query  313  ANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQN  492
            A+A ++NRGHDI + W GDAG V+INGT+Y L   HWH+PSEH +NGR   +E HMVH N
Sbjct  60   AHAVIKNRGHDIMVAWRGDAGGVVINGTEYKLVQCHWHTPSEHRVNGRSLNMEFHMVHNN  119

Query  493  TDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHY  672
            +       IAV+G+LY +G+PD FL K + +I+S++  +   +LG+  P DIK  S++++
Sbjct  120  SQ----GHIAVVGILYTLGRPDTFLEKFLEHITSLVGEE-GIDLGIVSPRDIKFGSRKYF  174

Query  673  RYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLL  852
            RYMGSLTVPPCTEGVIWTI  KVRT SR+QI+ LR AVHD  E NARP Q    R IYL 
Sbjct  175  RYMGSLTVPPCTEGVIWTIIDKVRTVSREQIRALRNAVHDGFEENARPPQPWGGRNIYLY  234

Query  853  SPA  861
             PA
Sbjct  235  GPA  237



>gb|ABK22387.1| unknown [Picea sitchensis]
Length=271

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 182/270 (67%), Gaps = 10/270 (4%)
 Frame = +1

Query  43   MRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            M RS++      + F L L  A  R QE++DEREF+Y EG  KGP  WGELK+EW AC  
Sbjct  1    MARSVI---PAFIAFALILFIAGVRTQEIDDEREFEYKEGP-KGPEHWGELKEEWKACGR  56

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G  QSPID+  +R  II+ +   + + Y PANAT+ NRGHDI + W   AGSV I G  +
Sbjct  57   GTQQSPIDVV-KRNAIISPNLGTLHRIYHPANATLVNRGHDIMVNWSEGAGSVEIKGKRF  115

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
             LK  HWH+P+EHTI+G+++ LE+H+VHQ  D     +IAVIG++++ G+PD FL++L  
Sbjct  116  TLKQCHWHTPAEHTIDGKQHPLEIHLVHQAVD----GEIAVIGIIFEFGRPDTFLAELRD  171

Query  583  NISSMIDRDVE-KELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRK  759
             I ++   +   K LGM DP DIK  S+++YRYMGSLT PPCTEGVIW +  +VRT S  
Sbjct  172  AIMAIAHMEPPVKPLGMVDPYDIKFDSRKYYRYMGSLTTPPCTEGVIWNVIDEVRTVSED  231

Query  760  QIKLLREAVHDYAERNARPLQALNRREIYL  849
            Q++ L+EAVHD  E+NARP+Q LN R + L
Sbjct  232  QVRALQEAVHDGYEKNARPIQPLNGRIVGL  261



>gb|KGN64825.1| hypothetical protein Csa_1G120410 [Cucumis sativus]
Length=254

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 175/245 (71%), Gaps = 6/245 (2%)
 Frame = +1

Query  118  AQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMR  297
            +QEVEDE EFDY E  EKGP  WG+LK EW +C  G MQSPID+ HERV+I +   + + 
Sbjct  8    SQEVEDETEFDYNEEGEKGPTHWGDLKPEWHSCKTGHMQSPIDLLHERVRIASLFTN-IE  66

Query  298  KHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELH  477
             +YKP NAT++NRGHDI ++    AG +++N T YFL+  HWHSPSEHTINGRR+ALE H
Sbjct  67   FNYKPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHTINGRRFALEAH  126

Query  478  MVHQNTDQNLTNQIAVIGVLYKIGK-PDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKM  654
            +VHQ+ + N     AVIGV+Y IG+ PD  LSK+  N+  + D   EK L + D S +KM
Sbjct  127  LVHQSQNGNY----AVIGVVYNIGRRPDYLLSKMKENLEEISDTCEEKALDVIDLSMLKM  182

Query  655  RSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNR  834
            +S  +YRY+GSLT PPC++ V+WTI +KVRT + +Q+KLLR A HD +  NARPLQ +N 
Sbjct  183  QSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTTEQVKLLRVASHDDSNTNARPLQPIND  242

Query  835  REIYL  849
            R+I L
Sbjct  243  RKIQL  247



>ref|XP_002445624.1| hypothetical protein SORBIDRAFT_07g022880 [Sorghum bicolor]
 gb|EES15119.1| hypothetical protein SORBIDRAFT_07g022880 [Sorghum bicolor]
Length=280

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 182/257 (71%), Gaps = 6/257 (2%)
 Frame = +1

Query  103  PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
            PA+   +E E E EF Y  G E GP  WG +K EWA CS G MQSPID+SHERV ++ + 
Sbjct  27   PAARGQEETEHEEEFSYVVGDENGPAHWGGIKAEWANCSAGRMQSPIDLSHERVSLVRSL  86

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRY  462
             + +   Y+PA+A++ NRGHDI + ++GDAGS++I+GT Y+L+  HWHSP+EHT++GRRY
Sbjct  87   GY-LTHSYRPADASIVNRGHDIMVRFNGDAGSLVIHGTAYYLRQMHWHSPTEHTVDGRRY  145

Query  463  ALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DVEKELGMFDP  639
             +ELH+VHQ     L N+ AVIG+LY+IG  D FL  L   I  + DR D E+ +G+ DP
Sbjct  146  DMELHLVHQT----LANKTAVIGILYEIGGEDPFLQALEPFIHRIADRKDREEPVGVVDP  201

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
               + R+  +YRYMGSLT PPCTEGVIWT+ K+VRT S+ Q++LLREAVHD  E+NARP+
Sbjct  202  RRARGRASVYYRYMGSLTTPPCTEGVIWTVVKRVRTVSKHQMELLREAVHDGMEKNARPV  261

Query  820  QALNRREIYLLSPAGKK  870
            Q +N R+I +  P   K
Sbjct  262  QDVNDRDISIFRPKPHK  278



>ref|XP_008464600.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like [Cucumis 
melo]
Length=278

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 172/245 (70%), Gaps = 6/245 (2%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            EV DE  F Y EG+  GP+ WG+LK EW +C  G  QSPI++  E V+++  +  ++ + 
Sbjct  38   EVGDESLFSYNEGNGNGPKEWGKLKPEWKSCGKGKYQSPINIVEEDVQVLP-NLGKLTRD  96

Query  304  YKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            Y PA A ++NRGHDI I W  DAG + +NGT Y L   HWH+PSEH+ NG+RY LE+H+V
Sbjct  97   YNPAPAILKNRGHDILIRWEKDAGKITMNGTKYKLSQCHWHAPSEHSFNGKRYDLEMHIV  156

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSK  663
            H +      N+ AV+ +LYK G+PD FLS+L  +I S I +  EKE+GM +P DIK   +
Sbjct  157  HTSNH----NETAVVAILYKFGRPDRFLSRLFHHIKS-IGKKEEKEIGMVNPGDIKFGGR  211

Query  664  RHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREI  843
            ++YRY+GSLTVPPCTEGVIWTI KKVRT SR+Q++ L+ A+HD  ++NARP+QAL+ R I
Sbjct  212  KYYRYIGSLTVPPCTEGVIWTIQKKVRTVSREQVRALKTAIHDGLKKNARPIQALDGRRI  271

Query  844  YLLSP  858
               +P
Sbjct  272  QFYTP  276



>gb|EMT00558.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=284

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 184/269 (68%), Gaps = 10/269 (4%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
            +L + S+IL  V    PA+   QE E E EF Y+  +E GP  WGE+K+EW+AC  G++Q
Sbjct  19   LLFSASIILSAV----PAARAQQETEHEEEFSYSLDAENGPAHWGEIKEEWSACGKGEIQ  74

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKS  414
            SPID++  RV ++    H +   Y PANA++ NRGHDI + + GDAGSV I+GT Y L+ 
Sbjct  75   SPIDLAGPRVTLVRRLGH-LNHSYAPANASIVNRGHDIMVRFEGDAGSVSIDGTAYHLRQ  133

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISS  594
             HWH+P+EH++NGRRY +ELHMVHQ+       + AVIGVLY+IG  DA L KL   +  
Sbjct  134  LHWHAPTEHSVNGRRYDMELHMVHQSAQ----GKAAVIGVLYEIGARDALLHKLEPYLEM  189

Query  595  MI-DRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
            +   RD ++++G+ D    + R+  +YRY+GSLT PPCT+GVIWTI K+VRT S+ Q++L
Sbjct  190  IAKQRDRQEKVGVVDARGARGRASVYYRYVGSLTTPPCTQGVIWTIVKRVRTVSKHQLEL  249

Query  772  LREAVHDYAERNARPLQALNRREIYLLSP  858
            LREAVHD  E+NARP Q LN R+I +  P
Sbjct  250  LREAVHDEMEKNARPRQELNSRDISMFWP  278



>ref|XP_002445628.1| hypothetical protein SORBIDRAFT_07g022910 [Sorghum bicolor]
 gb|EES15123.1| hypothetical protein SORBIDRAFT_07g022910 [Sorghum bicolor]
Length=281

 Score =   272 bits (696),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 176/256 (69%), Gaps = 6/256 (2%)
 Frame = +1

Query  109  STRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHH  288
            + RAQE E E EF Y  G E GP  WG +K EWAAC  G MQSPID+SHERV ++ +  +
Sbjct  28   AARAQETEHEEEFSYIPGDEHGPEHWGHIKAEWAACGTGRMQSPIDLSHERVSLVRSLGY  87

Query  289  EMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYAL  468
             +   Y+PA A++ NRGHDI + + GDAGS++INGT Y+LK  HWHSP+EHT++G R+ +
Sbjct  88   -LHHSYRPAEASIVNRGHDIMVRFEGDAGSLVINGTAYYLKQLHWHSPAEHTVDGHRHDM  146

Query  469  ELHMVHQNTDQNLTNQIAVIGVLYKIGK-PDAFLSKLMRNISSMID-RDVEKELGMFDPS  642
            ELH+VH++ D     + AVI +LY++G+  DAFL  L   I  + D RD E+ +G+ DP 
Sbjct  147  ELHLVHESADDK---KAAVIAILYEVGRHEDAFLRHLEPFIRRIADVRDREERVGVVDPR  203

Query  643  DIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQ  822
              +  +  +YRYMGSLT PPCTEGVIWTI K+VR+ S+ Q++LLREAVHD  E NARPLQ
Sbjct  204  RARGTASVYYRYMGSLTAPPCTEGVIWTIVKRVRSVSKYQLELLREAVHDDMEDNARPLQ  263

Query  823  ALNRREIYLLSPAGKK  870
              N R I +  P   K
Sbjct  264  EANNRRISIFRPKPDK  279



>gb|EYU18694.1| hypothetical protein MIMGU_mgv11b010420mg [Erythranthe guttata]
Length=248

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 172/244 (70%), Gaps = 7/244 (3%)
 Frame = +1

Query  130  EDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYK  309
            EDE  F YA  +EKGP  WG L  +W AC NG +QSPID+  +RV ++      +R+ YK
Sbjct  6    EDESPFTYAAQTEKGPNNWGSLNPKWEACKNGRLQSPIDLIDQRV-VLLPKLGSLRRTYK  64

Query  310  PANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQ  489
            PA A ++NRGHDI + W GDAG VI+NGT+Y L   HWH+PSEHTI+G+R+ +E+HM+H+
Sbjct  65   PAPAVIKNRGHDITVAWEGDAGGVIVNGTEYKLLQCHWHTPSEHTIDGKRFKMEIHMIHK  124

Query  490  NTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRH  669
            +++      I+V+G+LYK+G+PD FL+K+++NI  +    V    G+ DP  IK  S+++
Sbjct  125  SSE----GHISVVGILYKLGRPDPFLAKILKNIKRVNHEGVNA--GVLDPWGIKFGSRKY  178

Query  670  YRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYL  849
             RY GSLTVPPCTEGV+WTI KKVRT S +QI+ LREAVHD  E+NARP Q  +  ++Y+
Sbjct  179  LRYNGSLTVPPCTEGVLWTILKKVRTVSEEQIRALREAVHDGFEKNARPTQHSDEIDVYM  238

Query  850  LSPA  861
              P 
Sbjct  239  YRPG  242



>ref|XP_008462774.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=276

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 175/260 (67%), Gaps = 6/260 (2%)
 Frame = +1

Query  70   SLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            S+   FVL L   +  +QEV+DE  F+Y E   KGP RWGEL  EW  C++G MQSPID+
Sbjct  12   SVFYAFVLLLSRPAV-SQEVDDESGFNYDEDGNKGPSRWGELNVEWQECNSGKMQSPIDL  70

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
             H+RV+I+     + +  YKP NAT++NRGHDI ++W  DAG + INGT YFLK  HWHS
Sbjct  71   LHKRVQIVPKFV-DFKIAYKPTNATLKNRGHDIMLKWSDDAGYIEINGTRYFLKQCHWHS  129

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
            PSEHTING ++ALE H+VHQ+ +      IAVIG+LY+ G PD FLS +  ++  + + +
Sbjct  130  PSEHTINGEKFALEAHLVHQSHN----GHIAVIGILYQFGHPDYFLSTIKEHLEEISETN  185

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
               E+   DPS ++M    +Y+Y GSLT PPCT+ V+W I KKVR+ +  Q++LLR AVH
Sbjct  186  EYIEVNDIDPSLLRMDISSYYQYFGSLTTPPCTQNVLWIIAKKVRSVAPSQVELLRVAVH  245

Query  790  DYAERNARPLQALNRREIYL  849
            D +  NARPLQ LN R I L
Sbjct  246  DDSNTNARPLQPLNNRMIQL  265



>ref|XP_006292541.1| hypothetical protein CARUB_v10018775mg [Capsella rubella]
 gb|EOA25439.1| hypothetical protein CARUB_v10018775mg [Capsella rubella]
Length=268

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 173/261 (66%), Gaps = 9/261 (3%)
 Frame = +1

Query  79   LCFVLFLHPASTRA-QEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
            L F+    P  + A  EV DE  F Y +  E GP  WG++  EW  C++G  QSPID+++
Sbjct  14   LFFICLSFPTISLADSEVVDETPFTYEQKKENGPEGWGQINPEWKVCNSGRFQSPIDLTN  73

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPS  435
            ERV +I  H    ++ YKPA A + NRGHDI + W GDAG V I  TD+ L   HWHSPS
Sbjct  74   ERVSLI--HDQAWKRQYKPAPAVITNRGHDIMVSWKGDAGKVTIRQTDFKLVQCHWHSPS  131

Query  436  EHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVE  615
            EHT+NG RY LELHMVH +       + AVIGVLYK+GKP+ FL+KL+  I S+  +++ 
Sbjct  132  EHTVNGTRYDLELHMVHTSAG----GRTAVIGVLYKLGKPNEFLAKLLNGIKSVGTKEI-  186

Query  616  KELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDY  795
             +LG+ DP +I+ ++++ YRY+GSLTVPPCTEGV+WT+ K+V T S +QI  LREAVHD 
Sbjct  187  -DLGVIDPREIRFQTRKFYRYIGSLTVPPCTEGVLWTVVKRVNTISMEQITALREAVHDG  245

Query  796  AERNARPLQALNRREIYLLSP  858
             E N+RP+Q    R ++   P
Sbjct  246  FETNSRPVQESKGRTVWFYDP  266



>ref|XP_008464591.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like [Cucumis 
melo]
Length=268

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 185/263 (70%), Gaps = 10/263 (4%)
 Frame = +1

Query  76   ILCFVLF----LHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPI  243
            ILC ++F    L     R+QEVEDER FDY    EKGP  WGEL+ EW  C  G MQSPI
Sbjct  4    ILCSLIFSSLLLFSLKARSQEVEDERGFDYERDGEKGPVHWGELRAEWHKCKGGLMQSPI  63

Query  244  DMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHW  423
            D+ HERV++I+ H  +++ +YK +NAT++NRGHD+ ++W    G + +NGT Y LK  HW
Sbjct  64   DLLHERVEVIS-HLGDLQINYKSSNATLKNRGHDMMMKWVDGGGYMEMNGTQYKLKQCHW  122

Query  424  HSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID  603
            HSPSEHTI+G+ + LE H+VH++++      ++VIG+LY+IG+PD FLS +  ++    +
Sbjct  123  HSPSEHTIDGKNFDLEAHLVHESSN----GMVSVIGILYQIGEPDYFLSTIKEDLEVASN  178

Query  604  -RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLRE  780
              + E+ +G+ DP+ +KM SK++YRY+GSLTVPPCTE V+WTI  +VRT + +Q+KLLR 
Sbjct  179  THEEERVVGIIDPNILKMGSKQYYRYIGSLTVPPCTEDVMWTIIHQVRTVTEEQVKLLRV  238

Query  781  AVHDYAERNARPLQALNRREIYL  849
            AVHD +  NARPLQ +  R + L
Sbjct  239  AVHDDSNSNARPLQPIYNRTMQL  261



>ref|NP_001147028.1| carbonic anhydrase precursor [Zea mays]
 gb|ACF88000.1| unknown [Zea mays]
 gb|ACG25129.1| carbonic anhydrase precursor [Zea mays]
 gb|AFW61792.1| carbonic anhydrase [Zea mays]
Length=277

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 179/257 (70%), Gaps = 6/257 (2%)
 Frame = +1

Query  103  PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
            PA+   +E E E EF Y  G E GP  WG +K EW  CS G MQSPID+SHERV ++ + 
Sbjct  24   PAARAQEETEHEEEFSYVVGDENGPEHWGSIKAEWGNCSAGRMQSPIDLSHERVSLVRSL  83

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRY  462
             + +   Y+PA A + NRGHDI + + GDAG ++INGT Y+LK  HWHSP+EHT++GRRY
Sbjct  84   GY-LTHSYRPAEAAIANRGHDIMVRFKGDAGFLVINGTAYYLKQMHWHSPTEHTVDGRRY  142

Query  463  ALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DVEKELGMFDP  639
             +ELH+VH+++     N+ AVIG+LY+IG  D FL  L  +I  + DR D E+ +G+ DP
Sbjct  143  DMELHLVHESS----ANKAAVIGMLYEIGAEDPFLQALEPSIHRIADRQDREEAIGVVDP  198

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
               + R+  +YRY+GSLT PPCTEGVIWT+ K+VRT SR Q++LLREAVHD  E+NARP+
Sbjct  199  RRARGRASVYYRYVGSLTTPPCTEGVIWTVVKRVRTVSRHQLELLREAVHDGMEKNARPV  258

Query  820  QALNRREIYLLSPAGKK  870
            Q +N R+I +  P   K
Sbjct  259  QDVNDRDISIFRPKPHK  275



>gb|ADW27480.1| carbonic anhydrase [Zea mays]
Length=277

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 178/253 (70%), Gaps = 6/253 (2%)
 Frame = +1

Query  103  PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
            PA+   +E E E EF Y  G E GP  WG +K EW  CS G MQSPID+SHERV ++ + 
Sbjct  24   PAARAQEETEHEEEFSYVVGDENGPEHWGSIKAEWGNCSAGRMQSPIDLSHERVSLVRSL  83

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRY  462
             + +   Y+PA A + NRGHDI + + GDAG ++INGT Y+LK  HWHSP+EHT++GRRY
Sbjct  84   GY-LTHSYRPAEAAIANRGHDIMVRFKGDAGFLVINGTAYYLKQMHWHSPTEHTVDGRRY  142

Query  463  ALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDR-DVEKELGMFDP  639
             +ELH+VH+++     N+ AVIG+LY+IG  D FL  L  +I  + DR D E+ +G+ DP
Sbjct  143  DMELHLVHESS----ANKAAVIGMLYEIGGEDPFLQALEPSIHRIADRQDREEAIGVVDP  198

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
               + R+  +YRY+GSLT PPCTEGVIWT+ K+VRT SR Q++LLREAVHD  E+NARP+
Sbjct  199  RRARGRASVYYRYVGSLTTPPCTEGVIWTVVKRVRTVSRHQLELLREAVHDGMEKNARPV  258

Query  820  QALNRREIYLLSP  858
            Q +N R+I +  P
Sbjct  259  QDVNDRDISIFRP  271



>emb|CDP11563.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 176/263 (67%), Gaps = 7/263 (3%)
 Frame = +1

Query  73   LILCFVLFLHPAS-TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
               CF+L     +  RAQE +D+  F Y E S +GP  WGELK+EW  CS+G MQSPID+
Sbjct  10   FCCCFILVTFACNLARAQEEDDQHGFSYDENSPRGPAHWGELKEEWCTCSHGRMQSPIDL  69

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
                V++  +   ++ +HY+P+NAT+ NRGHDI + W  DAG + I+GT Y L+  HWHS
Sbjct  70   PDAEVQVDPSLG-KLHRHYRPSNATLINRGHDIMLRWVDDAGYIRIDGTLYQLQQCHWHS  128

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
            P+EH ING RY LE H+VHQ+ D     +IAVIG+LYKIG+PD FLS L   + ++ D  
Sbjct  129  PTEHAINGERYDLEAHLVHQSPD----GKIAVIGILYKIGRPDPFLSMLEHYLEALADTL  184

Query  610  VEKE-LGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
             E+E +G  DP+ I   SK +YRY GSLT PPCTE V+WTI  KV T SR Q+KL+R AV
Sbjct  185  EEEEVVGFVDPNQITFGSKGYYRYSGSLTTPPCTEDVLWTIVDKVGTVSRHQVKLIRNAV  244

Query  787  HDYAERNARPLQALNRREIYLLS  855
            HD ++ NARPLQ +N R I L +
Sbjct  245  HDGSKMNARPLQPINDRPIRLYT  267



>ref|XP_010434249.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 173/263 (66%), Gaps = 9/263 (3%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQ-EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
              L F+    P  + A  EV+DE  F Y + +EKGP  WG +  EW  C+ G  QSPID+
Sbjct  11   FALFFIYLSFPKISLANSEVDDETPFTYEQKTEKGPEGWGNINPEWKVCNTGRFQSPIDL  70

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            ++ERV +I  H     + Y+PA A + NRGHDI + W GDAG V I  TD+ L   HWHS
Sbjct  71   TNERVSLI--HDQAWNRQYQPAPAVITNRGHDIMVSWKGDAGKVTIRETDFKLVQCHWHS  128

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
            PSEHT+NG RY LELHMVH +       + AVIGVLYK+GKP+ FL+KL+  I ++  ++
Sbjct  129  PSEHTVNGTRYDLELHMVHTSAG----GRTAVIGVLYKLGKPNEFLTKLLNGIKAVGQKE  184

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
            V  +LG+ DP +I+ ++++ +RY+GSLTVPPCTEGV+WT+ K+V T S +QI  LREAVH
Sbjct  185  V--DLGVIDPREIRFQTRKFFRYIGSLTVPPCTEGVLWTVVKRVNTISMEQITALREAVH  242

Query  790  DYAERNARPLQALNRREIYLLSP  858
            D  E N+RP+Q    R ++   P
Sbjct  243  DGFETNSRPVQESKGRSVWFYDP  265



>ref|XP_010090219.1| hypothetical protein L484_016558 [Morus notabilis]
 gb|EXB39088.1| hypothetical protein L484_016558 [Morus notabilis]
Length=252

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 171/236 (72%), Gaps = 7/236 (3%)
 Frame = +1

Query  91   LFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKI  270
             + H +  RA EV+DE  F Y EGS KGP+ WGE+   W  C  G +QSPID+  +RV++
Sbjct  15   FYSHFSICRALEVDDESPFTYVEGSGKGPKEWGEVDPHWQLCDKGKLQSPIDLLDQRVQV  74

Query  271  ITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTIN  450
              +   ++++ YKPA AT++NRGHDI ++W GDAG + INGTDY L   HWHSPSEHT N
Sbjct  75   FPSLG-KLKRDYKPAPATIKNRGHDITVKWKGDAGKININGTDYALLQCHWHSPSEHTFN  133

Query  451  GRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGM  630
            G R+ LELH++H+++    + +IAVI ++Y+ G PD FL++L  +I S+     E+ELG+
Sbjct  134  GTRFELELHVIHKSS----SGEIAVIAIVYEYGHPDPFLTRLFEHIKSISHE--ERELGI  187

Query  631  FDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYA  798
             +P DIK  S+++YRY+GSLTVPPCTEGVIWTI KKVRTASR+Q+  LR+AVHD +
Sbjct  188  VNPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTASREQVHALRQAVHDVS  243



>ref|XP_004139442.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 ref|XP_004170043.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN64831.1| hypothetical protein Csa_1G120470 [Cucumis sativus]
Length=276

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 177/264 (67%), Gaps = 6/264 (2%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            L+  S+    VL L   +  +QEV++E  F+Y E   KGP  WGELK+EW  C  G MQS
Sbjct  8    LLFCSIFYALVLLLSRPAV-SQEVDNESGFNYNEDGNKGPSHWGELKQEWHECKTGKMQS  66

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PID+SH+RV+I+     + +  Y P NAT+ NRGHDI ++W  DAG + INGT YFLK  
Sbjct  67   PIDLSHQRVQIVHKFV-DSKIAYNPTNATLMNRGHDIMLKWSDDAGYIEINGTRYFLKQC  125

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHTING ++ALE H+VHQ+ + N    IAVIG+LY IG  D FLS +  ++  +
Sbjct  126  HWHSPSEHTINGEKFALEAHLVHQSHNGN----IAVIGILYDIGHSDYFLSTIKEHLEEI  181

Query  598  IDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLR  777
             + +   EL   DPS ++M+S  +Y+Y GSLTVPPCT+ V+W I KKVR+ +  Q++LLR
Sbjct  182  SETNEYIELNDIDPSLVEMKSSIYYQYYGSLTVPPCTQNVLWIIVKKVRSVASYQLELLR  241

Query  778  EAVHDYAERNARPLQALNRREIYL  849
             AVHD +  NARP+Q LN R I L
Sbjct  242  VAVHDDSNTNARPVQPLNNRIIQL  265



>ref|XP_004139554.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=269

 Score =   269 bits (688),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 183/263 (70%), Gaps = 10/263 (4%)
 Frame = +1

Query  76   ILC----FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPI  243
            ILC    F L L      +QEVE+ER FDY    EKGP  WGEL+ EW  C  G MQSPI
Sbjct  4    ILCSLIFFSLLLFSLKATSQEVENERGFDYERDGEKGPTHWGELRAEWHKCKGGLMQSPI  63

Query  244  DMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHW  423
            D+ HERV++I+ H  +++ +YK +NAT++NRGHD+ ++W    G + +NGT Y LK  HW
Sbjct  64   DLLHERVEVIS-HLGDLQINYKSSNATLKNRGHDMMMKWVDGGGYMEMNGTQYKLKQCHW  122

Query  424  HSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID  603
            HSPSEHTI+G+ + LE H+VH++++      I+VIG+LY+IG+PD FLS +  ++    +
Sbjct  123  HSPSEHTIDGKTFDLEAHLVHESSN----GMISVIGILYQIGEPDYFLSTIEEDLEVASN  178

Query  604  -RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLRE  780
              + E+ +G+ DP+ +KM SK++YRY+GSLTVPPCTE V+WTI  +VRT + +Q+KLLR 
Sbjct  179  THEEERVIGIIDPNILKMGSKQYYRYIGSLTVPPCTENVMWTIIHQVRTVTEEQVKLLRV  238

Query  781  AVHDYAERNARPLQALNRREIYL  849
            AVHD ++ NARPLQ    R + L
Sbjct  239  AVHDDSDSNARPLQPFYDRTMQL  261



>ref|XP_010439535.1| PREDICTED: alpha carbonic anhydrase 4 [Camelina sativa]
Length=267

 Score =   269 bits (688),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 174/263 (66%), Gaps = 9/263 (3%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQ-EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
              L F+    P  + A  EV+DE  F Y + +EKGP  WG++  EW  C+ G  QSPID+
Sbjct  11   FALFFIYLSFPEISLANSEVDDETSFTYEQKTEKGPEGWGQINPEWKVCNTGRFQSPIDL  70

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            ++ERV +I  H     + Y+PA A + NRGHDI + W GDAG + I  TD+ L   HWHS
Sbjct  71   TNERVSLI--HDQAWNRQYQPAPAVITNRGHDIMVSWKGDAGKITIRQTDFKLVQCHWHS  128

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
            PSEHT+NG RY LELHMVH +       + AVIGVLYK+GKP+ FL+KL+  I ++ +++
Sbjct  129  PSEHTVNGTRYDLELHMVHTSA----RGRTAVIGVLYKLGKPNEFLTKLLNGIKAVGNKE  184

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
            V  +LG+ DP +I+ ++++ YRY+GSLTVPPCTEGV+WT+ K+V T S +QI  LREAV 
Sbjct  185  V--DLGVIDPREIRFQTRKFYRYIGSLTVPPCTEGVLWTVVKRVNTISMEQITALREAVD  242

Query  790  DYAERNARPLQALNRREIYLLSP  858
            D  E N+RP+Q    R ++   P
Sbjct  243  DGFETNSRPVQDSKGRSVWFYDP  265



>emb|CDP14169.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   268 bits (685),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 171/245 (70%), Gaps = 6/245 (2%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            E + E  F + EG+ KGP+ WG +  +W  C NG +QSPID+  ER +  + +   +++ 
Sbjct  5    EKKGEIPFTHQEGTGKGPKNWGHIDPQWQVCGNGKLQSPIDLLDERAQA-SPNFKGLKRA  63

Query  304  YKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            YKPA A ++NRGHDI +EW GDAG +I+NGTDY +   HWHSPSEH +NGRRY LELH+V
Sbjct  64   YKPAPAVLKNRGHDIMVEWTGDAGKIIVNGTDYKVLQCHWHSPSEHNLNGRRYNLELHLV  123

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSK  663
            H+N+        AV+G+LY++G+PD FL++L+ +I +  +     +LG+  P DIK  S+
Sbjct  124  HKNS----LGDTAVVGILYELGRPDPFLAQLLHHIKTT-EIGGAVDLGIVSPLDIKFVSR  178

Query  664  RHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREI  843
             +YRY+GSLTVPPCTEGV+WTI KKVRT SR+QIK + +AV D  E NARP+Q  N R++
Sbjct  179  NYYRYIGSLTVPPCTEGVLWTIIKKVRTVSREQIKAIEDAVRDGFEANARPIQQQNGRQV  238

Query  844  YLLSP  858
            Y   P
Sbjct  239  YFYGP  243



>gb|KCW47832.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=289

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 179/270 (66%), Gaps = 17/270 (6%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
             IL +  +     L L  +S    EV          G+ KGP+ WG++   W AC  G +
Sbjct  31   GILRSSFVFFALGLLLTLSSASESEV----------GTGKGPKEWGQIDPRWQACGMGKL  80

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+ +ERV++   +  ++++ YKPA A VRNRGHDI + W GDAG + INGT Y L 
Sbjct  81   QSPIDLLNERVQVFP-NLGKLKRDYKPAPAIVRNRGHDITVMWKGDAGKININGTYYKLL  139

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHT NG RY LELHMVH ++      +IAVIG++YK G+PD FL+KL+ +I+
Sbjct  140  QCHWHSPSEHTFNGSRYDLELHMVHLSSH----GEIAVIGIVYKYGRPDPFLTKLLEHIT  195

Query  592  SMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
             +   D +  LG+ +P  IK  S++++RY+GSLTVPPCTEGV+WTI +KVRT SRKQ++ 
Sbjct  196  VVGKEDTD--LGVINPGIIKFGSRKYFRYIGSLTVPPCTEGVVWTIVRKVRTVSRKQVEA  253

Query  772  LREAVHDYAERNARPLQALNRREIYLLSPA  861
            LREAVHD  E NARP Q L+ R ++L +P 
Sbjct  254  LREAVHDGYEANARPTQQLDGRAVWLYTPG  283



>ref|XP_004160913.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=269

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 184/263 (70%), Gaps = 10/263 (4%)
 Frame = +1

Query  76   ILCFVLF----LHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPI  243
            ILC ++F    L      +QEVE+ER FDY    EKGP  WGEL+ EW  C  G MQSPI
Sbjct  4    ILCSLIFFSLPLFSLKATSQEVENERGFDYERDGEKGPTHWGELRAEWHKCKGGLMQSPI  63

Query  244  DMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHW  423
            D+ HERV++I+ H  +++ +YK +NAT++NRGHD+ ++W    G + +NGT Y LK  HW
Sbjct  64   DLLHERVEVIS-HLGDLQINYKSSNATLKNRGHDMMMKWVDGGGYMEMNGTQYKLKQCHW  122

Query  424  HSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID  603
            HSPSEHTI+G+ + LE H+VH++++      I+VIG+LY+IG+PD FLS +  ++    +
Sbjct  123  HSPSEHTIDGKTFDLEAHLVHESSN----GMISVIGILYQIGEPDYFLSTIEEDLEVASN  178

Query  604  -RDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLRE  780
              + E+ +G+ DP+ +KM SK++YRY+GSLTVPPCTE V+WTI  +VRT + +Q+KLLR 
Sbjct  179  THEEERVIGIIDPNILKMGSKQYYRYIGSLTVPPCTENVMWTIIHQVRTVTEEQVKLLRV  238

Query  781  AVHDYAERNARPLQALNRREIYL  849
            AVHD ++ NARPLQ    R + L
Sbjct  239  AVHDDSDSNARPLQPFYDRTMQL  261



>ref|XP_011075357.1| PREDICTED: alpha carbonic anhydrase 4-like [Sesamum indicum]
Length=274

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 180/264 (68%), Gaps = 9/264 (3%)
 Frame = +1

Query  79   LCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHE  258
            L F       +    EVE+E  F Y   S++GP  WG L ++W AC  G +QSPID++ +
Sbjct  14   LLFCSLFITLNAHENEVENESPFTYDWNSDRGPGNWGNLNRKWKACGFGKLQSPIDLNDD  73

Query  259  RVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSE  438
            RV I+ T  + +++ Y+PA A ++NRGHDI + W GDAG V+INGT++ L+  HWH+PSE
Sbjct  74   RVSIVHTLGN-LKRTYEPAPAVIKNRGHDIMVAWEGDAGGVVINGTEFKLQQCHWHTPSE  132

Query  439  HTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDV--  612
            HT++G+R+ +E+HMVH+N+      QI+V+G+LYK+G+PD FL+KL++ +  +       
Sbjct  133  HTVDGKRFKMEIHMVHKNS----RGQISVVGILYKLGRPDPFLAKLLKQVQLLKHVKTVG  188

Query  613  --EKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAV  786
               K +G  DP  IK  S++++RY+GSLTVPPCTEGV+WTI KKVRT S +QI+ LR+AV
Sbjct  189  HEGKYVGFVDPWGIKFGSRKYFRYIGSLTVPPCTEGVLWTILKKVRTVSIEQIRALRDAV  248

Query  787  HDYAERNARPLQALNRREIYLLSP  858
            HD  E NARP+Q  +   +Y+  P
Sbjct  249  HDGFEENARPIQQSDDITVYMYRP  272



>gb|KDO48229.1| hypothetical protein CISIN_1g025618mg [Citrus sinensis]
Length=250

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 171/244 (70%), Gaps = 7/244 (3%)
 Frame = +1

Query  127  VEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHY  306
             +DE  F Y E + KGP  WG++   W  C  G +QSPID+ ++RV+++     ++++ Y
Sbjct  9    TDDETPFSYKEETGKGPSEWGKISPHWRVCGIGKLQSPIDLLNQRVQVLPALG-KLKRDY  67

Query  307  KPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVH  486
            KPA A V+NRGHDI + W GDAG + INGT Y L   HWH+PSEHTING  Y +ELH+VH
Sbjct  68   KPALAVVKNRGHDICVWWRGDAGKMHINGTIYKLLQCHWHTPSEHTINGSSYEMELHLVH  127

Query  487  QNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKR  666
             ++D     ++AV G++Y+ G+PD FLSKL+ +I S+     EKE+G+ +P DIK  S++
Sbjct  128  LSSD----GKLAVTGIVYEYGRPDPFLSKLLHHIKSLGKE--EKEVGIVNPGDIKFGSRK  181

Query  667  HYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIY  846
            +YRY+GSLTVPPCTEGVIWTI  KVRT SR+Q++ L+E VHD  E+NARP   LN R I+
Sbjct  182  YYRYIGSLTVPPCTEGVIWTIGNKVRTVSREQVRALKEEVHDGYEKNARPTNELNGRPIW  241

Query  847  LLSP  858
              SP
Sbjct  242  FYSP  245



>ref|NP_193831.1| alpha carbonic anhydrase 4 [Arabidopsis thaliana]
 sp|F4JIK2.1|ATCA4_ARATH RecName: Full=Alpha carbonic anhydrase 4; Short=AtaCA4; Short=AtalphaCA4; 
AltName: Full=Alpha carbonate dehydratase 4; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE84385.1| alpha carbonic anhydrase 4 [Arabidopsis thaliana]
Length=267

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 174/263 (66%), Gaps = 9/263 (3%)
 Frame = +1

Query  73   LILCFVLFLHPASTRA-QEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            + +CF+    P  + A  EV+DE  F Y + +EKGP  WG++   W  C+ G  QSPID+
Sbjct  11   MAMCFIYLSFPNISHAHSEVDDETPFTYEQKTEKGPEGWGKINPHWKVCNTGRYQSPIDL  70

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            ++ERV +I  H     + YKPA A + NRGHDI + W GDAG + I  TD+ L   HWHS
Sbjct  71   TNERVSLI--HDQAWTRQYKPAPAVITNRGHDIMVSWKGDAGKMTIRKTDFNLVQCHWHS  128

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
            PSEHT+NG RY LELHMVH +       + AVIGVLYK+G+P+ FL+KL+  I ++ +++
Sbjct  129  PSEHTVNGTRYDLELHMVHTSA----RGRTAVIGVLYKLGEPNEFLTKLLNGIKAVGNKE  184

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
            +   LGM DP +I+ ++++ YRY+GSLTVPPCTEGVIWT+ K+V T S +QI  LR+AV 
Sbjct  185  I--NLGMIDPREIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQITALRQAVD  242

Query  790  DYAERNARPLQALNRREIYLLSP  858
            D  E N+RP+Q    R ++   P
Sbjct  243  DGFETNSRPVQDSKGRSVWFYDP  265



>ref|XP_004973745.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=282

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/254 (51%), Positives = 173/254 (68%), Gaps = 7/254 (3%)
 Frame = +1

Query  103  PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
            P +T  QE EDE  F Y  GS  GP RWG++   WA CSNG+MQSPID+S +RV ++ + 
Sbjct  28   PGATAQQETEDEHGFSYVPGSPNGPDRWGKINTLWAECSNGEMQSPIDLSDDRVTLVRSL  87

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRY  462
               +   Y+PA A++ NRGHDI +++ GDAG ++INGT Y L+  HWH+PSEHT++GRRY
Sbjct  88   GF-LNYSYRPAEASIVNRGHDIQVKFSGDAGRLVINGTVYHLRQLHWHTPSEHTVDGRRY  146

Query  463  ALELHMVHQNTDQNLTNQIAVIGVLYKIGK-PDAFLSKLMRNISSMID-RDVEKELGMFD  636
             +ELH+VHQ T+    N+ AVIGV Y+ G  PD FL  L  +I  + D RD E+ +G+ D
Sbjct  147  VMELHLVHQTTE----NKTAVIGVFYETGNIPDLFLKTLEPSIRRIGDTRDREEPIGVVD  202

Query  637  PSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARP  816
            P+  +     +YRYMGSLT PPCTEGV+WT+ K VR  ++ Q+ +LREAV D  E NARP
Sbjct  203  PNGARATGSVYYRYMGSLTTPPCTEGVVWTVFKTVRHVAKYQLDILREAVADGYEDNARP  262

Query  817  LQALNRREIYLLSP  858
            LQ +N R+I +  P
Sbjct  263  LQEVNNRDISIFRP  276



>gb|KCW47834.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=278

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/247 (52%), Positives = 171/247 (69%), Gaps = 7/247 (3%)
 Frame = +1

Query  52   SILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDM  231
             IL +  +     L L  +S    EV+DE  F Y EG+ KGP+ WG++   W AC  G +
Sbjct  31   GILRSSFVFFALGLLLTLSSASESEVDDETPFTYIEGTGKGPKEWGQIDPRWQACGMGKL  90

Query  232  QSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLK  411
            QSPID+ +ERV++   +  ++++ YKPA A VRNRGHDI + W GDAG + INGT Y L 
Sbjct  91   QSPIDLLNERVQVFP-NLGKLKRDYKPAPAIVRNRGHDITVMWKGDAGKININGTYYKLL  149

Query  412  SAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNIS  591
              HWHSPSEHT NG RY LELHMVH ++      +IAVIG++YK G+PD FL+KL+ +I+
Sbjct  150  QCHWHSPSEHTFNGSRYDLELHMVHLSSH----GEIAVIGIVYKYGRPDPFLTKLLEHIT  205

Query  592  SMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
             +   D   +LG+ +P  IK  S++++RY+GSLTVPPCTEGV+WTI +KVRT SRKQ++ 
Sbjct  206  VVGKEDT--DLGVINPGIIKFGSRKYFRYIGSLTVPPCTEGVVWTIVRKVRTVSRKQVEA  263

Query  772  LREAVHD  792
            LREAVHD
Sbjct  264  LREAVHD  270



>ref|XP_004506042.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=269

 Score =   266 bits (681),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 184/266 (69%), Gaps = 7/266 (3%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
            +++  SL++  VL L    T +QEVE E EF+Y E S KGP+ WG++K EW+ C NG MQ
Sbjct  7    LVLVFSLLIALVL-LSSCPTMSQEVEHESEFNYDEKSMKGPQHWGDIKPEWSMCKNGTMQ  65

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKS  414
            SPID+ ++RV+I++ +   ++ +YKP+NAT++NRGHDI +E   ++  + INGT Y LK 
Sbjct  66   SPIDLLNQRVQIVS-NLGTLQINYKPSNATLKNRGHDIMLELIANSSYLQINGTQYVLKQ  124

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISS  594
             HWHSPSEHTI+G+R+ LELHMVHQ      + Q AVIG+LYK G+P+ F S L  ++ +
Sbjct  125  FHWHSPSEHTIDGKRFDLELHMVHQTP----SGQTAVIGILYKTGRPNPFFSLLRSDLEA  180

Query  595  MIDR-DVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKL  771
            + ++ + E+ LG+ DP  I      +YRY+GSLT P C+E + WTI ++VR+ S++QIKL
Sbjct  181  ISEKTEEERALGVIDPRWINFGKTHYYRYIGSLTTPSCSENITWTIIQEVRSVSKEQIKL  240

Query  772  LREAVHDYAERNARPLQALNRREIYL  849
             R A HD +  NARPLQ LN R + L
Sbjct  241  FRVAAHDESNSNARPLQPLNDRLVQL  266



>ref|XP_010451325.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   266 bits (680),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 176/273 (64%), Gaps = 9/273 (3%)
 Frame = +1

Query  43   MRRSILVTGSLILCFVLFLHPASTRAQ-EVEDEREFDYAEGSEKGPRRWGELKKEWAACS  219
            M  + +      L F+    P  + A  EV+DE  F Y + +EKGP  WG +  EW  C+
Sbjct  1    MGSTTITIFFFALFFIYLSFPKISLANSEVDDETPFTYEQKTEKGPEGWGNINPEWKVCN  60

Query  220  NGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTD  399
             G  QSPID+++ERV +I  H     + Y+PA A + NRGHDI + W GDAG + I  TD
Sbjct  61   TGRFQSPIDLTNERVSLI--HDQAWHRQYQPAPAVITNRGHDIMVSWKGDAGKITIRQTD  118

Query  400  YFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLM  579
            + L   HWHSPSEHT+NG RY LELHMVH +       + AVIGVLYK+G+P+ FL+KL+
Sbjct  119  FKLVQCHWHSPSEHTVNGTRYDLELHMVHTSA----RGRTAVIGVLYKLGEPNEFLTKLL  174

Query  580  RNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRK  759
              I ++ +++V  +LG+ DP +I+ ++++ YRY+GSLTVPPCTEGV+WT+ K+V T S +
Sbjct  175  NGIKAVGNKEV--DLGVIDPREIRFQTRKFYRYIGSLTVPPCTEGVLWTVVKRVNTISME  232

Query  760  QIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            QI  LREAV D  E N+RP+Q    R ++   P
Sbjct  233  QITALREAVDDGFETNSRPVQDSKGRSVWFYDP  265



>ref|XP_010036660.1| PREDICTED: alpha carbonic anhydrase 4-like [Eucalyptus grandis]
Length=278

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 171/244 (70%), Gaps = 7/244 (3%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            EV+DE  F Y EG+ KGP+ WG +   W AC+ G +QSPID+ +ERV+I   H  ++++ 
Sbjct  38   EVDDESHFTYLEGTGKGPKDWGRIDPHWRACATGKLQSPIDLLNERVQIFP-HLGKLKRD  96

Query  304  YKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            YKPA A V+NRGHDI++ W G AG + INGT Y L   HWHSPSEHT NG RYALELH V
Sbjct  97   YKPAPAIVKNRGHDISVMWKGYAGQININGTYYKLLQCHWHSPSEHTFNGSRYALELHAV  156

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSK  663
            H+++       IAVI ++YK G+PD  L +L+ +I  +   D+  ELG+ +P  IK  S+
Sbjct  157  HESSH----GAIAVIAIVYKYGRPDPLLKELLEHIKVVDKEDI--ELGVINPGLIKFGSR  210

Query  664  RHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREI  843
            +++RY+GSLT+PPCTEGV+WTI +KVRT SR+Q+K LREAVHD  E N+RP Q  + R I
Sbjct  211  KYFRYIGSLTIPPCTEGVVWTIVRKVRTVSREQVKALREAVHDGFEANSRPTQRSHGRGI  270

Query  844  YLLS  855
             L S
Sbjct  271  GLYS  274



>dbj|BAK03530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 170/253 (67%), Gaps = 6/253 (2%)
 Frame = +1

Query  103  PASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTH  282
            PA    QE++DE EF Y  G++ GP  WG  K+EWA C  G MQSPID+S  R       
Sbjct  25   PADRAQQEIDDESEFSYIRGAKNGPENWGTFKEEWATCGTGQMQSPIDLSDRRASPSPDL  84

Query  283  HHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRY  462
             + +   Y PA+A++ NRGHDIA+ +HGDAGS+ I+GT Y L+  HWH+PSEH +NGRRY
Sbjct  85   GY-LNHSYVPADASIVNRGHDIAVMFHGDAGSLSIDGTAYHLRQVHWHAPSEHRVNGRRY  143

Query  463  ALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFDP  639
            +LELHMVH +      N+ AVIG+LYKIG+ D FL KL   +  M D ++ E+++G+ DP
Sbjct  144  SLELHMVHLSA----QNKTAVIGLLYKIGRRDHFLHKLEPYLMRMADMKEKEEKVGLVDP  199

Query  640  SDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPL  819
             + +   + +YRYMGSLT PPC EGVIWT+ K+V T S  Q+KLL +AVHD  E NARPL
Sbjct  200  GEARGDGEAYYRYMGSLTTPPCDEGVIWTVIKRVATVSTDQLKLLTDAVHDGFEMNARPL  259

Query  820  QALNRREIYLLSP  858
            Q +N R+I    P
Sbjct  260  QKVNDRDIRFFCP  272



>ref|XP_011048097.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
Length=285

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/281 (47%), Positives = 183/281 (65%), Gaps = 13/281 (5%)
 Frame = +1

Query  16   SVVLASFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGEL  195
            ++ ++SF  +   ++V+ SL +CF            EVE E EF Y EG+ KGP+ WG++
Sbjct  11   NINISSFLLLVSLVIVSFSLTICF--------ASESEVEKESEFAYVEGTGKGPKNWGKI  62

Query  196  KKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAG  375
               W  C  G MQSPID+   R   +  +  ++R+ Y+ A A V+NRGHDI + W GDAG
Sbjct  63   NPHWETCGKGQMQSPIDLLDGRAVQVFPNLGKLRRDYQAAPAAVKNRGHDITVIWKGDAG  122

Query  376  SVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKP  555
             + IN T Y LK  HWHSPSEHT NG RY LELH+VH ++       +AV  ++YK G+P
Sbjct  123  KITINNTSYQLKQCHWHSPSEHTFNGSRYDLELHLVHYSSQ----GGVAVSAIVYKYGRP  178

Query  556  DAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINK  735
            D FLS+L  +I+ + D + E + G+ +P DIK  S+++YRY+GSLT PPCTEGVIWTI K
Sbjct  179  DRFLSRLFHHITRL-DPEEEIDAGIVNPGDIKFGSRKYYRYIGSLTSPPCTEGVIWTIVK  237

Query  736  KVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            KVRT SR+Q+K LR+AVHD  E NARP Q+ + R ++  +P
Sbjct  238  KVRTVSREQVKALRDAVHDGFEANARPTQSSDGRAVFEYTP  278



>ref|XP_010109502.1| hypothetical protein L484_007522 [Morus notabilis]
 gb|EXC22913.1| hypothetical protein L484_007522 [Morus notabilis]
Length=289

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 181/263 (69%), Gaps = 10/263 (4%)
 Frame = +1

Query  76   ILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSH  255
            I    L LH     +QEVEDER FDY   S +GP RWG+++ +W  C+NG MQSPID+  
Sbjct  13   IFFIFLVLHFCPATSQEVEDERAFDYEAWSTRGPARWGQIRPDWRMCNNGTMQSPIDLMD  72

Query  256  ERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEW-HGDAGSVIINGTDYFLKSAHWHSP  432
            +RV++I+T    +R+ YKP NAT+ NRGHD+ ++W  G+AG + +NGT Y L+  HWHSP
Sbjct  73   QRVQVISTLQ-RLRRFYKPVNATLLNRGHDMMMKWTSGEAGYIDMNGTQYLLQQLHWHSP  131

Query  433  SEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL---MRNISSM-I  600
            SEHTINGRR+ LELHMVHQ+     T Q+ VIG+ Y+I   D FLS +   +++I++M  
Sbjct  132  SEHTINGRRFDLELHMVHQSR----TGQLVVIGINYRISSSDFFLSSMETHLQDIANMSY  187

Query  601  DRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLRE  780
            +   +K +G+ D   + +RS+R+YRY+GSLTVPPCT+ V+W + ++ R  +R+Q++LLR 
Sbjct  188  NSQPQKLVGIVDLRQLNIRSRRYYRYIGSLTVPPCTQSVVWIVLQQTRPVAREQVRLLRM  247

Query  781  AVHDYAERNARPLQALNRREIYL  849
            AV D +  NARPLQ  + R + L
Sbjct  248  AVRDGSATNARPLQRKHGRSVQL  270



>emb|CDX76404.1| BnaA08g09960D [Brassica napus]
Length=268

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 173/267 (65%), Gaps = 8/267 (3%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            +++ +L   ++ F + +  R  EV+DE  F Y +  EKGP  WG++   W  C+ G  QS
Sbjct  8    IISFALFFLYLCFSNISLARGAEVDDETPFTYEQNPEKGPEGWGKINPHWKTCNTGKFQS  67

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PID+++ RV II       R+ YKPA A + NRGHD+ + W GDAG + I  T+Y L   
Sbjct  68   PIDLTNARVSII--RDEAWRRQYKPAPAVIVNRGHDVMVSWKGDAGKITIRRTEYKLVQC  125

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHT+NG RY +ELHMVH +       + AVIGVLYK+GKP+ FL++L+  I ++
Sbjct  126  HWHSPSEHTVNGTRYDMELHMVHTSAG----GKTAVIGVLYKLGKPNEFLTRLLDGIKTV  181

Query  598  IDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLR  777
                 E++LG+ +P  I+ ++K+ YRY+GSLTVPPCTEGVIWT+ K+V T S +QI  LR
Sbjct  182  GKE--ERDLGIVEPRTIRFQTKKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQIAALR  239

Query  778  EAVHDYAERNARPLQALNRREIYLLSP  858
             AV D  E N+RP+Q  N R ++   P
Sbjct  240  SAVDDGYETNSRPVQERNGRSVWFYDP  266



>tpg|DAA48425.1| TPA: carbonic anhydrase [Zea mays]
Length=291

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 174/251 (69%), Gaps = 10/251 (4%)
 Frame = +1

Query  145  FDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANAT  324
            F+Y  G   GP  WG +K EWA CS G MQSPID++ ERV ++      +   Y+PA A+
Sbjct  40   FNYIPGDANGPENWGSIKPEWANCSAGRMQSPIDLARERVSLVPALGF-LNHSYRPAQAS  98

Query  325  VRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQN  504
            + NRGHDI + ++GDAGS++INGT Y L+  HWHSPSEHT++GRRYA+ELHMVH++    
Sbjct  99   IVNRGHDIMVRFNGDAGSLVINGTAYDLRQMHWHSPSEHTVDGRRYAMELHMVHESA---  155

Query  505  LTNQIAVIGVLYKIG-KPDAFLSKLMRNISSMIDR-DVEKELGMFDPSDIKMRSKRHYRY  678
               + AVIG+LY+IG  PD FL +L   I  + DR D E+ +G+ DP   +  +  +YRY
Sbjct  156  -AGKAAVIGILYEIGLVPDPFLLRLEPFIRRIADRKDREEPIGVVDPRLARGTASAYYRY  214

Query  679  MGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            MGSLT PPC+EGV+WTI KKVR+ S++Q++LLREAVHD  E NARP+Q LN R+I L  P
Sbjct  215  MGSLTTPPCSEGVVWTIIKKVRSVSKRQLELLREAVHDGNENNARPVQDLNDRDISLFRP  274

Query  859  AGKKLEK*TLL  891
               KL K  LL
Sbjct  275  ---KLHKQELL  282



>ref|XP_004166480.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like, partial [Cucumis sativus]
Length=242

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 170/240 (71%), Gaps = 6/240 (3%)
 Frame = +1

Query  133  DEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKP  312
            DE EFDY E  EKGP  WG+LK EW +C  G MQSPID+ HERV+I +   + +  +YKP
Sbjct  1    DETEFDYNEEGEKGPTHWGDLKPEWHSCKTGHMQSPIDLLHERVRIASLFTN-IEFNYKP  59

Query  313  ANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQN  492
             NAT++NRGHDI ++    AG +++N T YFL+  HWHSPSEHTINGRR+ALE H+VHQ+
Sbjct  60   TNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHTINGRRFALEAHLVHQS  119

Query  493  TDQNLTNQIAVIGVLYKIGK-PDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRH  669
             + N     AVIGV+Y IG+ PD  LSK+  N+  + D   EK L + D S +KM+S  +
Sbjct  120  QNGNY----AVIGVVYNIGRRPDYLLSKMKENLEEISDTCEEKALDVIDLSMLKMQSSLY  175

Query  670  YRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYL  849
            YRY+GSLT PPC++ V+WTI +KVRT + +Q+KLLR A HD +  NARPLQ +N R+I L
Sbjct  176  YRYIGSLTTPPCSQNVLWTIVRKVRTVTTEQVKLLRVASHDDSNTNARPLQPINDRKIQL  235



>ref|XP_004139552.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=250

 Score =   264 bits (674),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 171/242 (71%), Gaps = 6/242 (2%)
 Frame = +1

Query  127  VEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHY  306
             +DE EFDY E  EKGP  WG+LK EW +C  G MQSPID+ HERV+I +   + +  +Y
Sbjct  7    TKDETEFDYNEEGEKGPTHWGDLKPEWHSCKTGHMQSPIDLLHERVRIASLFTN-IEFNY  65

Query  307  KPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVH  486
            KP NAT++NRGHDI ++    AG +++N T YFL+  HWHSPSEHTINGRR+ALE H+VH
Sbjct  66   KPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHTINGRRFALEAHLVH  125

Query  487  QNTDQNLTNQIAVIGVLYKIGK-PDAFLSKLMRNISSMIDRDVEKELGMFDPSDIKMRSK  663
            Q+ + N     AVIGV+Y IG+ PD  LSK+  N+  + D   EK L + D S +KM+S 
Sbjct  126  QSQNGNY----AVIGVVYNIGRRPDYLLSKMKENLEEISDTCEEKALDVIDLSMLKMQSS  181

Query  664  RHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREI  843
             +YRY+GSLT PPC++ V+WTI +KVRT + +Q+KLLR A HD +  NARPLQ +N R+I
Sbjct  182  LYYRYIGSLTTPPCSQNVLWTIVRKVRTVTTEQVKLLRVASHDDSNTNARPLQPINDRKI  241

Query  844  YL  849
             L
Sbjct  242  QL  243



>gb|KHN02302.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=362

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 171/247 (69%), Gaps = 4/247 (2%)
 Frame = +1

Query  43   MRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSN  222
            M+R   ++ ++ L  +LF    ST    + DE E+ Y E S  GP+ WG+LK+EWAAC  
Sbjct  1    MQRQSHISVAISLICILF---CSTLTSAL-DEPEYGYNEKSANGPQHWGDLKEEWAACKI  56

Query  223  GDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDY  402
            G +QSPID+S   V++I         +YKP +ATV NRGHD+A+ W GDAGS+ INGT +
Sbjct  57   GQIQSPIDLSTNGVEVIPKLGGLKYWNYKPQHATVSNRGHDVAVIWEGDAGSIEINGTPF  116

Query  403  FLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMR  582
            FL+ AHWH P+EHTINGRRY LELHMVH +   + TN+ AV+GVLYK G PD  LSKL +
Sbjct  117  FLQQAHWHWPAEHTINGRRYDLELHMVHVSPQPDGTNKTAVVGVLYKYGSPDPLLSKLGK  176

Query  583  NISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQ  762
             I    + D EK +G+ DPS+I   SK +YRYMGSLT PPCTE +IWT++KKVRT SR Q
Sbjct  177  YIMDTPEEDDEKSVGVVDPSEIMKGSKMYYRYMGSLTAPPCTEDIIWTVDKKVRTVSRGQ  236

Query  763  IKLLREA  783
            +KLL++ 
Sbjct  237  VKLLKDT  243



>ref|XP_010555357.1| PREDICTED: alpha carbonic anhydrase 4 [Tarenaya hassleriana]
Length=276

 Score =   264 bits (675),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 169/268 (63%), Gaps = 11/268 (4%)
 Frame = +1

Query  55   ILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQ  234
             L++ SL     L    A+    EVEDE  F Y  GSEKGP +WG +  +W  C  G  Q
Sbjct  16   FLISSSLFYNVCL----ATIDNAEVEDESPFTYELGSEKGPEKWGNINPQWEVCQTGKFQ  71

Query  235  SPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKS  414
            SPID++  RV ++      +R  YKPA   ++NRGHDI + W  D G + ING+DY L  
Sbjct  72   SPIDLTSSRVSVLRQDDLWLRS-YKPAIGVIKNRGHDIMLSWKEDVGKITINGSDYKLVQ  130

Query  415  AHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISS  594
             HWHSPSEHT+NG R+ +ELHMVH N       +IAVIGVLY+ G PD FLS+L+  I S
Sbjct  131  CHWHSPSEHTVNGTRFVMELHMVHTNPQ----GKIAVIGVLYRFGVPDPFLSRLLNGIRS  186

Query  595  MIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLL  774
             +D++ E  +G+ DP  I+  S++ YRY+GSLTVPPCTEGVIWT+ K+V T S  Q++ L
Sbjct  187  -VDKE-EINMGIVDPRHIRYLSRKFYRYVGSLTVPPCTEGVIWTVVKRVNTVSPAQVRAL  244

Query  775  REAVHDYAERNARPLQALNRREIYLLSP  858
            REAVHD  E NARP+Q    R +    P
Sbjct  245  REAVHDGFETNARPIQHQQGRPLRYYEP  272



>gb|KGN58999.1| hypothetical protein Csa_3G742870 [Cucumis sativus]
Length=280

 Score =   265 bits (676),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 180/274 (66%), Gaps = 12/274 (4%)
 Frame = +1

Query  37   YTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAAC  216
            +++   I++T +L+   VL   P         +  EFDY  GS KGP +WG +K+EW+ C
Sbjct  8    FSLAFLIILTSTLLWASVLSHQPG--------EVCEFDYIGGSNKGPTKWGAIKEEWSKC  59

Query  217  SNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGT  396
            +NG MQSPID+S   + ++ +    + + Y P +AT+RNRGHDI++ W G+ GS+ IN T
Sbjct  60   NNGKMQSPIDLSTNTINVVNSLG-PLNREYNPFSATLRNRGHDISVAWEGNVGSIEINWT  118

Query  397  DYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL  576
             Y LK  HWHSPSEHT+NGRRY LELH+VH++ + N   + AV+  LY+IG PDAFLSK+
Sbjct  119  KYLLKQIHWHSPSEHTLNGRRYDLELHVVHESLNSNA--KYAVVSHLYEIGPPDAFLSKV  176

Query  577  MRNISSMIDRDVEKELGMFDPSDIKMRSK-RHYRYMGSLTVPPCTEGVIWTINKKVRTAS  753
               I  +     E +LG  +P +I+  S   +YRY+GSLT PPCTEGV+W+INK++ T S
Sbjct  177  SGGIKELSTGKKEIKLGSINPDEIRNASGINYYRYIGSLTAPPCTEGVVWSINKQIGTVS  236

Query  754  RKQIKLLREAVHDYAERNARPLQALNRREIYLLS  855
            ++Q+ LLR  V   AE NARP+Q LN R + L S
Sbjct  237  QEQVMLLRSTVEHCAETNARPVQPLNGRHVQLYS  270



>ref|XP_002278815.1| PREDICTED: alpha carbonic anhydrase 4-like [Vitis vinifera]
Length=279

 Score =   265 bits (676),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 174/249 (70%), Gaps = 6/249 (2%)
 Frame = +1

Query  112  TRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHE  291
            T A EVEDE EF Y EGSE GP +WG +K EW  C  G  QSPID+ + RV I      +
Sbjct  29   TIADEVEDESEFSYIEGSETGPEKWGTIKAEWKTCGKGKRQSPIDLRNRRVSIFPDFG-Q  87

Query  292  MRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALE  471
            +++ Y+PA+A ++NRGHD+A+EW G+AG + ++G  + L+  HWH+PSEHT+NG  + +E
Sbjct  88   LKRKYRPAHAVLKNRGHDVAVEWKGNAGKIKLHGVHFKLEQLHWHTPSEHTVNGTSFQME  147

Query  472  LHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDIK  651
            LH+VH++       +IAVIG  +K+G PD FL+K++ +++  I    EK++G+ D +DIK
Sbjct  148  LHLVHKSA----RGKIAVIGKTFKLGPPDPFLAKMIDHVTG-IPAGEEKDIGIVDANDIK  202

Query  652  MRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALN  831
               +++YRY+GSLT PPCTEGVIWTI+KKV T S++Q++ LR  VHD  E NARP Q LN
Sbjct  203  HWGRKYYRYIGSLTTPPCTEGVIWTISKKVNTVSKEQVESLRRVVHDGHEGNARPAQRLN  262

Query  832  RREIYLLSP  858
             R ++L  P
Sbjct  263  GRPVWLYIP  271



>ref|XP_004168623.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=280

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 180/274 (66%), Gaps = 12/274 (4%)
 Frame = +1

Query  37   YTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAAC  216
            +++   I++T +L+   VL   P         +  EFDY  GS KGP +WG +K+EW+ C
Sbjct  8    FSLAFLIILTSTLLWASVLSHQPG--------EVCEFDYIGGSNKGPTKWGAIKEEWSKC  59

Query  217  SNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGT  396
            +NG MQSPID+S   + ++ +    + + Y P +AT+RNRGHDI++ W G+ GS+ IN T
Sbjct  60   NNGKMQSPIDLSTNTINVVNSLG-PLTREYNPFSATLRNRGHDISVAWEGNVGSIEINWT  118

Query  397  DYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKL  576
             Y LK  HWHSPSEHT+NGRRY LELH+VH++ + N   + AV+  LY+IG PDAFLSK+
Sbjct  119  KYLLKQIHWHSPSEHTLNGRRYDLELHVVHESLNSNA--KYAVVSHLYEIGPPDAFLSKV  176

Query  577  MRNISSMIDRDVEKELGMFDPSDIKMRSK-RHYRYMGSLTVPPCTEGVIWTINKKVRTAS  753
               I  +     E +LG  +P +I+  S   +YRY+GSLT PPCTEGV+W+INK++ T S
Sbjct  177  SGGIKELSTGKKEIKLGSINPDEIRNASGINYYRYIGSLTAPPCTEGVVWSINKQIGTVS  236

Query  754  RKQIKLLREAVHDYAERNARPLQALNRREIYLLS  855
            ++Q+ LLR  V   AE NARP+Q LN R + L S
Sbjct  237  QEQVMLLRSTVEHCAETNARPVQPLNGRHVQLYS  270



>ref|XP_007204039.1| hypothetical protein PRUPE_ppa021069mg, partial [Prunus persica]
 gb|EMJ05238.1| hypothetical protein PRUPE_ppa021069mg, partial [Prunus persica]
Length=255

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 162/251 (65%), Gaps = 19/251 (8%)
 Frame = +1

Query  142  EFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANA  321
            EF+Y  GS+KGP  WGELKKEW  C +G  QSPID+       + +     +  YKPA A
Sbjct  4    EFEYKTGSKKGPEHWGELKKEWKTCKDGKSQSPIDLMDGIATKVNSSLEHFKVSYKPAEA  63

Query  322  TVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQ  501
             + N G  IAI W GDAGS+ INGTDY L+  HWHSPSEH+ING+RY LELHMVH+  + 
Sbjct  64   MIENEGPVIAIVWEGDAGSISINGTDYILRQCHWHSPSEHSINGKRYDLELHMVHRAKN-  122

Query  502  NLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKELGMFDPSDI-----------  648
               N +AV+G LY+IGKP+ FLS++ + I+SM D     +LG+ DP  +           
Sbjct  123  ---NNVAVVGFLYEIGKPNPFLSEVTKEIASMTDVKKNVQLGVIDPMKMKEAQTGFQDAK  179

Query  649  --KMR--SKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARP  816
              KMR  S + YRYMGS T PPCTEGV WTINK+V + S+ Q+ LL++ V DYA  NARP
Sbjct  180  RRKMREDSSKFYRYMGSFTTPPCTEGVTWTINKQVLSVSKSQVNLLQQVVFDYAMMNARP  239

Query  817  LQALNRREIYL  849
            LQ L  R+I L
Sbjct  240  LQPLYGRDIKL  250



>ref|XP_002869915.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46174.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=267

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 173/263 (66%), Gaps = 9/263 (3%)
 Frame = +1

Query  73   LILCFVLFLHPASTRAQ-EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDM  249
            L + F+    P  + A  EV+DE  F Y + +EKGP  WG++  +W  C+ G  QSPID+
Sbjct  11   LAMFFIYLSFPNISLAHTEVDDETPFTYEQKTEKGPEGWGKINPQWKVCNTGRYQSPIDL  70

Query  250  SHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHS  429
            ++ERV +I  H     + YKPA A + NRGHDI + W GDAG + I  TD+ L   HWHS
Sbjct  71   TNERVSLI--HDQAWTRQYKPAPAVITNRGHDIMVSWKGDAGKITIRKTDFKLVQCHWHS  128

Query  430  PSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRD  609
            PSEHT+NG  Y LELHMVH +       + AVIGVLY++G+P+ FL+KL+  I ++ +++
Sbjct  129  PSEHTVNGTSYDLELHMVHTSA----RGRTAVIGVLYRLGEPNEFLTKLLNGIKAVGNKE  184

Query  610  VEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVH  789
            +   LGM DP +I+ ++++ YRY+GSLTVPPCTEGVIWT+ K+V T S +QI  LREAV 
Sbjct  185  I--NLGMIDPREIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISTEQIAALREAVD  242

Query  790  DYAERNARPLQALNRREIYLLSP  858
            D  E N+RP+Q    R ++   P
Sbjct  243  DGFETNSRPVQDSKGRSVWFYDP  265



>ref|XP_008664513.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Zea mays]
 tpg|DAA48424.1| TPA: hypothetical protein ZEAMMB73_580242 [Zea mays]
Length=298

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 170/244 (70%), Gaps = 7/244 (3%)
 Frame = +1

Query  145  FDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANAT  324
            F Y  G E GP  WG +K EWAAC  G MQSPID+SHERV ++ +  + +   Y+PA A+
Sbjct  58   FSYVPGDEHGPEHWGSIKAEWAACGAGRMQSPIDLSHERVSLVRSLGY-LSHSYRPAEAS  116

Query  325  VRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQN  504
            + NRGHDI + + GDAGS++INGT Y+L+  HWHSP+EHT++GRRY +ELH+VH++ +  
Sbjct  117  IVNRGHDIMVRFEGDAGSLVINGTAYYLRQLHWHSPTEHTVDGRRYDMELHLVHESAE--  174

Query  505  LTNQIAVIGVLYKIGK-PDAFLSKLMRNISSMID-RDVEKELGMFDPSDIKMRSKRHYRY  678
              N+ AVI VLY+IG   DA L +L   I  + D RD E  +G+ DP   + R+  +YRY
Sbjct  175  --NKAAVIAVLYEIGGHDDALLRQLEPAIRRVADVRDREMRVGVVDPRRARGRASVYYRY  232

Query  679  MGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            +GSLT PPCTEGVIWTI K+VR+ S+ Q++LLREAVHD  E NARPLQ  N R++ +  P
Sbjct  233  VGSLTAPPCTEGVIWTIVKRVRSVSKHQLELLREAVHDDMENNARPLQEANHRDVSMFRP  292

Query  859  AGKK  870
               K
Sbjct  293  KPNK  296



>ref|XP_008241381.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Prunus mume]
Length=293

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/279 (46%), Positives = 180/279 (65%), Gaps = 18/279 (6%)
 Frame = +1

Query  85   FVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERV  264
            F+L L P  T A+    + EF++  GS+KGP  WG+LKKEW  C NG  QSPID+     
Sbjct  17   FLLCLDPTPTSAEVSGRKLEFEFKAGSKKGPEHWGDLKKEWMTCKNGKAQSPIDLRDGIA  76

Query  265  KIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHT  444
              + +     +  YKP  A ++N GH I++ W GDAGS+ ING +Y L+  HWH+PSEH+
Sbjct  77   TKVNSSLEHFKISYKPTKAILKNEGHAISVVWDGDAGSISINGKEYNLRQCHWHAPSEHS  136

Query  445  INGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMIDRDVEKEL  624
            I+G+RY +ELHMVH+  +    + +AV+G LYKIG+P+ F+SK+ + I+SM+D + + +L
Sbjct  137  IDGKRYDVELHMVHRAKN---NSDVAVVGFLYKIGQPNPFISKVRKAIASMMDVEKDVQL  193

Query  625  GMFDP----------SDIKMR-----SKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRK  759
            G+ DP           D+K R     S + YRY GS T PPC+EGV WTINK+V T S  
Sbjct  194  GVIDPRKMKKAKIGFQDLKKRQMKKASSKFYRYSGSFTTPPCSEGVTWTINKQVHTVSIA  253

Query  760  QIKLLREAVHDYAERNARPLQALNRREIYLLSPAGKKLE  876
            Q+KLL++AV ++AE NARP+Q LN R++ L   +  KL+
Sbjct  254  QVKLLQQAVFNFAELNARPVQPLNGRQVKLHGSSFVKLK  292



>ref|XP_004973662.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=277

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/241 (53%), Positives = 171/241 (71%), Gaps = 7/241 (3%)
 Frame = +1

Query  145  FDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANAT  324
            F Y  G E GP  WGE+K EWAAC  G MQSPID+ HERV ++    + +   Y+PA A+
Sbjct  36   FSYVHGDEHGPEHWGEIKAEWAACGAGRMQSPIDLHHERVSLVRGLGY-LDHSYRPAQAS  94

Query  325  VRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQN  504
            + NRGHDI + + GDAGS++INGT Y LK  HWHSP+EHT++GRRY LELH+VH++ ++ 
Sbjct  95   IVNRGHDIMVRFEGDAGSLVINGTAYHLKQLHWHSPTEHTVDGRRYDLELHLVHESAEK-  153

Query  505  LTNQIAVIGVLYKIGKP-DAFLSKLMRNISSMID-RDVEKELGMFDPSDIKMRSKRHYRY  678
               + AVI +LY+IG+  D  L ++   I  + D RD E+ + + DP  ++ R+  +YRY
Sbjct  154  ---KAAVIAILYEIGRGHDPLLHQMEPFIRQIADKRDREERVSVVDPRAVRGRASVYYRY  210

Query  679  MGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            MGSLTVPPCTEGVIWTI K+V T S+ Q++LLREAVHD  E+NARPLQ +N R++ L  P
Sbjct  211  MGSLTVPPCTEGVIWTIVKRVHTVSKYQLELLREAVHDDMEKNARPLQEVNSRDVSLFRP  270

Query  859  A  861
            +
Sbjct  271  S  271



>emb|CDY27409.1| BnaC03g64490D [Brassica napus]
Length=268

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 172/267 (64%), Gaps = 8/267 (3%)
 Frame = +1

Query  58   LVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQS  237
            +++ +L   ++ F + +  R  EV+DE  F Y +  EKGP  WG++   W  C+ G  QS
Sbjct  8    IISFALFFLYLSFSNISLARGAEVDDETSFTYEKNPEKGPEGWGKINPHWKTCNIGKFQS  67

Query  238  PIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSA  417
            PID+++ RV II       R+ YKPA A + NRGHD+ + W GDAG + I  T+Y L   
Sbjct  68   PIDLTNTRVSII--RDEAWRRQYKPAPAVIVNRGHDVMVSWKGDAGKITIRRTEYKLVQC  125

Query  418  HWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSM  597
            HWHSPSEHT+NG RY +ELHMVH +       +  VIGVLYK+GKP+ FL++L+  I ++
Sbjct  126  HWHSPSEHTVNGTRYDMELHMVHTSAG----GKTVVIGVLYKLGKPNEFLTRLLDGIKTV  181

Query  598  IDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLR  777
                 E++LG+ DP  I+ ++K+ YRY+GSLTVPPCTEGVIWT+ K+V T S +QI  LR
Sbjct  182  GKE--ERDLGIVDPRTIRFQTKKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQIAALR  239

Query  778  EAVHDYAERNARPLQALNRREIYLLSP  858
             AV D  E N+RP+Q  N R ++   P
Sbjct  240  SAVDDGYETNSRPVQERNGRSVWFYDP  266



>ref|XP_002308927.2| hypothetical protein POPTR_0006s04600g [Populus trichocarpa]
 gb|EEE92450.2| hypothetical protein POPTR_0006s04600g [Populus trichocarpa]
Length=285

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 180/278 (65%), Gaps = 13/278 (5%)
 Frame = +1

Query  25   LASFYTMRRSILVTGSLILCFVLFLHPASTRAQEVEDEREFDYAEGSEKGPRRWGELKKE  204
            ++SF  +   ++V+ SL +CF            EVE E EF Y EG+ KGP+ WG++   
Sbjct  14   ISSFLLLVSLVIVSFSLTICF--------ASESEVEKESEFAYVEGTGKGPKNWGKINPH  65

Query  205  WAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANATVRNRGHDIAIEWHGDAGSVI  384
            W  C  G MQSPID+   +   +  +  ++R+ Y+ A A V+NRGHDI + W GDAG + 
Sbjct  66   WETCGKGQMQSPIDLLDGKAVQVFPNLGKLRRDYQAAPAAVKNRGHDITVIWKGDAGKIT  125

Query  385  INGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQNLTNQIAVIGVLYKIGKPDAF  564
            IN T Y LK  HWHSPSEHT NG RY LELH+VH ++       +AV  ++YK G+PD F
Sbjct  126  INNTSYQLKQGHWHSPSEHTFNGSRYDLELHLVHYSSQ----GGVAVSAIVYKYGRPDRF  181

Query  565  LSKLMRNISSMIDRDVEKELGMFDPSDIKMRSKRHYRYMGSLTVPPCTEGVIWTINKKVR  744
            LS+L  +I+  +D + E + G+ +P DIK  S+++YRY+GSLT PPCTEGVIWTI KKVR
Sbjct  182  LSRLFHHITH-VDPEEEIDAGIVNPGDIKFGSRKYYRYIGSLTSPPCTEGVIWTIVKKVR  240

Query  745  TASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            T SR+Q+K LR+AVHD  E NARP Q+ + R ++   P
Sbjct  241  TVSREQVKALRDAVHDGYEANARPTQSSDGRAVFEYIP  278



>ref|NP_001149032.1| carbonic anhydrase precursor [Zea mays]
 gb|ACG33896.1| carbonic anhydrase precursor [Zea mays]
Length=291

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 173/251 (69%), Gaps = 10/251 (4%)
 Frame = +1

Query  145  FDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKHYKPANAT  324
            F+Y  G   GP  WG +K EWA CS G MQSPID++ ERV ++      +   Y+PA A+
Sbjct  40   FNYIPGDANGPENWGSIKPEWANCSAGRMQSPIDLARERVTLVPALGF-LNHSYRPAQAS  98

Query  325  VRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMVHQNTDQN  504
            + NRGHDI + ++GDAG ++INGT Y L+  HWHSPSEHT++GRRYA+ELHMVH++    
Sbjct  99   IVNRGHDIMVRFNGDAGRLVINGTAYDLRQMHWHSPSEHTVDGRRYAMELHMVHESA---  155

Query  505  LTNQIAVIGVLYKIG-KPDAFLSKLMRNISSMIDR-DVEKELGMFDPSDIKMRSKRHYRY  678
               + AVIG+LY+IG  PD FL +L   I  + DR D E+ +G+ DP   +  +  +YRY
Sbjct  156  -AGKAAVIGILYEIGLVPDPFLLRLEPFIRRIADRKDREEPIGVVDPRLARGTASAYYRY  214

Query  679  MGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRREIYLLSP  858
            MGSLT PPC+EGV+WTI KKVR+ S++Q++LLREAVHD  E NARP+Q LN R+I L  P
Sbjct  215  MGSLTTPPCSEGVVWTIIKKVRSVSKRQLELLREAVHDGNENNARPVQDLNDRDISLFRP  274

Query  859  AGKKLEK*TLL  891
               KL K  LL
Sbjct  275  ---KLHKQELL  282



>gb|AAF79837.1|AC026875_17 T6D22.16 [Arabidopsis thaliana]
Length=263

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 169/246 (69%), Gaps = 18/246 (7%)
 Frame = +1

Query  124  EVEDEREFDYAEGSEKGPRRWGELKKEWAACSNGDMQSPIDMSHERVKIITTHHHEMRKH  303
            EVEDEREF+Y +  EKGP RWGELK EW  C  G+MQSPID+ +ERV I++ H   + + 
Sbjct  33   EVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSPIDLMNERVNIVS-HLGRLNRD  91

Query  304  YKPANATVRNRGHDIAIEWHGDAGSVIINGTDYFLKSAHWHSPSEHTINGRRYALELHMV  483
            Y P+NAT++NRGHDI +++   AG++ ING +Y L+  HWHSPSEHTINGRR        
Sbjct  92   YNPSNATLKNRGHDIMLKFEDGAGTIKINGFEYELQQLHWHSPSEHTINGRR--------  143

Query  484  HQNTDQNLTNQIAVIGVLYKIGKPDAFLSKLMRNISSMID-RDVEKELGMFDPSDIKMRS  660
                      ++AV+ VLYKIG+ D F+  L + +  + +  + EK +GM DP+ IK+ S
Sbjct  144  --------NRRMAVVTVLYKIGRADTFIRSLEKELEGIAEMEEAEKNVGMIDPTKIKIGS  195

Query  661  KRHYRYMGSLTVPPCTEGVIWTINKKVRTASRKQIKLLREAVHDYAERNARPLQALNRRE  840
            +++YRY GSLT PPCT+ V W++ +KVRT +RKQ+KLLR AVHD A  NARP+Q  N+R 
Sbjct  196  RKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVHDDANSNARPVQPTNKRI  255

Query  841  IYLLSP  858
            ++L  P
Sbjct  256  VHLYRP  261



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2339198799562