BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18733_g1_i3 len=2581 path=[1:0-370 @372@!:371-1738 1740:1739-1856
1858:1857-2580]

Length=2581
                                                                      Score     E

ref|XP_009607277.1|  PREDICTED: uncharacterized protein LOC104101520    977   0.0      
ref|XP_009759170.1|  PREDICTED: uncharacterized protein LOC104211...    976   0.0      
ref|XP_006358173.1|  PREDICTED: SET and MYND domain-containing pr...    962   0.0      
ref|XP_010318210.1|  PREDICTED: SET and MYND domain-containing pr...    950   0.0      
ref|XP_004235445.1|  PREDICTED: SET and MYND domain-containing pr...    944   0.0      
ref|XP_010318211.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...    896   0.0      
ref|XP_011076554.1|  PREDICTED: SET and MYND domain-containing pr...    887   0.0      
ref|XP_009759171.1|  PREDICTED: uncharacterized protein LOC104211...    885   0.0      
ref|XP_010318212.1|  PREDICTED: SET and MYND domain-containing pr...    867   0.0      
ref|XP_010658299.1|  PREDICTED: SET and MYND domain-containing pr...    861   0.0      
emb|CDP13867.1|  unnamed protein product                                861   0.0      
ref|XP_008234145.1|  PREDICTED: SET and MYND domain-containing pr...    832   0.0      
ref|XP_009363760.1|  PREDICTED: histone-lysine N-methyltransferas...    826   0.0      
ref|XP_010278902.1|  PREDICTED: SET and MYND domain-containing pr...    822   0.0      
ref|XP_010278900.1|  PREDICTED: SET and MYND domain-containing pr...    819   0.0      
ref|XP_010658301.1|  PREDICTED: SET and MYND domain-containing pr...    815   0.0      
ref|XP_010318213.1|  PREDICTED: SET and MYND domain-containing pr...    808   0.0      
ref|XP_008376346.1|  PREDICTED: LOW QUALITY PROTEIN: SET and MYND...    805   0.0      
ref|XP_007220254.1|  hypothetical protein PRUPE_ppa001654mg             801   0.0      
ref|XP_006480312.1|  PREDICTED: SET and MYND domain-containing pr...    786   0.0      
gb|AES72697.2|  heat shock protein 70 (HSP70)-interacting protein...    786   0.0      
gb|EYU20145.1|  hypothetical protein MIMGU_mgv1a002206mg                781   0.0      
ref|XP_004309003.1|  PREDICTED: SET and MYND domain-containing pr...    780   0.0      
ref|XP_003602446.1|  SET and MYND domain-containing protein             780   0.0      
emb|CBI25524.3|  unnamed protein product                                772   0.0      
ref|XP_010109164.1|  SET and MYND domain-containing protein 4           774   0.0      
ref|XP_009759175.1|  PREDICTED: uncharacterized protein LOC104211...    766   0.0      
ref|XP_006423931.1|  hypothetical protein CICLE_v10030128mg             765   0.0      
gb|KDP45655.1|  hypothetical protein JCGZ_17262                         761   0.0      
gb|KHN02136.1|  RNA polymerase II-associated protein 3                  760   0.0      
ref|XP_002526395.1|  heat shock protein 70 (HSP70)-interacting pr...    759   0.0      Ricinus communis
ref|XP_007136384.1|  hypothetical protein PHAVU_009G040900g             750   0.0      
ref|XP_003528010.1|  PREDICTED: uncharacterized protein LOC100783548    746   0.0      
ref|XP_004147437.1|  PREDICTED: SET and MYND domain-containing pr...    746   0.0      
ref|XP_004502793.1|  PREDICTED: SET and MYND domain-containing pr...    745   0.0      
ref|XP_006843002.1|  hypothetical protein AMTR_s00076p00135550          745   0.0      
ref|XP_010670025.1|  PREDICTED: uncharacterized protein LOC104887...    742   0.0      
ref|XP_004502794.1|  PREDICTED: SET and MYND domain-containing pr...    738   0.0      
ref|XP_008813823.1|  PREDICTED: SET and MYND domain-containing pr...    737   0.0      
ref|XP_006578856.1|  PREDICTED: uncharacterized protein LOC100794...    736   0.0      
ref|XP_008444150.1|  PREDICTED: SET and MYND domain-containing pr...    735   0.0      
ref|XP_010058102.1|  PREDICTED: uncharacterized protein LOC104445...    736   0.0      
ref|XP_011012968.1|  PREDICTED: SET and MYND domain-containing pr...    727   0.0      
ref|XP_010058103.1|  PREDICTED: uncharacterized protein LOC104445...    716   0.0      
ref|XP_007011439.1|  Tetratricopeptide repeat-like superfamily pr...    719   0.0      
ref|XP_010658302.1|  PREDICTED: SET and MYND domain-containing pr...    711   0.0      
ref|XP_007136386.1|  hypothetical protein PHAVU_009G040900g             709   0.0      
ref|XP_010318214.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...    698   0.0      
ref|XP_009412478.1|  PREDICTED: N-lysine methyltransferase SMYD2-...    681   0.0      
ref|XP_010538897.1|  PREDICTED: SET and MYND domain-containing pr...    678   0.0      
ref|XP_010499889.1|  PREDICTED: SET and MYND domain-containing pr...    673   0.0      
ref|XP_010478762.1|  PREDICTED: SET and MYND domain-containing pr...    671   0.0      
ref|XP_010538898.1|  PREDICTED: SET and MYND domain-containing pr...    669   0.0      
ref|XP_010461168.1|  PREDICTED: SET and MYND domain-containing pr...    664   0.0      
ref|NP_174606.2|  carboxylate clamp-tetratricopeptide repeat protein    660   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413202.1|  PREDICTED: histone-lysine N-methyltransferas...    657   0.0      
ref|XP_006480311.1|  PREDICTED: SET and MYND domain-containing pr...    648   0.0      
ref|XP_006415091.1|  hypothetical protein EUTSA_v10006832mg             652   0.0      
ref|XP_003574165.1|  PREDICTED: SET and MYND domain-containing pr...    647   0.0      
ref|XP_004502795.1|  PREDICTED: SET and MYND domain-containing pr...    643   0.0      
ref|XP_006306798.1|  hypothetical protein CARUB_v10008336mg             645   0.0      
emb|CDY26924.1|  BnaA05g17880D                                          639   0.0      
ref|XP_009151465.1|  PREDICTED: SET and MYND domain-containing pr...    638   0.0      
gb|KDO56333.1|  hypothetical protein CISIN_1g048211mg                   631   0.0      
ref|XP_010478763.1|  PREDICTED: SET and MYND domain-containing pr...    624   0.0      
ref|XP_011012969.1|  PREDICTED: uncharacterized protein LOC105117...    622   0.0      
gb|AAG51222.1|AC051630_19  unknown protein; 33246-28649                 620   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662498.1|  PREDICTED: SET and MYND domain-containing pr...    621   0.0      
ref|XP_004982663.1|  PREDICTED: SET and MYND domain-containing pr...    620   0.0      
ref|XP_010670026.1|  PREDICTED: uncharacterized protein LOC104887...    607   0.0      
ref|XP_008444167.1|  PREDICTED: SET and MYND domain-containing pr...    606   0.0      
ref|NP_001065013.1|  Os10g0506800                                       609   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC67273.1|  hypothetical protein OsI_34249                          597   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007011440.1|  Tetratricopeptide repeat-like superfamily pr...    568   0.0      
gb|EMT23836.1|  RNA polymerase II-associated protein 3                  561   0.0      
ref|XP_002323703.2|  tetratricopeptide repeat-containing family p...    544   2e-180   Populus trichocarpa [western balsam poplar]
gb|EMS67338.1|  RNA polymerase II-associated protein 3                  546   6e-179   
gb|KHG07263.1|  Tomm70a                                                 534   3e-175   
dbj|BAC42319.1|  unknown protein                                        529   3e-174   Arabidopsis thaliana [mouse-ear cress]
emb|CDY64797.1|  BnaCnng44980D                                          509   1e-162   
gb|KCW57456.1|  hypothetical protein EUGRSUZ_H002372                    496   3e-162   
ref|XP_008444158.1|  PREDICTED: uncharacterized protein LOC103487...    497   8e-161   
ref|XP_009759172.1|  PREDICTED: SET and MYND domain-containing pr...    494   1e-159   
gb|KFK45070.1|  hypothetical protein AALP_AA1G339400                    489   3e-157   
gb|AAP54526.2|  TPR Domain containing protein, expressed                487   1e-156   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008813824.1|  PREDICTED: histone-lysine N-methyltransferas...    468   4e-151   
gb|KHG07262.1|  Tomm70a                                                 459   1e-146   
ref|XP_010905092.1|  PREDICTED: uncharacterized protein LOC105032355    444   2e-143   
ref|XP_006306797.1|  hypothetical protein CARUB_v10008336mg             449   9e-143   
ref|XP_010042039.1|  PREDICTED: histone-lysine N-methyltransferas...    441   6e-141   
ref|XP_010025866.1|  PREDICTED: uncharacterized protein LOC104416130    429   1e-134   
gb|KCW71434.1|  hypothetical protein EUGRSUZ_E00005                     404   4e-127   
ref|XP_010058121.1|  PREDICTED: uncharacterized protein LOC104445885    397   2e-120   
tpg|DAA49375.1|  TPA: hypothetical protein ZEAMMB73_691595              379   1e-118   
gb|EPS58929.1|  hypothetical protein M569_15882                         378   3e-118   
tpg|DAA49376.1|  TPA: hypothetical protein ZEAMMB73_691595              350   4e-107   
ref|XP_002978843.1|  hypothetical protein SELMODRAFT_418586             353   7e-104   
ref|XP_001754073.1|  predicted protein                                  342   6e-102   
gb|EEE51238.1|  hypothetical protein OsJ_32096                          313   1e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008234177.1|  PREDICTED: uncharacterized protein LOC103333162    283   3e-83    
gb|EEC67274.1|  hypothetical protein OsI_34250                          254   4e-74    Oryza sativa Indica Group [Indian rice]
tpg|DAA49377.1|  TPA: hypothetical protein ZEAMMB73_691595              250   6e-72    
tpg|DAA49374.1|  TPA: hypothetical protein ZEAMMB73_691595              246   4e-71    
ref|NP_001146688.1|  uncharacterized protein LOC100280288               247   8e-71    Zea mays [maize]
gb|AGT17023.1|  hypothetical protein SHCRBa_022_O03_F_420               244   2e-70    
ref|XP_002464405.1|  hypothetical protein SORBIDRAFT_01g017670          244   2e-70    Sorghum bicolor [broomcorn]
gb|KCW75607.1|  hypothetical protein EUGRSUZ_E04345                     241   2e-69    
ref|XP_010905093.1|  PREDICTED: uncharacterized protein LOC105032356    235   9e-67    
ref|XP_002975659.1|  hypothetical protein SELMODRAFT_415607             249   4e-66    
emb|CAN75589.1|  hypothetical protein VITISV_042880                     234   1e-61    Vitis vinifera
ref|XP_002323704.1|  hypothetical protein POPTR_0016s15100g             199   1e-54    Populus trichocarpa [western balsam poplar]
gb|EPS62414.1|  hypothetical protein M569_12375                         180   1e-47    
gb|ACN33898.1|  unknown                                                 174   3e-44    Zea mays [maize]
gb|KCW57457.1|  hypothetical protein EUGRSUZ_H002371                    166   3e-43    
gb|ACN31967.1|  unknown                                                 156   7e-39    Zea mays [maize]
emb|CAN75590.1|  hypothetical protein VITISV_042881                     150   4e-38    Vitis vinifera
ref|XP_007011436.1|  Tetratricopeptide repeat (TPR)-like superfam...    127   6e-30    
ref|XP_007894676.1|  PREDICTED: SET and MYND domain-containing pr...    130   6e-28    
ref|XP_003742261.1|  PREDICTED: SET and MYND domain-containing pr...    125   4e-26    
ref|XP_011060496.1|  PREDICTED: SET and MYND domain-containing pr...    122   3e-25    
gb|EGI61760.1|  SET and MYND domain-containing protein 4                121   7e-25    
ref|XP_002425634.1|  set and mynd domain-containing protein, puta...    110   2e-21    Pediculus humanus corporis [human body lice]
gb|EZA53989.1|  SET and MYND domain-containing protein                  108   6e-21    
ref|XP_002865337.1|  predicted protein                                99.0    1e-20    
gb|KFK45067.1|  hypothetical protein AALP_AA1G339200                    100   1e-20    
gb|KFK22698.1|  hypothetical protein AALP_AAs70005U000100             97.4    7e-20    
ref|XP_007221772.1|  hypothetical protein PRUPE_ppb024678mg           97.4    1e-19    
ref|XP_004525269.1|  PREDICTED: SET and MYND domain-containing pr...    102   4e-19    
ref|XP_002719091.1|  PREDICTED: SET and MYND domain-containing pr...    100   2e-18    Oryctolagus cuniculus [domestic rabbit]
gb|KDR23054.1|  SET and MYND domain-containing protein 4                100   3e-18    
ref|XP_002063397.1|  GK21416                                            100   3e-18    Drosophila willistoni
ref|XP_781331.1|  PREDICTED: SET and MYND domain-containing prote...  98.2    1e-17    Strongylocentrotus purpuratus [purple urchin]
ref|XP_007011437.1|  Uncharacterized protein TCM_045604               91.3    2e-17    
ref|XP_002065883.1|  GK20590                                          95.9    5e-17    Drosophila willistoni
ref|XP_001627273.1|  predicted protein                                94.4    2e-16    Nematostella vectensis
ref|XP_002589088.1|  hypothetical protein BRAFLDRAFT_75068            94.4    2e-16    Branchiostoma floridae
gb|KFK22697.1|  hypothetical protein AALP_AAs70005U000100             86.3    3e-16    
ref|XP_009066029.1|  hypothetical protein LOTGIDRAFT_169490           92.8    7e-16    
gb|ETN65695.1|  hypothetical protein AND_002531                       92.0    9e-16    
ref|XP_002733823.1|  PREDICTED: SET and MYND domain-containing pr...  91.7    1e-15    Saccoglossus kowalevskii
ref|XP_002865338.1|  predicted protein                                84.0    2e-15    
ref|XP_002740933.1|  PREDICTED: SET and MYND domain-containing pr...  89.4    7e-15    Saccoglossus kowalevskii
ref|XP_008208924.1|  PREDICTED: SET and MYND domain-containing pr...  88.6    1e-14    
ref|XP_001181205.2|  PREDICTED: SET and MYND domain-containing pr...  88.2    2e-14    Strongylocentrotus purpuratus [purple urchin]
dbj|BAH72397.1|  ACYPI003270                                          84.3    2e-14    Acyrthosiphon pisum
ref|XP_002128556.1|  PREDICTED: histone-lysine N-methyltransferas...  85.5    5e-14    Ciona intestinalis [sea vase]
ref|XP_001943918.1|  PREDICTED: mitochondrial import receptor sub...  84.7    1e-13    Acyrthosiphon pisum
ref|XP_004594020.1|  PREDICTED: SET and MYND domain-containing pr...  85.1    2e-13    
ref|XP_004376314.1|  PREDICTED: SET and MYND domain-containing pr...  84.3    2e-13    
ref|XP_010977200.1|  PREDICTED: SET and MYND domain-containing pr...  83.6    5e-13    
ref|XP_006185117.1|  PREDICTED: SET and MYND domain-containing pr...  83.6    5e-13    
gb|EZA60897.1|  SET and MYND domain-containing protein                83.2    5e-13    
ref|XP_005110357.1|  PREDICTED: SET and MYND domain-containing pr...  82.8    6e-13    
ref|XP_004594021.1|  PREDICTED: SET and MYND domain-containing pr...  82.8    8e-13    
gb|EZA61542.1|  SET and MYND domain-containing protein                82.4    8e-13    
ref|XP_008827011.1|  PREDICTED: SET and MYND domain-containing pr...  82.4    9e-13    
emb|CCF49883.1|  related to tetratricopeptide repeat protein 2, d...  82.0    9e-13    
gb|EFZ17321.1|  hypothetical protein SINV_03681                       81.6    1e-12    
ref|XP_008693504.1|  PREDICTED: SET and MYND domain-containing pr...  82.4    1e-12    
ref|XP_006099237.1|  PREDICTED: SET and MYND domain-containing pr...  82.0    1e-12    
ref|XP_008693503.1|  PREDICTED: SET and MYND domain-containing pr...  82.4    1e-12    
ref|XP_005298338.1|  PREDICTED: SET and MYND domain-containing pr...  82.0    1e-12    
ref|XP_392262.3|  PREDICTED: SET and MYND domain-containing prote...  82.0    1e-12    Apis mellifera [bee]
gb|KDO29854.1|  hypothetical protein SPRG_04933                       78.2    2e-12    
gb|KDO16803.1|  hypothetical protein SPRG_15594                       77.8    2e-12    
ref|XP_011058840.1|  PREDICTED: SET and MYND domain-containing pr...  80.9    3e-12    
ref|XP_009841908.1|  hypothetical protein H257_15485                  77.8    3e-12    
gb|KDP32756.1|  hypothetical protein JCGZ_12048                       80.1    3e-12    
ref|XP_004927446.1|  PREDICTED: tetratricopeptide repeat protein ...  78.2    3e-12    
ref|XP_004535928.1|  PREDICTED: RNA polymerase II-associated prot...  80.1    3e-12    
ref|XP_008603818.1|  hypothetical protein SDRG_00131                  77.4    3e-12    
gb|ENN78715.1|  hypothetical protein YQE_04887                        80.1    3e-12    
emb|CDS10959.1|  hypothetical protein LRAMOSA03224                    79.7    3e-12    
gb|EFN83374.1|  SET and MYND domain-containing protein 4              80.5    3e-12    
gb|AEE62160.1|  unknown                                               80.1    3e-12    
ref|XP_008545176.1|  PREDICTED: SET and MYND domain-containing pr...  80.5    4e-12    
ref|XP_005858368.1|  PREDICTED: SET and MYND domain-containing pr...  80.5    4e-12    
ref|XP_006863296.1|  PREDICTED: SET and MYND domain-containing pr...  80.5    4e-12    
ref|XP_008863387.1|  hypothetical protein H310_01849                  77.0    4e-12    
ref|XP_007621471.1|  PREDICTED: SET and MYND domain-containing pr...  80.5    4e-12    
ref|XP_008620154.1|  hypothetical protein SDRG_15750                  80.5    4e-12    
ref|XP_005858367.1|  PREDICTED: SET and MYND domain-containing pr...  80.5    4e-12    
ref|XP_006214533.1|  PREDICTED: SET and MYND domain-containing pr...  80.5    4e-12    
emb|CBY24692.1|  unnamed protein product                              79.3    5e-12    
ref|XP_005858369.1|  PREDICTED: SET and MYND domain-containing pr...  80.1    5e-12    
ref|XP_002513816.1|  protein with unknown function                    79.3    5e-12    Ricinus communis
ref|XP_002918077.1|  PREDICTED: SET and MYND domain-containing pr...  80.1    5e-12    
gb|KDO80753.1|  hypothetical protein CISIN_1g011626mg                 77.8    5e-12    
gb|ELU01530.1|  hypothetical protein CAPTEDRAFT_197951                79.7    6e-12    
ref|XP_008007961.1|  PREDICTED: SET and MYND domain-containing pr...  79.7    6e-12    
ref|XP_006343573.1|  PREDICTED: tetratricopeptide repeat protein ...  76.3    9e-12    
ref|XP_010262948.1|  PREDICTED: tetratricopeptide repeat protein ...  76.3    9e-12    
ref|XP_011097714.1|  PREDICTED: histone-lysine N-methyltransferas...  78.6    9e-12    
gb|KDO80752.1|  hypothetical protein CISIN_1g011626mg                 77.8    9e-12    
ref|XP_010262946.1|  PREDICTED: tetratricopeptide repeat protein ...  76.3    9e-12    
ref|XP_003386610.1|  PREDICTED: RNA polymerase II-associated prot...  78.2    1e-11    
ref|XP_005328011.1|  PREDICTED: SET and MYND domain-containing pr...  79.0    1e-11    
ref|XP_002403605.1|  SET and MYND domain-containing protein (SMYD...  79.0    1e-11    Ixodes scapularis [blacklegged tick]
ref|XP_006434126.1|  hypothetical protein CICLE_v10001105mg           78.2    1e-11    
gb|AAS07242.1|  putative MYND finger protein                          77.8    1e-11    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008061604.1|  PREDICTED: SET and MYND domain-containing pr...  78.6    1e-11    
gb|KDO80750.1|  hypothetical protein CISIN_1g011626mg                 77.8    2e-11    
gb|KDO80748.1|  hypothetical protein CISIN_1g011626mg                 77.8    2e-11    
ref|XP_006564918.1|  PREDICTED: SET and MYND domain-containing pr...  77.8    2e-11    
ref|XP_002533434.1|  heat shock protein 70 (HSP70)-interacting pr...  75.1    2e-11    Ricinus communis
gb|KDR12448.1|  SET and MYND domain-containing protein 4              78.2    2e-11    
ref|XP_008557095.1|  PREDICTED: dnaJ homolog subfamily C member 7...  78.2    2e-11    
ref|XP_003691021.1|  PREDICTED: SET and MYND domain-containing pr...  78.2    2e-11    
ref|XP_006564919.1|  PREDICTED: SET and MYND domain-containing pr...  77.4    2e-11    
ref|XP_004535929.1|  PREDICTED: RNA polymerase II-associated prot...  77.4    2e-11    
ref|XP_007177539.1|  PREDICTED: SET and MYND domain-containing pr...  78.2    2e-11    
ref|XP_004294618.1|  PREDICTED: tetratricopeptide repeat protein ...  75.1    2e-11    
ref|XP_006741459.1|  PREDICTED: SET and MYND domain-containing pr...  78.2    2e-11    
ref|XP_309411.4|  AGAP011232-PA                                       77.0    2e-11    Anopheles gambiae str. PEST
ref|XP_007177538.1|  PREDICTED: SET and MYND domain-containing pr...  78.2    2e-11    
gb|KDO28341.1|  hypothetical protein SPRG_06580                       78.6    2e-11    
ref|XP_001122116.2|  PREDICTED: SET and MYND domain-containing pr...  77.8    2e-11    Apis mellifera [bee]
ref|XP_006564917.1|  PREDICTED: SET and MYND domain-containing pr...  77.4    3e-11    
ref|XP_002428677.1|  set and mynd domain-containing protein, puta...  77.8    3e-11    Pediculus humanus corporis [human body lice]
gb|EFX61914.1|  hypothetical protein DAPPUDRAFT_68494                 77.8    3e-11    
emb|CDY51514.1|  BnaC04g02370D                                        77.8    3e-11    
ref|XP_003694793.1|  PREDICTED: SET and MYND domain-containing pr...  77.4    3e-11    
ref|XP_008007962.1|  PREDICTED: SET and MYND domain-containing pr...  77.4    4e-11    
ref|XP_003622987.1|  Tetratricopeptide repeat protein                 74.3    4e-11    
ref|XP_008007958.1|  PREDICTED: SET and MYND domain-containing pr...  77.4    4e-11    
gb|EEC76031.1|  hypothetical protein OsI_13199                        76.6    4e-11    Oryza sativa Indica Group [Indian rice]
ref|XP_002309374.2|  hypothetical protein POPTR_0006s19280g           74.3    4e-11    Populus trichocarpa [western balsam poplar]
gb|ABF98444.1|  MYND finger family protein, expressed                 76.6    4e-11    Oryza sativa Japonica Group [Japonica rice]
gb|EFN70437.1|  SET and MYND domain-containing protein 4              77.0    4e-11    
ref|XP_008007960.1|  PREDICTED: SET and MYND domain-containing pr...  77.4    4e-11    
ref|XP_005582512.1|  PREDICTED: SET and MYND domain-containing pr...  77.0    4e-11    
ref|XP_005349613.1|  PREDICTED: SET and MYND domain-containing pr...  77.0    4e-11    
ref|XP_005582516.1|  PREDICTED: SET and MYND domain-containing pr...  77.0    4e-11    
gb|EHH57568.1|  hypothetical protein EGM_07234                        77.0    5e-11    
ref|XP_001117365.1|  PREDICTED: SET and MYND domain-containing pr...  77.0    5e-11    Macaca mulatta [rhesus macaque]
gb|EHH24346.1|  hypothetical protein EGK_07991                        77.0    5e-11    
gb|EFX74155.1|  hypothetical protein DAPPUDRAFT_307492                73.6    5e-11    
ref|XP_005582519.1|  PREDICTED: SET and MYND domain-containing pr...  76.6    5e-11    
gb|AES79205.2|  heat shock protein 70 (HSP70)-interacting protein...  73.9    5e-11    
ref|XP_005834996.1|  FKBP-type peptidyl-prolyl cis-trans isomerase    76.3    5e-11    
ref|XP_003400603.1|  PREDICTED: SET and MYND domain-containing pr...  76.6    5e-11    
ref|XP_003417026.1|  PREDICTED: SET and MYND domain-containing pr...  77.0    5e-11    
ref|XP_006869038.1|  PREDICTED: small glutamine-rich tetratricope...  74.3    5e-11    
dbj|BAL14275.1|  serine/threonine-protein phosphatase 5               76.3    5e-11    
ref|XP_005975811.1|  PREDICTED: SET and MYND domain-containing pr...  76.6    6e-11    
emb|CCA23670.1|  Mitochondrial Protein Translocase (MPT) Family puta  73.6    6e-11    
dbj|GAM17448.1|  hypothetical protein SAMD00019534_006230             76.6    6e-11    
ref|XP_011010594.1|  PREDICTED: tetratricopeptide repeat protein ...  73.6    6e-11    
ref|XP_011079345.1|  PREDICTED: tetratricopeptide repeat protein 1    73.9    6e-11    
ref|XP_002175481.1|  DNAJ/TPR domain-containing protein DNAJC7 fa...  75.9    6e-11    Schizosaccharomyces japonicus yFS275
ref|XP_010633141.1|  PREDICTED: small glutamine-rich tetratricope...  74.3    6e-11    
ref|XP_005582520.1|  PREDICTED: SET and MYND domain-containing pr...  76.3    7e-11    
ref|XP_010859633.1|  PREDICTED: SET and MYND domain-containing pr...  76.6    7e-11    
ref|XP_003728116.1|  PREDICTED: SET and MYND domain-containing pr...  74.3    7e-11    
dbj|GAM21729.1|  hypothetical protein SAMD00019534_049040             76.3    7e-11    
ref|XP_008223581.1|  PREDICTED: tetratricopeptide repeat protein ...  73.2    8e-11    
ref|XP_005582517.1|  PREDICTED: SET and MYND domain-containing pr...  76.3    8e-11    
ref|XP_006751101.1|  PREDICTED: small glutamine-rich tetratricope...  73.2    8e-11    
ref|XP_010859631.1|  PREDICTED: SET and MYND domain-containing pr...  76.3    9e-11    
ref|XP_006622175.1|  PREDICTED: SET and MYND domain-containing pr...  75.9    9e-11    
ref|XP_009308327.1|  putative stress-inducible protein STI1-like      73.2    9e-11    
ref|XP_005888310.1|  PREDICTED: SET and MYND domain-containing pr...  76.3    9e-11    
dbj|BAK05802.1|  predicted protein                                    75.9    9e-11    
ref|XP_010046930.1|  PREDICTED: tetratricopeptide repeat protein 1    73.2    9e-11    
gb|KDR24362.1|  DnaJ-like protein subfamily C member 7                75.5    1e-10    
emb|CDH51232.1|  rna polymerase ii-associated protein 3-like          75.1    1e-10    
ref|XP_010447706.1|  PREDICTED: tetratricopeptide repeat protein ...  73.2    1e-10    
ref|XP_004903285.1|  PREDICTED: small glutamine-rich tetratricope...  73.6    1e-10    
ref|XP_009603851.1|  PREDICTED: serine/threonine-protein phosphat...  75.1    1e-10    
ref|XP_004903281.1|  PREDICTED: small glutamine-rich tetratricope...  73.9    1e-10    
ref|XP_004689426.1|  PREDICTED: small glutamine-rich tetratricope...  73.6    1e-10    
ref|XP_006284287.1|  hypothetical protein CARUB_v10005456mg           72.8    1e-10    
ref|XP_006977445.1|  PREDICTED: SET and MYND domain-containing pr...  75.5    1e-10    
ref|XP_002923601.1|  PREDICTED: small glutamine-rich tetratricope...  73.2    1e-10    
ref|XP_010633139.1|  PREDICTED: small glutamine-rich tetratricope...  73.6    1e-10    
gb|EMS63478.1|  Tetratricopeptide repeat protein 1                    72.4    1e-10    
ref|XP_004703756.1|  PREDICTED: small glutamine-rich tetratricope...  72.8    1e-10    
gb|EHB14637.1|  Small glutamine-rich tetratricopeptide repeat-con...  73.2    1e-10    
emb|CDS32355.1|  RNA polymerase II associated protein 3               74.3    1e-10    
ref|XP_002525865.1|  amidase, putative                                75.1    1e-10    
ref|XP_005633150.1|  PREDICTED: small glutamine-rich tetratricope...  73.2    2e-10    
ref|XP_004395431.1|  PREDICTED: small glutamine-rich tetratricope...  73.2    2e-10    
ref|XP_007143798.1|  hypothetical protein PHAVU_007G102500g           72.8    2e-10    
gb|AAM97151.1|  unknown protein,3'-partial                            74.3    2e-10    
ref|XP_001654193.1|  UDP-N-acetylglucosamine: polypeptide-N-acety...  74.3    2e-10    
ref|XP_004778025.1|  PREDICTED: small glutamine-rich tetratricope...  73.2    2e-10    
ref|XP_009618109.1|  PREDICTED: histone-lysine N-methyltransferas...  74.7    2e-10    
emb|CDY61202.1|  BnaA03g56720D                                        75.1    2e-10    
ref|XP_009133543.1|  PREDICTED: inactive TPR repeat-containing th...  75.1    2e-10    
ref|XP_008588286.1|  PREDICTED: small glutamine-rich tetratricope...  72.8    2e-10    
ref|XP_004903283.1|  PREDICTED: small glutamine-rich tetratricope...  73.2    2e-10    
ref|XP_004333075.1|  Hsp40, putative                                  74.7    2e-10    
gb|EMT01019.1|  Tetratricopeptide repeat protein 1                    72.0    2e-10    
ref|NP_001096081.1|  SET and MYND domain-containing protein 4         75.1    2e-10    
dbj|BAC41013.1|  unnamed protein product                              75.1    2e-10    
ref|XP_001861782.1|  tetratricopeptide repeat protein 2               74.3    2e-10    
gb|EXX62432.1|  Sti1p                                                 74.3    2e-10    
ref|XP_010190041.1|  PREDICTED: RNA polymerase II-associated prot...  74.7    2e-10    
gb|EDL12802.1|  SET and MYND domain containing 4, isoform CRA_b       74.7    2e-10    
ref|XP_002424514.1|  set and mynd domain containing protein, puta...  74.7    2e-10    
ref|XP_002282402.1|  PREDICTED: translocon at the outer membrane ...  74.3    2e-10    
ref|NP_001072288.1|  SET and MYND domain containing 4                 74.7    2e-10    
ref|NP_001231321.1|  small glutamine-rich tetratricopeptide repea...  72.4    3e-10    
ref|XP_001604392.1|  PREDICTED: SET and MYND domain-containing pr...  74.3    3e-10    
gb|EFN62504.1|  SET and MYND domain-containing protein 4              72.8    3e-10    
ref|XP_008211403.1|  PREDICTED: SET and MYND domain-containing pr...  74.3    3e-10    
gb|EXX62433.1|  Scj1p                                                 73.9    3e-10    
ref|XP_001654192.1|  UDP-N-acetylglucosamine: polypeptide-N-acety...  73.2    3e-10    
ref|XP_006627142.1|  PREDICTED: small glutamine-rich tetratricope...  72.4    3e-10    
ref|XP_005179095.1|  PREDICTED: RNA polymerase II-associated prot...  73.9    3e-10    
ref|XP_009187590.1|  PREDICTED: SET and MYND domain-containing pr...  74.3    3e-10    
ref|XP_001504392.2|  PREDICTED: SET and MYND domain-containing pr...  74.3    3e-10    
ref|XP_007229808.1|  PREDICTED: RNA polymerase II-associated prot...  73.9    3e-10    
gb|KFO28849.1|  Nuclear factor 1 C-type                               74.7    3e-10    
gb|KHN00149.1|  Translocon at the outer membrane of chloroplasts 64   73.2    3e-10    
gb|KCW78647.1|  hypothetical protein EUGRSUZ_C00110                   72.8    3e-10    
ref|XP_319734.4|  AGAP008985-PA                                       73.6    3e-10    
gb|KCW78648.1|  hypothetical protein EUGRSUZ_C00110                   72.8    3e-10    
gb|KFK29620.1|  hypothetical protein AALP_AA7G157600                  71.6    3e-10    
ref|XP_004498557.1|  PREDICTED: tetratricopeptide repeat protein ...  71.6    3e-10    
ref|XP_007229809.1|  PREDICTED: RNA polymerase II-associated prot...  73.9    3e-10    
ref|XP_002900537.1|  conserved hypothetical protein                   73.6    3e-10    
ref|XP_314232.5|  AGAP003336-PA                                       72.0    3e-10    
ref|XP_004487317.1|  PREDICTED: tetratricopeptide repeat protein ...  71.6    3e-10    
ref|XP_005597711.1|  PREDICTED: SET and MYND domain-containing pr...  74.3    3e-10    
gb|EPS65438.1|  hypothetical protein M569_09339                       73.9    3e-10    
ref|NP_596790.1|  DNAJ/TPR domain protein DNAJC7 family               73.6    3e-10    
ref|XP_008223580.1|  PREDICTED: tetratricopeptide repeat protein ...  71.2    3e-10    
ref|XP_005402660.1|  PREDICTED: SET and MYND domain-containing pr...  74.3    3e-10    
ref|XP_005724435.1|  PREDICTED: mitochondrial import receptor sub...  72.0    3e-10    
ref|XP_002324511.1|  tetratricopeptide repeat-containing family p...  71.6    3e-10    
ref|XP_008535929.1|  PREDICTED: SET and MYND domain-containing pr...  74.3    3e-10    
ref|XP_004548907.1|  PREDICTED: mitochondrial import receptor sub...  72.0    4e-10    
ref|XP_006783080.1|  PREDICTED: mitochondrial import receptor sub...  72.0    4e-10    
ref|XP_004012599.1|  PREDICTED: SET and MYND domain-containing pr...  74.3    4e-10    
ref|XP_009351162.1|  PREDICTED: sperm-associated antigen 1A-like      70.1    4e-10    
ref|XP_006195680.1|  PREDICTED: small glutamine-rich tetratricope...  70.5    4e-10    
emb|CDQ82829.1|  unnamed protein product                              73.9    4e-10    
ref|XP_007075224.1|  PREDICTED: small glutamine-rich tetratricope...  72.0    4e-10    
ref|XP_011018093.1|  PREDICTED: tetratricopeptide repeat protein 1    71.2    4e-10    
ref|XP_007621475.1|  PREDICTED: SET and MYND domain-containing pr...  73.6    4e-10    
ref|XP_008709445.1|  PREDICTED: small glutamine-rich tetratricope...  71.6    4e-10    
ref|XP_010998184.1|  PREDICTED: small glutamine-rich tetratricope...  71.2    5e-10    
gb|AAH95952.1|  Smyd4 protein                                         73.9    5e-10    
ref|XP_005693375.1|  PREDICTED: SET and MYND domain-containing pr...  73.9    5e-10    
ref|XP_761562.1|  hypothetical protein UM05415.1                      73.6    5e-10    
ref|XP_004667907.1|  PREDICTED: SET and MYND domain-containing pr...  73.9    5e-10    
ref|XP_008535930.1|  PREDICTED: SET and MYND domain-containing pr...  73.6    5e-10    
ref|XP_006647919.1|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...  73.6    5e-10    
ref|XP_010268410.1|  PREDICTED: tetratricopeptide repeat protein ...  70.5    5e-10    
ref|XP_007222478.1|  hypothetical protein PRUPE_ppa009782mg           70.9    5e-10    
ref|XP_004299527.1|  PREDICTED: translocon at the outer membrane ...  73.2    5e-10    
ref|NP_194777.3|  tetratricopeptide repeat domain-containing protein  70.9    5e-10    
ref|XP_005469784.1|  PREDICTED: mitochondrial import receptor sub...  70.5    6e-10    
ref|XP_007176736.1|  PREDICTED: small glutamine-rich tetratricope...  72.0    6e-10    
gb|EPY33557.1|  DnaJ like protein subfamily C member 7                73.2    6e-10    
ref|XP_007176083.1|  PREDICTED: small glutamine-rich tetratricope...  71.2    6e-10    
gb|EFX87160.1|  hypothetical protein DAPPUDRAFT_312722                73.6    6e-10    
ref|XP_003244133.1|  PREDICTED: SET and MYND domain-containing pr...  73.2    6e-10    
gb|AEM45799.1|  serine/threonine protein phosphatase 5                72.8    6e-10    
ref|XP_007176084.1|  PREDICTED: small glutamine-rich tetratricope...  71.2    6e-10    
ref|XP_002869376.1|  tetratricopeptide repeat-containing protein      70.9    6e-10    
gb|EDL18506.1|  small glutamine-rich tetratricopeptide repeat (TP...  70.1    7e-10    
gb|KDQ62262.1|  hypothetical protein JAAARDRAFT_30155                 72.0    7e-10    
ref|XP_002130937.1|  PREDICTED: tetratricopeptide repeat protein ...  70.1    7e-10    
ref|NP_061945.1|  small glutamine-rich tetratricopeptide repeat-c...  70.9    7e-10    
ref|XP_526906.2|  PREDICTED: small glutamine-rich tetratricopepti...  70.9    7e-10    
gb|EFA76591.1|  tetratricopeptide-like helical domain-containing ...  71.6    7e-10    
ref|XP_008380558.1|  PREDICTED: tetratricopeptide repeat protein 1    70.1    8e-10    
gb|EHJ70221.1|  putative tetratricopeptide repeat domain 1            70.5    8e-10    
ref|XP_009016128.1|  hypothetical protein HELRODRAFT_191313           73.2    8e-10    
ref|XP_010065502.1|  PREDICTED: histone-lysine N-methyltransferas...  72.4    8e-10    
emb|CDR44631.1|  CYFA0S15e00804g1_1                                   72.4    8e-10    
ref|XP_006195679.1|  PREDICTED: small glutamine-rich tetratricope...  69.7    8e-10    
ref|XP_007637602.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    8e-10    
emb|CDI57012.1|  related to tetratricopeptide repeat protein 2, d...  72.8    8e-10    
ref|XP_008237495.1|  PREDICTED: tetratricopeptide repeat protein ...  70.1    9e-10    
ref|XP_002163555.2|  PREDICTED: uncharacterized protein LOC100200645  73.2    9e-10    
ref|NP_001048155.1|  Os02g0754500                                     72.8    9e-10    
ref|XP_007559755.1|  PREDICTED: mitochondrial import receptor sub...  70.9    9e-10    
ref|XP_010964974.1|  PREDICTED: small glutamine-rich tetratricope...  70.9    9e-10    
ref|XP_007949203.1|  PREDICTED: small glutamine-rich tetratricope...  70.9    9e-10    
ref|XP_002837827.1|  hypothetical protein                             72.4    9e-10    
ref|XP_010998185.1|  PREDICTED: small glutamine-rich tetratricope...  70.9    9e-10    
ref|XP_005499976.1|  PREDICTED: RNA polymerase II-associated prot...  72.8    9e-10    
ref|XP_010268409.1|  PREDICTED: tetratricopeptide repeat protein ...  70.1    9e-10    
ref|XP_006754919.1|  PREDICTED: mitochondrial import receptor sub...  72.4    9e-10    
ref|XP_009356037.1|  PREDICTED: translocon at the outer membrane ...  72.4    9e-10    
gb|AES71348.2|  histone-lysine N-methyltransferase                    72.0    9e-10    
ref|XP_011082952.1|  PREDICTED: serine/threonine-protein phosphat...  72.0    1e-09    
gb|KFK24027.1|  hypothetical protein AALP_AAs74005U000100             67.8    1e-09    
ref|XP_003493967.1|  PREDICTED: SET and MYND domain-containing pr...  72.4    1e-09    
ref|XP_006913150.1|  PREDICTED: small glutamine-rich tetratricope...  70.5    1e-09    
ref|XP_007018976.1|  Histone-lysine N-methyltransferase ASHR1         72.0    1e-09    
ref|NP_001234232.1|  serine/threonine-protein phosphatase 5           72.0    1e-09    
ref|XP_003530960.1|  PREDICTED: translocon at the outer membrane ...  72.4    1e-09    
ref|XP_004500596.1|  PREDICTED: histone-lysine N-methyltransferas...  71.6    1e-09    
ref|XP_004441389.1|  PREDICTED: small glutamine-rich tetratricope...  70.5    1e-09    
ref|XP_003570616.2|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...  72.8    1e-09    
emb|CDX71941.1|  BnaC08g29330D                                        72.4    1e-09    
ref|XP_007951054.1|  PREDICTED: small glutamine-rich tetratricope...  70.5    1e-09    
ref|XP_007523551.1|  PREDICTED: small glutamine-rich tetratricope...  70.5    1e-09    
ref|XP_009142852.1|  PREDICTED: inactive TPR repeat-containing th...  72.4    1e-09    
ref|XP_007177541.1|  PREDICTED: SET and MYND domain-containing pr...  72.4    1e-09    
ref|XP_004337363.1|  tetratricopeptide repeat domain containing p...  72.4    1e-09    
ref|XP_007177540.1|  PREDICTED: SET and MYND domain-containing pr...  72.4    1e-09    
ref|XP_008864903.1|  hypothetical protein H310_02969                  69.7    1e-09    
ref|XP_004465620.1|  PREDICTED: small glutamine-rich tetratricope...  69.3    1e-09    
ref|XP_009116538.1|  PREDICTED: TPR repeat-containing thioredoxin...  72.4    1e-09    
emb|CDY55390.1|  BnaA05g34270D                                        72.4    1e-09    
ref|XP_009374583.1|  PREDICTED: tetratricopeptide repeat protein ...  69.3    1e-09    
gb|EFB17357.1|  hypothetical protein PANDA_007967                     69.7    1e-09    
ref|XP_003134059.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
gb|ELK36875.1|  Mitochondrial import receptor subunit TOM70           72.0    1e-09    
ref|XP_005099988.1|  PREDICTED: dnaJ homolog subfamily C member 7...  72.4    1e-09    
gb|KFB47810.1|  AGAP008985-PA-like protein                            71.6    1e-09    
ref|XP_006206475.1|  PREDICTED: small glutamine-rich tetratricope...  70.5    1e-09    
ref|XP_007201235.1|  hypothetical protein PRUPE_ppa010464mg           69.3    1e-09    
gb|KFK35092.1|  hypothetical protein AALP_AA5G234100                  72.0    1e-09    
ref|XP_006186133.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|XP_006871045.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|XP_006411519.1|  hypothetical protein EUTSA_v10016343mg           72.0    1e-09    
gb|EFX68223.1|  hypothetical protein DAPPUDRAFT_301530                69.3    1e-09    
ref|XP_006098433.1|  PREDICTED: mitochondrial import receptor sub...  72.0    1e-09    
ref|XP_003981070.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|XP_002919337.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|XP_008157873.1|  PREDICTED: mitochondrial import receptor sub...  72.0    1e-09    
ref|XP_005672552.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|XP_006762474.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|XP_782707.2|  PREDICTED: RNA polymerase II-associated protein...  71.6    1e-09    
gb|EMT16420.1|  Small glutamine-rich tetratricopeptide repeat-con...  72.0    1e-09    
ref|XP_004363379.1|  predicted protein                                72.0    1e-09    
ref|XP_007079952.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|XP_010947669.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|XP_008406507.1|  PREDICTED: mitochondrial import receptor sub...  70.1    1e-09    
ref|XP_008160099.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|XP_535258.1|  PREDICTED: small glutamine-rich tetratricopepti...  70.1    1e-09    
ref|XP_006348936.1|  PREDICTED: serine/threonine-protein phosphat...  71.6    1e-09    
ref|XP_005858011.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    1e-09    
ref|NP_001064904.1|  Os10g0486900                                     69.3    1e-09    
ref|XP_004623103.1|  PREDICTED: small glutamine-rich tetratricope...  70.1    2e-09    
ref|NP_001266017.1|  tetratricopeptide repeat protein 1-like          69.3    2e-09    
gb|KFH68608.1|  hypothetical protein MVEG_05418                       71.6    2e-09    
ref|XP_010272881.1|  PREDICTED: histone-lysine N-methyltransferas...  71.2    2e-09    
ref|XP_004270800.1|  PREDICTED: small glutamine-rich tetratricope...  69.7    2e-09    
ref|XP_005105913.1|  PREDICTED: SET and MYND domain-containing pr...  71.6    2e-09    
ref|XP_003631114.1|  Glutamyl-tRNA(Gln) amidotransferase subunit A    71.6    2e-09    
ref|XP_002508658.1|  hypothetical protein MICPUN_61723                71.6    2e-09    
gb|EHH59051.1|  Alpha-SGT                                             69.3    2e-09    
ref|XP_003131876.2|  PREDICTED: SET and MYND domain-containing pr...  72.0    2e-09    
gb|KGL72394.1|  RNA polymerase II-associated protein 3                71.6    2e-09    
ref|XP_004422933.1|  PREDICTED: small glutamine-rich tetratricope...  69.7    2e-09    
ref|XP_007103368.1|  PREDICTED: small glutamine-rich tetratricope...  69.7    2e-09    
ref|XP_010226322.1|  PREDICTED: RNA polymerase II-associated prot...  71.6    2e-09    
ref|XP_639380.1|  hypothetical protein DDB_G0282885                   70.9    2e-09    
emb|CAB68200.1|  putative protein                                     71.6    2e-09    
ref|NP_191421.2|  TPR repeat-containing thioredoxin TTL4              71.6    2e-09    
gb|EFX90083.1|  hypothetical protein DAPPUDRAFT_309882                71.6    2e-09    
ref|XP_004764592.1|  PREDICTED: small glutamine-rich tetratricope...  69.7    2e-09    
gb|KFV60677.1|  RNA polymerase II-associated protein 3                71.6    2e-09    
ref|NP_001181661.1|  small glutamine-rich tetratricopeptide repea...  69.7    2e-09    
ref|XP_007656901.1|  PREDICTED: small glutamine-rich tetratricope...  68.2    2e-09    
ref|XP_004465617.1|  PREDICTED: small glutamine-rich tetratricope...  69.7    2e-09    
ref|XP_007992913.1|  PREDICTED: small glutamine-rich tetratricope...  69.7    2e-09    
gb|KHN72220.1|  Hsc70-interacting protein                             68.6    2e-09    
ref|XP_004595724.1|  PREDICTED: small glutamine-rich tetratricope...  69.7    2e-09    
ref|XP_003394163.1|  PREDICTED: SET and MYND domain-containing pr...  71.6    2e-09    
ref|XP_002268888.1|  PREDICTED: outer envelope protein 64, mitoch...  71.2    2e-09    
ref|XP_003914680.1|  PREDICTED: small glutamine-rich tetratricope...  69.7    2e-09    
dbj|BAE01321.1|  unnamed protein product                              69.7    2e-09    
ref|XP_008291234.1|  PREDICTED: mitochondrial import receptor sub...  69.7    2e-09    
emb|CDY42827.1|  BnaC03g23790D                                        71.6    2e-09    
gb|KFB46947.1|  AGAP004797-PA-like protein                            68.6    2e-09    
ref|XP_004764593.1|  PREDICTED: small glutamine-rich tetratricope...  69.3    2e-09    
ref|XP_006517674.1|  PREDICTED: small glutamine-rich tetratricope...  68.2    2e-09    
ref|XP_001238168.1|  AGAP008840-PA                                    68.2    2e-09    
gb|KFH68925.1|  hypothetical protein MVEG_05728                       70.9    2e-09    
ref|XP_008240148.1|  PREDICTED: outer envelope protein 64, chloro...  71.2    2e-09    
emb|CCX34376.1|  Similar to DnaJ homolog subfamily C member 7 hom...  70.9    2e-09    
ref|XP_008047957.1|  PREDICTED: small glutamine-rich tetratricope...  69.3    2e-09    
ref|XP_011087889.1|  PREDICTED: outer envelope protein 64, mitoch...  71.2    2e-09    
gb|EPS64474.1|  hypothetical protein M569_10307                       68.9    2e-09    
ref|XP_002055573.1|  GJ19436                                          70.5    2e-09    
ref|XP_007935763.1|  PREDICTED: SET and MYND domain-containing pr...  71.6    2e-09    
ref|XP_008541988.1|  PREDICTED: small glutamine-rich tetratricope...  68.2    3e-09    
ref|XP_004685191.1|  PREDICTED: SET and MYND domain-containing pr...  71.2    3e-09    
ref|XP_008994617.1|  PREDICTED: SET and MYND domain-containing pr...  71.2    3e-09    
ref|XP_009972922.1|  PREDICTED: RNA polymerase II-associated prot...  71.2    3e-09    
ref|XP_003424896.2|  PREDICTED: uncharacterized protein LOC100121039  71.6    3e-09    
ref|XP_002747857.1|  PREDICTED: SET and MYND domain-containing pr...  71.2    3e-09    
ref|XP_969908.2|  PREDICTED: dnaJ homolog subfamily C member 7        70.9    3e-09    
ref|XP_004500595.1|  PREDICTED: histone-lysine N-methyltransferas...  70.9    3e-09    
gb|AAM61607.1|  unknown                                               68.9    3e-09    
dbj|BAG57017.1|  unnamed protein product                              68.9    3e-09    
emb|CCC90111.1|  unnamed protein product                              71.2    3e-09    
gb|EFA04042.1|  hypothetical protein TcasGA2_TC014273                 70.9    3e-09    
ref|XP_010365623.1|  PREDICTED: small glutamine-rich tetratricope...  69.3    3e-09    
gb|EHH29449.1|  Alpha-SGT                                             68.9    3e-09    
ref|XP_006641162.1|  PREDICTED: SET and MYND domain-containing pr...  71.2    3e-09    
ref|XP_003701709.1|  PREDICTED: SET and MYND domain-containing pr...  71.2    3e-09    



>ref|XP_009607277.1| PREDICTED: uncharacterized protein LOC104101520 [Nicotiana tomentosiformis]
Length=794

 Score =   977 bits (2526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/781 (63%), Positives = 604/781 (77%), Gaps = 19/781 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS VP+AL+QEI +STP  LP+TCSSLL+FFH LPQFHQ+VK+LTDP MALC KD 
Sbjct  1     MEKLKSAVPEALKQEIWKSTPTELPSTCSSLLDFFHHLPQFHQMVKDLTDPAMALCCKDQ  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             SAA E KL+GN+CFS GDYP AL  Y+QALRLAP + +D EKN  A+LYVNRASAL KMG
Sbjct  61    SAALEAKLKGNECFSKGDYPNALLSYSQALRLAPVDIDDMEKNPLAVLYVNRASALQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAKAWFRRGKAN SLG FEDAI+DL +SLK E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRLSPHYAKAWFRRGKANISLGKFEDAIRDLNISLKAEISSSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL I LD+HK   SS  K N+N S+V   DEPD+  +QC+   TKGRGM     +   S
Sbjct  181   AELNIALDKHKGMGSSGKKPNQNISEVP--DEPDQVKLQCLFKTTKGRGMFCVDGVSEAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKEDPYAAIILK CRET+CHFCFNELP  A+ C SCSIPLYCS QCQL +GG++  ++
Sbjct  239   LVHKEDPYAAIILKKCRETHCHFCFNELPADAISCLSCSIPLYCSDQCQLQAGGQKIDRS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
              R       LP++L+ YIS+ ++ G S   T  IAEHRHEC G HWP +LPSEVVLAGR+
Sbjct  299   FRSFKGLEGLPNDLQNYISDVLA-GNSTLETGHIAEHRHECLGFHWPLILPSEVVLAGRI  357

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK IEQ+K +S  S L+ +LDL HN+  L P++KLEMHIYSIIL++CLQ+ Y  +LP++
Sbjct  358   LVKVIEQKKHASVVSKLIGILDLSHNYPHLSPESKLEMHIYSIILVHCLQHFYTTELPIS  417

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G++IS+LVILLSQI+VNSMAIVRM++ + +GS+ E  NALTSSLEQVKVGQ +Y+ GS+F
Sbjct  418   GIVISKLVILLSQIQVNSMAIVRMQAPEVRGSVYEPGNALTSSLEQVKVGQVVYVAGSLF  477

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSCRPN HAYFLSRTLY++ T+ + AGSELELSYGPQVGQWD KDRQQ+L DRYSF+CQ
Sbjct  478   NHSCRPNIHAYFLSRTLYLQATEYILAGSELELSYGPQVGQWDFKDRQQLLEDRYSFTCQ  537

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-------------PHVSKQ  729
             C GCS+LN+SDL INAYRC KP CLGV+ DST+A Y KQKL             PH  KQ
Sbjct  538   CTGCSELNVSDLVINAYRCTKPNCLGVILDSTIARYEKQKLKLLLDAPAVYSSSPH--KQ  595

Query  728   VEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIA  549
             +++++   I++VA   +  +DY L+P HCL C  YRDLEA+CA  S+ ES   RLQDAIA
Sbjct  596   IDRLKGANINEVAR-RIFVSDYELEPQHCLVCGSYRDLEASCAATSQVESFCKRLQDAIA  654

Query  548   SNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKI  369
             SN+VP  +L +AL+ +D+LR+ LHP+NKRIAEVEDN+AQA CLVGE QAA+DHCKASI+I
Sbjct  655   SNEVPNNILQDALRCTDLLRTILHPYNKRIAEVEDNLAQAFCLVGELQAALDHCKASIQI  714

Query  368   LEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRL  189
             LEKLYDPNHI IGNELIK  S+Q+  G+  A+ +      IFSRY+GSHA   +P+L+ L
Sbjct  715   LEKLYDPNHIAIGNELIKFASLQILVGDSAASDSMSRITAIFSRYYGSHADDTYPFLRHL  774

Query  188   Q  186
             +
Sbjct  775   K  775



>ref|XP_009759170.1| PREDICTED: uncharacterized protein LOC104211758 isoform X1 [Nicotiana 
sylvestris]
Length=795

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/779 (63%), Positives = 607/779 (78%), Gaps = 14/779 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS VP+AL+QEI +STP  LP+TCSSLL+FFH LPQFHQ+VK+LTDP MALC KD 
Sbjct  1     MEKLKSAVPEALKQEIWKSTPTELPSTCSSLLDFFHHLPQFHQMVKDLTDPAMALCCKDQ  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             SAA E KL+GN+CFS GDYP AL  Y+QALR AP + +D EKN  A+LYVNRASAL KMG
Sbjct  61    SAALEAKLKGNECFSKGDYPNALLSYSQALRHAPVDIDDMEKNPVAVLYVNRASALQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAKAWFRRGKAN SLG FEDAI+DL +SLK E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRVSPHYAKAWFRRGKANISLGKFEDAIRDLNISLKAEISSSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL I LD++K   SS  K N+N S+V   DEPD+  ++C+   TKGRGM    D+   S
Sbjct  181   AELNIALDKNKGMGSSGKKRNQNLSEVP--DEPDQVKLRCLFKKTKGRGMFCVDDVSEAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKEDPYAAI+LK CRET+CHFCFNELP  A+ C SCSIPLYCS QCQL +GG++F ++
Sbjct  239   LVHKEDPYAAIVLKKCRETHCHFCFNELPADAISCLSCSIPLYCSDQCQLQAGGQKFDRS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                      LPD+L+ YIS+ V+   S   T  IAEHRHEC G HWP +LPSEVVLAGR+
Sbjct  299   FTSFKVLEGLPDDLQNYISDVVAGNNSTLETGHIAEHRHECLGFHWPLILPSEVVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK IEQ+K ++  SNL+ +LDL HN+ QLPP++KLEMHIYS+IL++CLQ+ Y  +LP++
Sbjct  359   LVKVIEQKKHANVVSNLIGILDLSHNYPQLPPESKLEMHIYSVILVHCLQHFYTTELPIS  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G++IS+LVILLSQI+VNSMA+VR+++ + +G + E  NALTSSLEQVKVGQA+Y+ GS+F
Sbjct  419   GIMISKLVILLSQIQVNSMAVVRVQAPEVRGPVYEPGNALTSSLEQVKVGQAVYVAGSLF  478

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSCRPN HAYFLSRTLYV+ T+ + AGSELELSYGPQVGQWD K RQQ+L DRYSF+CQ
Sbjct  479   NHSCRPNIHAYFLSRTLYVQATEYILAGSELELSYGPQVGQWDCKYRQQLLGDRYSFTCQ  538

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL------PHV-----SKQVE  723
             C GCS+LN+SDL INAYRC KP CLGV+ DST+A Y KQKL      P V      KQ+E
Sbjct  539   CTGCSELNVSDLVINAYRCTKPNCLGVILDSTIARYEKQKLKLLLDAPAVYSSSLHKQIE  598

Query  722   KVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASN  543
             K++   I++VA   + ++DY L+P +CL C  YRDLEA+CA  S+ +S   RLQDAIASN
Sbjct  599   KLKGANINEVAR-CIFQSDYKLEPQNCLVCGSYRDLEASCAATSQVDSCCKRLQDAIASN  657

Query  542   DVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILE  363
             +VP  +L +AL+ +D+LR+ LHPFNKRIAEVEDN++QA CLVGE QAA+DHCKASI+ILE
Sbjct  658   EVPNNILQDALRCTDLLRTILHPFNKRIAEVEDNLSQAFCLVGELQAALDHCKASIQILE  717

Query  362   KLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQ  186
              LYDPNHI IGNELIKL S+Q+  G+  A+ +      IFSRY+GSHA  I+P+L+ L+
Sbjct  718   NLYDPNHIAIGNELIKLASLQISVGDSAASDSMSKITTIFSRYYGSHADDIYPFLRHLK  776



>ref|XP_006358173.1| PREDICTED: SET and MYND domain-containing protein 4-like [Solanum 
tuberosum]
Length=778

 Score =   962 bits (2487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/775 (62%), Positives = 595/775 (77%), Gaps = 10/775 (1%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LKS VP AL+QEIS STP  LP+TCSSLL+FFH LPQFHQ++K+LTDP +ALC KD 
Sbjct  1     METLKSAVPDALKQEISNSTPSQLPSTCSSLLDFFHNLPQFHQMIKDLTDPSVALCCKDR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             +AA E KL+GN+CFS G+Y  AL FY++ALRLAP + +D E NL A+LYVNRAS L KMG
Sbjct  61    NAALETKLKGNECFSKGEYSNALLFYSKALRLAPVDMDDMEINLVALLYVNRASTLQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAKAWFRRGKAN SLG FEDAI+DL +SL +E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRVSPRYAKAWFRRGKANISLGKFEDAIRDLNISLMLEISSSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+I LD+ K       K+N+N+S+V   DEPD+  +QC+   TKGRGM    D+   S
Sbjct  181   AELKIALDKFKRIGIPRKKTNQNQSEVP--DEPDQVKLQCLLTTTKGRGMFCVDDVSEAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKEDPYAA+ILK CRET+CHFCFNELP  A+ C SCSIPLYCS  CQ+ +G  +F K+
Sbjct  239   LVHKEDPYAAVILKKCRETHCHFCFNELPADAISCASCSIPLYCSDWCQIQAGAPKFDKS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                 S    L D+L+ YIS+ V  G S   T  IAEHRHEC G HWP +LPSEVVLAGR+
Sbjct  299   SNSFSGLEGLADDLKNYISDVVLAGASTLDTGHIAEHRHECHGFHWPLILPSEVVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK IEQ + +   SNL+  LDL HN++QLPP++KLEMHIYSIILL+CLQ+ Y  +LP++
Sbjct  359   LVKVIEQNRRARADSNLVGFLDLSHNYLQLPPESKLEMHIYSIILLHCLQHFYRTELPIS  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G+++S+ VILLSQI+VNSMA+VRM++ + KGS+ E  NALTS+LEQVKVGQA+Y+ GS F
Sbjct  419   GIMVSKPVILLSQIQVNSMAVVRMQAPEVKGSIYESGNALTSNLEQVKVGQAVYVAGSFF  478

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC+PN H YFLSRTL+V+ T+ V AGSELELSYGPQVGQWD KDRQ++L DRYSF+CQ
Sbjct  479   NHSCQPNIHTYFLSRTLHVQATEYVLAGSELELSYGPQVGQWDCKDRQRLLEDRYSFTCQ  538

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL------PHV-SKQVEKVEN  711
             C GCS+LN+SDL INAYRC K  CLGV+ D T+ +  KQKL      P V SKQVEK+++
Sbjct  539   CTGCSELNVSDLVINAYRCTKLNCLGVILDRTVTTCEKQKLKLLIDAPTVYSKQVEKLKD  598

Query  710   ERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPV  531
               I +VA + V ++DY L+P HCL C+ YRDLEA+C  IS+ ES   RLQDAIASN+VP 
Sbjct  599   ANIVEVACH-VFESDYKLEPQHCLVCDSYRDLEASCVAISRTESCCKRLQDAIASNEVPT  657

Query  530   EVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYD  351
              +L +A+K +D+LR+  HP+NKRIAEVEDN+AQA CLVGE QAA+DHCK SI+ILEKLY 
Sbjct  658   NILLDAVKCTDLLRTIFHPYNKRIAEVEDNLAQAFCLVGELQAAIDHCKTSIQILEKLYG  717

Query  350   PNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQ  186
              NHI IGNELIKL S+Q+  G+  A+ +      I SRY+GSHA  I+PYL+ L+
Sbjct  718   ANHIAIGNELIKLASLQILVGDSAASGSISRITAILSRYYGSHADEIYPYLRHLK  772



>ref|XP_010318210.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Solanum lycopersicum]
Length=778

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/775 (62%), Positives = 595/775 (77%), Gaps = 10/775 (1%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LKS VP AL+QEIS STP  LP+TCSSLL FFH+LPQFHQ++K+LTDP +ALC KD 
Sbjct  1     METLKSAVPDALKQEISNSTPSQLPSTCSSLLHFFHKLPQFHQMIKDLTDPSVALCCKDR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             +AA E KL+GN+CFS G+Y  AL FY++ALR AP +  D E NL A+LYVNRAS L KMG
Sbjct  61    NAALENKLKGNECFSNGEYSNALLFYSKALRFAPVDMGDMEINLVALLYVNRASTLQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAK WFRRGKAN SLG FEDAI+DL +SL +E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRVSPRYAKGWFRRGKANISLGKFEDAIRDLNISLMLEISSSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+I LD+ K       K+N+N+S+V   DEPD+  +QC+   TKGRGM    D+   S
Sbjct  181   AELKIALDKFKRIGIPGKKTNQNQSEVP--DEPDQVKLQCLLTTTKGRGMFCVDDVSEAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKEDPYAA+ILK CRET+CHFCFNELP  A+ C SCSIPLYCS  CQ  +G  +F ++
Sbjct  239   LVHKEDPYAAVILKKCRETHCHFCFNELPADAISCVSCSIPLYCSDWCQKQAGAPKFDRS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                 S    L D+L+ Y+S+ V  G S   T  IAEHRHECQG HWP +LPSEVVLAGR+
Sbjct  299   SNSFSDLEGLADDLKNYMSDVVLAGASTLDTGHIAEHRHECQGFHWPLILPSEVVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK IEQ + +S  SNL+  LDL HN+V+LPP++KLEMHIYSIILL+CLQ+ Y  +LP++
Sbjct  359   LVKVIEQNRHASADSNLVGFLDLSHNYVKLPPESKLEMHIYSIILLHCLQHVYRTELPIS  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G+++S+LVILLSQI+VNSMA+VRM++   KG + E  NALTS+LEQVKVGQA+Y+ GS F
Sbjct  419   GIMVSKLVILLSQIQVNSMAVVRMQAPKVKGPIYEPGNALTSNLEQVKVGQAVYVAGSFF  478

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC+PN H YFLSRTL+++ T+ V AGSELELSYGPQVGQWD KDRQ++L DRYSF+CQ
Sbjct  479   NHSCQPNIHTYFLSRTLHIQATEYVLAGSELELSYGPQVGQWDCKDRQRLLEDRYSFTCQ  538

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL------PHV-SKQVEKVEN  711
             C GCS+LN+SDL INAYRC K  CLGV+ D T+ +  KQKL      P V SKQVEK+++
Sbjct  539   CTGCSELNVSDLVINAYRCTKLNCLGVILDRTVTTCEKQKLKLLIDAPTVYSKQVEKLKD  598

Query  710   ERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPV  531
             + I++VA + V ++DY L+P HCL C+ YRDLE++CA IS+ E+   RLQDAIASN+VP 
Sbjct  599   DNIAEVACH-VFESDYKLEPQHCLVCDSYRDLESSCAAISQTENCCKRLQDAIASNEVPT  657

Query  530   EVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYD  351
              +L +A+K +D+LR+  HP+NK IAEVEDN+AQA CLVGE QAA+DHCKASI+ILEKLY 
Sbjct  658   NILRDAVKYTDLLRTIFHPYNKIIAEVEDNLAQAFCLVGELQAAIDHCKASIQILEKLYG  717

Query  350   PNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQ  186
              NHI IGNELIKL S+Q+  G+  A+ +      I SRY+GSHA  I+PYL+ L+
Sbjct  718   ANHIAIGNELIKLVSLQILVGDTAASGSISRITAILSRYYGSHADEIYPYLRHLK  772



>ref|XP_004235445.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Solanum lycopersicum]
Length=786

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/783 (61%), Positives = 595/783 (76%), Gaps = 18/783 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LKS VP AL+QEIS STP  LP+TCSSLL FFH+LPQFHQ++K+LTDP +ALC KD 
Sbjct  1     METLKSAVPDALKQEISNSTPSQLPSTCSSLLHFFHKLPQFHQMIKDLTDPSVALCCKDR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             +AA E KL+GN+CFS G+Y  AL FY++ALR AP +  D E NL A+LYVNRAS L KMG
Sbjct  61    NAALENKLKGNECFSNGEYSNALLFYSKALRFAPVDMGDMEINLVALLYVNRASTLQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAK WFRRGKAN SLG FEDAI+DL +SL +E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRVSPRYAKGWFRRGKANISLGKFEDAIRDLNISLMLEISSSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+I LD+ K       K+N+N+S+V   DEPD+  +QC+   TKGRGM    D+   S
Sbjct  181   AELKIALDKFKRIGIPGKKTNQNQSEVP--DEPDQVKLQCLLTTTKGRGMFCVDDVSEAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKEDPYAA+ILK CRET+CHFCFNELP  A+ C SCSIPLYCS  CQ  +G  +F ++
Sbjct  239   LVHKEDPYAAVILKKCRETHCHFCFNELPADAISCVSCSIPLYCSDWCQKQAGAPKFDRS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                 S    L D+L+ Y+S+ V  G S   T  IAEHRHECQG HWP +LPSEVVLAGR+
Sbjct  299   SNSFSDLEGLADDLKNYMSDVVLAGASTLDTGHIAEHRHECQGFHWPLILPSEVVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK IEQ + +S  SNL+  LDL HN+V+LPP++KLEMHIYSIILL+CLQ+ Y  +LP++
Sbjct  359   LVKVIEQNRHASADSNLVGFLDLSHNYVKLPPESKLEMHIYSIILLHCLQHVYRTELPIS  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G+++S+LVILLSQI+VNSMA+VRM++   KG + E  NALTS+LEQVKVGQA+Y+ GS F
Sbjct  419   GIMVSKLVILLSQIQVNSMAVVRMQAPKVKGPIYEPGNALTSNLEQVKVGQAVYVAGSFF  478

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC+PN H YFLSRTL+++ T+ V AGSELELSYGPQVGQWD KDRQ++L DRYSF+CQ
Sbjct  479   NHSCQPNIHTYFLSRTLHIQATEYVLAGSELELSYGPQVGQWDCKDRQRLLEDRYSFTCQ  538

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL------PHV-SKQVEKVEN  711
             C GCS+LN+SDL INAYRC K  CLGV+ D T+ +  KQKL      P V SKQVEK+++
Sbjct  539   CTGCSELNVSDLVINAYRCTKLNCLGVILDRTVTTCEKQKLKLLIDAPTVYSKQVEKLKD  598

Query  710   ERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSI--------GRLQDA  555
             + I++VA + V ++DY L+P HCL C+ YRDLE++CA IS+ E+           RLQDA
Sbjct  599   DNIAEVACH-VFESDYKLEPQHCLVCDSYRDLESSCAAISQTENCCKSSGTYLPNRLQDA  657

Query  554   IASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASI  375
             IASN+VP  +L +A+K +D+LR+  HP+NK IAEVEDN+AQA CLVGE QAA+DHCKASI
Sbjct  658   IASNEVPTNILRDAVKYTDLLRTIFHPYNKIIAEVEDNLAQAFCLVGELQAAIDHCKASI  717

Query  374   KILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQ  195
             +ILEKLY  NHI IGNELIKL S+Q+  G+  A+ +      I SRY+GSHA  I+PYL+
Sbjct  718   QILEKLYGANHIAIGNELIKLVSLQILVGDTAASGSISRITAILSRYYGSHADEIYPYLR  777

Query  194   RLQ  186
              L+
Sbjct  778   HLK  780



>ref|XP_010318211.1| PREDICTED: N-lysine methyltransferase SMYD2 isoform X3 [Solanum 
lycopersicum]
Length=763

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/783 (59%), Positives = 576/783 (74%), Gaps = 41/783 (5%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LKS VP AL+QEIS STP  LP+TCSSLL FFH+LPQFHQ++K+LTDP +ALC KD 
Sbjct  1     METLKSAVPDALKQEISNSTPSQLPSTCSSLLHFFHKLPQFHQMIKDLTDPSVALCCKDR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             +AA E KL+GN+CFS G+Y  AL FY++ALR AP +  D E NL A+LYVNRAS L KMG
Sbjct  61    NAALENKLKGNECFSNGEYSNALLFYSKALRFAPVDMGDMEINLVALLYVNRASTLQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAK WFRR                       E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRVSPRYAKGWFRR-----------------------EISSSGKRQIE  157

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+I LD+ K       K+N+N+S+V   DEPD+  +QC+   TKGRGM    D+   S
Sbjct  158   AELKIALDKFKRIGIPGKKTNQNQSEVP--DEPDQVKLQCLLTTTKGRGMFCVDDVSEAS  215

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKEDPYAA+ILK CRET+CHFCFNELP  A+ C SCSIPLYCS  CQ  +G  +F ++
Sbjct  216   LVHKEDPYAAVILKKCRETHCHFCFNELPADAISCVSCSIPLYCSDWCQKQAGAPKFDRS  275

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                 S    L D+L+ Y+S+ V  G S   T  IAEHRHECQG HWP +LPSEVVLAGR+
Sbjct  276   SNSFSDLEGLADDLKNYMSDVVLAGASTLDTGHIAEHRHECQGFHWPLILPSEVVLAGRI  335

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK IEQ + +S  SNL+  LDL HN+V+LPP++KLEMHIYSIILL+CLQ+ Y  +LP++
Sbjct  336   LVKVIEQNRHASADSNLVGFLDLSHNYVKLPPESKLEMHIYSIILLHCLQHVYRTELPIS  395

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G+++S+LVILLSQI+VNSMA+VRM++   KG + E  NALTS+LEQVKVGQA+Y+ GS F
Sbjct  396   GIMVSKLVILLSQIQVNSMAVVRMQAPKVKGPIYEPGNALTSNLEQVKVGQAVYVAGSFF  455

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC+PN H YFLSRTL+++ T+ V AGSELELSYGPQVGQWD KDRQ++L DRYSF+CQ
Sbjct  456   NHSCQPNIHTYFLSRTLHIQATEYVLAGSELELSYGPQVGQWDCKDRQRLLEDRYSFTCQ  515

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL------PHV-SKQVEKVEN  711
             C GCS+LN+SDL INAYRC K  CLGV+ D T+ +  KQKL      P V SKQVEK+++
Sbjct  516   CTGCSELNVSDLVINAYRCTKLNCLGVILDRTVTTCEKQKLKLLIDAPTVYSKQVEKLKD  575

Query  710   ERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSI--------GRLQDA  555
             + I++VA + V ++DY L+P HCL C+ YRDLE++CA IS+ E+           RLQDA
Sbjct  576   DNIAEVACH-VFESDYKLEPQHCLVCDSYRDLESSCAAISQTENCCKSSGTYLPNRLQDA  634

Query  554   IASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASI  375
             IASN+VP  +L +A+K +D+LR+  HP+NK IAEVEDN+AQA CLVGE QAA+DHCKASI
Sbjct  635   IASNEVPTNILRDAVKYTDLLRTIFHPYNKIIAEVEDNLAQAFCLVGELQAAIDHCKASI  694

Query  374   KILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQ  195
             +ILEKLY  NHI IGNELIKL S+Q+  G+  A+ +      I SRY+GSHA  I+PYL+
Sbjct  695   QILEKLYGANHIAIGNELIKLVSLQILVGDTAASGSISRITAILSRYYGSHADEIYPYLR  754

Query  194   RLQ  186
              L+
Sbjct  755   HLK  757



>ref|XP_011076554.1| PREDICTED: SET and MYND domain-containing protein 4 [Sesamum 
indicum]
Length=771

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/777 (58%), Positives = 563/777 (72%), Gaps = 14/777 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS +P+ L+++I+EST + L +TCSSLL+FF  LP FHQ+V++LTDPEMALCGK+ 
Sbjct  1     MEKLKSAIPETLKRKIAESTANDLHSTCSSLLQFFQNLPLFHQMVRDLTDPEMALCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CF+ GDY  AL FY+QALR+AP +  D EKNL A LY+NRAS+LHK+G
Sbjct  61    EAAMEAKAKGNECFAKGDYSNALRFYSQALRMAPPDVEDKEKNLLATLYLNRASSLHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
               +E LQDC RAL +   YAKAWFRR KAN SL N++DAI DL VSLK+E SLSGKRQIE
Sbjct  121   FFLESLQDCSRALILSPGYAKAWFRRAKANLSLSNYKDAISDLTVSLKIETSLSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL ++ DQ + + S++ + N + S     DE  +  +QCV +PTKGRGM S  D+P+ S
Sbjct  181   SELNMLHDQFRPRSSAMEQPNDDRS-----DEQLQVELQCVPIPTKGRGMTSCTDVPLAS  235

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             L+HKEDPYAAIILK+CRET+C FCFNELP   VPC SCSIPLYCS +CQL +GG++F   
Sbjct  236   LIHKEDPYAAIILKHCRETHCAFCFNELPADTVPCMSCSIPLYCSLKCQLQAGGQDFSNY  295

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
               K     +L D LE+YI    S G+S    E  AEHRHEC GV+WPAVLPS+V+LAGR+
Sbjct  296   KSKYEFPEDLSDVLEQYIRNVTSPGISSSNFEH-AEHRHECLGVNWPAVLPSDVILAGRI  354

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK I+QQ           +LDLC N+ QL  D+KLE H+YS+IL+ CLQ   A +LP+ 
Sbjct  355   LVKHIQQQSRGGVQPKYHGILDLCQNYGQLSSDSKLEFHVYSMILMCCLQQVLATRLPLN  414

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
               I S++++LLSQIRVNSMA+VRMK  D K  LD      TSS+EQV+V QA+Y  GS F
Sbjct  415   SEITSEIIMLLSQIRVNSMAVVRMKYSDGKQPLDYDA---TSSVEQVQVAQAVYSGGSFF  471

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC+PNAHAYFLSRTL++R T+ V+AGSELELSYGPQVGQWD  +R++ L DRYSF CQ
Sbjct  472   NHSCQPNAHAYFLSRTLFIRATEHVAAGSELELSYGPQVGQWDCSERRKFLEDRYSFICQ  531

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV---SKQVEKVENERIS  699
             C GCSQ+NLSDL  + Y C +  C GVV DS +A Y ++KL HV   +   + + ++ I 
Sbjct  532   CSGCSQVNLSDLVHSGYHCNRSNCFGVVMDSCIAKYEREKLKHVKGPNSLQDMLHDDNIG  591

Query  698   DVAHYAVHKADYH--LKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEV  525
              VA     + DY    +PG+CL+C    DLEA+  TI+KAE  I RLQDA+AS + P  +
Sbjct  592   RVASRLFEQTDYSCCFEPGYCLSCGSLCDLEASQETITKAEICIKRLQDALASCETPTTL  651

Query  524   LSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPN  345
             + +ALK+ DILR+ LHPFNKRIAEVEDN+AQA C  GE QAAM HC ASIKILEKLY  +
Sbjct  652   IMDALKSIDILRTLLHPFNKRIAEVEDNIAQAFCSTGEIQAAMAHCLASIKILEKLYGED  711

Query  344   HIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQEAG  174
             HIVIGNELIKL SIQL  G +  A  T     IFSRY+GSHA ++FPYL+ L++EAG
Sbjct  712   HIVIGNELIKLSSIQLSMGQKSTADNTNQIVAIFSRYYGSHADIMFPYLRYLKREAG  768



>ref|XP_009759171.1| PREDICTED: uncharacterized protein LOC104211758 isoform X2 [Nicotiana 
sylvestris]
Length=750

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/779 (59%), Positives = 563/779 (72%), Gaps = 59/779 (8%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS VP+AL+QEI +STP  LP+TCSSLL+FFH LPQFHQ+VK+LTDP MALC KD 
Sbjct  1     MEKLKSAVPEALKQEIWKSTPTELPSTCSSLLDFFHHLPQFHQMVKDLTDPAMALCCKDQ  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             SAA E KL+GN+CFS GDYP AL  Y+QALR AP + +D EKN  A+LYVNRASAL KMG
Sbjct  61    SAALEAKLKGNECFSKGDYPNALLSYSQALRHAPVDIDDMEKNPVAVLYVNRASALQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAKAWFRRGKAN SLG FEDAI+DL +SLK E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRVSPHYAKAWFRRGKANISLGKFEDAIRDLNISLKAEISSSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL I LD++K   SS  K N+N S+V   DEPD+  ++C+   TKGRGM    D+   S
Sbjct  181   AELNIALDKNKGMGSSGKKRNQNLSEVP--DEPDQVKLRCLFKKTKGRGMFCVDDVSEAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKEDPYAAI+LK CRET+CHFCFNELP  A+ C SCSIPLYCS QCQL +GG++F ++
Sbjct  239   LVHKEDPYAAIVLKKCRETHCHFCFNELPADAISCLSCSIPLYCSDQCQLQAGGQKFDRS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                      LPD+L+ YIS+ V+   S   T  IAEHRHEC G HWP +LPSEVVLAGR+
Sbjct  299   FTSFKVLEGLPDDLQNYISDVVAGNNSTLETGHIAEHRHECLGFHWPLILPSEVVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK I +QK  +                                              V+
Sbjct  359   LVKVI-EQKKHANV--------------------------------------------VS  373

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
              +I   LVILLSQI+VNSMA+VR+++ + +G + E  NALTSSLEQVKVGQA+Y+ GS+F
Sbjct  374   NLIGILLVILLSQIQVNSMAVVRVQAPEVRGPVYEPGNALTSSLEQVKVGQAVYVAGSLF  433

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSCRPN HAYFLSRTLYV+ T+ + AGSELELSYGPQVGQWD K RQQ+L DRYSF+CQ
Sbjct  434   NHSCRPNIHAYFLSRTLYVQATEYILAGSELELSYGPQVGQWDCKYRQQLLGDRYSFTCQ  493

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL------PHV-----SKQVE  723
             C GCS+LN+SDL INAYRC KP CLGV+ DST+A Y KQKL      P V      KQ+E
Sbjct  494   CTGCSELNVSDLVINAYRCTKPNCLGVILDSTIARYEKQKLKLLLDAPAVYSSSLHKQIE  553

Query  722   KVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASN  543
             K++   I++VA   + ++DY L+P +CL C  YRDLEA+CA  S+ +S   RLQDAIASN
Sbjct  554   KLKGANINEVAR-CIFQSDYKLEPQNCLVCGSYRDLEASCAATSQVDSCCKRLQDAIASN  612

Query  542   DVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILE  363
             +VP  +L +AL+ +D+LR+ LHPFNKRIAEVEDN++QA CLVGE QAA+DHCKASI+ILE
Sbjct  613   EVPNNILQDALRCTDLLRTILHPFNKRIAEVEDNLSQAFCLVGELQAALDHCKASIQILE  672

Query  362   KLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQ  186
              LYDPNHI IGNELIKL S+Q+  G+  A+ +      IFSRY+GSHA  I+P+L+ L+
Sbjct  673   NLYDPNHIAIGNELIKLASLQISVGDSAASDSMSKITTIFSRYYGSHADDIYPFLRHLK  731



>ref|XP_010318212.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X4 
[Solanum lycopersicum]
Length=741

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/783 (57%), Positives = 552/783 (70%), Gaps = 63/783 (8%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LKS VP AL+QEIS STP  LP+TCSSLL FFH+LPQFHQ++K+LTDP +ALC KD 
Sbjct  1     METLKSAVPDALKQEISNSTPSQLPSTCSSLLHFFHKLPQFHQMIKDLTDPSVALCCKDR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             +AA E KL+GN+CFS G+Y  AL FY++ALR AP +  D E NL A+LYVNRAS L KMG
Sbjct  61    NAALENKLKGNECFSNGEYSNALLFYSKALRFAPVDMGDMEINLVALLYVNRASTLQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAK WFRRGKAN SLG FEDAI+DL +SL +E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRVSPRYAKGWFRRGKANISLGKFEDAIRDLNISLMLEISSSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+I LD+ K       K+N+N+S+V   DEPD+  +QC+   TKGRGM    D+   S
Sbjct  181   AELKIALDKFKRIGIPGKKTNQNQSEVP--DEPDQVKLQCLLTTTKGRGMFCVDDVSEAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKEDPYAA+ILK CRET+CHFCFNELP  A+ C SCSIPLYCS  CQ  +G  +F ++
Sbjct  239   LVHKEDPYAAVILKKCRETHCHFCFNELPADAISCVSCSIPLYCSDWCQKQAGAPKFDRS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                 S    L D+L+ Y+S+ V  G S   T  IAEHRHECQG HWP +LPSEVVLAGR+
Sbjct  299   SNSFSDLEGLADDLKNYMSDVVLAGASTLDTGHIAEHRHECQGFHWPLILPSEVVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK IEQ + +S  SNL+  L                     +ILL+ +Q          
Sbjct  359   LVKVIEQNRHASADSNLVGFL--------------------LVILLSQIQ----------  388

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
                            VNSMA+VRM++   KG + E  NALTS+LEQVKVGQA+Y+ GS F
Sbjct  389   ---------------VNSMAVVRMQAPKVKGPIYEPGNALTSNLEQVKVGQAVYVAGSFF  433

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC+PN H YFLSRTL+++ T+ V AGSELELSYGPQVGQWD KDRQ++L DRYSF+CQ
Sbjct  434   NHSCQPNIHTYFLSRTLHIQATEYVLAGSELELSYGPQVGQWDCKDRQRLLEDRYSFTCQ  493

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL------PHV-SKQVEKVEN  711
             C GCS+LN+SDL INAYRC K  CLGV+ D T+ +  KQKL      P V SKQVEK+++
Sbjct  494   CTGCSELNVSDLVINAYRCTKLNCLGVILDRTVTTCEKQKLKLLIDAPTVYSKQVEKLKD  553

Query  710   ERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSI--------GRLQDA  555
             + I++VA + V ++DY L+P HCL C+ YRDLE++CA IS+ E+           RLQDA
Sbjct  554   DNIAEVACH-VFESDYKLEPQHCLVCDSYRDLESSCAAISQTENCCKSSGTYLPNRLQDA  612

Query  554   IASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASI  375
             IASN+VP  +L +A+K +D+LR+  HP+NK IAEVEDN+AQA CLVGE QAA+DHCKASI
Sbjct  613   IASNEVPTNILRDAVKYTDLLRTIFHPYNKIIAEVEDNLAQAFCLVGELQAAIDHCKASI  672

Query  374   KILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQ  195
             +ILEKLY  NHI IGNELIKL S+Q+  G+  A+ +      I SRY+GSHA  I+PYL+
Sbjct  673   QILEKLYGANHIAIGNELIKLVSLQILVGDTAASGSISRITAILSRYYGSHADEIYPYLR  732

Query  194   RLQ  186
              L+
Sbjct  733   HLK  735



>ref|XP_010658299.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Vitis vinifera]
 ref|XP_010658300.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Vitis vinifera]
Length=787

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/789 (55%), Positives = 569/789 (72%), Gaps = 27/789 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP AL++ I+ESTPD LP+TC SLLEFF  + QF  +V +L   E ALC K+ 
Sbjct  1     MEKLKSLVPDALKRMIAESTPDDLPSTCYSLLEFFLHMQQFQMIVGDLAHSETALCRKNR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CFS GDY KAL  Y+QALR+APT+++D +KNL   L+VNRAS LHKMG
Sbjct  61    DAALESKRKGNECFSSGDYMKALSLYSQALRVAPTDADDVDKNLVVTLFVNRASVLHKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
              +VECL+DC+RAL I   YAKAW+RRGKANASL  +EDA+ DL V++ +E SL+G+ QIE
Sbjct  121   FLVECLRDCNRALLISPNYAKAWYRRGKANASLNGYEDAVHDLNVAMHLEESLAGRSQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL++ILDQ+K  +S       +++D+  L+E  +  +QCVS PTKGRGM S ++I    
Sbjct  181   RELKLILDQYKGNNSV---DQHDQNDLGTLEEQLQIKLQCVSTPTKGRGMASLSEISQSY  237

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYAAIILK+CR+T+CHFCFNELP  +VPC SCSIPLYCS  CQ+ +GG+E    
Sbjct  238   LVHTEEPYAAIILKHCRDTHCHFCFNELPADSVPCTSCSIPLYCSQHCQMQAGGQELRNN  297

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTED-----IAEHRHECQGVHWPAVLPSEVV  1425
              +       L  +LEKY++     G++ P+  D     IAEH+HEC+GV+WPAVLP E+V
Sbjct  298   SKNHGICKNLSSDLEKYVA-----GITLPKDSDSNIEWIAEHKHECKGVNWPAVLPPEIV  352

Query  1424  LAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAP  1245
             LAGRV+VK +EQ+K S   SNL+  LDL H++  + P++KL++HIYS++LL CLQ+SY  
Sbjct  353   LAGRVMVKSVEQKKHSCNASNLMDTLDLSHSYKTMAPESKLDLHIYSVVLLYCLQHSYGF  412

Query  1244  KLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKV  1083
             +LP+ G+ ISQL+IL+SQI+VNS+AIVRMK +D    LD+ VN      A TS++EQV+V
Sbjct  413   ELPLNGISISQLIILISQIKVNSIAIVRMKFMDGYSPLDQSVNFSPAGGAFTSNMEQVRV  472

Query  1082  GQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQ  903
             GQAIY V S+FNHSC+PN HAYFLSRTL++R T+ V+ G  LELSYGPQVGQWD KDRQ+
Sbjct  473   GQAIYSVASLFNHSCQPNIHAYFLSRTLFLRATEHVAVGCPLELSYGPQVGQWDCKDRQK  532

Query  902   ILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH------  741
              L+D YSF C+C GCS+LN+SDL +NA+RC  P C G V DS +  Y  +K         
Sbjct  533   FLKDEYSFRCECSGCSELNVSDLVLNAFRCVNPDCFGTVLDSCVIKYENKKFERFQGVPQ  592

Query  740   --VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
               +S+   +++N+ I +VAH A   + +   PG+CL+C  YRDLEA+ AT+ +A   I R
Sbjct  593   DCISEPHLQLKNDGIREVAHQAFANSSFRAAPGYCLHCGAYRDLEASHATVGEAGIYISR  652

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             LQ+AI S +VP    S+AL++ D+L+STLH +NK IAE ED +AQA C++GE Q AM HC
Sbjct  653   LQEAIVSKEVPATTFSDALRSLDLLKSTLHAYNKGIAEAEDWIAQAFCMIGELQPAMHHC  712

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIF  207
             KASI+ILEKLY  NHIVIG EL+KL SIQL  G+  A  +    A IFS Y+G HA ++F
Sbjct  713   KASIEILEKLYGSNHIVIGYELMKLSSIQLSLGDTAAMKSISRLAAIFSWYYGPHADMMF  772

Query  206   PYLQRLQQE  180
             PYL  L++E
Sbjct  773   PYLGSLKRE  781



>emb|CDP13867.1| unnamed protein product [Coffea canephora]
Length=793

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/790 (57%), Positives = 575/790 (73%), Gaps = 20/790 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLK+LVP+ L++ I  ST D L +T SSLL+FF  LP FH++V ELTD E  LC KD 
Sbjct  1     MEKLKALVPETLKRRILASTADDLLSTSSSLLDFFDPLPLFHRIVGELTDSESGLCSKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E KL+GN+CFS GD+P A+ FY++ALR AP   ++  K+L ++LYVNRA A +KMG
Sbjct  61    KVALESKLKGNECFSRGDFPDAVQFYSKALRFAPAGVDEMGKDLVSVLYVNRAFAFYKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VECL+D  RAL+    Y K WFRRGKANASLGN EDA++DL +S+K+E SLSGKRQIE
Sbjct  121   LLVECLRDSSRALSNSPGYIKGWFRRGKANASLGNHEDALRDLTISMKLEFSLSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKS----NRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADI  1782
             +E+++ILD+ K K SSL KS      +E  + + DEP +  +QCVS  TKGRG+ + ADI
Sbjct  181   NEMKMILDRSKEKTSSLQKSGSLQTSDECRLDIPDEPCQIKLQCVSTTTKGRGLTTLADI  240

Query  1781  PIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKE  1602
             P  SLVH+EDPYAAIILK+CRE++CHFCFNELPM ++PC SC IPLYCS  CQ+ + G +
Sbjct  241   PEASLVHEEDPYAAIILKHCRESHCHFCFNELPMDSLPCPSCLIPLYCSQLCQVQASGDK  300

Query  1601  FGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVL  1422
                T    S   +  D+L+KY+S+ VS+  S   +++  EH HEC G+HWP VLPSEVVL
Sbjct  301   MHDTAIDGSFIYKFSDDLQKYMSDVVSVKFSSSCSKNFTEHGHECGGLHWPLVLPSEVVL  360

Query  1421  AGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPK  1242
             AGRVL K+IEQQ+ SS   +L  + DLCHN+ QLPP++KLE H+YSI+L++CLQ+SY  +
Sbjct  361   AGRVLAKYIEQQRPSSLNLSLRGLWDLCHNYAQLPPESKLEFHVYSIVLMHCLQHSYGSE  420

Query  1241  LPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEH------VNALTSSLEQVKVG  1080
               ++G  I+QLVILLSQIR NSMAIVRM S D  GSL +H       +A T S++Q+KVG
Sbjct  421   FAISGETIAQLVILLSQIRANSMAIVRMTSFDAIGSLRQHPEFSPAADASTISMKQMKVG  480

Query  1079  QAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQI  900
             QA+YL GSMFNHSC+PN HAYF+SRTLYVR T+ V+ GSELELSYGPQVGQ D KDRQQ 
Sbjct  481   QAVYLAGSMFNHSCQPNIHAYFVSRTLYVRATEYVARGSELELSYGPQVGQLDCKDRQQF  540

Query  899   LRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL---------  747
             L D YSFSC+C GCSQLNLSDL +N+YRC K  C GVV DS +  Y  QKL         
Sbjct  541   LEDHYSFSCKCSGCSQLNLSDLVLNSYRCVKMNCYGVVLDSHVVEYENQKLHSFLGPPGM  600

Query  746   PHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
              + + +V+K   + IS +A Y +   ++ +KPG CLNC   RDLE+  + I++A+     
Sbjct  601   INSNLKVDKCRIDSISKIARYVLEN-NHLVKPGCCLNCGTERDLESLHSAINEADICFRG  659

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             LQDA AS++VPV  L +AL++ D+LR T+HP NKR+AE+ED++AQA CLVG+ Q A+DHC
Sbjct  660   LQDAFASSEVPVNALQDALRSLDLLRRTIHPLNKRLAEMEDSLAQAFCLVGKLQTALDHC  719

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIF  207
             + SIKILEKLYDPNHI IGNEL+KL SIQL   +  A+ T    A IF RY+GSHA  IF
Sbjct  720   QKSIKILEKLYDPNHIAIGNELLKLASIQLSFEDSTASDTLNRVAAIFLRYYGSHANKIF  779

Query  206   PYLQRLQQEA  177
             P LQ L++EA
Sbjct  780   PCLQLLKEEA  789



>ref|XP_008234145.1| PREDICTED: SET and MYND domain-containing protein 4 [Prunus mume]
Length=797

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/788 (54%), Positives = 551/788 (70%), Gaps = 23/788 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP+ L++ I ES+ D LP TCSSL++F      FHQ+V++L DPE+ALCGK+ 
Sbjct  1     MEKLKSLVPETLKRMIGESSADDLPRTCSSLVDFLLHFEPFHQMVRDLADPEVALCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CF  GDYP AL  YTQAL +AP ++++ ++NL A LYVNRAS LHKMG
Sbjct  61    EAALESKQKGNKCFLSGDYPNALDLYTQALIVAPMDAHE-DRNLVATLYVNRASVLHKMG  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC +DC+RAL I S YAKAW+RRGKANAS+GN++D I+DL V+  +E+++ GKRQIE
Sbjct  120   LLRECFRDCNRALQISSNYAKAWYRRGKANASMGNYKDTIRDLDVAKILELTMGGKRQIE  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              E++IILDQ     +   +   + SD+  LDEP    ++CV+ P KGRGM S  D+P  S
Sbjct  180   SEMKIILDQQNSTSNPSIQQYESTSDI--LDEPHPTGLRCVATPEKGRGMASTGDLPQAS  237

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH EDP++ IILK CRET+CH+C NELP   VPC SCSIPLYCS +C++ +GGK     
Sbjct  238   LVHTEDPFSMIILKPCRETHCHYCLNELPADKVPCTSCSIPLYCSQKCRIRAGGKMSWDY  297

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P     H  L  +LEKYI+E +    S   TE I EH+HEC+GVHWPAVLPSE+VLAGRV
Sbjct  298   PNNQRIHENLSADLEKYIAETILNVDSETDTEHIPEHKHECKGVHWPAVLPSEIVLAGRV  357

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK I +++ S+   NL  +LDL H++ ++PP+ KLE+HIYS +L  CLQ S   +LP+ 
Sbjct  358   LVKSIIKRRGSADIFNLREILDLSHHYSKMPPERKLELHIYSAVLSYCLQYSDDFELPIN  417

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLD-----EHVNALTSSLEQVKVGQAIYL  1065
             G  ISQ+VIL+SQIRVNSM +VRMKS+D  G  D          LTS++EQV+VGQAIY 
Sbjct  418   GFSISQIVILISQIRVNSMTVVRMKSIDQHGLEDIGKFSSLGGGLTSNVEQVRVGQAIYT  477

Query  1064  VGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRY  885
              GS+FNHSC+PN HAYFLSRTL++RTT+ V+AG  LELSYGPQVGQWD KDR + L D Y
Sbjct  478   SGSLFNHSCQPNIHAYFLSRTLFIRTTEYVAAGVPLELSYGPQVGQWDCKDRVKFLEDEY  537

Query  884   SFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-------------P  744
             SF CQC GC ++N SDL +NA+ C KP C G+V  S++    K+KL             P
Sbjct  538   SFRCQCSGCLKVNFSDLVLNAFHCVKPNCSGIVLQSSVVDCEKEKLKRLPNIITAGNMEP  597

Query  743   HVSKQVEKVENERISDVAHYAVH-KADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
             H+  + E +  + I  VAH+ +   + +H+ PG CL C  Y DLE++ A  +KA   I R
Sbjct  598   HLQAE-EFINIDDIDRVAHHHMQINSLFHINPGLCLKCCSYHDLESSSAAANKAWIIIRR  656

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             LQDAI S DV   +L +AL +  +LRST H +N+ IAE EDN+AQ  C VGE Q AM+HC
Sbjct  657   LQDAIVSKDVSSTILVDALSSLGVLRSTFHAYNRSIAEAEDNLAQVFCFVGELQPAMEHC  716

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIF  207
             KASI+ILEKLY+PNHIVIG EL+KL SIQL  G+  A  +     +IFS Y+GSH   IF
Sbjct  717   KASIEILEKLYNPNHIVIGYELVKLSSIQLSLGDCAAVDSINRLCDIFSCYYGSHTYKIF  776

Query  206   PYLQRLQQ  183
             PYLQ L++
Sbjct  777   PYLQFLKR  784



>ref|XP_009363760.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Pyrus x 
bretschneideri]
Length=794

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/789 (54%), Positives = 553/789 (70%), Gaps = 25/789 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP+ L++ I+ ST D LP  CSSL +F      FHQ+V++L DPE+ALCGK+ 
Sbjct  1     MEKLKSLVPETLKRSIAASTADDLPRNCSSLADFLLHFEPFHQMVRDLADPEVALCGKNI  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CF   DY +AL  YTQALR+AP +  D ++NL A LY NRAS L K+G
Sbjct  61    EAALEAKQKGNKCFLRSDYAEALDCYTQALRVAPMDV-DEDRNLVATLYTNRASVLQKLG  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC++DC+RAL   S YAKAW+RRGKANAS+GN+EDAI+DL V+  +E+S+SGKRQIE
Sbjct  120   LLRECVRDCNRALQTSSNYAKAWYRRGKANASIGNYEDAIRDLDVAKVLELSMSGKRQIE  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              E++II DQHK  + S      NE++ ++ DE  +  +QCV+ P KGRGM S +D+P  S
Sbjct  180   SEMKIISDQHKSMNPS---EQDNENNSSIFDELRQMELQCVTTPEKGRGMTSTSDLPQAS  236

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH EDP+A IILK CRET+CH+C NELP   VPC SCS PLYCS +C++ +GGK     
Sbjct  237   LVHTEDPFAMIILKPCRETHCHYCLNELPADKVPCTSCSTPLYCSQKCRIQAGGKMCWDY  296

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P   +    L  +LEKYI++          TE I EH+HEC+GVHWPAVLPSE+VLAGRV
Sbjct  297   PSNQNILENLSADLEKYIADTTLNVEPETGTEHIPEHKHECKGVHWPAVLPSEIVLAGRV  356

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK + +++ S+   +L  + DL H++ ++PP+TKLE+HIYS +LL CLQ+S   +LP+ 
Sbjct  357   LVKSVIKRRGSTDTFHLSEISDLSHHYSKMPPETKLELHIYSAVLLYCLQHSDGFELPIN  416

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKVGQAIY  1068
             G+ ISQ+VIL+SQIRVNSM IVRMKS+D  G  D+          LTS++EQVKVGQAIY
Sbjct  417   GLSISQIVILISQIRVNSMTIVRMKSIDYHGLEDQFGKLTPWGEGLTSNMEQVKVGQAIY  476

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
             L GS+FNHSC+PN HAYFL RTL++RTT+ V++G  LE SYGPQ+GQWD KDR + L D 
Sbjct  477   LSGSLFNHSCQPNIHAYFLLRTLFIRTTEFVASGVPLEFSYGPQIGQWDCKDRVKFLEDE  536

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-------------  747
             YSF CQCRGC  +N SDL +N + C KP C G+V D+ + +  ++KL             
Sbjct  537   YSFRCQCRGCLNVNFSDLALNGFHCVKPNCSGIVLDTGIVNIEREKLKYLPSIISTSSVE  596

Query  746   PHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
             PH+  QVE+   + I+ +A +      + + PG CL C  YRDLE++ A   KA   I R
Sbjct  597   PHL--QVEEFNTDEINKLAPHVQPNNVFDINPGFCLKCGSYRDLESSSAAADKARMCIRR  654

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             LQDAI S DV   V  +AL +  +LRST   +N+ IAE EDN+AQA CLVGE Q AM+HC
Sbjct  655   LQDAIVSQDVSSTVPLDALSSLGLLRSTFFAYNRSIAEAEDNLAQAFCLVGELQPAMEHC  714

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIF  207
             KASI+ILEKLY+PNHIVIG EL+KL S+QL  G+  AA++ K   +IFS Y+GSH  VIF
Sbjct  715   KASIEILEKLYNPNHIVIGYELVKLSSLQLSLGDCAAAASIKRLYQIFSCYYGSHTYVIF  774

Query  206   PYLQRLQQE  180
             PYL+ L++E
Sbjct  775   PYLRFLRRE  783



>ref|XP_010278902.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Nelumbo nucifera]
Length=787

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/793 (54%), Positives = 551/793 (69%), Gaps = 26/793 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLK++VP  L+  +SES P+ +P+TCSSLLEFF  LP F +VV+ELTDPE ALC K+ 
Sbjct  1     MEKLKAVVPSGLKGILSESNPEDIPSTCSSLLEFFQPLPLFQKVVRELTDPETALCAKNV  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             + A + K +GN+ FS GDY KAL FY+QALR AP   +  ++ L+  +YVNRAS+LHKMG
Sbjct  61    ATALDFKQKGNEYFSSGDYAKALAFYSQALRFAPMEVDKLDEMLATTIYVNRASSLHKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++E L+DC+RA+ +   YAKAW+RRG ANASL NFEDAI D+ V++ MEVSL GK QI+
Sbjct  121   LLIEALRDCNRAVVLSPCYAKAWYRRGTANASLQNFEDAISDMTVAMNMEVSLGGKNQIK  180

Query  1949  DELRIILDQHK--LKHSSLYKSNRNE-----SDVTMLDEPDRANMQCVSLPTKGRGMVSR  1791
             D+L+IILDQ K  ++ SS    + ++     S+    DE  +  +QCVS P+KGRGM S 
Sbjct  181   DKLKIILDQRKRTMRESSSTNLHNDKNLGSCSNTVSTDETCQIKLQCVSTPSKGRGMASL  240

Query  1790  ADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSG  1611
             +DI   SLVH E+PYA I+LK+CR+  CHFC +ELP   VPC SCSI LYCS  CQ  +G
Sbjct  241   SDIAQASLVHSEEPYAVILLKHCRDNYCHFCLSELPADMVPCTSCSISLYCSQHCQAKAG  300

Query  1610  GKEFGKTPRKVSRHNELPDELEKYISECVSI----GVSGPRTEDIAEHRHECQGVHWPAV  1443
             GK  G      S    +P +LE+YI++ ++I     +     +   EH HEC G HWPAV
Sbjct  301   GKPSGSNSNNYSIPKSVPPDLERYIAKTLAIDSGYALVDANADHFFEHGHECGGAHWPAV  360

Query  1442  LPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCL  1263
             LP E+VLAGR LVK I  +  S G S  +  L+L +N+ Q+  + KLE HIYSIIL  CL
Sbjct  361   LPCEIVLAGRALVKSIVDKGHSKGGSETIESLELLNNYAQMTLERKLETHIYSIILAYCL  420

Query  1262  QNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSS  1101
             Q SY  +  +TG  ISQLVIL+ QI+VNSMAIV+MKS+D  G L++  +      ALTS+
Sbjct  421   QQSYGLEFSLTGASISQLVILICQIKVNSMAIVQMKSVDAYGPLEQSRSQPSTKGALTSN  480

Query  1100  LEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWD  921
             +EQ++VGQAIY  GS+FNHSC+PN HAYF+SRTL++RTT+ V AG  LELSYGPQVGQ +
Sbjct  481   IEQIRVGQAIYPAGSLFNHSCQPNVHAYFISRTLFIRTTEFVPAGYPLELSYGPQVGQQE  540

Query  920   HKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
              K RQQ+L DRYSF CQC GCS++NLSDL INA+RCAKP CLG V DS +A + +QK   
Sbjct  541   FKVRQQLLEDRYSFKCQCGGCSEMNLSDLVINAFRCAKPNCLGTVLDSCMAKHTQQK---  597

Query  740   VSKQVEKVENERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
                 ++K++ E IS VA   + + +  + + PG+CLNC  Y DLE++ AT  KAE  I R
Sbjct  598   ----IDKLKREDISKVAQLLLEQTNRTFQVDPGYCLNCGSYNDLESSHATAKKAEIYIYR  653

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             L +AI S +V    L++AL++  ILRSTLH +NK +AE EDN+A A C +GE   AMDH 
Sbjct  654   LHNAINSMEVATNTLTDALESLYILRSTLHAYNKDMAEAEDNLAAAYCSIGELHPAMDHS  713

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIF  207
             KASIKILEKLY  NHIVIGNEL+KL SIQL  G+     +     EIFS Y+GSH+  IF
Sbjct  714   KASIKILEKLYSTNHIVIGNELVKLASIQLSLGDSTVMDSINQLDEIFSLYYGSHSARIF  773

Query  206   PYLQRLQQEAGCL  168
             PYL+ L++EA  L
Sbjct  774   PYLESLKREASKL  786



>ref|XP_010278900.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Nelumbo nucifera]
 ref|XP_010278901.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Nelumbo nucifera]
Length=805

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/804 (53%), Positives = 554/804 (69%), Gaps = 30/804 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLK++VP  L+  +SES P+ +P+TCSSLLEFF  LP F +VV+ELTDPE ALC K+ 
Sbjct  1     MEKLKAVVPSGLKGILSESNPEDIPSTCSSLLEFFQPLPLFQKVVRELTDPETALCAKNV  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             + A + K +GN+ FS GDY KAL FY+QALR AP   +  ++ L+  +YVNRAS+LHKMG
Sbjct  61    ATALDFKQKGNEYFSSGDYAKALAFYSQALRFAPMEVDKLDEMLATTIYVNRASSLHKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++E L+DC+RA+ +   YAKAW+RRG ANASL NFEDAI D+ V++ MEVSL GK QI+
Sbjct  121   LLIEALRDCNRAVVLSPCYAKAWYRRGTANASLQNFEDAISDMTVAMNMEVSLGGKNQIK  180

Query  1949  DELRIILDQHK--LKHSSLYKSNRNE-----SDVTMLDEPDRANMQCVSLPTKGRGMVSR  1791
             D+L+IILDQ K  ++ SS    + ++     S+    DE  +  +QCVS P+KGRGM S 
Sbjct  181   DKLKIILDQRKRTMRESSSTNLHNDKNLGSCSNTVSTDETCQIKLQCVSTPSKGRGMASL  240

Query  1790  ADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSG  1611
             +DI   SLVH E+PYA I+LK+CR+  CHFC +ELP   VPC SCSI LYCS  CQ  +G
Sbjct  241   SDIAQASLVHSEEPYAVILLKHCRDNYCHFCLSELPADMVPCTSCSISLYCSQHCQAKAG  300

Query  1610  GKEFGKTPRKVSRHNELPDELEKYISECVSI----GVSGPRTEDIAEHRHECQGVHWPAV  1443
             GK  G      S    +P +LE+YI++ ++I     +     +   EH HEC G HWPAV
Sbjct  301   GKPSGSNSNNYSIPKSVPPDLERYIAKTLAIDSGYALVDANADHFFEHGHECGGAHWPAV  360

Query  1442  LPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCL  1263
             LP E+VLAGR LVK I  +  S G S  +  L+L +N+ Q+  + KLE HIYSIIL  CL
Sbjct  361   LPCEIVLAGRALVKSIVDKGHSKGGSETIESLELLNNYAQMTLERKLETHIYSIILAYCL  420

Query  1262  QNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSS  1101
             Q SY  +  +TG  ISQLVIL+ QI+VNSMAIV+MKS+D  G L++  +      ALTS+
Sbjct  421   QQSYGLEFSLTGASISQLVILICQIKVNSMAIVQMKSVDAYGPLEQSRSQPSTKGALTSN  480

Query  1100  LEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWD  921
             +EQ++VGQAIY  GS+FNHSC+PN HAYF+SRTL++RTT+ V AG  LELSYGPQVGQ +
Sbjct  481   IEQIRVGQAIYPAGSLFNHSCQPNVHAYFISRTLFIRTTEFVPAGYPLELSYGPQVGQQE  540

Query  920   HKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQK---  750
              K RQQ+L DRYSF CQC GCS++NLSDL INA+RCAKP CLG V DS +A + +QK   
Sbjct  541   FKVRQQLLEDRYSFKCQCGGCSEMNLSDLVINAFRCAKPNCLGTVLDSCMAKHTQQKVSW  600

Query  749   ---LPHVSK-----QVEKVENERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACA  600
                +P+         ++K++ E IS VA   + + +  + + PG+CLNC  Y DLE++ A
Sbjct  601   LQVIPNFGSFERHLPIDKLKREDISKVAQLLLEQTNRTFQVDPGYCLNCGSYNDLESSHA  660

Query  599   TISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCL  420
             T  KAE  I RL +AI S +V    L++AL++  ILRSTLH +NK +AE EDN+A A C 
Sbjct  661   TAKKAEIYIYRLHNAINSMEVATNTLTDALESLYILRSTLHAYNKDMAEAEDNLAAAYCS  720

Query  419   VGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFS  240
             +GE   AMDH KASIKILEKLY  NHIVIGNEL+KL SIQL  G+     +     EIFS
Sbjct  721   IGELHPAMDHSKASIKILEKLYSTNHIVIGNELVKLASIQLSLGDSTVMDSINQLDEIFS  780

Query  239   RYFGSHALVIFPYLQRLQQEAGCL  168
              Y+GSH+  IFPYL+ L++EA  L
Sbjct  781   LYYGSHSARIFPYLESLKREASKL  804



>ref|XP_010658301.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Vitis vinifera]
Length=763

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/789 (53%), Positives = 550/789 (70%), Gaps = 51/789 (6%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP AL++ I+ESTPD LP+TC SLLEFF  + QF  +V +L   E ALC K+ 
Sbjct  1     MEKLKSLVPDALKRMIAESTPDDLPSTCYSLLEFFLHMQQFQMIVGDLAHSETALCRKNR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CFS GDY KAL  Y+QALR+APT+++D +KNL   L+VNRAS LH   
Sbjct  61    DAALESKRKGNECFSSGDYMKALSLYSQALRVAPTDADDVDKNLVVTLFVNRASVLH---  117

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
                                  AW+RRGKANASL  +EDA+ DL V++ +E SL+G+ QIE
Sbjct  118   ---------------------AWYRRGKANASLNGYEDAVHDLNVAMHLEESLAGRSQIE  156

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL++ILDQ+K  +S       +++D+  L+E  +  +QCVS PTKGRGM S ++I    
Sbjct  157   RELKLILDQYKGNNSV---DQHDQNDLGTLEEQLQIKLQCVSTPTKGRGMASLSEISQSY  213

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYAAIILK+CR+T+CHFCFNELP  +VPC SCSIPLYCS  CQ+ +GG+E    
Sbjct  214   LVHTEEPYAAIILKHCRDTHCHFCFNELPADSVPCTSCSIPLYCSQHCQMQAGGQELRNN  273

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTED-----IAEHRHECQGVHWPAVLPSEVV  1425
              +       L  +LEKY++     G++ P+  D     IAEH+HEC+GV+WPAVLP E+V
Sbjct  274   SKNHGICKNLSSDLEKYVA-----GITLPKDSDSNIEWIAEHKHECKGVNWPAVLPPEIV  328

Query  1424  LAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAP  1245
             LAGRV+VK +EQ+K S   SNL+  LDL H++  + P++KL++HIYS++LL CLQ+SY  
Sbjct  329   LAGRVMVKSVEQKKHSCNASNLMDTLDLSHSYKTMAPESKLDLHIYSVVLLYCLQHSYGF  388

Query  1244  KLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKV  1083
             +LP+ G+ ISQL+IL+SQI+VNS+AIVRMK +D    LD+ VN      A TS++EQV+V
Sbjct  389   ELPLNGISISQLIILISQIKVNSIAIVRMKFMDGYSPLDQSVNFSPAGGAFTSNMEQVRV  448

Query  1082  GQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQ  903
             GQAIY V S+FNHSC+PN HAYFLSRTL++R T+ V+ G  LELSYGPQVGQWD KDRQ+
Sbjct  449   GQAIYSVASLFNHSCQPNIHAYFLSRTLFLRATEHVAVGCPLELSYGPQVGQWDCKDRQK  508

Query  902   ILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH------  741
              L+D YSF C+C GCS+LN+SDL +NA+RC  P C G V DS +  Y  +K         
Sbjct  509   FLKDEYSFRCECSGCSELNVSDLVLNAFRCVNPDCFGTVLDSCVIKYENKKFERFQGVPQ  568

Query  740   --VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
               +S+   +++N+ I +VAH A   + +   PG+CL+C  YRDLEA+ AT+ +A   I R
Sbjct  569   DCISEPHLQLKNDGIREVAHQAFANSSFRAAPGYCLHCGAYRDLEASHATVGEAGIYISR  628

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             LQ+AI S +VP    S+AL++ D+L+STLH +NK IAE ED +AQA C++GE Q AM HC
Sbjct  629   LQEAIVSKEVPATTFSDALRSLDLLKSTLHAYNKGIAEAEDWIAQAFCMIGELQPAMHHC  688

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIF  207
             KASI+ILEKLY  NHIVIG EL+KL SIQL  G+  A  +    A IFS Y+G HA ++F
Sbjct  689   KASIEILEKLYGSNHIVIGYELMKLSSIQLSLGDTAAMKSISRLAAIFSWYYGPHADMMF  748

Query  206   PYLQRLQQE  180
             PYL  L++E
Sbjct  749   PYLGSLKRE  757



>ref|XP_010318213.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X5 
[Solanum lycopersicum]
Length=690

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/685 (60%), Positives = 517/685 (75%), Gaps = 18/685 (3%)
 Frame = -3

Query  2195  DTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFED  2016
             D E NL A+LYVNRAS L KMGL++ECL+DC RAL +   YAK WFRRGKAN SLG FED
Sbjct  3     DMEINLVALLYVNRASTLQKMGLLLECLRDCSRALRVSPRYAKGWFRRGKANISLGKFED  62

Query  2015  AIQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANM  1836
             AI+DL +SL +E+S SGKRQIE EL+I LD+ K       K+N+N+S+V   DEPD+  +
Sbjct  63    AIRDLNISLMLEISSSGKRQIEAELKIALDKFKRIGIPGKKTNQNQSEVP--DEPDQVKL  120

Query  1835  QCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESC  1656
             QC+   TKGRGM    D+   SLVHKEDPYAA+ILK CRET+CHFCFNELP  A+ C SC
Sbjct  121   QCLLTTTKGRGMFCVDDVSEASLVHKEDPYAAVILKKCRETHCHFCFNELPADAISCVSC  180

Query  1655  SIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHR  1476
             SIPLYCS  CQ  +G  +F ++    S    L D+L+ Y+S+ V  G S   T  IAEHR
Sbjct  181   SIPLYCSDWCQKQAGAPKFDRSSNSFSDLEGLADDLKNYMSDVVLAGASTLDTGHIAEHR  240

Query  1475  HECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEM  1296
             HECQG HWP +LPSEVVLAGR+LVK IEQ + +S  SNL+  LDL HN+V+LPP++KLEM
Sbjct  241   HECQGFHWPLILPSEVVLAGRILVKVIEQNRHASADSNLVGFLDLSHNYVKLPPESKLEM  300

Query  1295  HIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN  1116
             HIYSIILL+CLQ+ Y  +LP++G+++S+LVILLSQI+VNSMA+VRM++   KG + E  N
Sbjct  301   HIYSIILLHCLQHVYRTELPISGIMVSKLVILLSQIQVNSMAVVRMQAPKVKGPIYEPGN  360

Query  1115  ALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQ  936
             ALTS+LEQVKVGQA+Y+ GS FNHSC+PN H YFLSRTL+++ T+ V AGSELELSYGPQ
Sbjct  361   ALTSNLEQVKVGQAVYVAGSFFNHSCQPNIHTYFLSRTLHIQATEYVLAGSELELSYGPQ  420

Query  935   VGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVK  756
             VGQWD KDRQ++L DRYSF+CQC GCS+LN+SDL INAYRC K  CLGV+ D T+ +  K
Sbjct  421   VGQWDCKDRQRLLEDRYSFTCQCTGCSELNVSDLVINAYRCTKLNCLGVILDRTVTTCEK  480

Query  755   QKL------PHV-SKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACAT  597
             QKL      P V SKQVEK++++ I++VA + V ++DY L+P HCL C+ YRDLE++CA 
Sbjct  481   QKLKLLIDAPTVYSKQVEKLKDDNIAEVACH-VFESDYKLEPQHCLVCDSYRDLESSCAA  539

Query  596   ISKAESSI--------GRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDN  441
             IS+ E+           RLQDAIASN+VP  +L +A+K +D+LR+  HP+NK IAEVEDN
Sbjct  540   ISQTENCCKSSGTYLPNRLQDAIASNEVPTNILRDAVKYTDLLRTIFHPYNKIIAEVEDN  599

Query  440   VAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTK  261
             +AQA CLVGE QAA+DHCKASI+ILEKLY  NHI IGNELIKL S+Q+  G+  A+ +  
Sbjct  600   LAQAFCLVGELQAAIDHCKASIQILEKLYGANHIAIGNELIKLVSLQILVGDTAASGSIS  659

Query  260   STAEIFSRYFGSHALVIFPYLQRLQ  186
                 I SRY+GSHA  I+PYL+ L+
Sbjct  660   RITAILSRYYGSHADEIYPYLRHLK  684



>ref|XP_008376346.1| PREDICTED: LOW QUALITY PROTEIN: SET and MYND domain-containing 
protein 4 [Malus domestica]
Length=828

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/821 (52%), Positives = 548/821 (67%), Gaps = 55/821 (7%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP+ L++ I+ S  D LP TCSSL +F      F Q+V++L DPE+ALCGK+ 
Sbjct  1     MEKLKSLVPETLKRSIAASAADDLPRTCSSLADFLLHFEPFXQMVRDLADPEVALCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CF   DY +AL  YTQALR+AP +  D ++NL   LY NRAS L K+G
Sbjct  61    EAALEAKQKGNKCFLRSDYAEALDCYTQALRVAPMDV-DEDRNLVXTLYTNRASVLQKLG  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC+QDC+RAL   S YAKAW+RRGKANAS+GN+EDAI DL V+  +E+S SGKRQIE
Sbjct  120   LLRECVQDCNRALQTSSNYAKAWYRRGKANASIGNYEDAICDLDVAKVLELSXSGKRQIE  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              E++II DQHK   S++     NE++  +LDE  +  +QCV+ P KGRGM S +D+P  S
Sbjct  180   SEMKIISDQHK---STIPSEQDNENNSNILDELXQMELQCVTTPEKGRGMTSTSDLPQAS  236

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
              VH EDP+A IILK CRET+CH+C NELP   VPC SCSIPLYCS +C++ +GGK     
Sbjct  237   XVHTEDPFAMIILKPCRETHCHYCLNELPADKVPCTSCSIPLYCSQKCRIQAGGKMCWDY  296

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P   +    L   LEKYI +      S   TE I EH+HEC+ VHWPAVLPSE+VLAGRV
Sbjct  297   PSNQNILENLSANLEKYIVDTTLNVESETDTEHIPEHKHECKXVHWPAVLPSEIVLAGRV  356

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK + +++ S+   +L  + DL H++ ++PP+TKLE+HIYS +LL CLQ+S   +LP+ 
Sbjct  357   LVKSVIKRRGSTDTFHLSEISDLSHHYSKMPPETKLELHIYSAVLLYCLQHSDGFELPIN  416

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKVGQAIY  1068
             G+ ISQ+VIL+SQIRVNSM IVRMKS+D  G  D+          LTS++EQVKVGQAIY
Sbjct  417   GLSISQIVILISQIRVNSMTIVRMKSIDHHGLEDQFGKLTPWGEGLTSNMEQVKVGQAIY  476

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
             + GS+FNHSCRPN HAYFLSRTL++RTT+ V++G  LE SYGPQVGQWD  DR + L D 
Sbjct  477   ISGSLFNHSCRPNIHAYFLSRTLFIRTTEFVTSGVPLEFSYGPQVGQWDCXDRVKFLEDE  536

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSK--------  732
             YSF CQCRGC  +N S+L +N + C KP C G+V DS + +  ++KL ++ +        
Sbjct  537   YSFRCQCRGCLNVNFSNLALNGFHCVKPNCPGIVLDSGVVNIEREKLKYLPRIVSTSSVE  596

Query  731   ---QVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSI----  573
                QVE+   + I+ +A +      + + PG CL C  YRD E++ A   KA + I    
Sbjct  597   PHLQVEEFNTDEINKLAPHVQPNNVFDINPGFCLKCGSYRDXESSSAAADKARTRIXRXT  656

Query  572   ------------------------------GRLQDAIASNDVPVEVLSNALKASDILRST  483
                                            RL+DAI S DV   VL +AL +  +LRST
Sbjct  657   LSEKWFLSFQITGVPILYVHFACWSIDCFLDRLRDAIVSQDVSSTVLLDALSSLGLLRST  716

Query  482   LHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI  303
                +N+ IAE EDN+AQA CLVGE Q AM+HCKASI+ILEKLY+PNHIVIG EL+KL S+
Sbjct  717   FFAYNRSIAEAEDNLAQAFCLVGELQPAMEHCKASIEILEKLYNPNHIVIGYELVKLSSL  776

Query  302   QLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQE  180
             QL  G+R AA +     +IFS Y+GSH  VIFPYL+ L++E
Sbjct  777   QLSLGDRAAADSINRLYQIFSCYYGSHTYVIFPYLRFLRRE  817



>ref|XP_007220254.1| hypothetical protein PRUPE_ppa001654mg [Prunus persica]
 gb|EMJ21453.1| hypothetical protein PRUPE_ppa001654mg [Prunus persica]
Length=785

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/788 (53%), Positives = 539/788 (68%), Gaps = 35/788 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP+ L++ I ES+ D LP TCSSL++F      FHQ+V++L DPE+ALCGK+ 
Sbjct  1     MEKLKSLVPETLKRMIGESSADDLPRTCSSLVDFLLHFEPFHQMVRDLADPEVALCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CF  GDY  AL  YTQAL +AP ++++ ++NL A LYVNRAS LHKMG
Sbjct  61    EAALESKQKGNKCFLSGDYANALDLYTQALIVAPMDAHE-DRNLVATLYVNRASVLHKMG  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ ECL+DC+RAL I S YAKAW+RRGKANAS+GN++D I+DL V+  +E+++ GKRQIE
Sbjct  120   LLRECLRDCNRALQISSNYAKAWYRRGKANASMGNYKDTIRDLDVAKILELTMGGKRQIE  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              E++IILDQ     +   +   N SD+  LDEP    ++CV+ P KGRGM S  D+P  S
Sbjct  180   SEMKIILDQQNSTSNPSIQQYENTSDI--LDEPHPTGLRCVATPEKGRGMASTGDLPQAS  237

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH EDP++ IILK CRET+CH+C NELP   VPC SCSI LYCS +C++ +GGK     
Sbjct  238   LVHTEDPFSMIILKPCRETHCHYCLNELPADKVPCTSCSITLYCSKKCRIRAGGKMSWDY  297

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P     H  L  +LEKYI+E      S    E I EH+HEC+GVHWPAVLPSE+VLAGRV
Sbjct  298   PNNQRIHENLSADLEKYIAETTLNVDSETDAEHIPEHKHECKGVHWPAVLPSEIVLAGRV  357

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK I Q++ S+   NL  +LDL H++ + PP+ KLE+HIYS +L  CLQ S   +LP+ 
Sbjct  358   LVKSIIQRRGSTDIFNLREILDLSHHYSKTPPERKLELHIYSAVLSYCLQYSNDFELPIN  417

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLD-----EHVNALTSSLEQVKVGQAIYL  1065
             G  ISQ+VILLSQIRVNSM +VRMKS+D  G  D          LTS++EQV+VGQAIY 
Sbjct  418   GFSISQIVILLSQIRVNSMTVVRMKSIDQHGLEDIGKFSSLGGGLTSNVEQVRVGQAIYT  477

Query  1064  VGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRY  885
              GS+FNHSC+PN HAYFLSRTL++RTT+ V+AG  LELSYGPQVGQWD KDR + L D Y
Sbjct  478   SGSLFNHSCQPNIHAYFLSRTLFIRTTEFVTAGVPLELSYGPQVGQWDCKDRVKFLEDEY  537

Query  884   SFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-------------P  744
             SF CQC GC ++N SDL +NA+ C +  C G+V  S++    K+KL             P
Sbjct  538   SFRCQCSGCLKVNFSDLVLNAFHCVELNCSGIVLQSSVVDCEKEKLKRLPNIITAGNMEP  597

Query  743   HVSKQVEKVENERISDVAHYAVH-KADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
             H+  + E +  + I  VAH+ +   + +H+ PG CL C  YRDLE++ A  +KA   I  
Sbjct  598   HLQAE-EFINIDDIDRVAHHHMQINSLFHINPGLCLKCCSYRDLESSSAAANKAWIIIRS  656

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
                          +L +AL +  +LRST H +N+ IAE EDN+AQA C VGE Q AM+HC
Sbjct  657   ------------TILVDALSSLGVLRSTFHAYNRSIAEAEDNLAQAFCFVGELQHAMEHC  704

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIF  207
             KASI+ILEKLY+PNHIVIG EL+KL SIQL  G+  A  +     +IFS Y+GSHA  +F
Sbjct  705   KASIEILEKLYNPNHIVIGYELVKLSSIQLSLGDCAAVDSINRLCDIFSCYYGSHAYKVF  764

Query  206   PYLQRLQQ  183
             PY Q L++
Sbjct  765   PYFQFLKR  772



>ref|XP_006480312.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X2 [Citrus sinensis]
Length=786

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/784 (53%), Positives = 541/784 (69%), Gaps = 16/784 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP  L+Q ++ STPD LP T SSLL+FF  L QFHQ+V++L   E  LC K+ 
Sbjct  1     MEKLKSLVPNNLKQMVAHSTPDDLPLTSSSLLDFFLNLQQFHQIVRDLAGQESGLCAKNI  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              +A E+K +GNQ +  GDY  AL  YT+ALR+AP ++ND ++NL A LYVNRAS L K  
Sbjct  61    DSALELKQKGNQYYLSGDYSHALSCYTKALRVAPMDANDKDRNLVATLYVNRASVLQKRD  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
              +VECLQDC+RA+ I  +YAKAW+RRGK N SL N +DA+ DL ++   E SL+GK+QIE
Sbjct  121   HLVECLQDCNRAVQICPSYAKAWYRRGKVNVSLENHDDAVHDLTIAKNRESSLAGKKQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+IILDQ     + + +  +N   V+  DE  +  +QCV+ P KGRG+ S+ DIP GS
Sbjct  181   SELKIILDQSNRTSNKVVQHTKNNLRVS--DESVQVQLQCVTTPDKGRGITSQYDIPEGS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA  I K+CRET+CH+C NELP  A+PC SCSIPLYCS +C+  +GG+ F   
Sbjct  239   LVHSEEPYAVTISKHCRETHCHYCLNELPADAIPCTSCSIPLYCSRRCRGQAGGQVFKNC  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P + + ++ + D LE+YIS+        P  E I EH+HEC+GVHWP +LPS+VVLAGRV
Sbjct  299   PMERNINDSVFDNLEEYISQITLDNDFYPEDEHIFEHKHECKGVHWPVILPSDVVLAGRV  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK +++   S    NLL  L+L HN+ Q+  ++KLE HIY+I+LL CLQ+SY  +LP+ 
Sbjct  359   LVKSVQKNGVSMDVPNLLGKLELSHNYSQVSSESKLESHIYAIVLLYCLQHSYGFELPIN  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G  +SQ+VIL+SQIRVNS+AIVRM S +  G  D   +  T ++EQV+VG AIY  GS+F
Sbjct  419   GASVSQVVILISQIRVNSLAIVRMDS-NNYGQSDHVSSGSTCTVEQVRVGLAIYTAGSLF  477

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC PN HAYFLSRTL +RTT+ V +G  LELSYGPQVGQWD KDR + L D YSF CQ
Sbjct  478   NHSCLPNIHAYFLSRTLMIRTTEFVPSGYPLELSYGPQVGQWDCKDRLKFLEDEYSFRCQ  537

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQK---LPHVSK--------QVE  723
             C GCS+LN SDL INA+ C  P C GVV D+++ +  KQK   LP V +        QV 
Sbjct  538   CSGCSELNTSDLVINAFCCVDPNCPGVVLDNSILNCEKQKRKHLPAVPQCSSSVPHLQVG  597

Query  722   KVENERISDVAHYAVHKADYHLK--PGHCLNCNLYRDLEAACATISKAESSIGRLQDAIA  549
             K+ ++ I  VA+  + + +   +  PG+CL C   RDLE++ AT+ +A   I RLQDAI 
Sbjct  598   KLSSDYIGLVAYLLLEENNRTSRYGPGYCLKCGSDRDLESSYATVDEAWIYIRRLQDAII  657

Query  548   SNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKI  369
             S ++   VL +A +   +LRS LH +NKRIAE EDN+AQA CLVG+  +A DHCKASI+I
Sbjct  658   SKEISRAVLLDASRFLGLLRSILHAYNKRIAEAEDNLAQASCLVGDLISARDHCKASIEI  717

Query  368   LEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRL  189
             LEKLY  NHIVIG EL+KL SIQL   + +A  T    A IF  YFGSHA  +FP+L  L
Sbjct  718   LEKLYGHNHIVIGYELVKLSSIQLSLDDHNAVDTISRLAAIFLHYFGSHAETMFPHLLFL  777

Query  188   QQEA  177
             Q+EA
Sbjct  778   QREA  781



>gb|AES72697.2| heat shock protein 70 (HSP70)-interacting protein, putative [Medicago 
truncatula]
Length=778

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/780 (52%), Positives = 540/780 (69%), Gaps = 13/780 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             M+ LK  +P+ L+Q I +ST + L  TCSSL  FF     FHQ V +L DP  ALCGK  
Sbjct  1     MDTLKGAIPEKLKQAIRDSTVNTLQDTCSSLHHFFLHFDPFHQTVTQLADPSYALCGKSK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA + K  GNQCFS  DY  AL +YTQAL+ AP    + E N  A LY+NRA+ LHKM 
Sbjct  61    EAALKYKQLGNQCFSNADYANALDYYTQALQKAPFEVGEIENNFIATLYINRATVLHKMN  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VECL+DCDRAL I  +Y+KAW+RRGKAN + GN  DAI DL ++  +E S  GKRQIE
Sbjct  121   LLVECLRDCDRALQICPSYSKAWYRRGKANIAFGNNRDAICDLNIAKSVESSTGGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+IILDQ K     + +  + E+ ++   E  +  +Q VS+P KGRGMV  +D+  GS
Sbjct  181   CELKIILDQSK-STDIVVQPRQKENSLSTTGEMPQIKLQSVSVPDKGRGMVPPSDVSPGS  239

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA +ILK CRET+CH+C N+LP   VPC SCSIPLYCS QCQ+ +GG+ F  +
Sbjct  240   LVHAEEPYAMVILKQCRETHCHYCLNDLPADRVPCISCSIPLYCSHQCQIKAGGQMFMIS  299

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                      LP++L +Y +E +       +  ++ EH+HECQGVHWPAVLPS++VLAGR+
Sbjct  300   TEDNYILKNLPNDLAEYAAEVIQYNDCEQKIGNVTEHKHECQGVHWPAVLPSDIVLAGRL  359

Query  1409  LVKFIEQQKDSSG-FSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPV  1233
             L KF+   K+SSG  ++ +  L+L H +  +P ++KL+ HIY+I+LL CL++SY   L +
Sbjct  360   LAKFLS--KNSSGDITSFVEKLELSHCYEHMPFESKLDSHIYAIVLLYCLKHSYGAMLAI  417

Query  1232  TGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDE------HVNA-LTSSLEQVKVGQA  1074
              G+ I Q+VIL+SQI+VN M +VR+KS+D  G  D+      H +  LTS++EQV+VG+A
Sbjct  418   NGISILQVVILISQIKVNCMTVVRLKSIDAHGLSDQSGGFPFHSSVHLTSNVEQVRVGKA  477

Query  1073  IYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILR  894
             IY VGS+FNHSC+PN HAYFLSRTLY+RTT +V+AG +LELSYGPQVG WD KDRQ  L+
Sbjct  478   IYKVGSLFNHSCQPNVHAYFLSRTLYLRTTQAVAAGCQLELSYGPQVGLWDCKDRQSFLK  537

Query  893   DRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVE  714
             D Y+F CQC GCS++NLSD+ +NA+ C  P C G V +S +    KQK+ H++   + ++
Sbjct  538   DEYAFHCQCTGCSEVNLSDIVLNAFHCVNPNCSGAVLESRVLECEKQKIKHLAVADKVIK  597

Query  713   NERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASND  540
             N+ I +V  +A ++ D   H++PG CL C+ YRDLE++ AT+ KA   I RLQDAI S +
Sbjct  598   NDDIYEVCLHAFNQNDASIHIQPGFCLKCSSYRDLESSRATVDKALICIKRLQDAILSKE  657

Query  539   VPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEK  360
             +    +S+AL++  +LRS LH  NK IAE EDN+AQA CLVGE Q + DHCKASI+ILEK
Sbjct  658   ISNTSISDALRSLHLLRSNLHACNKVIAEAEDNLAQAFCLVGELQLSADHCKASIQILEK  717

Query  359   LYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQE  180
             +YDP+ IVI  EL+KL S+QL  G+  A ++      IFSRY+G HA ++FPYLQ L++E
Sbjct  718   IYDPDDIVIAYELVKLSSVQLSLGDNSAVNSIGRIGAIFSRYYGLHADLVFPYLQYLRRE  777



>gb|EYU20145.1| hypothetical protein MIMGU_mgv1a002206mg [Erythranthe guttata]
Length=701

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/774 (53%), Positives = 515/774 (67%), Gaps = 80/774 (10%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS++P+ L+ EIS+ST D L  TCSSLL FF  LP FHQ+V+ELTDPE ALCGK+ 
Sbjct  1     MEKLKSVIPETLKLEISQSTIDELHCTCSSLLNFFQNLPLFHQMVRELTDPEKALCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CFS G+Y  ALHFY+QALR AP +  D EKNL AMLY+NRAS LHK+G
Sbjct  61    EAAMEAKAKGNECFSKGEYSTALHFYSQALRAAPADVEDKEKNLVAMLYLNRASTLHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
               +E L+DC RAL +   YAKAWFRR KAN+SLGN+EDAI+DL VSLK+E S SGK+QIE
Sbjct  121   FFLESLRDCSRALIVSPAYAKAWFRRAKANSSLGNYEDAIKDLTVSLKIETSSSGKKQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
             +EL ++L++  L  + + K   + S+  +L E     ++ VS  TKGRGM S  DIP+ S
Sbjct  181   NELNMLLNKSGLSRA-IEKPYHDSSEERLLME-----LKYVSTTTKGRGMTSFTDIPLAS  234

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             L+HKEDPYAAIILKNCRET+C FCFNELP   VPC SCSIPLYCS  CQ+ +GG++F   
Sbjct  235   LIHKEDPYAAIILKNCRETHCAFCFNELPADTVPCVSCSIPLYCSLNCQVQAGGEDFSLC  294

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
               K     EL D+LE+Y     S  +S    E  AEH+HECQG+HWPAVL          
Sbjct  295   KDKYRLPQELSDDLEQYAKNVTSPDISSSSIEHAAEHKHECQGMHWPAVL----------  344

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
                                           P D  L   I  I+LL+             
Sbjct  345   ------------------------------PSDVVLAGRILIIMLLS-------------  361

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
                         +IRVNSMAIVRM   D + +LD +    TSS+EQV+V QA+Y  GS+F
Sbjct  362   ------------RIRVNSMAIVRMNHPDGRQNLDYNA---TSSVEQVQVAQAVYSSGSLF  406

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC PN HAYFLSRTL++R T++V+AGSELELSYGPQVGQWD  +R++ L +RYSF CQ
Sbjct  407   NHSCVPNVHAYFLSRTLFMRATENVTAGSELELSYGPQVGQWDCSERRKFLEERYSFICQ  466

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV----SKQVEKVENERI  702
             C GCSQLN SDL    YRC+ P C GVV +S +A Y K+KL H     S Q   +++++I
Sbjct  467   CSGCSQLNFSDLVHTGYRCSIPNCSGVVLESCVAKYEKEKLKHFKGPDSLQQYILKDDKI  526

Query  701   SDVAHYAVHKADYH--LKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVE  528
               VA +   + DY+   +PGHCL+C  +RDL A+  TI KAE  + RLQ+A+AS ++  +
Sbjct  527   GGVASHVFEQNDYYRCFEPGHCLSCGSFRDLPASQKTIVKAEIRVRRLQEAVASGEIATD  586

Query  527   VLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDP  348
             ++ +ALK+ DILR+ LHPFNKRIAEVED +AQA C +GE QAA+ HC+ASI+ILEKLY  
Sbjct  587   LVVDALKSIDILRTVLHPFNKRIAEVEDIIAQAFCSIGEFQAALKHCRASIEILEKLYGE  646

Query  347   NHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQ  186
             +HIVIGNELIKL SIQL  G ++ A  T  T  IFS+Y+GSHA  +FP+L+ L+
Sbjct  647   SHIVIGNELIKLASIQLSNGLKNGADNTSRTVAIFSQYYGSHADNMFPHLRYLK  700



>ref|XP_004309003.1| PREDICTED: SET and MYND domain-containing protein 4-like [Fragaria 
vesca subsp. vesca]
Length=780

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/786 (52%), Positives = 536/786 (68%), Gaps = 21/786 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP  L+Q I+ES  D LP+TCSSLL+F      F Q+VK+LTDPE+ALCGK  
Sbjct  1     MEKLKSLVPGTLKQIIAESITDDLPSTCSSLLDFLLHFEPFQQMVKDLTDPEVALCGKSK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E K +GN+CF   DY  AL FYTQALR+AP ++++ ++NL A LYVNRAS L KMG
Sbjct  61    EGALESKHKGNRCFLKSDYANALDFYTQALRVAPMDAHEADRNLVATLYVNRASVLQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC++DC+RAL I S YAKAWFRRGKANA++  +EDAI DL V+  +E S  GK+QIE
Sbjct  121   LVRECVRDCNRALRISSNYAKAWFRRGKANAAMERYEDAICDLDVAKSVEASDGGKKQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              E++++LDQ     SS  + N+N+S V  LDEP +  +QCV+ P KG+G+ S  DI   S
Sbjct  181   SEIKVVLDQQYRAASSSRQHNQNDSIV--LDEPQQMKLQCVTTPEKGKGLASMVDILQAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH EDP+A IILK  RET+CH+C NELP   VPC SCSIP YCS +C + +GG+     
Sbjct  239   LVHTEDPFATIILKPRRETHCHYCLNELPADKVPCTSCSIPWYCSQKCCIEAGGEICCDY  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P   S H  L D L++Y+ +  ++     R   I EH+HEC GVHWPAVLPSE+VL GRV
Sbjct  299   PNNRSIHKYLSDNLQRYVVD-TTLNADSERANQIPEHKHECNGVHWPAVLPSEIVLVGRV  357

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LV  I ++  S+   NL  + DL H++ ++ P++KLE+HIY+ +L  CLQ+    ++P+ 
Sbjct  358   LVNSIIKRGGSTDRFNLGAISDLSHHYSRMSPESKLELHIYATVLSCCLQHCNGFEVPIN  417

Query  1229  GviisqlvillsqIRVNSMAIVRMKS------LDTKGSLDEHVNALTSSLEQVKVGQAIY  1068
             G+ ISQ+VIL+SQIRVNSM IVRMK        D  G+L       TS++EQV+VGQAIY
Sbjct  418   GISISQIVILISQIRVNSMTIVRMKFPNHHELEDQFGNLSPWKGGPTSNVEQVRVGQAIY  477

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
                S+FNHSC+PN HAYFLSRTL++RTT+ V+AGS LELSYGPQVGQWD KDR + L D 
Sbjct  478   TSASLFNHSCQPNIHAYFLSRTLHIRTTEFVAAGSPLELSYGPQVGQWDCKDRIKFLEDE  537

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV-----SKQVE  723
             YSF CQC GCS++N SDL +NA+ C K  C G+V +S++ +  K+KL H+     +  ++
Sbjct  538   YSFRCQCTGCSKMNFSDLVLNAFHCVKLNCSGIVLESSVINCEKEKLKHLPNILNTDSID  597

Query  722   KVENERISDVAHYAVHKAD----YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDA  555
              +   +  ++   AV+       + L PG+CL C  YRDLE++      A + I RLQ++
Sbjct  598   SLLQAKELNIVSKAVNDMQINSFFQLNPGYCLKCGTYRDLESSSVA---ANNCIRRLQNS  654

Query  554   IASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASI  375
             I S  +    L  AL +  +LRSTLH +N+ IAE EDN AQA CLVGE Q+AM+HCKASI
Sbjct  655   IDSKTISRTTLLGALSSLGVLRSTLHAYNRNIAEAEDNFAQAFCLVGEMQSAMEHCKASI  714

Query  374   KILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQ  195
             +ILEKLY+ NHIV+G EL+KL SIQL   +  A  +     +IFS Y+GSH  VIFP LQ
Sbjct  715   EILEKLYNCNHIVVGYELVKLSSIQLSLRDSGAVDSIDRLYQIFSCYYGSHTDVIFPDLQ  774

Query  194   RLQQEA  177
              L++E 
Sbjct  775   FLRKEG  780



>ref|XP_003602446.1| SET and MYND domain-containing protein [Medicago truncatula]
Length=785

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/787 (51%), Positives = 540/787 (69%), Gaps = 20/787 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             M+ LK  +P+ L+Q I +ST + L  TCSSL  FF     FHQ V +L DP  ALCGK  
Sbjct  1     MDTLKGAIPEKLKQAIRDSTVNTLQDTCSSLHHFFLHFDPFHQTVTQLADPSYALCGKSK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA + K  GNQCFS  DY  AL +YTQAL+ AP    + E N  A LY+NRA+ LHKM 
Sbjct  61    EAALKYKQLGNQCFSNADYANALDYYTQALQKAPFEVGEIENNFIATLYINRATVLHKMN  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VECL+DCDRAL I  +Y+KAW+RRGKAN + GN  DAI DL ++  +E S  GKRQIE
Sbjct  121   LLVECLRDCDRALQICPSYSKAWYRRGKANIAFGNNRDAICDLNIAKSVESSTGGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+IILDQ K     + +  + E+ ++   E  +  +Q VS+P KGRGMV  +D+  GS
Sbjct  181   CELKIILDQSK-STDIVVQPRQKENSLSTTGEMPQIKLQSVSVPDKGRGMVPPSDVSPGS  239

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA +ILK CRET+CH+C N+LP   VPC SCSIPLYCS QCQ+ +GG+ F  +
Sbjct  240   LVHAEEPYAMVILKQCRETHCHYCLNDLPADRVPCISCSIPLYCSHQCQIKAGGQMFMIS  299

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                      LP++L +Y +E +       +  ++ EH+HECQGVHWPAVLPS++VLAGR+
Sbjct  300   TEDNYILKNLPNDLAEYAAEVIQYNDCEQKIGNVTEHKHECQGVHWPAVLPSDIVLAGRL  359

Query  1409  LVKFIEQQKDSSG-FSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPV  1233
             L KF+   K+SSG  ++ +  L+L H +  +P ++KL+ HIY+I+LL CL++SY   L +
Sbjct  360   LAKFLS--KNSSGDITSFVEKLELSHCYEHMPFESKLDSHIYAIVLLYCLKHSYGAMLAI  417

Query  1232  TGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDE------HVNA-LTSSLEQVKVGQA  1074
              G+ I Q+VIL+SQI+VN M +VR+KS+D  G  D+      H +  LTS++EQV+VG+A
Sbjct  418   NGISILQVVILISQIKVNCMTVVRLKSIDAHGLSDQSGGFPFHSSVHLTSNVEQVRVGKA  477

Query  1073  IYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILR  894
             IY VGS+FNHSC+PN HAYFLSRTLY+RTT +V+AG +LELSYGPQVG WD KDRQ  L+
Sbjct  478   IYKVGSLFNHSCQPNVHAYFLSRTLYLRTTQAVAAGCQLELSYGPQVGLWDCKDRQSFLK  537

Query  893   DRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVE  714
             D Y+F CQC GCS++NLSD+ +NA+ C  P C G V +S +    KQK+ H++   + ++
Sbjct  538   DEYAFHCQCTGCSEVNLSDIVLNAFHCVNPNCSGAVLESRVLECEKQKIKHLAVADKVIK  597

Query  713   NERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESSI-------GRLQ  561
             N+ I +V  +A ++ D   H++PG CL C+ YRDLE++ AT+ KA   I        RLQ
Sbjct  598   NDDIYEVCLHAFNQNDASIHIQPGFCLKCSSYRDLESSRATVDKALICIKRLKYGNDRLQ  657

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKA  381
             DAI S ++    +S+AL++  +LRS LH  NK IAE EDN+AQA CLVGE Q + DHCKA
Sbjct  658   DAILSKEISNTSISDALRSLHLLRSNLHACNKVIAEAEDNLAQAFCLVGELQLSADHCKA  717

Query  380   SIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPY  201
             SI+ILEK+YDP+ IVI  EL+KL S+QL  G+  A ++      IFSRY+G HA ++FPY
Sbjct  718   SIQILEKIYDPDDIVIAYELVKLSSVQLSLGDNSAVNSIGRIGAIFSRYYGLHADLVFPY  777

Query  200   LQRLQQE  180
             LQ L++E
Sbjct  778   LQYLRRE  784



>emb|CBI25524.3| unnamed protein product [Vitis vinifera]
Length=716

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/728 (54%), Positives = 519/728 (71%), Gaps = 45/728 (6%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP AL++ I+ESTPD LP+TC SLLEFF  + QF  +V +L   E ALC K+ 
Sbjct  1     MEKLKSLVPDALKRMIAESTPDDLPSTCYSLLEFFLHMQQFQMIVGDLAHSETALCRKNR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CFS GDY KAL  Y+QALR+APT+++D +KNL   L+VNRAS LHKMG
Sbjct  61    DAALESKRKGNECFSSGDYMKALSLYSQALRVAPTDADDVDKNLVVTLFVNRASVLHKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
              +VECL+DC+RAL I   YAKAW+RRGKANASL  +EDA+ DL V++ +E SL+G+ QIE
Sbjct  121   FLVECLRDCNRALLISPNYAKAWYRRGKANASLNGYEDAVHDLNVAMHLEESLAGRSQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTML-------DEPDRANMQCVSLPTKGRGMVSR  1791
              EL++ILDQ+K  +S       +++D+  L       +E  +  +QCVS PTKGRGM S 
Sbjct  181   RELKLILDQYKGNNSV---DQHDQNDLGTLGKMPYVTEEQLQIKLQCVSTPTKGRGMASL  237

Query  1790  ADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSG  1611
             ++I    LVH E+PYAAIILK+CR+T+CHFCFNELP  +VPC SCSIPLYCS  CQ+ +G
Sbjct  238   SEISQSYLVHTEEPYAAIILKHCRDTHCHFCFNELPADSVPCTSCSIPLYCSQHCQMQAG  297

Query  1610  GKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSE  1431
             G+E     R  S++++                 S    E IAEH+HEC+GV+WPAVLP E
Sbjct  298   GQEL----RNNSKNHD-----------------SDSNIEWIAEHKHECKGVNWPAVLPPE  336

Query  1430  VVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSY  1251
             +VLAGRV+VK +EQ+K S   SNL+  LDL H++  + P++KL++HIYS++LL CLQ+SY
Sbjct  337   IVLAGRVMVKSVEQKKHSCNASNLMDTLDLSHSYKTMAPESKLDLHIYSVVLLYCLQHSY  396

Query  1250  APKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQV  1089
               +LP+ G+ ISQL+IL+SQI+VNS+AIVRMK +D    LD+ VN      A TS++EQV
Sbjct  397   GFELPLNGISISQLIILISQIKVNSIAIVRMKFMDGYSPLDQSVNFSPAGGAFTSNMEQV  456

Query  1088  KVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDR  909
             +VGQAIY V S+FNHSC+PN HAYFLSRTL++R T+ V+ G  LELSYGPQVGQWD KDR
Sbjct  457   RVGQAIYSVASLFNHSCQPNIHAYFLSRTLFLRATEHVAVGCPLELSYGPQVGQWDCKDR  516

Query  908   QQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH----  741
             Q+ L+D YSF C+C GCS+LN+SDL +NA+RC  P C G V DS +  Y  +K       
Sbjct  517   QKFLKDEYSFRCECSGCSELNVSDLVLNAFRCVNPDCFGTVLDSCVIKYENKKFERFQGV  576

Query  740   ----VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSI  573
                 +S+   +++N+ I +VAH A   + +   PG+CL+C  YRDLEA+ AT+ +A   I
Sbjct  577   PQDCISEPHLQLKNDGIREVAHQAFANSSFRAAPGYCLHCGAYRDLEASHATVGEAGIYI  636

Query  572   GRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMD  393
              RLQ+AI S +VP    S+AL++ D+L+STLH +NK IAE ED +AQA C++GE Q AM 
Sbjct  637   SRLQEAIVSKEVPATTFSDALRSLDLLKSTLHAYNKGIAEAEDWIAQAFCMIGELQPAMH  696

Query  392   HCKASIKI  369
             HCKASI++
Sbjct  697   HCKASIEV  704



>ref|XP_010109164.1| SET and MYND domain-containing protein 4 [Morus notabilis]
 gb|EXC21093.1| SET and MYND domain-containing protein 4 [Morus notabilis]
Length=796

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/794 (51%), Positives = 539/794 (68%), Gaps = 26/794 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS +P+ L++ ++++TP  LP TCSSLL+F    P FH +V++L + E ALCGK+ 
Sbjct  1     MEKLKSAIPETLKRMVADTTPGDLPRTCSSLLDFLLHFPPFHHMVEDLAESEKALCGKNE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A + K +GN+CF+ GDY  AL  Y+QALR+AP ++ D +KNL A LY+NRA  LHKM 
Sbjct  61    DEALQWKQKGNRCFATGDYSNALASYSQALRVAPMDAEDMDKNLVATLYLNRAFVLHKMN  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC++DC+RAL I  +Y+KAW+RRG ANASLGN++DAI DL V+  +E+S   K QIE
Sbjct  121   LLAECIRDCNRALQISPSYSKAWYRRGIANASLGNYKDAINDLNVAKTVELSSGAKSQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDV----TMLDEPDRANMQCVSLPTKGRGMVSRADI  1782
              EL+ + D+     +   K    + ++      + E D+  +QCV+ P K RGM S ++I
Sbjct  181   SELKTLSDECGRTTNPALKHTVKQFNILAKKDQIAEADQIKLQCVNTPDKARGMASTSNI  240

Query  1781  PIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKE  1602
             P GSLVH E+P+A +ILK+CRET+CH+C NELP+  VPC SCSIP+YCS  CQL +GGK 
Sbjct  241   PPGSLVHTEEPFATVILKSCRETHCHYCLNELPVDKVPCTSCSIPVYCSLNCQLRAGGKL  300

Query  1601  FGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVL  1422
             F   P+       L + LEKY++E      S    E I EHRHEC GV WP+VLPSE+VL
Sbjct  301   FS-FPKSHGIQKGLSNNLEKYVAEITLGANSETDIEHIPEHRHECHGVSWPSVLPSEIVL  359

Query  1421  AGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPK  1242
             AGR  VK I Q++ S   +NL+ +LDL H++ Q+ P+++LE+ IYS +LL CLQ S   +
Sbjct  360   AGRAFVKSIMQRRGSLEIANLIEILDLSHHYSQMSPESRLEVQIYSTVLLCCLQRSSDLE  419

Query  1241  LPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEH----VNALTSSLEQVKVGQA  1074
             + + G  I+Q+VI++SQIRVNSMAI R+KS+D  G +D+       ALTS++EQVKVGQA
Sbjct  420   IQINGFSIAQVVIIISQIRVNSMAITRIKSIDVNGIVDQFGKFSSGALTSNVEQVKVGQA  479

Query  1073  IYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILR  894
             IY  GS+ NHSC+PN HAYFLSRTL++RTT++V+AG  LELSYG QVGQWD KDR ++L 
Sbjct  480   IYKAGSLLNHSCQPNIHAYFLSRTLFIRTTETVAAGCPLELSYGLQVGQWDCKDRIKLLE  539

Query  893   DRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-----------  747
             D YSF CQCR C + N SDL ++A+ C KP C G+V DS + +  K K+           
Sbjct  540   DEYSFRCQCRACLKANFSDLVLHAFHCIKPNCSGIVVDSGVLNCEKHKIEQLYDIVGTSN  599

Query  746   --PHVSKQVEKVENERISDVAHYAV--HKADYHLKPGHCLNCNLYRDLEAACATISKAES  579
               PH   QVE   ++  ++V   A     +  ++ PG+CL C  Y DLE + AT++KA  
Sbjct  600   WEPHF--QVENFNSDYANEVMLDAFLDSNSSSNVNPGNCLKCGSYCDLETSRATVNKAWK  657

Query  578   SIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAA  399
              I RLQD I S D+    LS+ L + D+L+STLH +N+RIAEVED +AQA C+VG+ Q A
Sbjct  658   CIRRLQDGIVSEDISSSELSDTLTSLDLLKSTLHAYNRRIAEVEDILAQAFCMVGDLQLA  717

Query  398   MDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHA  219
              DHCKASI+ILEKLY  NHIVIG+EL+KL SIQL   +  A  +     +IFS Y+GS A
Sbjct  718   RDHCKASIEILEKLYTCNHIVIGHELVKLSSIQLSLNDPAAVDSINRVVKIFSCYYGSDA  777

Query  218   LVIFPYLQRLQQEA  177
               IFP+LQ L++E 
Sbjct  778   DFIFPHLQFLRKET  791



>ref|XP_009759175.1| PREDICTED: uncharacterized protein LOC104211758 isoform X4 [Nicotiana 
sylvestris]
Length=624

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/581 (66%), Positives = 464/581 (80%), Gaps = 2/581 (0%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS VP+AL+QEI +STP  LP+TCSSLL+FFH LPQFHQ+VK+LTDP MALC KD 
Sbjct  1     MEKLKSAVPEALKQEIWKSTPTELPSTCSSLLDFFHHLPQFHQMVKDLTDPAMALCCKDQ  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             SAA E KL+GN+CFS GDYP AL  Y+QALR AP + +D EKN  A+LYVNRASAL KMG
Sbjct  61    SAALEAKLKGNECFSKGDYPNALLSYSQALRHAPVDIDDMEKNPVAVLYVNRASALQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAKAWFRRGKAN SLG FEDAI+DL +SLK E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRVSPHYAKAWFRRGKANISLGKFEDAIRDLNISLKAEISSSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL I LD++K   SS  K N+N S+V   DEPD+  ++C+   TKGRGM    D+   S
Sbjct  181   AELNIALDKNKGMGSSGKKRNQNLSEVP--DEPDQVKLRCLFKKTKGRGMFCVDDVSEAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKEDPYAAI+LK CRET+CHFCFNELP  A+ C SCSIPLYCS QCQL +GG++F ++
Sbjct  239   LVHKEDPYAAIVLKKCRETHCHFCFNELPADAISCLSCSIPLYCSDQCQLQAGGQKFDRS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                      LPD+L+ YIS+ V+   S   T  IAEHRHEC G HWP +LPSEVVLAGR+
Sbjct  299   FTSFKVLEGLPDDLQNYISDVVAGNNSTLETGHIAEHRHECLGFHWPLILPSEVVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK IEQ+K ++  SNL+ +LDL HN+ QLPP++KLEMHIYS+IL++CLQ+ Y  +LP++
Sbjct  359   LVKVIEQKKHANVVSNLIGILDLSHNYPQLPPESKLEMHIYSVILVHCLQHFYTTELPIS  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G++IS+LVILLSQI+VNSMA+VR+++ + +G + E  NALTSSLEQVKVGQA+Y+ GS+F
Sbjct  419   GIMISKLVILLSQIQVNSMAVVRVQAPEVRGPVYEPGNALTSSLEQVKVGQAVYVAGSLF  478

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSCRPN HAYFLSRTLYV+ T+ + AGSELELSYGPQVGQWD K RQQ+L DRYSF+CQ
Sbjct  479   NHSCRPNIHAYFLSRTLYVQATEYILAGSELELSYGPQVGQWDCKYRQQLLGDRYSFTCQ  538

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL  747
             C GCS+LN+SDL INAYRC KP CLGV+ DST+A Y KQKL
Sbjct  539   CTGCSELNVSDLVINAYRCTKPNCLGVILDSTIARYEKQKL  579



>ref|XP_006423931.1| hypothetical protein CICLE_v10030128mg [Citrus clementina]
 gb|ESR37171.1| hypothetical protein CICLE_v10030128mg [Citrus clementina]
Length=756

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/771 (53%), Positives = 523/771 (68%), Gaps = 20/771 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP  L+Q ++ STPD LP T SSLL+FF  L QFHQ+V++L   E  LC K+ 
Sbjct  1     MEKLKSLVPNNLKQMVAHSTPDDLPLTSSSLLDFFLNLQQFHQIVRDLAGQESGLCAKNI  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              +A E+K +GNQ +  GDY  AL  YT+ALR+AP ++ND ++NL A LYVNRAS L K  
Sbjct  61    DSALELKQKGNQYYLSGDYSHALSCYTKALRVAPMDANDKDRNLVATLYVNRASVLQKRD  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
              +VECLQDC+RA+ I  +YAKAW+RRGK N SL N +DA+ DL ++   E SL+GK+QIE
Sbjct  121   HLVECLQDCNRAVQICPSYAKAWYRRGKVNVSLENHDDAVHDLTIAKNRESSLAGKKQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+IILDQ     + + +  +N   V+  DE  +  +QCV+ P KGRG+ S+ DIP GS
Sbjct  181   SELKIILDQSNRTSNKVVQHTKNNLRVS--DESVQVQLQCVTTPDKGRGITSQYDIPEGS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA  I K+CRET+CH+C NELP  A+PC SCSIPLYCS +C+  +GG+ F   
Sbjct  239   LVHSEEPYAVTISKHCRETHCHYCLNELPADAIPCTSCSIPLYCSRRCRGQAGGQVFKNC  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P + + ++ + D LE+YIS+        P  E I EH+HEC+GVHWP +LPS+VVLAGRV
Sbjct  299   PMERNINDSVFDNLEEYISQITLDNDFYPEDEHIFEHKHECKGVHWPVILPSDVVLAGRV  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK +++   S    NLL  L+L HN+ Q+  ++KLE HIY+I+LL CLQ+SY  +LP+ 
Sbjct  359   LVKSVQKNGVSMDVPNLLGKLELSHNYSQVSSESKLESHIYAIVLLYCLQHSYGFELPIN  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G  +SQ+VIL+SQIRVNS+AIVRM S +  G  D   +  T ++EQV+VG AIY  GS+F
Sbjct  419   GASVSQVVILISQIRVNSLAIVRMDS-NNYGQSDHVSSGSTCTVEQVRVGLAIYTAGSLF  477

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC PN HAYFLSRTL +RTT+ V +G  LELSYGPQVGQWD KDR + L D YSF CQ
Sbjct  478   NHSCLPNIHAYFLSRTLMIRTTEFVPSGYPLELSYGPQVGQWDCKDRLKFLEDEYSFRCQ  537

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVA  690
             C GCS+LN SDL INA+ C  P C GVV D+++ +  KQK  H+   V +      S V 
Sbjct  538   CSGCSELNTSDLVINAFCCVDPNCPGVVLDNSILNCEKQKRKHLPA-VPQCS----SSVP  592

Query  689   HYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNAL  510
             H   +       PG+CL C   RDLE++ AT+ +A   I R             VL +A 
Sbjct  593   HLQENNRTSRYGPGYCLKCGSDRDLESSYATVDEAWIYIRR------------AVLLDAS  640

Query  509   KASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIG  330
             +   +LRS LH +NKRIAE EDN+AQA CLVG+  +A DHCKASI+ILEKLY  NHIVIG
Sbjct  641   RFLGLLRSILHAYNKRIAEAEDNLAQASCLVGDLISARDHCKASIEILEKLYGHNHIVIG  700

Query  329   NELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
              EL+KL SIQL   + +A  T    A IF  YFGSHA  +FP+L  LQ+EA
Sbjct  701   YELVKLSSIQLSLDDHNAVDTISRLAAIFLHYFGSHAETMFPHLLFLQREA  751



>gb|KDP45655.1| hypothetical protein JCGZ_17262 [Jatropha curcas]
Length=789

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/796 (52%), Positives = 548/796 (69%), Gaps = 29/796 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKSLVP+ L+Q +++S PD L +T SSLL F   LPQFHQ+V++LTD E ALC K+ 
Sbjct  1     MERLKSLVPEGLKQIVADSNPDDLQSTSSSLLRFLMNLPQFHQMVRDLTDVEAALCAKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K + N C+  G+Y  AL  Y+QALR+AP ++ D +KNL A LY+NRAS LHK+G
Sbjct  61    EKALELKHKANTCYMNGNYNTALACYSQALRVAPADAIDIDKNLIATLYLNRASLLHKIG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VEC++DC+RAL I   YAKAW+RRGK NA+LGN++DA+QDL V+  +E SL GK+QI 
Sbjct  121   LLVECVRDCNRALQISPCYAKAWYRRGKVNAALGNYKDAVQDLNVAEYVESSLGGKKQIA  180

Query  1949  DELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              E +IIL++++      ++   R+  +   L+E  +  + CV+   KGRGM S  +IP  
Sbjct  181   SERKIILEKNEGTGGRPVHCIERSSGN---LNELPQIKLLCVTTQDKGRGMASPCEIPQA  237

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFG-  1596
             SL+H E+PYA IILK+CRET+CH+C NELP   VPC SCSIPLYCS  CQ  +GG+    
Sbjct  238   SLIHMEEPYALIILKSCRETHCHYCLNELPADTVPCISCSIPLYCSQHCQEQAGGETISC  297

Query  1595  -KTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLA  1419
              KT  ++S +  LP  L+ YI E  S   SGP  E   EH+HEC GVHWPAV P ++VLA
Sbjct  298   FKTKDRISEN--LPSNLKGYIIEVTSYSDSGPDVECFPEHKHECLGVHWPAVFPPDIVLA  355

Query  1418  GRVLVKFIEQQKDSSGF--SNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAP  1245
             GR+L K + Q++   GF  SNLL  L+L H++ ++ P+ KLE+HIY+I+LL CLQ  +  
Sbjct  356   GRMLAKSVSQRR---GFVESNLLGPLELSHSYSKMNPEGKLELHIYAIVLLYCLQRPFRF  412

Query  1244  KLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDE-----HV-NALTSSLEQ--V  1089
             +LP+ GV +SQ +IL+SQIRVN+MA+VRMKS+D+   LD+     H+ +ALTSS++Q  V
Sbjct  413   ELPINGVSLSQTIILVSQIRVNAMAVVRMKSIDSCCPLDQFRKFSHIGDALTSSVDQVHV  472

Query  1088  KVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDR  909
              VGQAIY  GS+FNHSC+PN HAYFLSRTL+VRTT+ V+ G  LELSYGP+VGQWD KDR
Sbjct  473   SVGQAIYRAGSLFNHSCQPNIHAYFLSRTLFVRTTELVATGCPLELSYGPRVGQWDCKDR  532

Query  908   QQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL---PHV  738
              + L DRYSF CQC GCS+LN SDL INA+ C    C GVV DS + +    KL   P V
Sbjct  533   LKFLEDRYSFRCQCSGCSRLNPSDLVINAFHCVNSNCDGVVLDSCVINTELCKLTSIPRV  592

Query  737   SKQVEK---VENERISDVAHYA--VHKADYHLKPGHCLNCNLYRDLEAACATISKAESSI  573
             SK       ++ + ++DVA +A  +  +  H++PG CLNC    +LE+      K+   I
Sbjct  593   SKTQGLDLCLQVDGLNDVACFAQELCNSSLHIQPGSCLNCGSLCNLESLHEATRKSWIYI  652

Query  572   GRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMD  393
              RLQDA+ S ++   +LS+AL+A   LRS LH +NKRIAE  DN+AQA C +G+ Q+A D
Sbjct  653   ERLQDAVVSKEISTAILSDALRALGTLRSILHIYNKRIAEANDNLAQAFCQLGDFQSAQD  712

Query  392   HCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALV  213
             HCK SIKILE LY P+ IVIG EL+KL +IQ+  G   A+ +      IF RY+GSHA  
Sbjct  713   HCKVSIKILEMLYGPDDIVIGYELVKLSTIQISLGEPSASDSINRLGAIFLRYYGSHADS  772

Query  212   IFPYLQRLQQEAGCLA  165
              FPYLQ L++E+  LA
Sbjct  773   NFPYLQMLKRESCNLA  788



>gb|KHN02136.1| RNA polymerase II-associated protein 3 [Glycine soja]
Length=786

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/781 (51%), Positives = 523/781 (67%), Gaps = 14/781 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LK+ +P+ L++ I++S  D L +TCSSL  FF     FHQ++ EL DP+ AL GK+ 
Sbjct  1     MEILKAAIPENLKRAIADSDVDDLGSTCSSLHRFFLHFHPFHQMITELADPKYALSGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA + K  GNQCFS  DY KAL  YTQALR AP ++ D E NL A LY+NRA+ LHKM 
Sbjct  61    DAALKSKQLGNQCFSNADYAKALDCYTQALREAPLDTGDMESNLVATLYINRATVLHKMS  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VECL+DC RAL +  +YAKAW+RRGKANASLGN+++AI DL V+  +E S+ G+RQIE
Sbjct  121   LLVECLRDCTRALQVCPSYAKAWYRRGKANASLGNYKNAICDLNVAKSVEPSMGGRRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+I+LDQ +   +++ +    E++   + E     +QCVS P KGRGMVS   I  GS
Sbjct  181   GELKILLDQCR-STTAVVQIQHKENNCNTVGEMPHIKLQCVSTPDKGRGMVSSCVISPGS  239

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA IILK CRET+CH+C N+LP  +VPC SCSIPLYCS QCQ  + G+ F   
Sbjct  240   LVHVEEPYAMIILKQCRETHCHYCLNDLPADSVPCISCSIPLYCSHQCQTRATGQMFKIY  299

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P        LP +L +Y +E +    S P   DI EH+HECQGVHWP VLPSE+VLAGR+
Sbjct  300   PDYNGFFKNLPSDLGEYAAEVIQCNDSEPEIGDITEHKHECQGVHWPVVLPSEIVLAGRI  359

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             L +F+          N +  L+L H + QLP ++KL+ HIY+I+LL CLQ+S      + 
Sbjct  360   LARFL-LNSSPEDIINFVERLELSHCYKQLPSESKLDSHIYAIVLLYCLQHSCGTMFSID  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNAL--------TSSLEQVKVGQA  1074
              V ISQ+VI++SQI+VN M +VR+KS+D  GS   H            TS++EQV+VG+A
Sbjct  419   EVSISQVVIIISQIKVNCMTVVRLKSIDAHGS--GHFGDFPFQSGAHSTSNVEQVRVGKA  476

Query  1073  IYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILR  894
             IY  GS+FNHSC+PN HAYFLSR LY+RTT+ V+AGS+LELSYGPQVG WD KDR   L+
Sbjct  477   IYKAGSLFNHSCQPNVHAYFLSRALYLRTTNVVAAGSQLELSYGPQVGLWDCKDRLNFLK  536

Query  893   DRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVE  714
             + Y+F C C GCS++N SDL +NA+ C  P C G V +S +     QK+ H        +
Sbjct  537   NEYAFHCLCTGCSEVNRSDLVLNAFHCVNPNCSGAVLESRVLDCEMQKIKHFPIPDHVDK  596

Query  713   NERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASND  540
             N+ I +V H+   +     H++PG+CL C  Y DLE++ A + KA + I RLQDAI S  
Sbjct  597   NDDIYEVCHHVFKQNGKSIHIQPGYCLKCGSYCDLESSHAAVGKALACITRLQDAILSQQ  656

Query  539   VPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEK  360
             +    +S+AL++  +LR  LH +NK  AE ED++AQA CLVGE Q ++DHCKASI+ILEK
Sbjct  657   ISSITISDALRSLKLLRLNLHAYNKLTAEAEDSIAQAFCLVGELQLSLDHCKASIQILEK  716

Query  359   LYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQE  180
             LYD + IVI  EL+KL SIQL   +  A  +     +IFSRY+G HA ++FPYLQ L++E
Sbjct  717   LYDTDDIVIAYELVKLSSIQLSLDDGTAVESISRIDDIFSRYYGLHADLVFPYLQYLRRE  776

Query  179   A  177
              
Sbjct  777   V  777



>ref|XP_002526395.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus 
communis]
 gb|EEF35971.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus 
communis]
Length=781

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/792 (50%), Positives = 532/792 (67%), Gaps = 36/792 (5%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS++P +++Q I++S PD LP+T SSLL F   L QFHQ++++L DPE ALC K+ 
Sbjct  1     MERLKSVIPDSIKQIIADSNPDVLPSTSSSLLHFLMNLSQFHQMIRDLVDPEAALCAKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E+KL+ N+C+  GD+  AL  Y+QALR+AP ++ + +KNL A LY+NRAS  HK+G
Sbjct  61    DAAMELKLKANKCYKSGDHATALACYSQALRIAPVDAFEMDKNLVATLYLNRASLFHKIG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++EC++DC+RAL I  TYAKAW+RRGKANA LGN+E A+ DL V+  +E+S SGK+QIE
Sbjct  121   LLLECVRDCNRALQISPTYAKAWYRRGKANAGLGNYEYAVCDLNVAKNVELSFSGKKQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQC-----------VSLPTKGRG  1803
             +EL+II  Q     S  +    N  D ++       N+ C           V+ P KGRG
Sbjct  181   NELKIIAGQCAGSASRSF----NHIDNSL----GSFNLSCQMTHSEYKLLRVTTPDKGRG  232

Query  1802  MVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQ  1623
             M S  DIP  SLVH E PYA I+LKNCR+T+CH+C  ELP   VPC SCS+PLYCS  CQ
Sbjct  233   MASGCDIPQASLVHVEKPYALIVLKNCRDTHCHYCLKELPADTVPCLSCSVPLYCSQLCQ  292

Query  1622  LVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAV  1443
             + +GGK       K      LPD+++++I+E      S P  E   EH+HEC GV+WP V
Sbjct  293   VHAGGKTMSYCNTKDGIDESLPDDVKEHITEVALHSPSDPDAESFPEHKHECLGVNWPTV  352

Query  1442  LPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCL  1263
             LP+++VLAGR+L K I +     G       LDL H++ Q+ P+ KLE+HI++I+LL CL
Sbjct  353   LPTDIVLAGRLLAKSISEIGSMEG------TLDLSHSYSQINPEGKLELHIFAIVLLCCL  406

Query  1262  QNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHV------NALTSS  1101
             Q+S+  +LP+ GV +SQ +IL+SQ+RVN+MA+VRMKS+D     D  V      +ALTSS
Sbjct  407   QHSFGFELPINGVSLSQAIILVSQVRVNAMAVVRMKSVDAHCPSDHLVKLSHSGDALTSS  466

Query  1100  LEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWD  921
             +EQV VGQAIY  GS+FNHSC+PN HAYFLSRTL++RTT+ ++ G  LELSYGPQVGQ D
Sbjct  467   VEQVPVGQAIYTAGSLFNHSCQPNVHAYFLSRTLFIRTTEHLATGCPLELSYGPQVGQRD  526

Query  920   HKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
              KDR + L+D+YSF C C GCS +NLSDL  NA+RC    C+GVV D ++ +   +KL +
Sbjct  527   CKDRLKFLQDKYSFRCHCNGCSIVNLSDLVQNAFRCIDLNCVGVVLDRSVINSEIKKLKN  586

Query  740   VSKQVEKVENE---RISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESS  576
               +  E+   +   ++ D+AH A+  ++   H++PG CLNC  Y DLEA    +  A   
Sbjct  587   FPRAPERQRLDLCLQVDDLAHLALELSNGPLHIQPGCCLNCGSYCDLEAVHEGMRTAWIY  646

Query  575   IGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAM  396
               RLQDAI    +   V+++A +A   LRS LH +NK IAE ED +AQA CLV + Q+A 
Sbjct  647   FKRLQDAIVVKKISTTVITDASRALGALRSILHAYNKHIAEAEDILAQAFCLVEDFQSAR  706

Query  395   DHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHAL  216
             DHC+ASIKILE LY P+HIVIG ELIKL +IQL  G+  A  +      IF RYFGSHA 
Sbjct  707   DHCRASIKILEMLYGPDHIVIGYELIKLSTIQLSMGDLSAVDSINRLGAIFERYFGSHAD  766

Query  215   VIFPYLQRLQQE  180
              IFPYLQ L+++
Sbjct  767   FIFPYLQTLREK  778



>ref|XP_007136384.1| hypothetical protein PHAVU_009G040900g [Phaseolus vulgaris]
 ref|XP_007136385.1| hypothetical protein PHAVU_009G040900g [Phaseolus vulgaris]
 gb|ESW08378.1| hypothetical protein PHAVU_009G040900g [Phaseolus vulgaris]
 gb|ESW08379.1| hypothetical protein PHAVU_009G040900g [Phaseolus vulgaris]
Length=784

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/779 (51%), Positives = 520/779 (67%), Gaps = 14/779 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LK+ +P++L++ I++S  D L +TCSSL  FF     FHQ++ +L DP+  LCGK  
Sbjct  1     METLKAAIPESLKRAIADSNVDDLQSTCSSLHRFFLHFDPFHQIITQLADPKYGLCGKSE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A + K  GN+CFS  DY KAL  YTQALR AP ++ D + NL A LY+NRA+ LHKM 
Sbjct  61    EDALKSKQLGNECFSNADYAKALDCYTQALRKAPLDTGDRKSNLVATLYINRATVLHKMS  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VECL+DC RAL I  +YAKAW+RRGKANASLGN+ +AI DL V+  +E SL GKRQIE
Sbjct  121   LLVECLRDCTRALKICPSYAKAWYRRGKANASLGNYRNAICDLNVAKIVEPSLGGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+I+LDQ K   +++   +++ S  T+ + P +  +QCVS+P KGRGMVS   I  GS
Sbjct  181   VELKILLDQCKSTSAAVQIQHKDNSCNTVGEMP-QMKLQCVSMPDKGRGMVSSCVISPGS  239

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA IILK CRET+CH+C N+LP   VPC SCSIPLYCS QCQ+ +GG+ F   
Sbjct  240   LVHSEEPYAMIILKQCRETHCHYCLNDLPADRVPCISCSIPLYCSHQCQIRAGGQMFRIY  299

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P       ++P +L +Y SE +    S    EDI EH+HEC GVHWP VLPSE+VL GR+
Sbjct  300   PENNDTFKKMPSDLGEYASEVIQSDDSEQEIEDITEHKHECGGVHWPVVLPSEIVLTGRI  359

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             L  F+     S    N +  L+L H +  +  ++KL+ HIY+ +LL CLQ+S      + 
Sbjct  360   LAGFL-LNSTSENIVNFVERLELSHCYKHMSSESKLDSHIYATVLLYCLQHSCETMFSID  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNAL--------TSSLEQVKVGQA  1074
             GV ISQ+VI++SQI+VN M IVR+KS+D  G    H            TS++EQV+VG+A
Sbjct  419   GVSISQVVIIISQIKVNCMTIVRLKSIDAHGG---HFGEFPFQYGAHSTSNVEQVRVGKA  475

Query  1073  IYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILR  894
             IY  GS+FNHSC+PN HAYFLSRTLY+RTT  V+AG +LELSYGPQVG WD KDR   L+
Sbjct  476   IYKAGSLFNHSCQPNVHAYFLSRTLYLRTTHGVAAGCQLELSYGPQVGLWDCKDRLNFLK  535

Query  893   DRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVE  714
             D Y+F CQC GCS++N+SD+ +NA+ C  P C G V +S +    +QK+ H +      +
Sbjct  536   DEYAFHCQCIGCSEVNVSDVVLNAFHCVNPNCSGAVLESRVLDCEQQKIKHFTITDRVDK  595

Query  713   NERISDVAHYAVHKADY-HLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDV  537
             N+ IS   +       Y H +PG+CL C  Y DLE++ A +S+A   I RLQDAI   ++
Sbjct  596   NDDISVCLNVFKQNGAYIHGQPGYCLKCGSYCDLESSQAAVSEALICIKRLQDAILLKEI  655

Query  536   PVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKL  357
                 +S+AL +   LR  LH +NK IAE ED++AQA CLVGE Q ++DHCKASI+ILEKL
Sbjct  656   SSITISDALISLQSLRLNLHAYNKLIAEAEDSIAQAFCLVGELQLSVDHCKASIQILEKL  715

Query  356   YDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQE  180
             YD + IVI  EL+KL SI L   +  AA +     +IFSRY+G HA ++FP LQ L++E
Sbjct  716   YDTDDIVIAYELVKLSSILLSLDDSTAAESINRIDDIFSRYYGLHADLVFPDLQYLRKE  774



>ref|XP_003528010.1| PREDICTED: uncharacterized protein LOC100783548 [Glycine max]
Length=786

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/781 (50%), Positives = 521/781 (67%), Gaps = 14/781 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LK+ +P+ L++ I++S  D L +TCSSL  FF     FHQ++ EL DP+ AL GK+ 
Sbjct  1     MEILKAAIPENLKRAIADSDVDDLGSTCSSLHRFFLHFHPFHQMITELADPKYALSGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA + K  GNQCFS  DY KAL  YTQALR AP ++ D E NL A LY+NRA+ LHKM 
Sbjct  61    DAALKSKQLGNQCFSNADYAKALDCYTQALREAPLDTGDMESNLVATLYINRATVLHKMS  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VECL+DC RAL +  +YAKAW+RRGKANA LGN+++AI DL V+  +E S+ G+RQIE
Sbjct  121   LLVECLRDCTRALQVCPSYAKAWYRRGKANALLGNYKNAICDLNVAKSVEPSMGGRRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+I+LDQ +   +++ +    E++   + E     +QCVS P KGRGMVS   I  GS
Sbjct  181   GELKILLDQCR-STTAVVQIQHKENNCNTVGEMPHIKLQCVSTPDKGRGMVSSCVISPGS  239

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA IILK CRET+CH+C N+LP   VPC SCSIPLYCS QCQ  + G+ F   
Sbjct  240   LVHVEEPYAMIILKQCRETHCHYCLNDLPADRVPCISCSIPLYCSHQCQTRATGQMFKIY  299

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P        LP +L +Y +E +    S     DI EH+HECQGVHWP VLPSE+VLAGR+
Sbjct  300   PDYNGFFKNLPSDLGEYAAEVIQCNDSEQEIGDITEHKHECQGVHWPVVLPSEIVLAGRI  359

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             L +F+          N +  L+L H + QLP ++KL+ HIY+I+LL CLQ+S      + 
Sbjct  360   LARFL-LNSSPEDIINFVERLELSHCYKQLPSESKLDSHIYAIVLLYCLQHSCGTMFSID  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNAL--------TSSLEQVKVGQA  1074
              V ISQ+VI++SQI+VN M +VR+KS+D  GS   H            TS++EQV+VG+A
Sbjct  419   EVSISQVVIIISQIKVNCMTVVRLKSIDAHGS--GHFGDFPFQSGAHSTSNVEQVRVGKA  476

Query  1073  IYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILR  894
             IY  GS+FNHSC+PN HAYFLSR LY+RTT+ V+AGS+LELSYGPQVG WD KDR   L+
Sbjct  477   IYKAGSLFNHSCQPNVHAYFLSRALYLRTTNVVAAGSQLELSYGPQVGLWDCKDRLNFLK  536

Query  893   DRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVE  714
             + Y+F C C GCS++N SDL +NA+ C  P C G V +S +     QK+ H        +
Sbjct  537   NEYAFHCLCTGCSEVNRSDLVLNAFHCVNPNCSGAVLESRVLDCEMQKIKHFPIPDHVDK  596

Query  713   NERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASND  540
             N+ I +V H+   +     H++PG+CL C  Y DLE++ A + KA + I RLQDAI S  
Sbjct  597   NDDIYEVCHHVFKQNGKSIHIQPGYCLKCGSYCDLESSHAAVGKALACITRLQDAILSQQ  656

Query  539   VPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEK  360
             +   ++S+AL++  +LR  LH +NK  AE ED++AQA CLVGE Q ++DHCKASI+ILEK
Sbjct  657   ISSIIISDALRSLKLLRLNLHAYNKLTAEAEDSIAQAFCLVGELQLSLDHCKASIQILEK  716

Query  359   LYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQE  180
             LYD + IVI  EL+KL SIQL   +  A  +     +IFSRY+G HA ++FPYLQ L++E
Sbjct  717   LYDTDDIVIAYELVKLSSIQLSLDDGTAVESISRIDDIFSRYYGLHADLVFPYLQYLRRE  776

Query  179   A  177
              
Sbjct  777   V  777



>ref|XP_004147437.1| PREDICTED: SET and MYND domain-containing protein 4-like [Cucumis 
sativus]
 ref|XP_004161155.1| PREDICTED: SET and MYND domain-containing protein 4-like [Cucumis 
sativus]
 gb|KGN65553.1| hypothetical protein Csa_1G445890 [Cucumis sativus]
Length=775

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/777 (50%), Positives = 520/777 (67%), Gaps = 16/777 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELT-DPEMALCGKD  2313
             MEKLKSLVP+ L+Q +  +T D LP++ S LL  F +   F Q++ +L  DPE ALCGK 
Sbjct  1     MEKLKSLVPENLKQMVGSTTADDLPSSSSFLLRLFQQSQLFFQIIGDLAMDPENALCGKK  60

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               AA E+K +GNQCF  GDY  AL +Y++AL++AP N+ D +KNL A LYVNRAS LHKM
Sbjct  61    KDAALELKRQGNQCFLNGDYTNALVYYSKALQVAPMNAVDMDKNLVATLYVNRASVLHKM  120

Query  2132  GLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
              L +ECL+DC+RAL I STYAKAW+RRGKAN S+  F+DAI+D K+S  +EVS +GK+ I
Sbjct  121   DLQLECLRDCNRALQISSTYAKAWYRRGKANVSMDIFDDAIRDFKISKHVEVSFNGKKLI  180

Query  1952  EDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
             +DEL+++  QH   +++   S     D    D+P +  +  V+   KGRGMVS  +IP  
Sbjct  181   DDELKVVQHQHSRSNTANEHSKNKLDD---FDDPIQVKLH-VTTSIKGRGMVSPTEIPPS  236

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGK  1593
             SLVH E+PYA +ILK+CRET+CH+C NELP+  VPC SCSIPLYCS  CQ+ +GG+    
Sbjct  237   SLVHVEEPYAVVILKHCRETHCHYCLNELPVDKVPCPSCSIPLYCSQHCQIQAGGRMLQN  296

Query  1592  TPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGR  1413
              P        L D+L KY+ E      S  RTED+ EH+HEC GVHWPA+LPSE+VLAGR
Sbjct  297   VPDVQDIFKNLSDDLRKYVQEITLCSFSELRTEDVPEHKHECDGVHWPAILPSEIVLAGR  356

Query  1412  VLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPV  1233
             ++ KFI Q+   +  SN++ +L+L H+F ++  D+KLE  IYSI+LL+CLQ  +  K+ +
Sbjct  357   IVAKFIAQRGVFTDASNIVDMLNLSHHFPEMHADSKLECIIYSIMLLSCLQQFFPSKIAI  416

Query  1232  TGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEH-----VNALTSSLEQVKVGQAIY  1068
              G   SQ+ IL+SQIR NS++IVRMKS D  GS D+      V   T ++EQV+VGQAIY
Sbjct  417   NGNTTSQIAILISQIRTNSISIVRMKSFDAPGSPDKDESLSSVVPFTCNMEQVRVGQAIY  476

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
               GS+FNHSC+PN HAYF SRTL++R T  ++ G  LELSYGPQVGQ D KDR Q+L+D 
Sbjct  477   TTGSLFNHSCKPNIHAYFNSRTLFIRATVFMAVGCPLELSYGPQVGQLDCKDRLQLLKDE  536

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENE  708
             YSF+CQC GCS +++SDL INA+ C  P C GVV D ++ S    K    +K    V ++
Sbjct  537   YSFNCQCSGCSTVHISDLVINAFCCINPNCRGVVLDRSIFSCENTK----TKDFLTVNDQ  592

Query  707   RISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVE  528
              I  +  +    +  H  P HCL C  Y D++++  T+ KA     RLQ  I  N V   
Sbjct  593   MI--LEPFMQTDSFLHAGPSHCLKCGSYCDIKSSRLTVDKAGIHFTRLQQEINLNRVSET  650

Query  527   VLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDP  348
              +S+AL A   L+STLH +N+RIAE EDN++QA  L+G+ + A +HCKASI+ILEKLY  
Sbjct  651   TVSDALGALISLKSTLHEYNRRIAEAEDNLSQAFSLLGKLELAAEHCKASIRILEKLYGE  710

Query  347   NHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
             NHI IGNEL KL SI +  G+ +A    K  ++IF  Y+GS+   +FP+L  L++E 
Sbjct  711   NHIAIGNELSKLSSILISVGDHNAVDCIKRLSKIFRCYYGSNVNTMFPFLNILEEET  767



>ref|XP_004502793.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Cicer arietinum]
Length=783

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/787 (50%), Positives = 526/787 (67%), Gaps = 22/787 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             M+ LK+ VP +LR+ I  ST D LP TCSSL  FF +   F ++V +L+D    LCGK+ 
Sbjct  1     MDILKAAVPNSLRKVIGNSTLDTLPDTCSSLHNFFLKFQPFCEIVTQLSDSSYGLCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A + K  GNQCF   DY KAL +YTQALR AP N    E NL A LY NRA+ L+KM 
Sbjct  61    DDALKYKHLGNQCFVEADYVKALDYYTQALRKAP-NDGAIENNLFATLYANRATVLYKMS  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L +ECL+DC+RAL I  +YAKAW+RRGKAN SLGN++DAI DL V+  +E +  GKRQIE
Sbjct  120   LFIECLRDCNRALQICPSYAKAWYRRGKANVSLGNYKDAICDLNVAKIVETATGGKRQIE  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+IILDQ K   +++ +    E+++  + E     +Q +S+P KGRGMVS  D+  GS
Sbjct  180   SELKIILDQSK-STNTVEEPQHKENNLNTVGEVPHIKLQSISMPDKGRGMVSSCDVSPGS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA IILK CRET+CH+C N+LP   VPC SCSIP YCS QCQ+ + G+ +  +
Sbjct  239   LVHAEEPYATIILKQCRETHCHYCLNDLPADRVPCISCSIPWYCSRQCQIRASGEMYLIS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                      LP  L +Y +E V       + +D+ EH+HEC GVHWPAVLP E+VLAGR+
Sbjct  299   AEASYILKNLPGVLGEYAAEVVECSYRELKVDDVTEHQHECNGVHWPAVLPPEIVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNS------YA  1248
             L KF  +   S G ++ +  L+L H +  +P ++KL+ HIY+I+LL CL+ S      Y 
Sbjct  359   LAKFFSKSS-SDGITSFVENLELSHCYEHMPFESKLDSHIYAIVLLYCLKFSNEFKFSYE  417

Query  1247  PKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNA-------LTSSLEQV  1089
                 + G+ ISQ+VI++SQI+VN M +VR+KS+DT G  D+           LT+ +EQV
Sbjct  418   RMSSINGISISQVVIVISQIKVNCMTVVRLKSVDTLGLSDQSGGFPIYSSAHLTNKVEQV  477

Query  1088  KVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDR  909
             +VG+AIY  GS+FNHSC+PN HAYFLSRTLY+RTT+ ++AG +LELSYGPQVG WD KDR
Sbjct  478   RVGKAIYKAGSLFNHSCKPNVHAYFLSRTLYLRTTNVIAAGCQLELSYGPQVGLWDCKDR  537

Query  908   QQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH--VS  735
             +  L+D Y+F CQC GCS++NLSD+ +NA+ C  P C G V +S +    KQK+ H  +S
Sbjct  538   RNFLKDEYAFHCQCTGCSEVNLSDIVLNAFHCVDPNCSGAVLESRVLECEKQKIEHFLIS  597

Query  734   KQVEKVENERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
              +V K  N+ I +V  +  ++ D   H++PG CL C  Y DLE++ AT+ KA   I RLQ
Sbjct  598   DKVNK--NDDIYEVCLHVFNQNDATIHIQPGLCLKCGSYCDLESSRATVDKALICIKRLQ  655

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKA  381
             DAI S ++     S+AL++  +L+S LH +NK IAE EDN+AQA C+VG+ Q ++DHCKA
Sbjct  656   DAILSKEISNTCTSDALRSLHLLKSNLHAYNKLIAEAEDNLAQAFCIVGKLQLSVDHCKA  715

Query  380   SIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPY  201
             SI+ILEKLYDP+ IVI  EL+KL S+QL   +  A  +      IFSRY+G HA ++FP 
Sbjct  716   SIQILEKLYDPDDIVIAYELVKLSSVQLSLDDDSAVDSISRIGGIFSRYYGLHADLVFPX  775

Query  200   LQRLQQE  180
              Q L++E
Sbjct  776   XQYLRRE  782



>ref|XP_006843002.1| hypothetical protein AMTR_s00076p00135550 [Amborella trichopoda]
 gb|ERN04677.1| hypothetical protein AMTR_s00076p00135550 [Amborella trichopoda]
Length=787

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/796 (49%), Positives = 525/796 (66%), Gaps = 43/796 (5%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LKSLVP  LR+ I++S PD LP+T SSLL+FF   PQFH+V+KEL DPE  LC K+ 
Sbjct  1     METLKSLVPIRLREMIAQSAPDDLPSTSSSLLDFFLSFPQFHEVLKELNDPETGLCRKNR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A  +K +GN CFS GDY +AL FYT+ALR  P +  + +K   A LY NRAS+LHK+G
Sbjct  61    EDALVLKQKGNHCFSNGDYHEALRFYTKALRNTPMSDGEIDKCFVATLYTNRASSLHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ E ++DC RAL++   +AKAWFRRGK N +L  +E AI DL V+LKME SL GK QI+
Sbjct  121   LLEESIRDCSRALSLLPNHAKAWFRRGKVNVTLKKYEGAINDLNVALKMESSLVGKNQIK  180

Query  1949  DELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
             DEL   + Q K +  SS      N  ++    EP +A + CVS P KGRGM S++DI  G
Sbjct  181   DELHFAIKQSKRIGESSTSSCRTNGLELEPDVEPSQAELSCVSTPYKGRGMTSKSDILPG  240

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGK  1593
              ++H E+P AAIILK+CRE +CHFCF ELP   +PC SC+IPLYCS  C   + GK+   
Sbjct  241   CMIHSEEPIAAIILKHCREAHCHFCFMELPADTIPCSSCTIPLYCSDHCLEKASGKQ---  297

Query  1592  TPRKVSRHNELPDELEKYISECVSIGVS-GPRTEDIA---EHRHECQGVHWPAVLPSEVV  1425
                        P+  +  + + + I +S   + ED A   EH HEC GVHWPA+LP +VV
Sbjct  298   -----------PERKQINVQDAIEINLSMNAKKEDFAGVSEHGHECGGVHWPAILPVDVV  346

Query  1424  LAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAP  1245
             LAGR+LVK +E+QK   G  +++T L LCHN+  LP ++K+E+HIYS++L  CLQ SYA 
Sbjct  347   LAGRILVKCLERQKYLGGSFDIITELGLCHNYSSLPSESKVELHIYSVVLAYCLQKSYAS  406

Query  1244  KLPVTGviisqlvillsqIRVNSMAIVRMKSLDTK------GSLDEHVNALTSSLEQVKV  1083
              +P TG  +SQL++L+ QIRVNSMAIV MKS D        G L    +ALTSS+EQV+V
Sbjct  407   LVPFTGPSVSQLIVLVCQIRVNSMAIVCMKSFDASDELRNMGKLTFKKDALTSSVEQVRV  466

Query  1082  GQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQ  903
             GQAIYL GS+FNHSC PN HAYF+SRTL++R+ + + AGS +ELSYGPQ+G+WD   RQ 
Sbjct  467   GQAIYLRGSLFNHSCEPNIHAYFVSRTLFLRSIEQIPAGSSVELSYGPQIGEWDLAQRQL  526

Query  902   ILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVK------QKLPH  741
              L ++YSF CQC GCS+LNLSDL ++ +RCAK  C G V +S +  + K      Q +  
Sbjct  527   SLENKYSFMCQCSGCSELNLSDLVLHGFRCAKADCYGAVLNSPVVRHRKLVGNCLQTIVK  586

Query  740   VSKQ-----VEKVENERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAE  582
             +S+        K + + IS VA   + + D  +H+ PG+CL C  + DLE+A  ++ K  
Sbjct  587   ISRWELALPEGKKKRKAISKVARQLLEETDGLFHIDPGYCLRCGSFHDLESAGVSLKKIT  646

Query  581   SSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQA  402
             + + RL D   S D    ++SN L+  ++LRST+HP++K IAE ED +A+A C VGEP +
Sbjct  647   AGLERLWDLNGSKD----LISNGLRHLELLRSTMHPYSKDIAEAEDKLAEAFCSVGEPHS  702

Query  401   AMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAAS-TTKSTAEIFSRYFGS  225
             AMDHCKASI+ILEKLY  NHI I NELIKL SIQ+   +  AA  T     +I + ++GS
Sbjct  703   AMDHCKASIQILEKLYPQNHIAIANELIKLASIQISLIHPMAAKCTVDRVDKILTLHYGS  762

Query  224   HALVIFPYLQRLQQEA  177
             H   +FPY+Q  ++E 
Sbjct  763   HYSKLFPYVQGFRKEV  778



>ref|XP_010670025.1| PREDICTED: uncharacterized protein LOC104887127 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=788

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/790 (49%), Positives = 525/790 (66%), Gaps = 30/790 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS++P  +++EI +ST + LP+ CSSL EFF   P FH ++++LT+P++ LC K+ 
Sbjct  1     MEKLKSIIPLKIKREIKQSTAENLPSICSSLHEFFAESPLFHSMLQDLTNPQLGLCAKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K +GN CFS  DY +A  FY+QALR+AP +  D +  L A LYVNRAS+ HKM 
Sbjct  61    EDALELKFKGNACFSSCDYSQATRFYSQALRVAPMDV-DNDNKLVATLYVNRASSFHKMN  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VE L+DC RAL+I   YAKAW+RRGK N SL N+EDAI DLKV+L  E +  GKRQIE
Sbjct  120   LLVESLRDCSRALSISPRYAKAWYRRGKVNTSLLNYEDAICDLKVALDFEGTCGGKRQIE  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
             ++L++I ++ K + S    + + +    ++DE  +  +QCVS PTKGRGM S  D+P  S
Sbjct  180   NDLKLIAERKKTESSFRELTGKEQ---LVIDELPQGKLQCVSTPTKGRGMSSLCDMPPAS  236

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             L+HKE+ YAAII K+ R+T+CHFCFNELP  +VPC SCSI LYCS  CQL +GG+     
Sbjct  237   LLHKEEAYAAIISKSFRDTHCHFCFNELPPDSVPCTSCSISLYCSEHCQLQAGGQVSRSY  296

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                    + L  EL+KY S+           E  +EH HEC GV+WP VLP+EVVLAGR+
Sbjct  297   LSNKETEHILSGELQKYFSKVTLESHLDSGVEFFSEHGHECHGVNWPVVLPTEVVLAGRI  356

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK +E +++S         LDL HN+V LPP++K+E+H+YSI+LL CL +S    L + 
Sbjct  357   LVKLLELKENSKD-------LDLYHNYVHLPPESKVELHVYSIVLLYCLHSSSRTGLELR  409

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKVGQAIY  1068
             G I ++++IL+SQI+VNSMAIVRMK  D    ++   N       LTS+LEQV+VGQAIY
Sbjct  410   GAIFAKVIILISQIKVNSMAIVRMKYADMCHPVNHSENLSLPGDTLTSNLEQVRVGQAIY  469

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
             L GS+FNHSC PN HAYF+SR+L +R T+ V  G  LE+SYGPQVGQWD+++RQQ L+D 
Sbjct  470   LSGSLFNHSCMPNIHAYFISRSLLIRATEFVLTGCPLEMSYGPQVGQWDYRNRQQFLQDN  529

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV----------  738
             YSF CQC GC  +NL DL  NA+RCAK  C GVV D  +  Y K K  ++          
Sbjct  530   YSFKCQCSGCDSVNLPDLVFNAFRCAKMNCSGVVLDDCMVEYEKHKFSNLQVIAEDHSMK  589

Query  737   -SKQVEKVENERISDVAHYAVHKADY--HLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
               ++V+K+ N+ I  +A      +++   ++ G CL C    DL++   T  +++  I  
Sbjct  590   HQREVDKLMNDEIKKIACLMFEHSNHCPEVQSGCCLRCGSVNDLKSLHVTADESDRYIRS  649

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             LQ+A+ S  V   +LSNAL +   L+S+LH +NK++A+ ED +A+A C VGE Q A+DHC
Sbjct  650   LQEAVISKQVYAGLLSNALSSLKDLKSSLHSYNKKLAKAEDILAEAFCSVGELQQAIDHC  709

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIF  207
               S++IL+KLY P HI +GNELIKL S+QL  GN  AA T      IFS Y+G HA ++F
Sbjct  710   TVSVEILKKLYSPGHIALGNELIKLSSLQLALGNAAAADTVNQMDTIFSNYYGRHAELMF  769

Query  206   PYLQRLQQEA  177
             PYLQ L++E 
Sbjct  770   PYLQNLKREV  779



>ref|XP_004502794.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X2 [Cicer arietinum]
Length=790

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/794 (49%), Positives = 526/794 (66%), Gaps = 29/794 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             M+ LK+ VP +LR+ I  ST D LP TCSSL  FF +   F ++V +L+D    LCGK+ 
Sbjct  1     MDILKAAVPNSLRKVIGNSTLDTLPDTCSSLHNFFLKFQPFCEIVTQLSDSSYGLCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A + K  GNQCF   DY KAL +YTQALR AP N    E NL A LY NRA+ L+KM 
Sbjct  61    DDALKYKHLGNQCFVEADYVKALDYYTQALRKAP-NDGAIENNLFATLYANRATVLYKMS  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L +ECL+DC+RAL I  +YAKAW+RRGKAN SLGN++DAI DL V+  +E +  GKRQIE
Sbjct  120   LFIECLRDCNRALQICPSYAKAWYRRGKANVSLGNYKDAICDLNVAKIVETATGGKRQIE  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+IILDQ K   +++ +    E+++  + E     +Q +S+P KGRGMVS  D+  GS
Sbjct  180   SELKIILDQSK-STNTVEEPQHKENNLNTVGEVPHIKLQSISMPDKGRGMVSSCDVSPGS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA IILK CRET+CH+C N+LP   VPC SCSIP YCS QCQ+ + G+ +  +
Sbjct  239   LVHAEEPYATIILKQCRETHCHYCLNDLPADRVPCISCSIPWYCSRQCQIRASGEMYLIS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                      LP  L +Y +E V       + +D+ EH+HEC GVHWPAVLP E+VLAGR+
Sbjct  299   AEASYILKNLPGVLGEYAAEVVECSYRELKVDDVTEHQHECNGVHWPAVLPPEIVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNS------YA  1248
             L KF  +   S G ++ +  L+L H +  +P ++KL+ HIY+I+LL CL+ S      Y 
Sbjct  359   LAKFFSKSS-SDGITSFVENLELSHCYEHMPFESKLDSHIYAIVLLYCLKFSNEFKFSYE  417

Query  1247  PKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNA-------LTSSLEQV  1089
                 + G+ ISQ+VI++SQI+VN M +VR+KS+DT G  D+           LT+ +EQV
Sbjct  418   RMSSINGISISQVVIVISQIKVNCMTVVRLKSVDTLGLSDQSGGFPIYSSAHLTNKVEQV  477

Query  1088  KVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDR  909
             +VG+AIY  GS+FNHSC+PN HAYFLSRTLY+RTT+ ++AG +LELSYGPQVG WD KDR
Sbjct  478   RVGKAIYKAGSLFNHSCKPNVHAYFLSRTLYLRTTNVIAAGCQLELSYGPQVGLWDCKDR  537

Query  908   QQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH--VS  735
             +  L+D Y+F CQC GCS++NLSD+ +NA+ C  P C G V +S +    KQK+ H  +S
Sbjct  538   RNFLKDEYAFHCQCTGCSEVNLSDIVLNAFHCVDPNCSGAVLESRVLECEKQKIEHFLIS  597

Query  734   KQVEKVENERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESSI----  573
              +V K  N+ I +V  +  ++ D   H++PG CL C  Y DLE++ AT+ KA   I    
Sbjct  598   DKVNK--NDDIYEVCLHVFNQNDATIHIQPGLCLKCGSYCDLESSRATVDKALICIKRLN  655

Query  572   ---GRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQA  402
                 RLQDAI S ++     S+AL++  +L+S LH +NK IAE EDN+AQA C+VG+ Q 
Sbjct  656   YGNDRLQDAILSKEISNTCTSDALRSLHLLKSNLHAYNKLIAEAEDNLAQAFCIVGKLQL  715

Query  401   AMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSH  222
             ++DHCKASI+ILEKLYDP+ IVI  EL+KL S+QL   +  A  +      IFSRY+G H
Sbjct  716   SVDHCKASIQILEKLYDPDDIVIAYELVKLSSVQLSLDDDSAVDSISRIGGIFSRYYGLH  775

Query  221   ALVIFPYLQRLQQE  180
             A ++FP  Q L++E
Sbjct  776   ADLVFPXXQYLRRE  789



>ref|XP_008813823.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Phoenix dactylifera]
Length=798

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/798 (49%), Positives = 529/798 (66%), Gaps = 24/798 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKSL+P  L++ I EST + L +TCSSLLEFF  LPQF  V+KELTDPEMALC K  
Sbjct  1     MERLKSLIPNDLKRMIGESTTENLTSTCSSLLEFFRPLPQFQHVIKELTDPEMALCRKSK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             +AA + K +GN+CFS GDY KAL +Y+QALR AP N +D + NL+A LYVNRAS++HK+G
Sbjct  61    AAALDSKQKGNECFSKGDYVKALSYYSQALRYAPLNYDDIDVNLAATLYVNRASSMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC+ DC+RA+A+   Y KAW+RRGKANASL  +E AI DL+V+  ME +L  K  I+
Sbjct  121   LLEECIHDCNRAIALSPGYVKAWYRRGKANASLKCYEVAIPDLEVAFSMEDTLPRKNHIK  180

Query  1949  DELRIILDQ-HKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
             +EL+++L + +  K +S+  +N     +    E     +QCV +P+KGRGM S  DIP  
Sbjct  181   EELKMVLSKLNSTKGASISTNNNKNEKLAASAESYHIALQCVFIPSKGRGMTSADDIPPA  240

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGK  1593
             SL+H E+P AAI++K+CRET+CHFCF+E+P   + C SC+IP+YCS  CQ  +GG++F +
Sbjct  241   SLLHTEEPLAAIVMKSCRETHCHFCFSEVPADVLFCHSCTIPIYCSQHCQEQAGGQQFLR  300

Query  1592  TPRKVSRHNELPDELEKYISEC-----VSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEV  1428
                  +    L  ELEK++        VS   +    +   EHRHEC G HW AVLP +V
Sbjct  301   NEGSFTVQKCLSAELEKHVMNASLANQVSCAAADMNIKKNPEHRHECGGAHWSAVLPHDV  360

Query  1427  VLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYA  1248
             VLAGRV+ K+IE +K S   SN L  L+  HN+ Q+P   KLE+HIY+ +L  CLQN Y 
Sbjct  361   VLAGRVMSKYIE-KKSSGKISNPLETLEFAHNYCQIPLANKLELHIYATVLSYCLQNYYG  419

Query  1247  PKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHV------NALTSSLEQVK  1086
                P  G  +SQLV+L+SQ++VNSMA+V M SLD   +L + +      NA T + EQ +
Sbjct  420   SDFPSIGASVSQLVLLISQVKVNSMAVVHMNSLDGHEALKKPLKLSTIENAFTCNTEQAR  479

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             VGQAIY  GS+FNHSC+PN HAYFL+R L +R+T+ V A + LELSYGPQVGQ D + RQ
Sbjct  480   VGQAIYSTGSLFNHSCQPNIHAYFLARMLLIRSTEFVPAWNPLELSYGPQVGQLDLQGRQ  539

Query  905   QILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQV  726
              +L ++YSF CQC  CS+LNLSDL INA+RC+ PGCLGVV        ++  L  VS   
Sbjct  540   NLLEEQYSFKCQCSSCSELNLSDLIINAFRCSHPGCLGVVSHVAHYKKIEDDLLQVSGPS  599

Query  725   EKVE--------NERISDVAHYAVHKADY--HLKPGHCLNCNLYRDLEAACATISKAESS  576
                +           IS VAH  +        + PG+CL+C  YRDL+++    + A  +
Sbjct  600   YSCKLSLPFSKHKMDISKVAHMLLKDKGVTCDIYPGYCLSCGFYRDLKSSVTASNSAMLN  659

Query  575   IGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAM  396
             I RL+D++ S +VP   +S+AL++   L+   HP++K +AE EDN+A+A   +G+ + AM
Sbjct  660   IQRLRDSLNSKEVPEISISDALESLSHLKLIWHPYSKVVAEAEDNIAEAYVRIGDFERAM  719

Query  395   DHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAE-IFSRYFGSHA  219
             +HC ASI+IL KLY   HIVIG+EL+KL SIQL   +  AA ++   AE IFS Y+GSH 
Sbjct  720   NHCIASIEILNKLYHAEHIVIGHELMKLTSIQLSLDDHAAARSSIKRAEAIFSLYYGSHV  779

Query  218   LVIFPYLQRLQQEAGCLA  165
               IFPY++ L++EAG LA
Sbjct  780   TKIFPYIEALKREAGSLA  797



>ref|XP_006578856.1| PREDICTED: uncharacterized protein LOC100794609 isoform X1 [Glycine 
max]
 ref|XP_006578857.1| PREDICTED: uncharacterized protein LOC100794609 isoform X2 [Glycine 
max]
Length=789

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/784 (51%), Positives = 524/784 (67%), Gaps = 19/784 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LK+ +P+ L++ I +S  D L +TCSSL  FF     FHQ++ EL DP+ ALC K+ 
Sbjct  1     METLKAAIPENLKRAIGDSDVDDLRSTCSSLHRFFLHFHPFHQMITELADPKYALCAKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNS-NDTEKNLS-AMLYVNRASALHK  2136
              AA + +L GNQCFS  DY KAL  YTQALR AP ++ +D E NL  A LY+NRA+ LHK
Sbjct  61    DAALKSRLLGNQCFSNADYAKALDCYTQALREAPLDTASDMESNLVVATLYINRATVLHK  120

Query  2135  MGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQ  1956
             M LIVECL+DC RAL I  +YAKAW+RRGKANASLGN+++AI DL V+  +E S+ GKRQ
Sbjct  121   MSLIVECLRDCTRALQICPSYAKAWYRRGKANASLGNYKNAICDLNVAKSVEPSMGGKRQ  180

Query  1955  IEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPI  1776
             IE EL+I+LDQ K   +++ +    E++   + E     +Q VS P KGRG+VS   I  
Sbjct  181   IEGELKILLDQCK-STTAVEQIQHTENNCNTVGEMPHIKLQRVSTPDKGRGIVSSCVISP  239

Query  1775  GSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFG  1596
             G LVH E+PYA IILK CRET+CH+C N+LP   VPC  CSIPLYCS QC++ + G+ F 
Sbjct  240   GFLVHAEEPYAMIILKQCRETHCHYCLNDLPADRVPCILCSIPLYCSHQCRIRATGQMFK  299

Query  1595  KTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAG  1416
               P        LP +L +Y +E +    S     DI EH+HECQGVHWP VLPSE+VLAG
Sbjct  300   IYPEYNGFFKNLPSDLGEYAAEVIQCNDSELEIGDITEHKHECQGVHWPMVLPSEIVLAG  359

Query  1415  RVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLP  1236
             R+L +F+          N +  L+L H + Q+  + KL+ HIY+I+LL CLQ+S      
Sbjct  360   RILARFL-LNIPPEDIINFVERLELSHCYKQMSSERKLDSHIYAIVLLYCLQHSCGIMFS  418

Query  1235  VTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNAL--------TSSLEQVKVG  1080
             +  V ISQ+VI++SQI+VN M +VR+KS+D  G L               TS++EQV+VG
Sbjct  419   IDEVFISQVVIIISQIKVNCMTVVRLKSIDAHG-LSGRFGEFPFQSGAHSTSNVEQVRVG  477

Query  1079  QAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQI  900
             +AIY  GS+FNHSC+PN HAYFLSRTLY+RTT+ V+A S+LELSYGPQVG WD KDR   
Sbjct  478   KAIYKAGSLFNHSCQPNIHAYFLSRTLYLRTTNVVAAESQLELSYGPQVGLWDCKDRLNF  537

Query  899   LRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH--VSKQV  726
             L+D Y+F CQC GCS++NLSD+ +NA+ C    C G V +S +    KQK+ H  +S  V
Sbjct  538   LKDEYAFLCQCTGCSEVNLSDIVLNAFHCVNTNCSGTVLESRVHDSEKQKIKHFPISDHV  597

Query  725   EKVENERISDVAH--YAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAI  552
             +K  N  I +V    +  + A   ++PG+CL C  Y DLE++ A +SKA + I RLQDAI
Sbjct  598   DK--NADIYEVCLRVFKQNGASIDIQPGYCLKCGSYCDLESSRAAVSKALTCIKRLQDAI  655

Query  551   ASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIK  372
              S  +    +S+ALK+  +LR  LH +NK IAE ED++AQA CLVGE Q ++D+CKASI+
Sbjct  656   LSQQISSITISDALKSLRLLRLNLHAYNKLIAEAEDSIAQAFCLVGELQLSLDYCKASIQ  715

Query  371   ILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQR  192
             ILEKLYD + IVI  EL+KL SIQL  G+  A  +     +IFSRY+G HA ++FPYLQ 
Sbjct  716   ILEKLYDTDDIVIAYELVKLSSIQLSLGDGTAVESISRIDDIFSRYYGLHADLVFPYLQY  775

Query  191   LQQE  180
             L++E
Sbjct  776   LRRE  779



>ref|XP_008444150.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Cucumis melo]
Length=775

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/780 (50%), Positives = 526/780 (67%), Gaps = 22/780 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELT-DPEMALCGKD  2313
             MEKLKSLVP+ L+Q +  +T D LP++ S LL  F +   F QV+ +LT DPE ALCGK 
Sbjct  1     MEKLKSLVPENLKQMVGSTTADDLPSSSSFLLRLFQQSQLFFQVIGDLTMDPENALCGKK  60

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               AA E+K +GNQCF  GDY  AL +Y++AL +AP N+ D +KNL A LYVNRAS LHKM
Sbjct  61    KDAALELKRQGNQCFLNGDYANALVYYSKALLVAPMNAVDMDKNLVATLYVNRASVLHKM  120

Query  2132  GLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
              L +E L+DC+RAL I S YAKAW+RRGKAN S+  F+DAI+D ++S  +EVS +GK+QI
Sbjct  121   DLQLESLRDCNRALQISSNYAKAWYRRGKANVSMEIFDDAIRDFQISKHVEVSFNGKKQI  180

Query  1952  EDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQC-VSLPTKGRGMVSRADIPI  1776
             +DEL++I  QH  + +++ + ++N+ D    D  D   ++  V+   KGRGMVS  +IP 
Sbjct  181   DDELKVIQHQHS-RSNTVNEHSKNKLD----DYDDLIQVKLHVTTSNKGRGMVSPTEIPP  235

Query  1775  GSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFG  1596
              SL+H E+PYA +ILK+CRET+CH+C NELP+  VPC SCSIPLYCS  CQ+ +GG    
Sbjct  236   SSLIHVEEPYAVVILKHCRETHCHYCLNELPVDKVPCPSCSIPLYCSQHCQIQAGGPMLR  295

Query  1595  KTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAG  1416
                        L D+L  YI E      S  RTE++ EH+HEC GVHWPA+LPSE+VLAG
Sbjct  296   NVSDIQDIFKNLSDDLRMYIQEITLCSFSELRTENVHEHKHECDGVHWPAILPSEIVLAG  355

Query  1415  RVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLP  1236
             R++ KFI Q+   +  SNL+ +L+L H+F ++  D+KLE  IYSIILL+CLQ  +  ++ 
Sbjct  356   RIVAKFIAQRGVFADASNLVDMLNLSHHFPEMHTDSKLECIIYSIILLSCLQQFFPSQVE  415

Query  1235  VTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDE-----HVNALTSSLEQVKVGQAI  1071
             + G   SQ+ IL+SQIR NS++IVRMKS D  GS D+      V   T ++EQV+VGQAI
Sbjct  416   INGNTTSQIAILISQIRTNSISIVRMKSFDAPGSPDKGERLSSVIPFTCNMEQVRVGQAI  475

Query  1070  YLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRD  891
             Y  GS+FNHSC+PN HAYF SRTL++R T   + G  LELSYGPQVGQ D KDR ++L+D
Sbjct  476   YTTGSLFNHSCKPNIHAYFNSRTLFIRATSFAAVGCPLELSYGPQVGQLDCKDRLKLLKD  535

Query  890   RYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVEN  711
              YSF+CQC GCS +++SDL INA+ C  P C GVV D ++ +    K    +K    V++
Sbjct  536   EYSFNCQCSGCSIVHISDLVINAFCCINPNCRGVVLDRSIFNCENTK----TKDFLTVDD  591

Query  710   ERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDV  537
             + I +     + + D   H  P HCL C  Y D++++  T+ KA     RLQ  I  N V
Sbjct  592   QIILE----PIMQTDSFLHAGPSHCLKCGSYCDIKSSRLTVDKAGIHFTRLQQEINLNRV  647

Query  536   PVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKL  357
                 +S+AL A   L+STLH +N+RIAE EDN++QA CL+G+ + A +HCKASI+ILEKL
Sbjct  648   SETTVSDALGALISLKSTLHEYNRRIAEAEDNLSQAFCLLGKLELAAEHCKASIRILEKL  707

Query  356   YDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
             Y  NHI IGNEL+KL SI +  G+ +AA   K +++IF  Y+GS+A  +FP+L  L++E 
Sbjct  708   YGGNHIAIGNELLKLSSILISVGDHNAADCIKRSSKIFRCYYGSNANTMFPFLNILEEET  767



>ref|XP_010058102.1| PREDICTED: uncharacterized protein LOC104445854 isoform X1 [Eucalyptus 
grandis]
Length=793

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/792 (48%), Positives = 517/792 (65%), Gaps = 29/792 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS+VP  L+  +  S+ D + +T SSLL FF  LP+F  +V++L DPE  +CGK+ 
Sbjct  1     MERLKSMVPDTLKAVVGASSADDILSTSSSLLHFFLALPEFQLMVRDLVDPERCVCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA + K +GN CFS  D+  AL FY+QAL +AP ++ D +KNL ++LYVNRA AL+K+G
Sbjct  61    DAALDAKQKGNLCFSSADFSGALAFYSQALIVAPFDARDKDKNLVSVLYVNRAVALYKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
               +ECL+DC+RAL I   YAKAW+ RGK NAS  N+EDA+ DL V+  ME S  GKRQIE
Sbjct  121   FKIECLRDCNRALQISPGYAKAWYWRGKINASSENYEDAMADLHVANLMETSSGGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              E++++  Q      SL  +  +E+ + + D P    ++ + +P KGRGM S  +IP   
Sbjct  181   GEMKLLQVQFTRMSGSL--TQHDENIIKISDVPHEVKVKSIVMPHKGRGMASTGEIPPSY  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYAA+ILKNCR+  CH+CFNELP   VPC  C+IP YCS  CQL +GG +    
Sbjct  239   LVHSEEPYAAVILKNCRDRYCHYCFNELPADVVPCSFCAIPRYCSEHCQLKAGGHQSRNN  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
               +VS H E+P E+E +I E  S        E  AEHRHEC   +WPAVLP EVVLAGRV
Sbjct  299   VEEVSLHVEVPTEIENHIREVTSDNWEEKIPEHFAEHRHECLDANWPAVLPHEVVLAGRV  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             +VK + Q++D       +  LDL +++ +L  + KLE+ IY+++LL CLQ S +  LPV 
Sbjct  359   VVKSLVQRRDLVE----IKALDLSYSYTELAVEVKLELCIYAVVLLVCLQRSLSLDLPVN  414

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKVGQAIY  1068
                + Q++I++ QIR+NSMAI+RMKS D     D H        A  S++EQV VGQAIY
Sbjct  415   PYFVYQIIIIMCQIRLNSMAIIRMKSSDPNAPQDPHRKLSSNEAASASTIEQVSVGQAIY  474

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
              VGS+FNHSCRPN HAYFL+RTL++RTT+ V AG  LELSYGPQVGQW  +DR + L ++
Sbjct  475   AVGSLFNHSCRPNIHAYFLARTLFIRTTELVEAGCSLELSYGPQVGQWSCQDRLKFLGEK  534

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-------------  747
             Y F CQCR CS +NLSDL ++A+ C  P C G+V D+       +KL             
Sbjct  535   YCFRCQCRSCSVVNLSDLVLSAFHCVHPHCSGIVLDTFDIKSETEKLKQSRHAGDIYSLE  594

Query  746   PHVSKQVEKVENERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESSI  573
             P+V  QV+K  +    ++ H A  K  +  H   G+CL C  + DLE++C  +SKA  ++
Sbjct  595   PYV--QVDKFGDLYAGEMDHNAQEKSYSSLHAGVGYCLKCGSHCDLESSCLMVSKALGNM  652

Query  572   GRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMD  393
              RLQD I   ++   +LSNAL++ D LR  LH +NK IAE ED++AQA C +GE Q AM+
Sbjct  653   KRLQDGIVRKELSGSLLSNALESLDQLRKVLHAYNKSIAEAEDSIAQAFCFIGELQCAME  712

Query  392   HCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALV  213
             HCK+SI+ILEKLY P+H+VIG EL+KL SIQL  G+ DA  T      IF  ++GSHA V
Sbjct  713   HCKSSIQILEKLYSPDHVVIGYELVKLLSIQLSLGDVDAGETLNRLGMIFEHHYGSHAAV  772

Query  212   IFPYLQRLQQEA  177
             +FPYL+  ++EA
Sbjct  773   VFPYLKSFKREA  784



>ref|XP_011012968.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Populus euphratica]
Length=783

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/786 (50%), Positives = 523/786 (67%), Gaps = 24/786 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLK LVP+++++ + ES+ + L +T S+LL     LPQF Q++ +L D   +LCGK+ 
Sbjct  1     MEKLKCLVPESIKRMVGESSHEDLASTSSTLLHCLLNLPQFQQMIDDLADSNNSLCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K +GN+ +   +Y  AL  Y+QALR+AP ++ D +KNL A L++NRAS  HK+G
Sbjct  61    KVALELKQKGNESYLTAEYASALESYSQALRVAPMDAVDMDKNLVATLFLNRASLFHKIG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
              + E L+DC RA+ I  TYAKAW+RRGKAN  LGNF+DA+ D   +  +E+SL GKR IE
Sbjct  121   FLTESLRDCKRAIQISPTYAKAWYRRGKANVDLGNFKDAVNDFNNAKSLELSLDGKRHIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL IIL++   K +S      N++     DEP +  +  VS P KGRGM S+ DI   S
Sbjct  181   TELNIILERQ--KSTSKMAVQENDNCFGHFDEPHQLKLSQVSTPDKGRGMASQCDIAQAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKE+PYA IILK+CRET+CH+C N+L    VPC SC+IPLYCS  CQ+ +GG+ F   
Sbjct  239   LVHKEEPYALIILKSCRETHCHYCLNQLRADTVPCTSCTIPLYCSEHCQVQAGGEPFSNF  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
               K+  +        +Y     S   S P  E   EH+HEC GV+WPA+LPS++VLAGR+
Sbjct  299   QDKIGTNESHSHSHGEYKFAVCS--DSNP-IECFPEHKHECLGVNWPAILPSDIVLAGRI  355

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK   Q+   S  SN L  L L H++ Q+ P++KLE+H+Y+I+LL CLQ+S+  +LP+ 
Sbjct  356   LVKSTSQR--CSTKSNALCDLGLSHSYTQITPESKLELHVYAIVLLCCLQHSFGFELPIN  413

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGS----LDEHVNALTSSLEQVKVGQAIYLV  1062
             GV +SQ +IL+SQIRVN+MAIVRMKS+D        L    +ALTSSLEQV VGQAIY  
Sbjct  414   GVSLSQTIILISQIRVNAMAIVRMKSVDDPPDQFRKLTSVGDALTSSLEQVPVGQAIYKA  473

Query  1061  GSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYS  882
              S+FNHSC PN HAYFLSRTL++RTT++VS G  LELSYGPQVGQ D +DR + L D+YS
Sbjct  474   ASLFNHSCLPNIHAYFLSRTLFIRTTENVSTGCPLELSYGPQVGQSDCEDRLRYLADKYS  533

Query  881   FSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSK----------  732
             F CQCRGCSQLNLSDL +NA+ C    C GVV +ST+ +    KL +  +          
Sbjct  534   FRCQCRGCSQLNLSDLVLNAFCCVNHNCAGVVLESTIINGETHKLNNFPRAPEKQKFDSH  593

Query  731   -QVEKVENERISDVAHYAV--HKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
              Q +K+    ++DVA  A+  + +  H+ PG CL+C  +RDL+A+   I+KA S I RLQ
Sbjct  594   LQGQKLNIVDLNDVAGLALKFNNSSLHIHPGFCLHCGSHRDLDASHEAINKAWSYIKRLQ  653

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKA  381
             +AI S D+    L +A +A  ILRSTLH +NK +AE EDN+AQA CLV + Q+A +HCK 
Sbjct  654   EAIISKDITGTTLLDASRALGILRSTLHAYNKSVAEAEDNLAQAFCLVRDFQSAREHCKE  713

Query  380   SIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPY  201
             SIKIL+ LY P+HIVIG EL+KL SIQL   +  A  +T     IF+RYFG H   I PY
Sbjct  714   SIKILQTLYGPDHIVIGYELVKLASIQLSLDDPAAVDSTNHLGLIFARYFGPHVDFIVPY  773

Query  200   LQRLQQ  183
              Q L++
Sbjct  774   QQFLKR  779



>ref|XP_010058103.1| PREDICTED: uncharacterized protein LOC104445854 isoform X2 [Eucalyptus 
grandis]
Length=765

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/792 (48%), Positives = 503/792 (64%), Gaps = 57/792 (7%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS+VP  L+  +  S+ D + +T SSLL FF  LP+F  +V++L DPE  +CGK+ 
Sbjct  1     MERLKSMVPDTLKAVVGASSADDILSTSSSLLHFFLALPEFQLMVRDLVDPERCVCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA + K +GN CFS  D+  AL FY+QAL +AP ++ D +KNL ++LYVNRA AL+K+G
Sbjct  61    DAALDAKQKGNLCFSSADFSGALAFYSQALIVAPFDARDKDKNLVSVLYVNRAVALYKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
               +ECL+DC+RAL I   YAKAW+ RGK NAS  N+EDA+ DL V+  ME S  GKRQIE
Sbjct  121   FKIECLRDCNRALQISPGYAKAWYWRGKINASSENYEDAMADLHVANLMETSSGGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
                                           D P    ++ + +P KGRGM S  +IP   
Sbjct  181   ------------------------------DVPHEVKVKSIVMPHKGRGMASTGEIPPSY  210

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYAA+ILKNCR+  CH+CFNELP   VPC  C+IP YCS  CQL +GG +    
Sbjct  211   LVHSEEPYAAVILKNCRDRYCHYCFNELPADVVPCSFCAIPRYCSEHCQLKAGGHQSRNN  270

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
               +VS H E+P E+E +I E  S        E  AEHRHEC   +WPAVLP EVVLAGRV
Sbjct  271   VEEVSLHVEVPTEIENHIREVTSDNWEEKIPEHFAEHRHECLDANWPAVLPHEVVLAGRV  330

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             +VK + Q++D       +  LDL +++ +L  + KLE+ IY+++LL CLQ S +  LPV 
Sbjct  331   VVKSLVQRRDLVE----IKALDLSYSYTELAVEVKLELCIYAVVLLVCLQRSLSLDLPVN  386

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKVGQAIY  1068
                + Q++I++ QIR+NSMAI+RMKS D     D H        A  S++EQV VGQAIY
Sbjct  387   PYFVYQIIIIMCQIRLNSMAIIRMKSSDPNAPQDPHRKLSSNEAASASTIEQVSVGQAIY  446

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
              VGS+FNHSCRPN HAYFL+RTL++RTT+ V AG  LELSYGPQVGQW  +DR + L ++
Sbjct  447   AVGSLFNHSCRPNIHAYFLARTLFIRTTELVEAGCSLELSYGPQVGQWSCQDRLKFLGEK  506

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-------------  747
             Y F CQCR CS +NLSDL ++A+ C  P C G+V D+       +KL             
Sbjct  507   YCFRCQCRSCSVVNLSDLVLSAFHCVHPHCSGIVLDTFDIKSETEKLKQSRHAGDIYSLE  566

Query  746   PHVSKQVEKVENERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESSI  573
             P+V  QV+K  +    ++ H A  K  +  H   G+CL C  + DLE++C  +SKA  ++
Sbjct  567   PYV--QVDKFGDLYAGEMDHNAQEKSYSSLHAGVGYCLKCGSHCDLESSCLMVSKALGNM  624

Query  572   GRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMD  393
              RLQD I   ++   +LSNAL++ D LR  LH +NK IAE ED++AQA C +GE Q AM+
Sbjct  625   KRLQDGIVRKELSGSLLSNALESLDQLRKVLHAYNKSIAEAEDSIAQAFCFIGELQCAME  684

Query  392   HCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALV  213
             HCK+SI+ILEKLY P+H+VIG EL+KL SIQL  G+ DA  T      IF  ++GSHA V
Sbjct  685   HCKSSIQILEKLYSPDHVVIGYELVKLLSIQLSLGDVDAGETLNRLGMIFEHHYGSHAAV  744

Query  212   IFPYLQRLQQEA  177
             +FPYL+  ++EA
Sbjct  745   VFPYLKSFKREA  756



>ref|XP_007011439.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY20249.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=833

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/757 (50%), Positives = 505/757 (67%), Gaps = 24/757 (3%)
 Frame = -3

Query  2378  LPQFHQVVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNS  2199
             L +FHQ++ EL   E  LCGK+  AA ++K +GNQC+S  DY +AL  Y+QALR+AP ++
Sbjct  73    LTEFHQLIGELAKRETGLCGKNREAALDLKQKGNQCYSTRDYSQALRCYSQALRVAPIDA  132

Query  2198  NDTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFE  2019
             +D  KNL A LY+NRAS  HKM L +E L+DC RAL +  +Y KAW+RRGK NA+LGN+E
Sbjct  133   DDMGKNLVATLYLNRASLFHKMDLPMESLRDCSRALQVSPSYPKAWYRRGKVNATLGNYE  192

Query  2018  DAIQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRN-----ESDVTMLDE  1854
             DA+ DL V+  ME SL GK+QIE EL I+   H  K +     N+      +S   + D 
Sbjct  193   DAVNDLTVARNMEPSLGGKKQIESELDILGQHHDRKSAKPVHYNQKSVGIPDSTNHLSDV  252

Query  1853  PDRANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHA  1674
             P +  + CV+ P KGRGM S+ DIP  SL+H E+PYA +ILK+CRET+CH+C NELP   
Sbjct  253   PHQIKLHCVTTPDKGRGMASQFDIPQASLIHTEEPYAVVILKHCRETHCHYCLNELPADT  312

Query  1673  VPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTE  1494
             +PC SCS+PLYCS  CQ+ +GG+       KV    ++   +E+YI++        P+ E
Sbjct  313   IPCISCSMPLYCSQHCQVRAGGQIHFNYSNKVDICEKMSSSIEEYIADKTVGSNFDPKLE  372

Query  1493  DIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPP  1314
              I EH+HECQGVHWPA+LPS+VVLAGRV+VK IEQ++      N L  L LC ++ ++PP
Sbjct  373   CIPEHKHECQGVHWPAILPSDVVLAGRVVVKSIEQKEQFIEVPNFLETLGLCESYSKMPP  432

Query  1313  DTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDT---  1143
             ++KLE++IYSI+LL CLQ+SY+ +L + GV  S++VILLSQIRVNSMAIVRMKS D    
Sbjct  433   ESKLELNIYSIVLLFCLQHSYSSELSINGVSTSRIVILLSQIRVNSMAIVRMKSSDVYDQ  492

Query  1142  -----KGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDS  978
                  K S  E   ALTSS+EQV+VGQA+Y+  S+FNHSCRPN HAYF+SR+L +R T+ 
Sbjct  493   QDWFRKFSSGEAETALTSSVEQVRVGQALYITASLFNHSCRPNIHAYFISRSLVIRATEF  552

Query  977   VSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGC  798
             V+ G  LELSYGPQVGQWD KDR + L ++Y F C C GCS++N SDL IN + C  P C
Sbjct  553   VAGGCPLELSYGPQVGQWDCKDRLRFLDEQYFFRCWCHGCSEVNASDLVINGFCCVNPNC  612

Query  797   LGVVPDSTLASYVKQKLPHVSK--------QVEKVENERISDVAHYAVH--KADYHLKPG  648
              GVV D  +A+  KQK P + +        QV ++ +  I   AH ++   ++   +   
Sbjct  613   SGVVLDKLVANCEKQK-PKIPETIGVESHLQVHELNDIDIKKAAHISLDETRSSLRIDSE  671

Query  647   HCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFN  468
             +CL C  Y +L +    + KA  ++ RLQD+I   D+    LS+AL++  ILRS LH +N
Sbjct  672   YCLKCGSYCNLASMSEAVKKAWINLRRLQDSITLKDMHGTELSDALRSVGILRSILHAYN  731

Query  467   KRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRG  288
             K I E EDN+AQA C  G+ Q A DHCKASI+ILEKLY P+HIVIG EL+KL SIQL  G
Sbjct  732   KGIGEAEDNLAQAFCFTGDLQPARDHCKASIEILEKLYGPDHIVIGYELVKLSSIQLWLG  791

Query  287   NRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
             +  A  +    + IFSRY+G  A +IFPYL  L++++
Sbjct  792   DCAAVDSINRLSLIFSRYYGPDAGIIFPYLGFLRRKS  828



>ref|XP_010658302.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X3 
[Vitis vinifera]
Length=655

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/654 (55%), Positives = 473/654 (72%), Gaps = 27/654 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP AL++ I+ESTPD LP+TC SLLEFF  + QF  +V +L   E ALC K+ 
Sbjct  1     MEKLKSLVPDALKRMIAESTPDDLPSTCYSLLEFFLHMQQFQMIVGDLAHSETALCRKNR  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA E K +GN+CFS GDY KAL  Y+QALR+APT+++D +KNL   L+VNRAS LHKMG
Sbjct  61    DAALESKRKGNECFSSGDYMKALSLYSQALRVAPTDADDVDKNLVVTLFVNRASVLHKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
              +VECL+DC+RAL I   YAKAW+RRGKANASL  +EDA+ DL V++ +E SL+G+ QIE
Sbjct  121   FLVECLRDCNRALLISPNYAKAWYRRGKANASLNGYEDAVHDLNVAMHLEESLAGRSQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL++ILDQ+K  +S       +++D+  L+E  +  +QCVS PTKGRGM S ++I    
Sbjct  181   RELKLILDQYKGNNSV---DQHDQNDLGTLEEQLQIKLQCVSTPTKGRGMASLSEISQSY  237

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYAAIILK+CR+T+CHFCFNELP  +VPC SCSIPLYCS  CQ+ +GG+E    
Sbjct  238   LVHTEEPYAAIILKHCRDTHCHFCFNELPADSVPCTSCSIPLYCSQHCQMQAGGQELRNN  297

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTED-----IAEHRHECQGVHWPAVLPSEVV  1425
              +       L  +LEKY++     G++ P+  D     IAEH+HEC+GV+WPAVLP E+V
Sbjct  298   SKNHGICKNLSSDLEKYVA-----GITLPKDSDSNIEWIAEHKHECKGVNWPAVLPPEIV  352

Query  1424  LAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAP  1245
             LAGRV+VK +EQ+K S   SNL+  LDL H++  + P++KL++HIYS++LL CLQ+SY  
Sbjct  353   LAGRVMVKSVEQKKHSCNASNLMDTLDLSHSYKTMAPESKLDLHIYSVVLLYCLQHSYGF  412

Query  1244  KLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKV  1083
             +LP+ G+ ISQL+IL+SQI+VNS+AIVRMK +D    LD+ VN      A TS++EQV+V
Sbjct  413   ELPLNGISISQLIILISQIKVNSIAIVRMKFMDGYSPLDQSVNFSPAGGAFTSNMEQVRV  472

Query  1082  GQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQ  903
             GQAIY V S+FNHSC+PN HAYFLSRTL++R T+ V+ G  LELSYGPQVGQWD KDRQ+
Sbjct  473   GQAIYSVASLFNHSCQPNIHAYFLSRTLFLRATEHVAVGCPLELSYGPQVGQWDCKDRQK  532

Query  902   ILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH------  741
              L+D YSF C+C GCS+LN+SDL +NA+RC  P C G V DS +  Y  +K         
Sbjct  533   FLKDEYSFRCECSGCSELNVSDLVLNAFRCVNPDCFGTVLDSCVIKYENKKFERFQGVPQ  592

Query  740   --VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKA  585
               +S+   +++N+ I +VAH A   + +   PG+CL+C  YRDLEA+ AT+ +A
Sbjct  593   DCISEPHLQLKNDGIREVAHQAFANSSFRAAPGYCLHCGAYRDLEASHATVGEA  646



>ref|XP_007136386.1| hypothetical protein PHAVU_009G040900g [Phaseolus vulgaris]
 gb|ESW08380.1| hypothetical protein PHAVU_009G040900g [Phaseolus vulgaris]
Length=745

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/732 (51%), Positives = 490/732 (67%), Gaps = 14/732 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LK+ +P++L++ I++S  D L +TCSSL  FF     FHQ++ +L DP+  LCGK  
Sbjct  1     METLKAAIPESLKRAIADSNVDDLQSTCSSLHRFFLHFDPFHQIITQLADPKYGLCGKSE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A + K  GN+CFS  DY KAL  YTQALR AP ++ D + NL A LY+NRA+ LHKM 
Sbjct  61    EDALKSKQLGNECFSNADYAKALDCYTQALRKAPLDTGDRKSNLVATLYINRATVLHKMS  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VECL+DC RAL I  +YAKAW+RRGKANASLGN+ +AI DL V+  +E SL GKRQIE
Sbjct  121   LLVECLRDCTRALKICPSYAKAWYRRGKANASLGNYRNAICDLNVAKIVEPSLGGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+I+LDQ K   +++   +++ S  T+ + P +  +QCVS+P KGRGMVS   I  GS
Sbjct  181   VELKILLDQCKSTSAAVQIQHKDNSCNTVGEMP-QMKLQCVSMPDKGRGMVSSCVISPGS  239

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA IILK CRET+CH+C N+LP   VPC SCSIPLYCS QCQ+ +GG+ F   
Sbjct  240   LVHSEEPYAMIILKQCRETHCHYCLNDLPADRVPCISCSIPLYCSHQCQIRAGGQMFRIY  299

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P       ++P +L +Y SE +    S    EDI EH+HEC GVHWP VLPSE+VL GR+
Sbjct  300   PENNDTFKKMPSDLGEYASEVIQSDDSEQEIEDITEHKHECGGVHWPVVLPSEIVLTGRI  359

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             L  F+     S    N +  L+L H +  +  ++KL+ HIY+ +LL CLQ+S      + 
Sbjct  360   LAGFL-LNSTSENIVNFVERLELSHCYKHMSSESKLDSHIYATVLLYCLQHSCETMFSID  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNAL--------TSSLEQVKVGQA  1074
             GV ISQ+VI++SQI+VN M IVR+KS+D  G    H            TS++EQV+VG+A
Sbjct  419   GVSISQVVIIISQIKVNCMTIVRLKSIDAHGG---HFGEFPFQYGAHSTSNVEQVRVGKA  475

Query  1073  IYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILR  894
             IY  GS+FNHSC+PN HAYFLSRTLY+RTT  V+AG +LELSYGPQVG WD KDR   L+
Sbjct  476   IYKAGSLFNHSCQPNVHAYFLSRTLYLRTTHGVAAGCQLELSYGPQVGLWDCKDRLNFLK  535

Query  893   DRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVE  714
             D Y+F CQC GCS++N+SD+ +NA+ C  P C G V +S +    +QK+ H +      +
Sbjct  536   DEYAFHCQCIGCSEVNVSDVVLNAFHCVNPNCSGAVLESRVLDCEQQKIKHFTITDRVDK  595

Query  713   NERISDVAHYAVHKADY-HLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDV  537
             N+ IS   +       Y H +PG+CL C  Y DLE++ A +S+A   I RLQDAI   ++
Sbjct  596   NDDISVCLNVFKQNGAYIHGQPGYCLKCGSYCDLESSQAAVSEALICIKRLQDAILLKEI  655

Query  536   PVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKL  357
                 +S+AL +   LR  LH +NK IAE ED++AQA CLVGE Q ++DHCKASI+ILEKL
Sbjct  656   SSITISDALISLQSLRLNLHAYNKLIAEAEDSIAQAFCLVGELQLSVDHCKASIQILEKL  715

Query  356   YDPNHIVIGNEL  321
             YD + IVI  EL
Sbjct  716   YDTDDIVIAYEL  727



>ref|XP_010318214.1| PREDICTED: N-lysine methyltransferase SMYD2 isoform X6 [Solanum 
lycopersicum]
Length=614

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/608 (59%), Positives = 456/608 (75%), Gaps = 18/608 (3%)
 Frame = -3

Query  1964  KRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRAD  1785
             +RQIE EL+I LD+ K       K+N+N+S+V   DEPD+  +QC+   TKGRGM    D
Sbjct  4     ERQIEAELKIALDKFKRIGIPGKKTNQNQSEVP--DEPDQVKLQCLLTTTKGRGMFCVDD  61

Query  1784  IPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGK  1605
             +   SLVHKEDPYAA+ILK CRET+CHFCFNELP  A+ C SCSIPLYCS  CQ  +G  
Sbjct  62    VSEASLVHKEDPYAAVILKKCRETHCHFCFNELPADAISCVSCSIPLYCSDWCQKQAGAP  121

Query  1604  EFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVV  1425
             +F ++    S    L D+L+ Y+S+ V  G S   T  IAEHRHECQG HWP +LPSEVV
Sbjct  122   KFDRSSNSFSDLEGLADDLKNYMSDVVLAGASTLDTGHIAEHRHECQGFHWPLILPSEVV  181

Query  1424  LAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAP  1245
             LAGR+LVK IEQ + +S  SNL+  LDL HN+V+LPP++KLEMHIYSIILL+CLQ+ Y  
Sbjct  182   LAGRILVKVIEQNRHASADSNLVGFLDLSHNYVKLPPESKLEMHIYSIILLHCLQHVYRT  241

Query  1244  KLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYL  1065
             +LP++G+++S+LVILLSQI+VNSMA+VRM++   KG + E  NALTS+LEQVKVGQA+Y+
Sbjct  242   ELPISGIMVSKLVILLSQIQVNSMAVVRMQAPKVKGPIYEPGNALTSNLEQVKVGQAVYV  301

Query  1064  VGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRY  885
              GS FNHSC+PN H YFLSRTL+++ T+ V AGSELELSYGPQVGQWD KDRQ++L DRY
Sbjct  302   AGSFFNHSCQPNIHTYFLSRTLHIQATEYVLAGSELELSYGPQVGQWDCKDRQRLLEDRY  361

Query  884   SFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL------PHV-SKQV  726
             SF+CQC GCS+LN+SDL INAYRC K  CLGV+ D T+ +  KQKL      P V SKQV
Sbjct  362   SFTCQCTGCSELNVSDLVINAYRCTKLNCLGVILDRTVTTCEKQKLKLLIDAPTVYSKQV  421

Query  725   EKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSI--------G  570
             EK++++ I++VA + V ++DY L+P HCL C+ YRDLE++CA IS+ E+           
Sbjct  422   EKLKDDNIAEVACH-VFESDYKLEPQHCLVCDSYRDLESSCAAISQTENCCKSSGTYLPN  480

Query  569   RLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDH  390
             RLQDAIASN+VP  +L +A+K +D+LR+  HP+NK IAEVEDN+AQA CLVGE QAA+DH
Sbjct  481   RLQDAIASNEVPTNILRDAVKYTDLLRTIFHPYNKIIAEVEDNLAQAFCLVGELQAAIDH  540

Query  389   CKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVI  210
             CKASI+ILEKLY  NHI IGNELIKL S+Q+  G+  A+ +      I SRY+GSHA  I
Sbjct  541   CKASIQILEKLYGANHIAIGNELIKLVSLQILVGDTAASGSISRITAILSRYYGSHADEI  600

Query  209   FPYLQRLQ  186
             +PYL+ L+
Sbjct  601   YPYLRHLK  608



>ref|XP_009412478.1| PREDICTED: N-lysine methyltransferase SMYD2-A isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=793

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/801 (47%), Positives = 514/801 (64%), Gaps = 35/801 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+L SL+P  L++ I  S P+ L  T S LL+F   LPQF QV++ELTDP++ALC K  
Sbjct  1     MERLTSLIPDELKRVIGRSAPENLTMTSSLLLDFLRPLPQFQQVIRELTDPDLALCRKSK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA   K +GN+CF  GDY +AL FY+ ALR AP NS + + NL A LYVNRAS +HK+G
Sbjct  61    EAALGSKQKGNECFMKGDYVEALSFYSHALRHAPANS-EMDVNLVATLYVNRASTMHKLG  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC++DC+RA++IF  Y KAW+RRGKANASL +++ A  DL+V++ ME + S K QI+
Sbjct  120   LLQECIRDCNRAISIFPAYVKAWYRRGKANASLKDYKHATHDLEVAVSMEDNPSRKSQIK  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESD-VTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              EL I+L +    +     SN  E + V  L +     +QCVS P KGRG+ S  DIP  
Sbjct  180   GELSIVLSESSSSNEIGMVSNNGEDEKVDSLAQSKALVLQCVSSPHKGRGLTSAHDIPPA  239

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGK  1593
             SLVH E+P AAI+LK+CRET+CHFCF+ELP   + C SC+IP+YCS  CQ     + FGK
Sbjct  240   SLVHHEEPLAAILLKSCRETHCHFCFDELPADILFCPSCTIPVYCSKNCQ----EQAFGK  295

Query  1592  TPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIA-----EHRHECQGVHWPAVLPSEV  1428
                 +S+ N L  +LEK++   +    +    EDI      EHRHEC G HW AVLP ++
Sbjct  296   HDTYLSKTN-LATDLEKHVMNAILANPTRSTGEDICSNHILEHRHECGGAHWSAVLPPDI  354

Query  1427  VLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYA  1248
             VLA R++V  IE+ K S    N L  LD  HN+ Q P  +KLE+H+Y+I+LL CL   Y 
Sbjct  355   VLAARLIVTSIEKCKASGTIFNPLDYLDFVHNYAQNPSVSKLELHVYAIVLLYCLHQYYN  414

Query  1247  PKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSL---------DEHVNALTSSLE  1095
                P++G  ++QL++++SQI+VNSMA++ MKS +   +          +EH+   T   +
Sbjct  415   SDFPLSGASVAQLILVISQIKVNSMAVIHMKSHNRDEAFGKCSKFFIFEEHI---TQDTK  471

Query  1094  QVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHK  915
             QVKV QAIY  GS+FNHSC+PN HAYFLSRTL+VR+ + V A   LELSYGPQ G+ D +
Sbjct  472   QVKVAQAIYSRGSLFNHSCQPNVHAYFLSRTLFVRSVEVVPAWCPLELSYGPQAGELDLQ  531

Query  914   DRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVS  735
              RQ++L ++YSF C+C  CS+LNLSDL +N++RC +P CLG V ++T    ++     VS
Sbjct  532   GRQKLLEEQYSFQCRCSSCSELNLSDLVMNSFRCVRPYCLGAVLEATHYKRLESNFLQVS  591

Query  734   KQVEKVE--------NERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKA  585
                   +         + ISDVA   +H+  A+ H+  GHC++C    DLE + A    +
Sbjct  592   NASGTFKLSLPLLSSKKDISDVARMLLHERGANSHIAAGHCMSCGSCCDLECSTAGSKSS  651

Query  584   ESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQ  405
              ++I RL+D++ S+ +P   +S  L +   LRS  HP++K +AE +DNVA+A   +GE +
Sbjct  652   LANIQRLKDSLDSDQIPDAFVSEMLSSLSHLRSVRHPYSKIVAEADDNVAEAFVRIGELK  711

Query  404   AAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFG  228
              A+ HC ASI+ILEKLY  NHIV+G+EL+KL SIQL  G+R A  S+      IF  Y+G
Sbjct  712   LAVQHCVASIEILEKLYGSNHIVMGHELMKLASIQLCTGDRTATLSSIDRVESIFLLYYG  771

Query  227   SHALVIFPYLQRLQQEAGCLA  165
             SH   IFP+L+ L+ EA  LA
Sbjct  772   SHVDRIFPHLKVLRTEAERLA  792



>ref|XP_010538897.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Tarenaya hassleriana]
Length=787

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/788 (47%), Positives = 507/788 (64%), Gaps = 30/788 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P+ LR+ +  ST + L ++ SSLL  F  LPQFH  V +L D +   CGKD 
Sbjct  1     MEKLKSLIPEDLRETVRRSTANDLHSSSSSLLRLFLGLPQFHHAVNDLADSDSGCCGKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA ++K RGN CF    + +AL FY++ALRLAP ++ D  +NL A L++NRA+ LH + 
Sbjct  61    DAALDLKRRGNHCFRSRKFHEALLFYSKALRLAPPDAIDGHRNLLASLFLNRANVLHNLD  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ E L+DC RAL I   YAKAW+RRGK N  LGN+E+A +D  VSL +E S+ GK+Q++
Sbjct  121   LLAESLRDCHRALRIDPFYAKAWYRRGKLNTVLGNYEEAFRDFTVSLSLESSVDGKKQLQ  180

Query  1949  DELRIILDQHKLKHS--SLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPI  1776
             DE +II DQ   + S  + Y+ + + S   +L  P    ++CVS   KGRGMVS  DI  
Sbjct  181   DECKIISDQRNKQASGHTAYRVSDSASSDYLLSVPSEIKLRCVSTEEKGRGMVSECDIQQ  240

Query  1775  GSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFG  1596
              ++VH E+PY+ +ILK+CRET+CHFC NELP  +VPC SCS+ +YCS  CQ  SGG    
Sbjct  241   STVVHVEEPYSVVILKSCRETHCHFCLNELPADSVPCSSCSVTVYCSELCQFQSGG----  296

Query  1595  KTPRKVSRHN--------ELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVL  1440
                  VSR +         LPD+L  +I    S+      TE I EH+HEC G +WPAVL
Sbjct  297   ----MVSRDDMDGHHVCQSLPDDLSDHIKGVTSVNNLFSGTECIREHQHECLGANWPAVL  352

Query  1439  PSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQ  1260
             PS+VVLAGR+LVK I Q K +   SNL   LDL H++ ++ P++K+  HI+S +LL CL 
Sbjct  353   PSDVVLAGRILVKLINQGKLAMDLSNLQENLDLSHSYSEMDPESKINFHIFSTVLLFCLN  412

Query  1259  NSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKS--LDTKGSLDEHV--NALTSSLEQ  1092
              S+   L + G+ ++Q +ILLSQI+VNS+A+V M+S  L  K +  E++       SLEQ
Sbjct  413   KSFCSDLSINGISVTQTIILLSQIKVNSIAVVCMRSAGLSFKSNPSENIPGKGQIQSLEQ  472

Query  1091  VKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKD  912
             ++VGQA+Y  GS+FNHSC+PN HAYFLSR L +RTT+ V  G  LELSYGP+VG WD KD
Sbjct  473   IRVGQALYKTGSLFNHSCKPNIHAYFLSRRLILRTTEFVPTGCPLELSYGPEVGMWDCKD  532

Query  911   RQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSK  732
             R + L+D Y F CQCRGCS +N+SD+ IN YRC  P C GVV DS +     ++L H S 
Sbjct  533   RIKFLQDEYFFRCQCRGCSWINISDIVINGYRCKDPNCTGVVLDSYVPGCEAKELKHFSS  592

Query  731   ----QVEKVENERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESSIG  570
                 Q  ++ N    +VA   V K  +   ++PG CL C    DLE +   + +A S + 
Sbjct  593   ASDIQASEMTNTDFGEVASLLVSKTRSSLQIEPGICLKCGFRCDLETSRMEVKRAWSYMR  652

Query  569   RLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDH  390
             RL++   +    V  LS+ L++  +LRS LH +NK IAE ED VAQA  L G+ + A  H
Sbjct  653   RLEELTDAEGANVSALSDYLRSLKVLRSFLHMYNKGIAEAEDKVAQACYLAGDLEGARKH  712

Query  389   CKASIKILEKLYDP-NHIVIGNELIKLGSIQLQRGNRDAASTTKS-TAEIFSRYFGSHAL  216
             C+ASIKILE+LY+  +HIVIGNEL+KL SIQ+  G+   AS ++     IF +Y+GSH+ 
Sbjct  713   CEASIKILERLYEEDDHIVIGNELVKLSSIQVALGDSSGASESRERVCRIFGKYYGSHSH  772

Query  215   VIFPYLQR  192
             ++F YL++
Sbjct  773   ILFSYLKQ  780



>ref|XP_010499889.1| PREDICTED: SET and MYND domain-containing protein 4-like [Camelina 
sativa]
Length=798

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/792 (46%), Positives = 499/792 (63%), Gaps = 22/792 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P+ LRQ +  S+ D L  T SSLL  F  LPQFHQ V EL DP++  CGK+ 
Sbjct  1     MEKLKSLIPEDLRQTVKSSSEDDLLTTTSSLLRLFMGLPQFHQAVIELADPDLGCCGKNE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               + ++K RGN  F   D+  AL FY++ALR+AP  + D +K+L A L++NRA+ LH +G
Sbjct  61    ETSLDLKRRGNLSFRSRDFHDALRFYSKALRVAPPEAIDGDKSLLASLFLNRANVLHNLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L  E L+DC RAL I   YAKAW+RRGK N  LGN++DA  D+ VS+  E SL+GK+Q++
Sbjct  121   LHKESLRDCHRALRIDPCYAKAWYRRGKLNTLLGNYKDAFHDITVSMSFESSLAGKKQLK  180

Query  1949  DELRIILD---QHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIP  1779
             +EL  I D   +   +H   + SN    D  +        ++CVS   KGRGMVS  DI 
Sbjct  181   NELNAIPDYQNKQTSEHDEYHPSNYASVD-HLPSVQSGVKLRCVSTKEKGRGMVSECDIE  239

Query  1778  IGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEF  1599
                ++H E+P++ +I K+CRET+CHFC NELP  AVPC SCSIP+YCS  CQ+ SGG   
Sbjct  240   QACMIHIEEPFSVVISKSCRETHCHFCLNELPADAVPCPSCSIPVYCSESCQIQSGGMLS  299

Query  1598  GKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLA  1419
                  K      LPD++ + I    S  +     E I EH+HE +G +WPAVLPS+ VLA
Sbjct  300   TNERDKHHIFQNLPDDIVEQIRGITSADIYYSENECIQEHQHEFRGANWPAVLPSDAVLA  359

Query  1418  GRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKL  1239
             GRV++KFI Q K ++   NL  +L+L H++  + P+TKLE+H+ SI+++ CL NS  P L
Sbjct  360   GRVIMKFINQAKAATDLCNLQEILELSHSYSMMNPETKLELHLLSIVIIWCLSNSSCPDL  419

Query  1238  PVTGviisqlvillsqIRVNSMAIVRMK----SLDTKGSLDEHVNALTSSLEQVKVGQAI  1071
              V    ++Q +ILLSQI+VNS+A+VRMK    S     S +        SLEQ++VGQA+
Sbjct  420   SVCEAAVTQTIILLSQIKVNSIAVVRMKSSGDSFKCIPSGNVSAKEQIQSLEQIRVGQAL  479

Query  1070  YLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRD  891
             Y  GS+FNHSC+PN H YFLSR L VRTT+ V  G  LELSYGP+VG+WD KDR + L +
Sbjct  480   YKTGSLFNHSCKPNIHLYFLSRGLVVRTTEFVPMGCPLELSYGPEVGKWDCKDRLRFLEE  539

Query  890   RYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV---------  738
              Y F C+CR CSQ+NLSDL IN Y C    C GVV DS +A+   +KL H          
Sbjct  540   EYFFHCRCRCCSQINLSDLVINGYCCVNTDCTGVVLDSIVATCESEKLNHFLTAPKSLDH  599

Query  737   -SKQVEKVENERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
              +K  EKV  + + +VA   + K     H++P  CL C    D+E + A ++KA + + R
Sbjct  600   HTKVWEKVHTD-VEEVASSLLSKRRGSLHIEPEICLKCGSRSDIENSHAAVNKAWNHLRR  658

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             + +   S    V +LS+ L++  +LR+ LH +NK IA+ ED VAQ   L  E   A  HC
Sbjct  659   VDELKNSGQANVSLLSDCLRSIAVLRTFLHMYNKDIADAEDKVAQVCYLAEELLDARQHC  718

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVI  210
             +ASIKIL++LY+  H+VIGNE++KL SIQL  G+   A  TTK  ++IF++Y+GSHA  +
Sbjct  719   EASIKILKRLYEEEHVVIGNEMVKLASIQLASGDSSGAWKTTKRLSQIFAKYYGSHAETL  778

Query  209   FPYLQRLQQEAG  174
             F YL  L+QEA 
Sbjct  779   FSYLPCLKQEAA  790



>ref|XP_010478762.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Camelina sativa]
Length=797

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/792 (46%), Positives = 500/792 (63%), Gaps = 22/792 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P+ L Q +  S+ D L  T SSLL  F  LPQFHQ V EL DP++  CGK+ 
Sbjct  1     MEKLKSLIPEDLLQTVKSSSDDDLLTTTSSLLRLFMGLPQFHQAVSELADPDLGCCGKNE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               + ++K RGN  F   D+  AL FY++ALR+AP  + D +K+L A L +NRA+ LH +G
Sbjct  61    ETSLDLKRRGNLSFRSRDFHDALRFYSKALRVAPPEAIDGDKSLLASLLLNRANVLHNLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ E L+DC RAL I   YAKAW+RRGK N  LGN++DA  D+ VS+ +E SL+GK+Q++
Sbjct  121   LLKESLRDCHRALRIDPCYAKAWYRRGKLNTLLGNYKDAFHDITVSMSLESSLAGKKQLQ  180

Query  1949  DELRIILDQHKLKHSSLYK----SNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADI  1782
             +E   I D ++ K +S Y     SN    D  +        ++CVS   KGRGMVS  DI
Sbjct  181   NERNAISD-YQNKQTSEYDECHLSNYAGED-HLPTVQTEVKLRCVSTKEKGRGMVSECDI  238

Query  1781  PIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKE  1602
              + S++H E+P++ +I K+CRET+CHFC NELP  AVPC SCSIP+YCS  CQ+ SGG  
Sbjct  239   ELASVIHIEEPFSVVISKSCRETHCHFCLNELPADAVPCPSCSIPVYCSESCQIQSGGML  298

Query  1601  FGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVL  1422
                   K      LPD++ ++I    S  +     E I EH+HEC+G +W AVL S+ VL
Sbjct  299   STNERDKHHVFQNLPDDIVEHIKGITSADIYYSENECIQEHQHECRGANWSAVLTSDAVL  358

Query  1421  AGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPK  1242
             AGRV++K I Q K ++  SNL  +L+L H++  + P+ KLE+H+ SI+L+ CL  S  P 
Sbjct  359   AGRVIMKLINQGKAATDLSNLQEILELSHSYSMMNPEIKLELHLISIVLIWCLSKSSCPD  418

Query  1241  LPVTGviisqlvillsqIRVNSMAIVRMK----SLDTKGSLDEHVNALTSSLEQVKVGQA  1074
             L V    ++Q +ILLSQI+VNS+A+VRMK    S     S +        SLEQ++VGQA
Sbjct  419   LSVCEAAVTQTIILLSQIKVNSIAVVRMKSSGDSFKCIPSGNVSAKEQIQSLEQIRVGQA  478

Query  1073  IYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILR  894
             +Y  GS+FNHSC+PN H YFLSR L V+TT+ V  G  LELSYGP+VG+WD KDR + L 
Sbjct  479   LYKTGSLFNHSCKPNIHLYFLSRGLVVQTTEFVPMGCPLELSYGPEVGKWDCKDRIRFLE  538

Query  893   DRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV--------  738
             + Y F C+CR CSQ+NLSDL IN Y C    C GVV DS +A+ V +KL H         
Sbjct  539   EEYFFHCRCRCCSQINLSDLVINGYCCVNTDCTGVVLDSNVATCVSEKLNHFLTAPKSLD  598

Query  737   -SKQVEKVENERISDVAH--YAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
                QV    +  + +VA   ++  +  +H++P  CL C    D+E + A ++KA + + R
Sbjct  599   HHTQVWDKVHTDVEEVASSLFSKRRGSFHIEPEICLKCGSRSDIENSHAAVNKAWNHLRR  658

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             + +   S    V +LS+ L++  +LR+ LH +NK IA+ ED VAQ   L  E   A  HC
Sbjct  659   VDELKNSGQANVSLLSDCLRSIAVLRNFLHMYNKDIADAEDKVAQVCYLAEELLDARKHC  718

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVI  210
             +ASIKIL++LYD  H+VIGNE++KL SIQL  G+   A  TTK  ++IFS+Y+GSHA  +
Sbjct  719   EASIKILKRLYDDEHVVIGNEMVKLASIQLASGDSSGAWKTTKRLSQIFSKYYGSHAETL  778

Query  209   FPYLQRLQQEAG  174
             F YL  L+QEA 
Sbjct  779   FSYLPCLKQEAA  790



>ref|XP_010538898.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Tarenaya hassleriana]
Length=762

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/782 (47%), Positives = 499/782 (64%), Gaps = 43/782 (5%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P+ LR+ +  ST + L ++ SSLL  F  LPQFH  V +L D +   CGKD 
Sbjct  1     MEKLKSLIPEDLRETVRRSTANDLHSSSSSLLRLFLGLPQFHHAVNDLADSDSGCCGKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA ++K RGN CF    + +AL FY++ALRLAP ++ D  +NL A L++NRA+ LH + 
Sbjct  61    DAALDLKRRGNHCFRSRKFHEALLFYSKALRLAPPDAIDGHRNLLASLFLNRANVLHNLD  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ E L+DC RAL I   YAKAW+RRGK N  LGN+E+A +D  VSL +E S+ GK+Q++
Sbjct  121   LLAESLRDCHRALRIDPFYAKAWYRRGKLNTVLGNYEEAFRDFTVSLSLESSVDGKKQLQ  180

Query  1949  DELRIILDQHKLKHS--SLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPI  1776
             DE +II DQ   + S  + Y+ + + S   +L  P    ++CVS   KGRGMVS  DI  
Sbjct  181   DECKIISDQRNKQASGHTAYRVSDSASSDYLLSVPSEIKLRCVSTEEKGRGMVSECDIQQ  240

Query  1775  GSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFG  1596
              ++VH E+PY+ +ILK+CRET+CHFC NELP  +VPC SCS+ +YCS  CQ  SGG    
Sbjct  241   STVVHVEEPYSVVILKSCRETHCHFCLNELPADSVPCSSCSVTVYCSELCQFQSGG----  296

Query  1595  KTPRKVSRHN--------ELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVL  1440
                  VSR +         LPD+L  +I    S+      TE I EH+HEC G +WPAVL
Sbjct  297   ----MVSRDDMDGHHVCQSLPDDLSDHIKGVTSVNNLFSGTECIREHQHECLGANWPAVL  352

Query  1439  PSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQ  1260
             PS+VVLAGR+LVK I Q K +   SNL   LDL H++ ++ P++K+  HI+S +LL CL 
Sbjct  353   PSDVVLAGRILVKLINQGKLAMDLSNLQENLDLSHSYSEMDPESKINFHIFSTVLLFCLN  412

Query  1259  NSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKS--LDTKGSLDEHV--NALTSSLEQ  1092
              S+   L + G+ ++Q +ILLSQI+VNS+A+V M+S  L  K +  E++       SLEQ
Sbjct  413   KSFCSDLSINGISVTQTIILLSQIKVNSIAVVCMRSAGLSFKSNPSENIPGKGQIQSLEQ  472

Query  1091  VKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKD  912
             ++VGQA+Y  GS+FNHSC+PN HAYFLSR L +RTT+ V  G  LELSYGP+VG WD KD
Sbjct  473   IRVGQALYKTGSLFNHSCKPNIHAYFLSRRLILRTTEFVPTGCPLELSYGPEVGMWDCKD  532

Query  911   RQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSK  732
             R + L+D Y F CQCRGCS +N+SD+ IN YRC  P C GVV DS +     ++L H S 
Sbjct  533   RIKFLQDEYFFRCQCRGCSWINISDIVINGYRCKDPNCTGVVLDSYVPGCEAKELKHFSS  592

Query  731   QVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAI  552
                                 +D  ++PG CL C    DLE +   + +A S + RL++  
Sbjct  593   -------------------ASDIQIEPGICLKCGFRCDLETSRMEVKRAWSYMRRLEELT  633

Query  551   ASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIK  372
              +    V  LS+ L++  +LRS LH +NK IAE ED VAQA  L G+ + A  HC+ASIK
Sbjct  634   DAEGANVSALSDYLRSLKVLRSFLHMYNKGIAEAEDKVAQACYLAGDLEGARKHCEASIK  693

Query  371   ILEKLYDP-NHIVIGNELIKLGSIQLQRGNRDAASTTKS-TAEIFSRYFGSHALVIFPYL  198
             ILE+LY+  +HIVIGNEL+KL SIQ+  G+   AS ++     IF +Y+GSH+ ++F YL
Sbjct  694   ILERLYEEDDHIVIGNELVKLSSIQVALGDSSGASESRERVCRIFGKYYGSHSHILFSYL  753

Query  197   QR  192
             ++
Sbjct  754   KQ  755



>ref|XP_010461168.1| PREDICTED: SET and MYND domain-containing protein 4-like [Camelina 
sativa]
Length=795

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/791 (46%), Positives = 496/791 (63%), Gaps = 22/791 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P  L + +  S+ D L  T SSLL  F  LPQFHQ V EL DP++  CGK+ 
Sbjct  1     MEKLKSLIPDDLLKTVKSSSDDDLLTTTSSLLRLFLGLPQFHQAVSELADPDLGCCGKNE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               + ++K RGN  F   D+  AL FY++ALR+AP +  D  K+L A L++NRA+ LH +G
Sbjct  61    ETSLDLKRRGNLSFRSRDFHDALRFYSKALRVAPPDGGD--KSLLASLFLNRANVLHNLG  118

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ E L+DC RAL I   YAKAW+RRGK N+ LGN++DA  D+ VS+ +E SL+GK+Q++
Sbjct  119   LLKESLRDCHRALRIDPCYAKAWYRRGKLNSLLGNYKDAFLDITVSMSLESSLAGKKQLQ  178

Query  1949  DELRII---LDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIP  1779
             +EL  I    ++   +H   + SN    D  +        + CVS   KGRGMVS  DI 
Sbjct  179   NELNAIPNYQNKQTSEHDEYHPSNYASVD-HLPSVQSGVKLHCVSTIEKGRGMVSECDIE  237

Query  1778  IGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEF  1599
               S++H E+P++ +I K+CRET+CHFC NELP  AVPC SCSIP+YCS  CQ+ SGG   
Sbjct  238   QASVIHIEEPFSVVISKSCRETHCHFCLNELPADAVPCPSCSIPVYCSESCQIQSGGMLS  297

Query  1598  GKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLA  1419
                  K      LPD++ ++I    S        E I EH+HEC+G +WPAVLPS+ VLA
Sbjct  298   TNERDKHHVFQNLPDDIVEHIKGITSADTYYSENECIQEHQHECRGANWPAVLPSDAVLA  357

Query  1418  GRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKL  1239
             GR+++K I Q K ++  SNL  +L+L H++  + P+TKLE+H+ SI+L+ CL  S  P L
Sbjct  358   GRLIMKLINQGKAATDLSNLQEILELSHSYSMMKPETKLELHLLSIVLILCLNKSSCPDL  417

Query  1238  PVTGviisqlvillsqIRVNSMAIVRMKS----LDTKGSLDEHVNALTSSLEQVKVGQAI  1071
              V    ++Q +ILLSQI+VNS+A+VRMKS         S +        SLEQ++VGQA+
Sbjct  418   SVCEAAVTQTIILLSQIKVNSIAVVRMKSSGDSFKCIPSGNVSAKEQIQSLEQIRVGQAL  477

Query  1070  YLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRD  891
             Y  GS+FNHSC+PN H YFLSR L VRTT+ V  G  LELSYGP+VG+WD KDR + L +
Sbjct  478   YKTGSLFNHSCKPNIHLYFLSRGLVVRTTEFVPMGCPLELSYGPEVGKWDCKDRIRFLEE  537

Query  890   RYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSK-------  732
              Y F C+CR CSQ+N+SDL IN Y C    C GVV DS +A+   +KL H          
Sbjct  538   EYFFHCRCRCCSQINISDLVINGYCCVNTNCTGVVLDSNVATCESEKLNHFLTAPKSLDH  597

Query  731   --QVEKVENERISDVAHYAVHKA--DYHLKPGHCLNCNLYRDLEAACATISKAESSIGRL  564
               QV +  +  + +VA   + K     H++P  CL C     +E + A ++KA + + R+
Sbjct  598   HVQVWEKMHTDVEEVASSLLSKRRDSLHIEPEICLKCGSRSAIENSHAAVNKAWNHLRRV  657

Query  563   QDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCK  384
              + I S    V V+S+ L++  +LR+ LH +NK IA+ ED VAQ   L  E   A  HC+
Sbjct  658   DELINSGQANVSVVSDCLRSIAVLRTFLHMYNKDIADAEDKVAQVCYLAEELVDARKHCE  717

Query  383   ASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVIF  207
             ASIKIL++LY+  H+VIGNE++KL SIQL  G+   A  TTK  ++IFS+Y+GSHA   F
Sbjct  718   ASIKILKRLYEEEHVVIGNEMVKLASIQLASGDSSGAWKTTKRLSQIFSKYYGSHAETPF  777

Query  206   PYLQRLQQEAG  174
              YL  L+QEA 
Sbjct  778   SYLPCLKQEAA  788



>ref|NP_174606.2| carboxylate clamp-tetratricopeptide repeat protein [Arabidopsis 
thaliana]
 gb|AEE31589.1| carboxylate clamp-tetratricopeptide repeat protein [Arabidopsis 
thaliana]
Length=798

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/795 (46%), Positives = 508/795 (64%), Gaps = 28/795 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P+ L Q +  S+ D L +T SSLL  F  LPQFHQ V EL +PE+  CGK+ 
Sbjct  1     MEKLKSLIPEDLLQTVKSSSVDDLLSTSSSLLRLFLGLPQFHQAVSELANPELGCCGKNE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               + ++K RGN CF   D+ +AL  Y++ALR+AP ++ D +K+L A L++NRA+ LH +G
Sbjct  61    ETSLDLKRRGNHCFRSRDFDEALRLYSKALRVAPLDAIDGDKSLLASLFLNRANVLHNLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ E L+DC RAL I   YAKAW+RRGK N  LGN++DA +D+ VS+ +E SL GK+Q++
Sbjct  121   LLKESLRDCHRALRIDPYYAKAWYRRGKLNTLLGNYKDAFRDITVSMSLESSLVGKKQLQ  180

Query  1949  DELRIILD---QHKLKHSSLYKSNRNESD----VTMLDEPDRANMQCVSLPTKGRGMVSR  1791
             +EL+ I D      L+H     SN    D    V M        ++CVS   KGRGMVS 
Sbjct  181   NELKAIPDYQNNQTLEHDEYRPSNDAGVDHLPSVQM-----EVKLRCVSTKEKGRGMVSE  235

Query  1790  ADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSG  1611
              DI   S++H E+P++ +I K+CRET+CHFC NELP   VPC SCSIP+YCS  CQ+ SG
Sbjct  236   CDIEEASVIHVEEPFSVVISKSCRETHCHFCLNELPADTVPCPSCSIPVYCSESCQIQSG  295

Query  1610  GKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSE  1431
             G        K     +LPD++ ++I    S  +    T+ I EH+HEC+G +WPAVLPS+
Sbjct  296   GMLSTNEMDKHHIFQKLPDDIVEHIKGVTSADIYYFATDLIQEHQHECRGANWPAVLPSD  355

Query  1430  VVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSY  1251
              VLAGR+++K I Q K ++  SNL  +L+L H + ++ P+ KLE+H+ SI+L+ CL  S 
Sbjct  356   AVLAGRIIMKLINQGKAATDLSNLQEILELSHTYSKMNPENKLELHLLSIVLIWCLSKSS  415

Query  1250  APKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALT----SSLEQVKV  1083
              P L V    ++Q +ILLSQI+VNS+A+ RMKS           N  T     SLEQ++V
Sbjct  416   CPNLSVCEASVTQTIILLSQIKVNSIAVARMKSSGDSFKCLPSGNISTKEPIQSLEQIRV  475

Query  1082  GQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQ  903
             GQA+Y  GS+FNHSC+PN H YFLSR L ++TT+ V  G  LELSYGP+VG+WD K+R +
Sbjct  476   GQALYKTGSLFNHSCKPNIHLYFLSRGLIMQTTEFVPTGCPLELSYGPEVGKWDCKNRIR  535

Query  902   ILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH------  741
              L + Y F C+CRGC+Q+N+SDL IN Y C    C GVV DS +A+   +KL H      
Sbjct  536   FLEEEYFFHCRCRGCAQINISDLVINGYGCVNTNCTGVVLDSNVATCESEKLNHFFTAPR  595

Query  740   -VSKQVEKVEN--ERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESS  576
              V +QV+  E     + +VA   + K     H++P  CL C    D+E + A ++KA + 
Sbjct  596   NVDQQVQMREKVYADVGEVASSLLSKPSGSLHIEPEICLKCGSRCDIENSHAEVNKAWNH  655

Query  575   IGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAM  396
             + R+++ + S      VLS+  ++  +LR+ LH +NK IA+ ED VAQA  L GE   A 
Sbjct  656   MRRVEELMNSGRANYSVLSDCSRSIAVLRTFLHMYNKDIADAEDKVAQACYLAGELVDAR  715

Query  395   DHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHA  219
              HC+ASIKIL++LY+  H+VIGNE++KL SIQL  G+   A  TTK +++IFS+Y+GSHA
Sbjct  716   KHCEASIKILKRLYEDEHVVIGNEMVKLASIQLASGDSSGAWDTTKRSSQIFSKYYGSHA  775

Query  218   LVIFPYLQRLQQEAG  174
               +F YL  L+QE  
Sbjct  776   ETLFSYLPCLKQETA  790



>ref|XP_009413202.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=747

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/792 (45%), Positives = 487/792 (61%), Gaps = 63/792 (8%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+L SL+P  L++ I  S P+ L  T S LL+F   LPQF QV++ELTDP++ALC K  
Sbjct  1     MERLTSLIPDELKRVIGRSAPENLTMTSSLLLDFLRPLPQFQQVIRELTDPDLALCRKSK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA   K +GN+CF  GDY +AL FY+ ALR AP NS + + NL A LYVNRAS +HK+G
Sbjct  61    EAALGSKQKGNECFMKGDYVEALSFYSHALRHAPANS-EMDVNLVATLYVNRASTMHKLG  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC++DC+RA++IF  Y KAW+RRGKANASL +++ A  DL+V++ ME + S K QI+
Sbjct  120   LLQECIRDCNRAISIFPAYVKAWYRRGKANASLKDYKHATHDLEVAVSMEDNPSRKSQIK  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESD-VTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              EL I+L +    +     SN  E + V  L +     +QCVS P KGRG+ S  DIP  
Sbjct  180   GELSIVLSESSSSNEIGMVSNNGEDEKVDSLAQSKALVLQCVSSPHKGRGLTSAHDIPPA  239

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGK  1593
             SLVH E+P AAI+LK+CRET+CHFCF+ELP   + C SC+IP+YCS  CQ     + FGK
Sbjct  240   SLVHHEEPLAAILLKSCRETHCHFCFDELPADILFCPSCTIPVYCSKNCQ----EQAFGK  295

Query  1592  TPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIA-----EHRHECQGVHWPAVLPSEV  1428
                 +S+ N L  +LEK++   +    +    EDI      EHRHEC G HW AVLP ++
Sbjct  296   HDTYLSKTN-LATDLEKHVMNAILANPTRSTGEDICSNHILEHRHECGGAHWSAVLPPDI  354

Query  1427  VLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYA  1248
             VLA R++V  IE+ K S    N L  LD  HN+ Q P  +KLE+H+Y+I+LL CL   Y 
Sbjct  355   VLAARLIVTSIEKCKASGTIFNPLDYLDFVHNYAQNPSVSKLELHVYAIVLLYCLHQYYN  414

Query  1247  PKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIY  1068
                P++G                                        +S+ QVKV QAIY
Sbjct  415   SDFPLSG----------------------------------------ASVAQVKVAQAIY  434

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
               GS+FNHSC+PN HAYFLSRTL+VR+ + V A   LELSYGPQ G+ D + RQ++L ++
Sbjct  435   SRGSLFNHSCQPNVHAYFLSRTLFVRSVEVVPAWCPLELSYGPQAGELDLQGRQKLLEEQ  494

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVE--  714
             YSF C+C  CS+LNLSDL +N++RC +P CLG V ++T    ++     VS      +  
Sbjct  495   YSFQCRCSSCSELNLSDLVMNSFRCVRPYCLGAVLEATHYKRLESNFLQVSNASGTFKLS  554

Query  713   ------NERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQD  558
                    + ISDVA   +H+  A+ H+  GHC++C    DLE + A    + ++I RL+D
Sbjct  555   LPLLSSKKDISDVARMLLHERGANSHIAAGHCMSCGSCCDLECSTAGSKSSLANIQRLKD  614

Query  557   AIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKAS  378
             ++ S+ +P   +S  L +   LRS  HP++K +AE +DNVA+A   +GE + A+ HC AS
Sbjct  615   SLDSDQIPDAFVSEMLSSLSHLRSVRHPYSKIVAEADDNVAEAFVRIGELKLAVQHCVAS  674

Query  377   IKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVIFPY  201
             I+ILEKLY  NHIV+G+EL+KL SIQL  G+R A  S+      IF  Y+GSH   IFP+
Sbjct  675   IEILEKLYGSNHIVMGHELMKLASIQLCTGDRTATLSSIDRVESIFLLYYGSHVDRIFPH  734

Query  200   LQRLQQEAGCLA  165
             L+ L+ EA  LA
Sbjct  735   LKVLRTEAERLA  746



>ref|XP_006480311.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Citrus sinensis]
Length=653

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/656 (52%), Positives = 451/656 (69%), Gaps = 16/656 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSLVP  L+Q ++ STPD LP T SSLL+FF  L QFHQ+V++L   E  LC K+ 
Sbjct  1     MEKLKSLVPNNLKQMVAHSTPDDLPLTSSSLLDFFLNLQQFHQIVRDLAGQESGLCAKNI  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              +A E+K +GNQ +  GDY  AL  YT+ALR+AP ++ND ++NL A LYVNRAS L K  
Sbjct  61    DSALELKQKGNQYYLSGDYSHALSCYTKALRVAPMDANDKDRNLVATLYVNRASVLQKRD  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
              +VECLQDC+RA+ I  +YAKAW+RRGK N SL N +DA+ DL ++   E SL+GK+QIE
Sbjct  121   HLVECLQDCNRAVQICPSYAKAWYRRGKVNVSLENHDDAVHDLTIAKNRESSLAGKKQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+IILDQ     + + +  +N   V+  DE  +  +QCV+ P KGRG+ S+ DIP GS
Sbjct  181   SELKIILDQSNRTSNKVVQHTKNNLRVS--DESVQVQLQCVTTPDKGRGITSQYDIPEGS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA  I K+CRET+CH+C NELP  A+PC SCSIPLYCS +C+  +GG+ F   
Sbjct  239   LVHSEEPYAVTISKHCRETHCHYCLNELPADAIPCTSCSIPLYCSRRCRGQAGGQVFKNC  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
             P + + ++ + D LE+YIS+        P  E I EH+HEC+GVHWP +LPS+VVLAGRV
Sbjct  299   PMERNINDSVFDNLEEYISQITLDNDFYPEDEHIFEHKHECKGVHWPVILPSDVVLAGRV  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK +++   S    NLL  L+L HN+ Q+  ++KLE HIY+I+LL CLQ+SY  +LP+ 
Sbjct  359   LVKSVQKNGVSMDVPNLLGKLELSHNYSQVSSESKLESHIYAIVLLYCLQHSYGFELPIN  418

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMF  1050
             G  +SQ+VIL+SQIRVNS+AIVRM S +  G  D   +  T ++EQV+VG AIY  GS+F
Sbjct  419   GASVSQVVILISQIRVNSLAIVRMDS-NNYGQSDHVSSGSTCTVEQVRVGLAIYTAGSLF  477

Query  1049  NHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQ  870
             NHSC PN HAYFLSRTL +RTT+ V +G  LELSYGPQVGQWD KDR + L D YSF CQ
Sbjct  478   NHSCLPNIHAYFLSRTLMIRTTEFVPSGYPLELSYGPQVGQWDCKDRLKFLEDEYSFRCQ  537

Query  869   CRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQK---LPHVSK--------QVE  723
             C GCS+LN SDL INA+ C  P C GVV D+++ +  KQK   LP V +        QV 
Sbjct  538   CSGCSELNTSDLVINAFCCVDPNCPGVVLDNSILNCEKQKRKHLPAVPQCSSSVPHLQVG  597

Query  722   KVENERISDVAHYAVHKADYHLK--PGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
             K+ ++ I  VA+  + + +   +  PG+CL C   RDLE++ AT+ +A   I R+Q
Sbjct  598   KLSSDYIGLVAYLLLEENNRTSRYGPGYCLKCGSDRDLESSYATVDEAWIYIRRMQ  653



>ref|XP_006415091.1| hypothetical protein EUTSA_v10006832mg [Eutrema salsugineum]
 gb|ESQ33444.1| hypothetical protein EUTSA_v10006832mg [Eutrema salsugineum]
Length=798

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/789 (46%), Positives = 508/789 (64%), Gaps = 18/789 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEI-SESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKD  2313
             MEKLKSL+P+ L Q + S S  D L ++ SSLL  F  LPQFH+VV EL+DP +  CGK+
Sbjct  1     MEKLKSLIPEDLLQTVRSSSVDDLLSSSSSSLLRLFLGLPQFHRVVSELSDPGLGCCGKN  60

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
                + ++K RGN CF   D+  AL FY++ALR+AP ++ D +K+L A L++NRA+ LH +
Sbjct  61    EETSLDLKRRGNLCFRSHDFDDALRFYSKALRVAPPHAIDGDKSLLASLFLNRANVLHNL  120

Query  2132  GLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
             GL+ E L+DC RAL I   YAKAW+RRGK N  LGN++DA  D+ VS+ +E S  G +Q+
Sbjct  121   GLVEESLRDCHRALRIDPYYAKAWYRRGKLNTVLGNYKDASLDITVSMSLESSPVGLKQL  180

Query  1952  EDELRII-LDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPI  1776
             ++EL+ I ++    K+   Y  + N     +        ++CVS   KGRGMVS  DI  
Sbjct  181   QNELKAIPVNNKTSKNHDEYHPSSNAGVDYLPRVQSEVKLRCVSTKEKGRGMVSECDIEQ  240

Query  1775  GSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFG  1596
              S++H E+P++ +I KNCRET+CHFC NELP  +VPC SCSIP+YCS  CQ+ SGG    
Sbjct  241   ASVIHVEEPFSVVISKNCRETHCHFCLNELPDDSVPCPSCSIPVYCSESCQIRSGGMLST  300

Query  1595  KTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAG  1416
                 K      LPD++ ++I+   S+      TE I EH+HEC+G +W AVLPS+ VLAG
Sbjct  301   NKMDKHHNFQNLPDDIVEHITGVTSVDKYYSETESIQEHQHECRGANWSAVLPSDAVLAG  360

Query  1415  RVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLP  1236
             RV++K I Q K +   SNL  +L+L H++ ++ P++KLE+H+ SI+L+ CL  S  P L 
Sbjct  361   RVIMKLINQGKATMDLSNLQEILELSHSYSEMSPESKLELHLLSIVLIWCLSKSCCPDLL  420

Query  1235  VTGviisqlvillsqIRVNSMAIVRMK----SLDTKGSLDEHVNALTSSLEQVKVGQAIY  1068
             +    ++Q +ILLSQI+VNS+A+VRMK    S     S +        SLEQ++VGQAIY
Sbjct  421   ICEASVTQTIILLSQIKVNSIAVVRMKSSGDSFQCIPSGNVSAKEPIQSLEQIRVGQAIY  480

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
               GS+FNHSC+PN H YFLSR L +RTT+ V  G  LELSYGP+VG+WD KDR + L + 
Sbjct  481   KSGSLFNHSCKPNIHLYFLSRGLVMRTTEFVPMGCPLELSYGPEVGKWDCKDRIRFLEEE  540

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL------PHVSKQV  726
             Y F C+CRGCSQ+N+SDL IN Y C    C GVV DS +A+   +KL      P    + 
Sbjct  541   YFFHCRCRGCSQINISDLVINGYCCVNTNCTGVVLDSKVATCESEKLNLFLAAPKSLDRH  600

Query  725   EKVENERISDVAHYAVH-----KADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
              +V  +  +DV   A       +  +H++P  CL C    D+E +   ++KA + + R+ 
Sbjct  601   FQVSEKVYADVGEVASSLLTKPRGSFHIEPEICLKCGSRCDVEKSHVEVNKAWNHLRRVD  660

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKA  381
             + + S    V +LS+ L++  +LR++LH +NK IA+ ED VAQA  L GE + A +HC+A
Sbjct  661   ELMNSGHANVSMLSDCLRSIAVLRTSLHVYNKDIADAEDKVAQACYLAGELRGAREHCEA  720

Query  380   SIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVIFP  204
             SIKIL++LY+  H+VIGNE++KL SIQL  G+  AA  TTK  ++IFS+Y+GSHA  +F 
Sbjct  721   SIKILKRLYEDEHVVIGNEMVKLASIQLASGDSSAAWDTTKILSQIFSKYYGSHAQTLFC  780

Query  203   YLQRLQQEA  177
             YL   +QEA
Sbjct  781   YLPCFKQEA  789



>ref|XP_003574165.1| PREDICTED: SET and MYND domain-containing protein 4 [Brachypodium 
distachyon]
Length=791

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/803 (45%), Positives = 509/803 (63%), Gaps = 52/803 (6%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  +R+ + E T   LP+T S LL+FF  +P FHQV+ ELTDPE+ALC KD 
Sbjct  1     MERLKSAVPADIRRAVGEGTARDLPSTTSLLLDFFDGVPLFHQVISELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K RGN CFS  ++ +AL FY+QALR  P +S+   + L   LYVNRAS +HK+G
Sbjct  61    GRAVELKGRGNACFSKREFEQALGFYSQALRYVPISSDGNYEILVPTLYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ +CL+DC+RA+++ S YAKAW+RRG  NASL  +  AI DLKV+L MEV+ SGK  IE
Sbjct  121   LLKQCLRDCNRAISVSSNYAKAWYRRGMVNASLKKYSSAIHDLKVALSMEVTSSGKSNIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESD-----VTMLDEPDRANMQCVSLPTKGRGMVSRAD  1785
              EL++IL    LKH ++ +  R+ SD     +    EP +  ++C S P KGRGM+S   
Sbjct  181   QELKLIL----LKHRNVNEVGRSSSDCQDAGLPHTAEPHKVVLECASTPNKGRGMMSLNV  236

Query  1784  IPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGK  1605
             I   SL+H EDP AAII+K+CRET+CH+CF+E P   V C  C+IP+YCS +CQ  + G 
Sbjct  237   ISPASLIHVEDPLAAIIIKSCRETHCHYCFSEAPADVVFCPLCTIPVYCSKECQEQAVG-  295

Query  1604  EFGKTPRKVSRHNELPDELEK-YISECVSIGVSGPR-----TEDIAEHRHECQGVHWPAV  1443
                     +S + +   E    ++ +   +G++  R     ++ IAEH HEC G HW AV
Sbjct  296   -------DISWNQDTSLEFNSHHLVDNAKLGLTSTRCKTSNSKQIAEHMHECGGAHWAAV  348

Query  1442  LPSEVVLAGRVLVKFIEQQ---KDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILL  1272
             LP+++VLAGRV+ ++I+++     SS  S     LDL H++    P +KLE HIY+I+LL
Sbjct  349   LPADIVLAGRVMAQYIDKRLLTGKSSAISG--PNLDLVHHYDIDSPTSKLESHIYAIVLL  406

Query  1271  NCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEH------VNAL  1110
              CLQ  Y   L      +SQLV+L+ QI+VNS+AIV MKS+D    L E        +A+
Sbjct  407   LCLQKYYRSDLSWREESLSQLVLLICQIKVNSIAIVHMKSVDGGQELTESKGYSTASDAV  466

Query  1109  TSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVG  930
               S+EQ++V QAIY+ GS+FNHSCRPN H YF SRTL++R+T+ + +GS LELSYGPQ G
Sbjct  467   MCSVEQIRVAQAIYMSGSLFNHSCRPNVHTYFHSRTLFLRSTEYIESGSPLELSYGPQAG  526

Query  929   QWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTL-------  771
             + D  +RQ+ L++ Y FSC+C  CS+LNLSDL I+++ C +  CLG V +ST        
Sbjct  527   EMDLLERQKSLQENYKFSCRCSSCSELNLSDLVIDSFCCPRSFCLGAVSESTCYRSEENF  586

Query  770   -------ASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLE  612
                    ++  K  LP VSK  E +  E++  +  +    AD  + PG+C++C    DL 
Sbjct  587   VHVSLNGSAVCKLSLPDVSKVDEDM--EKVGKL-FFRNDDADLKIDPGYCMSCRSQLDLS  643

Query  611   AACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQ  432
             +  AT+ +A S I R ++ I  +DV   +++NAL++ + ++   HP++K +A+ ED +A+
Sbjct  644   SVVATLDRAASKINRFKELIVIDDVSEVLITNALQSLEQIKKLRHPYSKALAQAEDKIAE  703

Query  431   AMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTA  252
             A   VG+ + A  HC+ASIKILEKLY P HI I +ELIKL SI+L  G++  A+ T + A
Sbjct  704   AFAKVGDQEQARKHCEASIKILEKLYHPKHIAIAHELIKLISIKLCMGDKAGAAATVTRA  763

Query  251   E-IFSRYFGSHALVIFPYLQRLQ  186
             E IF  Y+G     + PY+  L+
Sbjct  764   EAIFLLYYGPDVQRVLPYIDALK  786



>ref|XP_004502795.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X3 [Cicer arietinum]
Length=691

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/696 (49%), Positives = 461/696 (66%), Gaps = 22/696 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             M+ LK+ VP +LR+ I  ST D LP TCSSL  FF +   F ++V +L+D    LCGK+ 
Sbjct  1     MDILKAAVPNSLRKVIGNSTLDTLPDTCSSLHNFFLKFQPFCEIVTQLSDSSYGLCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A + K  GNQCF   DY KAL +YTQALR AP N    E NL A LY NRA+ L+KM 
Sbjct  61    DDALKYKHLGNQCFVEADYVKALDYYTQALRKAP-NDGAIENNLFATLYANRATVLYKMS  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L +ECL+DC+RAL I  +YAKAW+RRGKAN SLGN++DAI DL V+  +E +  GKRQIE
Sbjct  120   LFIECLRDCNRALQICPSYAKAWYRRGKANVSLGNYKDAICDLNVAKIVETATGGKRQIE  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL+IILDQ K   +++ +    E+++  + E     +Q +S+P KGRGMVS  D+  GS
Sbjct  180   SELKIILDQSK-STNTVEEPQHKENNLNTVGEVPHIKLQSISMPDKGRGMVSSCDVSPGS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYA IILK CRET+CH+C N+LP   VPC SCSIP YCS QCQ+ + G+ +  +
Sbjct  239   LVHAEEPYATIILKQCRETHCHYCLNDLPADRVPCISCSIPWYCSRQCQIRASGEMYLIS  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                      LP  L +Y +E V       + +D+ EH+HEC GVHWPAVLP E+VLAGR+
Sbjct  299   AEASYILKNLPGVLGEYAAEVVECSYRELKVDDVTEHQHECNGVHWPAVLPPEIVLAGRI  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNS------YA  1248
             L KF  +   S G ++ +  L+L H +  +P ++KL+ HIY+I+LL CL+ S      Y 
Sbjct  359   LAKFFSKSS-SDGITSFVENLELSHCYEHMPFESKLDSHIYAIVLLYCLKFSNEFKFSYE  417

Query  1247  PKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNA-------LTSSLEQV  1089
                 + G+ ISQ+VI++SQI+VN M +VR+KS+DT G  D+           LT+ +EQV
Sbjct  418   RMSSINGISISQVVIVISQIKVNCMTVVRLKSVDTLGLSDQSGGFPIYSSAHLTNKVEQV  477

Query  1088  KVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDR  909
             +VG+AIY  GS+FNHSC+PN HAYFLSRTLY+RTT+ ++AG +LELSYGPQVG WD KDR
Sbjct  478   RVGKAIYKAGSLFNHSCKPNVHAYFLSRTLYLRTTNVIAAGCQLELSYGPQVGLWDCKDR  537

Query  908   QQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH--VS  735
             +  L+D Y+F CQC GCS++NLSD+ +NA+ C  P C G V +S +    KQK+ H  +S
Sbjct  538   RNFLKDEYAFHCQCTGCSEVNLSDIVLNAFHCVDPNCSGAVLESRVLECEKQKIEHFLIS  597

Query  734   KQVEKVENERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
              +V K  N+ I +V  +  ++ D   H++PG CL C  Y DLE++ AT+ KA   I RLQ
Sbjct  598   DKVNK--NDDIYEVCLHVFNQNDATIHIQPGLCLKCGSYCDLESSRATVDKALICIKRLQ  655

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAE  453
             DAI S ++     S+AL++  +L+S LH +NK IAE
Sbjct  656   DAILSKEISNTCTSDALRSLHLLKSNLHAYNKLIAE  691



>ref|XP_006306798.1| hypothetical protein CARUB_v10008336mg [Capsella rubella]
 gb|EOA39696.1| hypothetical protein CARUB_v10008336mg [Capsella rubella]
Length=797

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/792 (46%), Positives = 504/792 (64%), Gaps = 22/792 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P+ L Q +  S+ D LP++ SSLL  F  LPQFHQ V ELTDP++  CGK+ 
Sbjct  1     MEKLKSLIPEDLLQTVKSSSVDDLPSSSSSLLRLFLGLPQFHQAVSELTDPDLGCCGKNE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               + ++K RGN  F   D+  AL FY++ALR+AP ++ D +K+L A L++NRA+ LH +G
Sbjct  61    ETSLDLKRRGNLSFRSRDFHDALRFYSKALRVAPPDAIDGDKSLLASLFLNRANVLHNLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L  E L+DC RAL I   YAKAW+RRGK N  LGN++DA  D+ VS+ +E SL+GK+Q++
Sbjct  121   LYKESLRDCHRALRIDPCYAKAWYRRGKLNTLLGNYKDAFHDITVSMSLESSLAGKKQLQ  180

Query  1949  DELRIILDQHKLK---HSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIP  1779
             +EL+ I +    +   H   + SN    D  +     +  ++CVS   KGRGMVS  DI 
Sbjct  181   NELKAIPEYQNTQTSEHDDCHPSNYAGGD-HLPSVQTKVKLRCVSTKDKGRGMVSDCDIE  239

Query  1778  IGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEF  1599
               S++H E+P++ +I K+CRET+CHFC NELP  AVPC SCS  +YCS  CQ+ SG    
Sbjct  240   QESVIHIEEPFSVVISKSCRETHCHFCLNELPADAVPCPSCSRSVYCSESCQIQSGEMML  299

Query  1598  GKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLA  1419
                  K    + LPD++ ++I       V     E I EH+HEC+G +WPAVLPS+ VLA
Sbjct  300   TSERDKHHIFHNLPDDIVEHIKGITPADVYYSENECIQEHQHECRGANWPAVLPSDAVLA  359

Query  1418  GRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKL  1239
             GRV++K I Q K     SNL  +L+L H++  + P++KLEMH+ SI+L+ CL  S  P L
Sbjct  360   GRVIMKLINQGKAVMDLSNLQEILELSHSYSMMNPESKLEMHLLSIVLIWCLSKSSCPDL  419

Query  1238  PVTGviisqlvillsqIRVNSMAIVRMKS----LDTKGSLDEHVNALTSSLEQVKVGQAI  1071
              V    ++Q +ILL+QI+VNS+A+VRMKS    L    S +        SLEQ++VGQA+
Sbjct  420   SVCEAAVTQTIILLAQIKVNSIAVVRMKSSGDFLKCIPSGNVSAKEQIQSLEQIRVGQAL  479

Query  1070  YLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRD  891
             Y  GS+FNHSC+PN H YFLSR L VRTT+ V  GS LELSYGP+VG+WD K+R + L +
Sbjct  480   YKTGSLFNHSCKPNIHLYFLSRGLVVRTTEFVPLGSPLELSYGPEVGKWDCKNRIRFLEE  539

Query  890   RYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQK----------LPH  741
              Y F C+CR CSQ+N+SDL IN Y C    C GVV DS +A+    K          L H
Sbjct  540   EYFFHCRCRCCSQINISDLVINGYCCVNTNCTGVVLDSNVATCESSKLNNFLTAPKSLDH  599

Query  740   VSKQVEKVENERISDVAHYAV--HKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
               K  EKV  + + +VA   +  H+   H++P  CL C    D++ + A ++KA + + R
Sbjct  600   HIKVWEKVHTD-VGEVASSLLSKHRDSLHIEPDICLKCGSRCDVKNSHAAVNKAWNHLRR  658

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             + + I S    V V+S+ L++  +LR+ LH +NK IA+ ED VAQ   L  E   A  HC
Sbjct  659   VDELINSGQANVSVISDCLRSIAVLRTFLHMYNKDIADAEDKVAQVCYLAEELLDARKHC  718

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVI  210
             +ASIKIL++LY+  H+VIGNE++KL SIQL  G+   A +TTK  ++IFS+Y+GSHA  +
Sbjct  719   EASIKILKRLYEDEHVVIGNEMVKLASIQLASGDSSGAWNTTKKFSKIFSKYYGSHAETL  778

Query  209   FPYLQRLQQEAG  174
             F YL  L+QEA 
Sbjct  779   FSYLPCLKQEAA  790



>emb|CDY26924.1| BnaA05g17880D [Brassica napus]
Length=786

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/794 (46%), Positives = 506/794 (64%), Gaps = 35/794 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEI--SESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGK  2316
             ME LKSL+P+ L Q +  S S+ D L ++ SSLL F   LPQFHQ V EL DP++  CGK
Sbjct  1     METLKSLIPEHLLQTVKSSSSSVDDLLSSSSSLLRFLLGLPQFHQAVSELADPDLGCCGK  60

Query  2315  DHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHK  2136
                ++ ++K RGN CF    +  AL FY++ALR+A  N+      L A L++NRA+ALH 
Sbjct  61    SQESSLDLKRRGNLCFRSRSFDDALRFYSKALRVARDNT------LLASLFLNRANALHN  114

Query  2135  MGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQ  1956
             +GL+ E L+DC RAL I   YAKAWFRRGK N  LGN++DA +D+ VS+ +E S +GK+Q
Sbjct  115   LGLLQESLRDCHRALRIDPFYAKAWFRRGKLNTLLGNYKDAFRDITVSISLESSPAGKKQ  174

Query  1955  IEDELRIILD-QHKLKHSSLYKSNRNESDVTMLDEPD---RANMQCVSLPTKGRGMVSRA  1788
             +++EL  I D Q+K       +++ N       D P+      ++CVS   KGRGMVS +
Sbjct  175   LQNELLAIPDFQNK-------QTSENTLCYATADLPNVQSEVKLRCVSTKEKGRGMVSES  227

Query  1787  DIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGG  1608
             DI   S++H E+P+  +I K+CRET+CHFC NELP  +VPC SCS+P+YCS  CQ+ SGG
Sbjct  228   DIEQPSVIHVEEPFCVVISKSCRETHCHFCLNELPADSVPCPSCSVPVYCSESCQIQSGG  287

Query  1607  KEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEV  1428
                     K S    LPD++ ++I    S       TE + EH+HEC+G +WPAVLPS+ 
Sbjct  288   TLSTNEMVKNSTFQNLPDDIVEHIKGVTSAVRYYSETECVQEHQHECRGANWPAVLPSDA  347

Query  1427  VLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYA  1248
             VLAGRV++K I Q +  +  SNL   LDL H++ ++ P++KLE+H+ SI+L+ CL  S  
Sbjct  348   VLAGRVIMKLINQGETPTDLSNLQEKLDLSHSYSKMSPESKLELHLLSIVLIWCLNKSCC  407

Query  1247  PKLPVTGviisqlvillsqIRVNSMAIVRMK----SLDTKGSLDEHVNALTSSLEQVKVG  1080
             P L V    +SQ +ILLSQI+VNSMAIVRMK    S     + +        SLEQ++VG
Sbjct  408   PDLSVCEASVSQTIILLSQIKVNSMAIVRMKSSGDSFKCIPAGNVSAKEPIQSLEQIRVG  467

Query  1079  QAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQI  900
             QA+Y +GS+FNHSC+PN H YFLSR L +RTT+ V  G  LELSYGP+VG+WD KDR + 
Sbjct  468   QALYKIGSLFNHSCKPNIHLYFLSRGLVMRTTEFVPVGCPLELSYGPEVGKWDCKDRIRF  527

Query  899   LRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEK  720
               + Y F CQC GCSQ+N+SDL IN Y C    C GVV DS++A+   +KL H     + 
Sbjct  528   FEEEYFFHCQCCGCSQMNISDLVINGYCCVNTSCTGVVLDSSVAACESEKLNHFLAAPKS  587

Query  719   VENE---------RISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESSI  573
             +++           +S+VA   + K     H+K   CL C    ++E + A ++KA + +
Sbjct  588   LDHHFLVSEKVYAGVSEVASSLLIKPSGSLHIKADKCLKCGSRCEVENSHAEVNKAWNHL  647

Query  572   GRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMD  393
              R+++ + S    + VLS+ L++  +LR++LH +NK IA+ ED VAQA  L GE + A +
Sbjct  648   RRVEELMNSGRANISVLSDCLRSIAVLRTSLHMYNKDIADAEDKVAQACYLAGEMKGARE  707

Query  392   HCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHAL  216
             HC+ASIKIL++LY   H+VIGNEL+KL SIQL  G+   A  TTK  ++IFS+Y+GSHA 
Sbjct  708   HCEASIKILKRLYGDEHVVIGNELVKLASIQLASGDSSGAWETTKRLSQIFSKYYGSHAE  767

Query  215   VIFPYLQRLQQEAG  174
              +F YL  L+ EA 
Sbjct  768   TLFSYLSCLKLEAA  781



>ref|XP_009151465.1| PREDICTED: SET and MYND domain-containing protein 4 [Brassica 
rapa]
Length=786

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/794 (46%), Positives = 506/794 (64%), Gaps = 35/794 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEI--SESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGK  2316
             ME LKSL+P+ L Q +  S S+ D L ++ SSLL F   LPQFHQ V EL DP++  CGK
Sbjct  1     METLKSLIPEHLLQTVKSSSSSVDDLLSSSSSLLRFLLGLPQFHQAVSELADPDLGCCGK  60

Query  2315  DHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHK  2136
                ++ ++K RGN CF    +  AL FY++ALR+A  N+      L A L++NRA+ALH 
Sbjct  61    SQESSLDLKRRGNLCFRSRSFDDALRFYSKALRVARDNT------LLASLFLNRANALHN  114

Query  2135  MGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQ  1956
             +GL+ E L+DC RAL I   Y+KAWFRRGK N  LGN++DA +D+ VS+ +E S +GK+Q
Sbjct  115   LGLLQESLRDCHRALRIDPFYSKAWFRRGKLNTLLGNYKDAFRDITVSISLESSPAGKKQ  174

Query  1955  IEDELRIILD-QHKLKHSSLYKSNRNESDVTMLDEPD---RANMQCVSLPTKGRGMVSRA  1788
             +++EL  I D Q+K       +++ N       D P+      ++CVS   KGRGMVS +
Sbjct  175   LQNELLAIPDFQNK-------QTSENTLCYATADLPNVQSEVKLRCVSTKEKGRGMVSES  227

Query  1787  DIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGG  1608
             DI   S++H E+P+  +I K+CRET+CHFC NELP  +VPC SCS+P+YCS  CQ+ SGG
Sbjct  228   DIEQPSVIHVEEPFCVVISKSCRETHCHFCLNELPADSVPCPSCSVPVYCSESCQIQSGG  287

Query  1607  KEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEV  1428
                     K S    LPD++ ++I    S       TE + EH+HEC+G +WPAVLPS+ 
Sbjct  288   TLSTNEMVKNSTFQNLPDDIVEHIKGVTSAVRYYSETECVQEHQHECRGANWPAVLPSDA  347

Query  1427  VLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYA  1248
             VLAGRV++K I Q +  +  SNL   LDL H++ ++ P++KLE+H+ SI+L+ CL  S  
Sbjct  348   VLAGRVIMKLINQGETPTDLSNLQEKLDLSHSYSKMSPESKLELHLLSIVLIWCLNKSCC  407

Query  1247  PKLPVTGviisqlvillsqIRVNSMAIVRMK----SLDTKGSLDEHVNALTSSLEQVKVG  1080
             P L V    +SQ +ILLSQI+VNSMAIVRMK    S     + +        SLEQ++VG
Sbjct  408   PDLSVCEASVSQTIILLSQIKVNSMAIVRMKSSGDSFKCIPAGNVSAKEPIQSLEQIRVG  467

Query  1079  QAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQI  900
             QA+Y +GS+FNHSC+PN H YFLSR L +RTT+ V  G  LELSYGP+VG+WD KDR + 
Sbjct  468   QALYKIGSLFNHSCKPNIHLYFLSRGLVMRTTEFVPVGCPLELSYGPEVGKWDCKDRIRF  527

Query  899   LRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEK  720
               + Y F CQC GCSQ+N+SDL IN Y C    C GVV DS++A+   +KL H     + 
Sbjct  528   FEEEYFFHCQCCGCSQMNISDLVINGYCCVNTSCTGVVLDSSVAACESEKLNHFLAAPKS  587

Query  719   VENE---------RISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESSI  573
             +++           +S+VA   + K     H+K   CL C    ++E + A ++KA + +
Sbjct  588   LDHHFLVSEKVYAGVSEVASSLLIKPSGSLHIKADKCLKCGSRCEVENSHAEVNKAWNHL  647

Query  572   GRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMD  393
              R+++ + S    + VLS+ L++  +LR++LH +NK IA+ ED VAQA  L GE + A +
Sbjct  648   RRVEELMNSGRANISVLSDCLRSIAVLRTSLHMYNKDIADAEDKVAQACYLAGEMKGARE  707

Query  392   HCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHAL  216
             HC+ASIKIL++LY   H+VIGNEL+KL SIQL  G+   A  TTK  ++IFS+Y+GSHA 
Sbjct  708   HCEASIKILKRLYGDEHVVIGNELVKLASIQLASGDSSGAWETTKRLSQIFSKYYGSHAE  767

Query  215   VIFPYLQRLQQEAG  174
              +F YL  L+ EA 
Sbjct  768   TLFSYLSCLKLEAA  781



>gb|KDO56333.1| hypothetical protein CISIN_1g048211mg [Citrus sinensis]
Length=665

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/689 (50%), Positives = 449/689 (65%), Gaps = 43/689 (6%)
 Frame = -3

Query  2204  NSNDTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGN  2025
             ++ND ++NL A LYVNRAS L K   +VECL+DC+RA+ I  +YAKAW+RRGK N SL N
Sbjct  2     DANDKDRNLVATLYVNRASVLQKRDHLVECLRDCNRAVQICPSYAKAWYRRGKVNVSLEN  61

Query  2024  FEDAIQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDR  1845
              +DA+ DL ++   E SL+GK+QIE EL+IILDQ     + + +  +N   V+  DE  +
Sbjct  62    HDDAVHDLTIAKNRESSLAGKKQIESELKIILDQSNRTSNKVVQHTKNNLRVS--DESVQ  119

Query  1844  ANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPC  1665
               +QCV+ P KGRG+ S+ DIP GSLVH E+PYA  I K+CRET+CH+C NELP  A+PC
Sbjct  120   VQLQCVTTPDKGRGITSQYDIPEGSLVHSEEPYAVTISKHCRETHCHYCLNELPADAIPC  179

Query  1664  ESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIA  1485
              SCSIPLYCS +C+  +GG+ F   P + + ++ + D LE+YIS+        P  E I 
Sbjct  180   TSCSIPLYCSRRCRGQAGGQVFKNCPMERNINDSVFDNLEEYISQITLDNDFYPEDEHIF  239

Query  1484  EHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTK  1305
             EH+HEC+GVHWP +LPS+VVLAGRVLVK +++   S    NLL  L+L HN+ Q+ P++K
Sbjct  240   EHKHECKGVHWPVILPSDVVLAGRVLVKSVQKNGVSMDVPNLLGKLELSHNYSQVSPESK  299

Query  1304  LEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDE  1125
             LE HIY+I+LL CLQ+SY  +LP+ G  +SQ+VIL+SQIRVNS+AIVRM S +  G  D 
Sbjct  300   LESHIYAIVLLYCLQHSYGFELPINGASVSQVVILISQIRVNSLAIVRMNS-NNYGQSDH  358

Query  1124  HVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSY  945
               +  T ++EQV+VG AIY  GS+FNHSC PN HAYFLSRTL +RTT+ V +G  LELSY
Sbjct  359   VSSGSTCTVEQVRVGLAIYTAGSLFNHSCLPNIHAYFLSRTLMIRTTEFVPSGYPLELSY  418

Query  944   GPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLAS  765
             GPQVGQWD KDR + L D YSF CQC GCS+LN SDL INA+ C  P C GVV D+++ +
Sbjct  419   GPQVGQWDCKDRLKFLEDEYSFRCQCSGCSELNTSDLVINAFCCVDPNCPGVVLDNSILN  478

Query  764   YVKQKLPHVSK-----------QVEKVENERISDVAHYAVHKADY--HLKPGHCLNCNLY  624
               KQK  H+             QV K+ ++ I  VA+  + + +      PG+CL C   
Sbjct  479   CEKQKRKHLPAVPQCSSSAPHLQVGKLSSDYIGLVAYLLLEENNRTSRYGPGYCLKCGSD  538

Query  623   RDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVED  444
             RDLE++ AT+ +A   I RLQDAI S ++   VL +A +   +LRS LH +NK IAE   
Sbjct  539   RDLESSYATVDEAWIYIRRLQDAIISKEISRAVLLDASRFLGLLRSILHAYNKSIAE---  595

Query  443   NVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTT  264
                                     ILEKLY  NHIVIG EL+KL SIQL   + +A  T 
Sbjct  596   ------------------------ILEKLYGHNHIVIGYELVKLSSIQLSLDDHNAVDTI  631

Query  263   KSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
                A IF  YFGSHA  +FP+L  LQ+EA
Sbjct  632   SRLAAIFLHYFGSHAETMFPHLLFLQREA  660



>ref|XP_010478763.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X2 [Camelina sativa]
Length=760

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/792 (45%), Positives = 479/792 (60%), Gaps = 59/792 (7%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P+ L Q +  S+ D L  T SSLL  F  LPQFHQ V EL DP++  CGK+ 
Sbjct  1     MEKLKSLIPEDLLQTVKSSSDDDLLTTTSSLLRLFMGLPQFHQAVSELADPDLGCCGKNE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               + ++K RGN  F   D+  AL FY++ALR+AP  + D +K+L A L +NRA+ LH +G
Sbjct  61    ETSLDLKRRGNLSFRSRDFHDALRFYSKALRVAPPEAIDGDKSLLASLLLNRANVLHNLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ E L+DC RAL I   YAKAW+RRGK N  LGN++DA  D+ VS+ +E SL+GK+Q++
Sbjct  121   LLKESLRDCHRALRIDPCYAKAWYRRGKLNTLLGNYKDAFHDITVSMSLESSLAGKKQLQ  180

Query  1949  DELRIILDQHKLKHSSLYK----SNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADI  1782
             +E   I D ++ K +S Y     SN    D  +        ++CVS   KGRGMVS  DI
Sbjct  181   NERNAISD-YQNKQTSEYDECHLSNYAGED-HLPTVQTEVKLRCVSTKEKGRGMVSECDI  238

Query  1781  PIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKE  1602
              + S++H E+P++ +I K+CRET+CHFC NELP  AVPC SCSIP+YCS  CQ+ SGG  
Sbjct  239   ELASVIHIEEPFSVVISKSCRETHCHFCLNELPADAVPCPSCSIPVYCSESCQIQSGGML  298

Query  1601  FGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVL  1422
                   K      LPD                    DI EH                 + 
Sbjct  299   STNERDKHHVFQNLPD--------------------DIVEH-----------------IK  321

Query  1421  AGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPK  1242
             AGRV++K I Q K ++  SNL  +L+L H++  + P+ KLE+H+ SI+L+ CL  S  P 
Sbjct  322   AGRVIMKLINQGKAATDLSNLQEILELSHSYSMMNPEIKLELHLISIVLIWCLSKSSCPD  381

Query  1241  LPVTGviisqlvillsqIRVNSMAIVRMKS----LDTKGSLDEHVNALTSSLEQVKVGQA  1074
             L V    ++Q +ILLSQI+VNS+A+VRMKS         S +        SLEQ++VGQA
Sbjct  382   LSVCEAAVTQTIILLSQIKVNSIAVVRMKSSGDSFKCIPSGNVSAKEQIQSLEQIRVGQA  441

Query  1073  IYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILR  894
             +Y  GS+FNHSC+PN H YFLSR L V+TT+ V  G  LELSYGP+VG+WD KDR + L 
Sbjct  442   LYKTGSLFNHSCKPNIHLYFLSRGLVVQTTEFVPMGCPLELSYGPEVGKWDCKDRIRFLE  501

Query  893   DRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV--------  738
             + Y F C+CR CSQ+NLSDL IN Y C    C GVV DS +A+ V +KL H         
Sbjct  502   EEYFFHCRCRCCSQINLSDLVINGYCCVNTDCTGVVLDSNVATCVSEKLNHFLTAPKSLD  561

Query  737   -SKQVEKVENERISDVAH--YAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
                QV    +  + +VA   ++  +  +H++P  CL C    D+E + A ++KA + + R
Sbjct  562   HHTQVWDKVHTDVEEVASSLFSKRRGSFHIEPEICLKCGSRSDIENSHAAVNKAWNHLRR  621

Query  566   LQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
             + +   S    V +LS+ L++  +LR+ LH +NK IA+ ED VAQ   L  E   A  HC
Sbjct  622   VDELKNSGQANVSLLSDCLRSIAVLRNFLHMYNKDIADAEDKVAQVCYLAEELLDARKHC  681

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVI  210
             +ASIKIL++LYD  H+VIGNE++KL SIQL  G+   A  TTK  ++IFS+Y+GSHA  +
Sbjct  682   EASIKILKRLYDDEHVVIGNEMVKLASIQLASGDSSGAWKTTKRLSQIFSKYYGSHAETL  741

Query  209   FPYLQRLQQEAG  174
             F YL  L+QEA 
Sbjct  742   FSYLPCLKQEAA  753



>ref|XP_011012969.1| PREDICTED: uncharacterized protein LOC105117117 isoform X2 [Populus 
euphratica]
Length=731

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/786 (45%), Positives = 480/786 (61%), Gaps = 76/786 (10%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLK LVP+++++ + ES+ + L +T S+LL     LPQF Q++ +L D   +LCGK+ 
Sbjct  1     MEKLKCLVPESIKRMVGESSHEDLASTSSTLLHCLLNLPQFQQMIDDLADSNNSLCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K +GN+ +   +Y  AL  Y+QALR+AP ++ D +KNL A L++NRAS  HK+G
Sbjct  61    KVALELKQKGNESYLTAEYASALESYSQALRVAPMDAVDMDKNLVATLFLNRASLFHKIG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
              + E L+DC RA+ I  TYAKAW+RRGKAN  LGNF+DA+ D   +  +E+SL GKR IE
Sbjct  121   FLTESLRDCKRAIQISPTYAKAWYRRGKANVDLGNFKDAVNDFNNAKSLELSLDGKRHIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL IIL++   K +S      N++     DEP +  +  VS P KGRGM S+ DI   S
Sbjct  181   TELNIILERQ--KSTSKMAVQENDNCFGHFDEPHQLKLSQVSTPDKGRGMASQCDIAQAS  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVHKE+PYA IILK+CRET+CH+C N+L    VPC SC+IPLYCS  CQ+ +GG+ F   
Sbjct  239   LVHKEEPYALIILKSCRETHCHYCLNQLRADTVPCTSCTIPLYCSEHCQVQAGGEPFSNF  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
               K+  +        +Y     S   S P  E   EH+HEC GV+WPA+LPS++VLAGR+
Sbjct  299   QDKIGTNESHSHSHGEYKFAVCS--DSNP-IECFPEHKHECLGVNWPAILPSDIVLAGRI  355

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK   Q+   S  SN L  L L H++ Q+ P++KLE+H+Y+I+LL CLQ+S+  +LP+ 
Sbjct  356   LVKSTSQR--CSTKSNALCDLGLSHSYTQITPESKLELHVYAIVLLCCLQHSFGFELPIN  413

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGS----LDEHVNALTSSLEQVKVGQAIYLV  1062
             GV +SQ +IL+SQIRVN+MAIVRMKS+D        L    +ALTSSLEQV         
Sbjct  414   GVSLSQTIILISQIRVNAMAIVRMKSVDDPPDQFRKLTSVGDALTSSLEQV---------  464

Query  1061  GSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYS  882
                                                        GQ D +DR + L D+YS
Sbjct  465   -------------------------------------------GQSDCEDRLRYLADKYS  481

Query  881   FSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSK----------  732
             F CQCRGCSQLNLSDL +NA+ C    C GVV +ST+ +    KL +  +          
Sbjct  482   FRCQCRGCSQLNLSDLVLNAFCCVNHNCAGVVLESTIINGETHKLNNFPRAPEKQKFDSH  541

Query  731   -QVEKVENERISDVAHYAV--HKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
              Q +K+    ++DVA  A+  + +  H+ PG CL+C  +RDL+A+   I+KA S I RLQ
Sbjct  542   LQGQKLNIVDLNDVAGLALKFNNSSLHIHPGFCLHCGSHRDLDASHEAINKAWSYIKRLQ  601

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKA  381
             +AI S D+    L +A +A  ILRSTLH +NK +AE EDN+AQA CLV + Q+A +HCK 
Sbjct  602   EAIISKDITGTTLLDASRALGILRSTLHAYNKSVAEAEDNLAQAFCLVRDFQSAREHCKE  661

Query  380   SIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPY  201
             SIKIL+ LY P+HIVIG EL+KL SIQL   +  A  +T     IF+RYFG H   I PY
Sbjct  662   SIKILQTLYGPDHIVIGYELVKLASIQLSLDDPAAVDSTNHLGLIFARYFGPHVDFIVPY  721

Query  200   LQRLQQ  183
              Q L++
Sbjct  722   QQFLKR  727



>gb|AAG51222.1|AC051630_19 unknown protein; 33246-28649 [Arabidopsis thaliana]
Length=781

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/795 (45%), Positives = 493/795 (62%), Gaps = 45/795 (6%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P+ L Q +  S+ D L +T SSLL  F  LPQFHQ V EL +PE+  CGK+ 
Sbjct  1     MEKLKSLIPEDLLQTVKSSSVDDLLSTSSSLLRLFLGLPQFHQAVSELANPELGCCGKNE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               + ++K RGN CF   D+ +AL  Y++ALR+AP ++ D +K+L A L++NRA+ LH +G
Sbjct  61    ETSLDLKRRGNHCFRSRDFDEALRLYSKALRVAPLDAIDGDKSLLASLFLNRANVLHNLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ E L+DC RAL I   YAKAW+RRGK N  LGN++DA +D+ VS+ +E SL GK+Q++
Sbjct  121   LLKESLRDCHRALRIDPYYAKAWYRRGKLNTLLGNYKDAFRDITVSMSLESSLVGKKQLQ  180

Query  1949  DELRIILD---QHKLKHSSLYKSNRNESD----VTMLDEPDRANMQCVSLPTKGRGMVSR  1791
             +EL+ I D      L+H     SN    D    V M        ++CVS   KGRGMVS 
Sbjct  181   NELKAIPDYQNNQTLEHDEYRPSNDAGVDHLPSVQM-----EVKLRCVSTKEKGRGMVSE  235

Query  1790  ADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSG  1611
              DI   S++H E+P                 F+ LP   VPC SCSIP+YCS  CQ+ SG
Sbjct  236   CDIEEASVIHVEEP-----------------FSVLPADTVPCPSCSIPVYCSESCQIQSG  278

Query  1610  GKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSE  1431
             G        K     +LPD++ ++I    S  +    T+ I EH+HEC+G +WPAVLPS+
Sbjct  279   GMLSTNEMDKHHIFQKLPDDIVEHIKGVTSADIYYFATDLIQEHQHECRGANWPAVLPSD  338

Query  1430  VVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSY  1251
              VLAGR+++K I Q K ++  SNL  +L+L H + ++ P+ KLE+H+ SI+L+ CL  S 
Sbjct  339   AVLAGRIIMKLINQGKAATDLSNLQEILELSHTYSKMNPENKLELHLLSIVLIWCLSKSS  398

Query  1250  APKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALT----SSLEQVKV  1083
              P L V    ++Q +ILLSQI+VNS+A+ RMKS           N  T     SLEQ++V
Sbjct  399   CPNLSVCEASVTQTIILLSQIKVNSIAVARMKSSGDSFKCLPSGNISTKEPIQSLEQIRV  458

Query  1082  GQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQ  903
             GQA+Y  GS+FNHSC+PN H YFLSR L ++TT+ V  G  LELSYGP+VG+WD K+R +
Sbjct  459   GQALYKTGSLFNHSCKPNIHLYFLSRGLIMQTTEFVPTGCPLELSYGPEVGKWDCKNRIR  518

Query  902   ILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH------  741
              L + Y F C+CRGC+Q+N+SDL IN Y C    C GVV DS +A+   +KL H      
Sbjct  519   FLEEEYFFHCRCRGCAQINISDLVINGYGCVNTNCTGVVLDSNVATCESEKLNHFFTAPR  578

Query  740   -VSKQVEKVEN--ERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESS  576
              V +QV+  E     + +VA   + K     H++P  CL C    D+E + A ++KA + 
Sbjct  579   NVDQQVQMREKVYADVGEVASSLLSKPSGSLHIEPEICLKCGSRCDIENSHAEVNKAWNH  638

Query  575   IGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAM  396
             + R+++ + S      VLS+  ++  +LR+ LH +NK IA+ ED VAQA  L GE   A 
Sbjct  639   MRRVEELMNSGRANYSVLSDCSRSIAVLRTFLHMYNKDIADAEDKVAQACYLAGELVDAR  698

Query  395   DHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHA  219
              HC+ASIKIL++LY+  H+VIGNE++KL SIQL  G+   A  TTK +++IFS+Y+GSHA
Sbjct  699   KHCEASIKILKRLYEDEHVVIGNEMVKLASIQLASGDSSGAWDTTKRSSQIFSKYYGSHA  758

Query  218   LVIFPYLQRLQQEAG  174
               +F YL  L+QE  
Sbjct  759   ETLFSYLPCLKQETA  773



>ref|XP_006662498.1| PREDICTED: SET and MYND domain-containing protein 4-like [Oryza 
brachyantha]
Length=793

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/801 (43%), Positives = 500/801 (62%), Gaps = 42/801 (5%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  LR+ + E T   LP T S LL F   LP FH V+ ELTDPE+ALC KD 
Sbjct  1     MERLKSAVPAELRRAVGEGTAADLPFTTSRLLSFLEGLPLFHLVIGELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A+E+K +GN+CFS  ++ +AL FY+QALR  P +S+  +  L A LYVNRAS +HK+G
Sbjct  61    GRAAELKGKGNECFSKREFEQALGFYSQALRYLPISSDGKDAGLIATLYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC++DCDRA+++   YAKAW+R+G  NASL N++ AI DL+V+L MEV+ SGK  I 
Sbjct  121   LLEECIRDCDRAISVSPNYAKAWYRKGMVNASLKNYKSAINDLEVALSMEVTSSGKSNIT  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRAN-----MQCVSLPTKGRGMVSRAD  1785
              EL++IL     KH ++ +   + SD T    P         ++CVS P KGRGM+S  D
Sbjct  181   QELKLILQ----KHQNVNQVGASSSDCTDAGFPHTVQQHEVILECVSTPNKGRGMMSPND  236

Query  1784  IPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGK  1605
             I   SL+H EDP AAII+K+CR+T+CH+CF+E P   V C SC+IP+YCS++CQ      
Sbjct  237   ISPASLIHAEDPLAAIIMKSCRDTHCHYCFSEAPTDVVFCPSCTIPIYCSNRCQ------  290

Query  1604  EFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDI-----AEHRHECQGVHWPAVL  1440
                K   ++S +     E  K + +   + V+  R + +     AEH+HEC G HW AVL
Sbjct  291   --DKAVGQISGNQNTHLESNKNLVDIAKLSVTSTRCKTLDSKQNAEHKHECGGAHWSAVL  348

Query  1439  PSEVVLAGRVLVKFIEQQKDSSGFSNLLTV-LDLCHNFVQLPPDTKLEMHIYSIILLNCL  1263
             PS++VLAGR++ ++I++Q  +   S +    LDL H++ Q  P +K E H+Y+I+LL+C+
Sbjct  349   PSDIVLAGRIMAQYIDKQLLAGKRSTISGPNLDLVHHYDQDSPASKFESHMYAIVLLSCV  408

Query  1262  QNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSL--DEHVN----ALTSS  1101
             Q+ Y   +      +SQLV+L+ QI+VNS+AIV MKS+D   +L  D+  +    A+  S
Sbjct  409   QSYYKSGISWAEDSLSQLVLLICQIKVNSIAIVHMKSMDGGKALTVDKRFSGSSGAVMCS  468

Query  1100  LEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWD  921
             +EQV+V QAIY   S FNHSC+PN HAYF  RTL +R+T+ + AG+ +ELSYGPQ G+ D
Sbjct  469   VEQVRVAQAIYKSSSFFNHSCQPNVHAYFHLRTLVLRSTEYIKAGTPIELSYGPQAGEID  528

Query  920   HKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
               +RQ+ LR+ Y FSC C  CS LNLSDL +N++RC +  CLG V + T  +  K+    
Sbjct  529   LPERQKSLRENYYFSCGCSSCSVLNLSDLVMNSFRCPQNNCLGAVSELTF-NKCKENFVR  587

Query  740   VSKQVEKVENERISDVAHY---------AVHKAD--YHLKPGHCLNCNLYRDLEAACATI  594
             VS     V +  + D++ +            K D   ++ PG CL+C    DL ++ A  
Sbjct  588   VSMGESHVCSLSLPDISRFDGDMVKVGKLFFKTDAILNIDPGFCLSCRSRLDLSSSVAMS  647

Query  593   SKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVG  414
              +A S I RL++  + +  P  +++ AL++ + ++   HP++K +A+ +D +A+A   VG
Sbjct  648   DRAISKINRLKELPSLDHAPEFLIAEALRSLEQIKKFRHPYSKALAQAQDTIAEAFAKVG  707

Query  413   EPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGN-RDAASTTKSTAEIFSR  237
             + + A  HCKASI+ILEKLY   HI+I +ELIKL SI+L  G+   AA++      IFS 
Sbjct  708   DQEQARKHCKASIEILEKLYHTKHIIIAHELIKLVSIELSMGDSASAAASFAQAEAIFSL  767

Query  236   YFGSHALVIFPYLQRLQQEAG  174
             Y+G     IFPY+  L++  G
Sbjct  768   YYGPDVKKIFPYVDVLRRNVG  788



>ref|XP_004982663.1| PREDICTED: SET and MYND domain-containing protein 4-like [Setaria 
italica]
Length=789

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/802 (45%), Positives = 487/802 (61%), Gaps = 48/802 (6%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  LR+ + E     LP T S LL FF  LP FHQV++ELTDPE++LC KD 
Sbjct  1     MERLKSAVPAELRRAVGEGLAADLPNTTSRLLAFFDNLPLFHQVMRELTDPELSLCRKDE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K +GN CFS  ++ +AL FY+QALR  P N +  + NL + +Y+NRAS +HK+G
Sbjct  61    GRAVELKGQGNACFSRREFGEALRFYSQALRHVPINPDRMDVNLVSAIYINRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L  E L+DCDRA+A+   Y+KAW+R+G    SL N+  AI DL+V+L MEV+  GKR IE
Sbjct  121   LFRESLRDCDRAIAVSPNYSKAWYRKGMVKTSLKNYSSAINDLEVALNMEVTSLGKRNIE  180

Query  1949  DELRIILD-QHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              E+++IL  Q  +        +  ++D+ +  +P +  ++ +S P KGRGM S  DIP  
Sbjct  181   QEIKLILQKQENVTEVGTSNCDSKDADLPLSGQPQKVIIESISTPNKGRGMASTDDIPPA  240

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGK  1593
             SL+H EDP AAIILK+ RET+CHFCFNE P   V C  C+IP+YCS +CQ     +  G 
Sbjct  241   SLIHVEDPLAAIILKSSRETHCHFCFNEAPADVVFCPLCTIPIYCSKRCQ----EQAVGD  296

Query  1592  TPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGR  1413
                    H      L K     ++     P +   AEHRHEC G HW AVLP++ VLAGR
Sbjct  297   ISCNQDAHLGHATSLAKL---SITSSCKSPSSTLFAEHRHECGGAHWAAVLPADKVLAGR  353

Query  1412  VLVKFIEQQ---KDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPK  1242
             ++ + IE++     S+  S     LDL H++ +  P  KLE  IY+I+LL CLQN Y   
Sbjct  354   IMARDIEKRMLYGKSAAISG--PNLDLVHHYDRHSPVNKLESQIYAIVLLLCLQNHYRSD  411

Query  1241  LPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTS--------SLEQVK  1086
             L  T   +SQLV+L+ QI+VNS+AIVRMKS+D  G L+  VN   S        S+EQV+
Sbjct  412   LLWTEESLSQLVLLIFQIKVNSIAIVRMKSMD--GGLELTVNRGVSAAEGANMCSVEQVR  469

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             V QAIY+ GSMFNHSCRPN HAYFLSR L +R+T+ + +GS +ELSYGPQ G+    DRQ
Sbjct  470   VAQAIYVSGSMFNHSCRPNVHAYFLSRALILRSTEFIKSGSPVELSYGPQAGEMHLSDRQ  529

Query  905   QILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTL-------------AS  765
             + L++ Y FSCQC  CS+LNLSDL +N++ C +  CLG + +ST               S
Sbjct  530   KSLQENYYFSCQCSSCSELNLSDLVMNSFCCPQRNCLGAISESTYYRSKENFVNVSLGGS  589

Query  764   YV-KQKLPHVSKQVEKVENERISDVAHYAVHKADYHLK--PGHCLNCNLYRDLEAACATI  594
             YV K  LP +SK  + +E     +VA      +D  L   PG C+NC  + D+ +A AT 
Sbjct  590   YVSKLSLPDISKVGKDME-----EVARSLFGNSDVSLNIDPGCCMNCRSHIDVASAAATS  644

Query  593   SKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVG  414
              +  S + RL++    +     ++  AL++   L+   HP++K +A+ ED +A+A   +G
Sbjct  645   HREASKVDRLKEITLLDKT---LILEALQSLKQLKKLRHPYSKALAQAEDTIAEAFVKIG  701

Query  413   EPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGN-RDAASTTKSTAEIFSR  237
             + + A  HC+ASI+ILEKLY P HI I +ELIKL SI L  G+   AA+T      IFS 
Sbjct  702   DQEQAQKHCEASIQILEKLYHPKHIAIAHELIKLISILLSLGDTASAAATFARAEAIFSL  761

Query  236   YFGSHALVIFPYLQRLQQEAGC  171
             Y+GSH   I  YL  L++   C
Sbjct  762   YYGSHMEKILAYLGTLKRAVRC  783



>ref|XP_010670026.1| PREDICTED: uncharacterized protein LOC104887127 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=665

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/660 (48%), Positives = 435/660 (66%), Gaps = 30/660 (5%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS++P  +++EI +ST + LP+ CSSL EFF   P FH ++++LT+P++ LC K+ 
Sbjct  1     MEKLKSIIPLKIKREIKQSTAENLPSICSSLHEFFAESPLFHSMLQDLTNPQLGLCAKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K +GN CFS  DY +A  FY+QALR+AP +  D +  L A LYVNRAS+ HKM 
Sbjct  61    EDALELKFKGNACFSSCDYSQATRFYSQALRVAPMDV-DNDNKLVATLYVNRASSFHKMN  119

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+VE L+DC RAL+I   YAKAW+RRGK N SL N+EDAI DLKV+L  E +  GKRQIE
Sbjct  120   LLVESLRDCSRALSISPRYAKAWYRRGKVNTSLLNYEDAICDLKVALDFEGTCGGKRQIE  179

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
             ++L++I ++ K + S    + + +    ++DE  +  +QCVS PTKGRGM S  D+P  S
Sbjct  180   NDLKLIAERKKTESSFRELTGKEQ---LVIDELPQGKLQCVSTPTKGRGMSSLCDMPPAS  236

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             L+HKE+ YAAII K+ R+T+CHFCFNELP  +VPC SCSI LYCS  CQL +GG+     
Sbjct  237   LLHKEEAYAAIISKSFRDTHCHFCFNELPPDSVPCTSCSISLYCSEHCQLQAGGQVSRSY  296

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                    + L  EL+KY S+           E  +EH HEC GV+WP VLP+EVVLAGR+
Sbjct  297   LSNKETEHILSGELQKYFSKVTLESHLDSGVEFFSEHGHECHGVNWPVVLPTEVVLAGRI  356

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LVK +E +++S         LDL HN+V LPP++K+E+H+YSI+LL CL +S    L + 
Sbjct  357   LVKLLELKENSKD-------LDLYHNYVHLPPESKVELHVYSIVLLYCLHSSSRTGLELR  409

Query  1229  GviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKVGQAIY  1068
             G I ++++IL+SQI+VNSMAIVRMK  D    ++   N       LTS+LEQV+VGQAIY
Sbjct  410   GAIFAKVIILISQIKVNSMAIVRMKYADMCHPVNHSENLSLPGDTLTSNLEQVRVGQAIY  469

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
             L GS+FNHSC PN HAYF+SR+L +R T+ V  G  LE+SYGPQVGQWD+++RQQ L+D 
Sbjct  470   LSGSLFNHSCMPNIHAYFISRSLLIRATEFVLTGCPLEMSYGPQVGQWDYRNRQQFLQDN  529

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV----------  738
             YSF CQC GC  +NL DL  NA+RCAK  C GVV D  +  Y K K  ++          
Sbjct  530   YSFKCQCSGCDSVNLPDLVFNAFRCAKMNCSGVVLDDCMVEYEKHKFSNLQVIAEDHSMK  589

Query  737   -SKQVEKVENERISDVAHYAVHKADY--HLKPGHCLNCNLYRDLEAACATISKAESSIGR  567
               ++V+K+ N+ I  +A      +++   ++ G CL C    DL++   T  +++  I R
Sbjct  590   HQREVDKLMNDEIKKIACLMFEHSNHCPEVQSGCCLRCGSVNDLKSLHVTADESDRYIRR  649



>ref|XP_008444167.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X3 
[Cucumis melo]
Length=648

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/644 (50%), Positives = 433/644 (67%), Gaps = 22/644 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELT-DPEMALCGKD  2313
             MEKLKSLVP+ L+Q +  +T D LP++ S LL  F +   F QV+ +LT DPE ALCGK 
Sbjct  1     MEKLKSLVPENLKQMVGSTTADDLPSSSSFLLRLFQQSQLFFQVIGDLTMDPENALCGKK  60

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               AA E+K +GNQCF  GDY  AL +Y++AL +AP N+ D +KNL A LYVNRAS LHKM
Sbjct  61    KDAALELKRQGNQCFLNGDYANALVYYSKALLVAPMNAVDMDKNLVATLYVNRASVLHKM  120

Query  2132  GLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
              L +E L+DC+RAL I S YAKAW+RRGKAN S+  F+DAI+D ++S  +EVS +GK+QI
Sbjct  121   DLQLESLRDCNRALQISSNYAKAWYRRGKANVSMEIFDDAIRDFQISKHVEVSFNGKKQI  180

Query  1952  EDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQC-VSLPTKGRGMVSRADIPI  1776
             +DEL++I  QH  + +++ + ++N+ D    D  D   ++  V+   KGRGMVS  +IP 
Sbjct  181   DDELKVIQHQHS-RSNTVNEHSKNKLD----DYDDLIQVKLHVTTSNKGRGMVSPTEIPP  235

Query  1775  GSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFG  1596
              SL+H E+PYA +ILK+CRET+CH+C NELP+  VPC SCSIPLYCS  CQ+ +GG    
Sbjct  236   SSLIHVEEPYAVVILKHCRETHCHYCLNELPVDKVPCPSCSIPLYCSQHCQIQAGGPMLR  295

Query  1595  KTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAG  1416
                        L D+L  YI E      S  RTE++ EH+HEC GVHWPA+LPSE+VLAG
Sbjct  296   NVSDIQDIFKNLSDDLRMYIQEITLCSFSELRTENVHEHKHECDGVHWPAILPSEIVLAG  355

Query  1415  RVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLP  1236
             R++ KFI Q+   +  SNL+ +L+L H+F ++  D+KLE  IYSIILL+CLQ  +  ++ 
Sbjct  356   RIVAKFIAQRGVFADASNLVDMLNLSHHFPEMHTDSKLECIIYSIILLSCLQQFFPSQVE  415

Query  1235  VTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDE-----HVNALTSSLEQVKVGQAI  1071
             + G   SQ+ IL+SQIR NS++IVRMKS D  GS D+      V   T ++EQV+VGQAI
Sbjct  416   INGNTTSQIAILISQIRTNSISIVRMKSFDAPGSPDKGERLSSVIPFTCNMEQVRVGQAI  475

Query  1070  YLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRD  891
             Y  GS+FNHSC+PN HAYF SRTL++R T   + G  LELSYGPQVGQ D KDR ++L+D
Sbjct  476   YTTGSLFNHSCKPNIHAYFNSRTLFIRATSFAAVGCPLELSYGPQVGQLDCKDRLKLLKD  535

Query  890   RYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVEN  711
              YSF+CQC GCS +++SDL INA+ C  P C GVV D ++ +    K    +K    V++
Sbjct  536   EYSFNCQCSGCSIVHISDLVINAFCCINPNCRGVVLDRSIFNCENTK----TKDFLTVDD  591

Query  710   ERISDVAHYAVHKAD--YHLKPGHCLNCNLYRDLEAACATISKA  585
             + I +     + + D   H  P HCL C  Y D++++  T+ KA
Sbjct  592   QIILE----PIMQTDSFLHAGPSHCLKCGSYCDIKSSRLTVDKA  631



>ref|NP_001065013.1| Os10g0506800 [Oryza sativa Japonica Group]
 gb|AAX95731.1| tetratricopeptide repeat, putative [Oryza sativa Japonica Group]
 gb|ABB47859.2| TPR Domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26927.1| Os10g0506800 [Oryza sativa Japonica Group]
 dbj|BAG90688.1| unnamed protein product [Oryza sativa Japonica Group]
Length=793

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/787 (44%), Positives = 494/787 (63%), Gaps = 22/787 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  LR+ + E T   LP+T S LL F   LP F QV+ ELTDPE+ALC KD 
Sbjct  1     MERLKSAVPAELRRAVGEGTAADLPSTTSRLLAFLEALPLFRQVIGELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A+E+K +GN CFS  ++ +AL FY+QALR  P + + T+ +L A LYVNRAS +HK+G
Sbjct  61    GRAAELKGKGNACFSKREFEQALGFYSQALRYFPISPDGTDASLIATLYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ ECL+DCDRA+++   YAKAW+RRG  NAS  N+  +I DL+V+L MEV+ SGK  IE
Sbjct  121   LLEECLRDCDRAISVSPNYAKAWYRRGMVNASFRNYSSSIHDLEVALSMEVTSSGKSNIE  180

Query  1949  DELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              EL++IL +H+ +       SN   +D+   ++  +  ++C S P KGRGM S  DI   
Sbjct  181   QELKLILQKHQNVNEVGTASSNCINADMPHTEQQPKVILECTSTPNKGRGMSSPNDISPA  240

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGK  1593
             SL+H EDP A II+K+CR+T+CH+CF+E P   V C SC+IP+YCS++CQ  + G+    
Sbjct  241   SLIHAEDPLAVIIMKSCRDTHCHYCFSEAPADVVVCPSCTIPIYCSNRCQEKAIGQMSCN  300

Query  1592  TPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGR  1413
                 +  +N + D  +  ++   S     P ++ IAEHRHEC G  W AVLP+++VLAGR
Sbjct  301   QNTHLESNNNVVDIAKLSVT---STKSKTPDSKQIAEHRHECGGACWAAVLPADIVLAGR  357

Query  1412  VLVKFIEQQKDSSGFSNLLTV-LDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLP  1236
             ++ ++IE+Q      S +    LDL H++ Q    +K E HIY+ +L  CLQ+ Y   + 
Sbjct  358   IMAQYIEKQLLVGKRSTISGPNLDLVHHYDQDSSASKFESHIYATVLFLCLQSYYKSGVS  417

Query  1235  VTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTS----SLEQVKVGQAIY  1068
                  +SQLV+L+ QI+VNS+AIV MKS+D   +L +  +  +     S+EQV+V QAIY
Sbjct  418   WAEDSLSQLVLLICQIKVNSIAIVHMKSMDGVKALTKGFSGFSGDVMCSVEQVRVAQAIY  477

Query  1067  LVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDR  888
             + GS FNHSCRPN HAYF SRTL +R+T+ + AGS +ELSYGPQVG+ D  +RQ+ LR+ 
Sbjct  478   MSGSFFNHSCRPNIHAYFHSRTLILRSTEYIKAGSPIELSYGPQVGEMDLPERQKSLREN  537

Query  887   YSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENE  708
             Y FSC C  CS L+LSDL +N++ C +  CLG V +  +    K+   HVS     V   
Sbjct  538   YYFSCGCSSCSVLSLSDLVMNSFCCPQSNCLGAVSE-LIHHRHKENFVHVSIGESHVCTL  596

Query  707   RISDVAHY---------AVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
              + DV+ +            K+D  +++ PG C++C    DL +A A   +A S I RL+
Sbjct  597   SLPDVSKFDEDIVKVGKLFFKSDTMFNIDPGFCMSCRSQLDLSSAVAMSDRATSKINRLK  656

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKA  381
             +  + ++VP  +++ AL++ + +    HP++K +A+  D +A+A   VG+ + A  HC+A
Sbjct  657   ELPSLDNVPEVLIAEALQSLERIEKLRHPYSKTLAQSHDTIAEAFAKVGDQEQARKHCEA  716

Query  380   SIKILEKLYDPNHIVIGNELIKLGSIQLQRGN-RDAASTTKSTAEIFSRYFGSHALVIFP  204
             SIKILEKLY P HI+I +ELIKL SI+L  G+   AA+       IFS Y+G     I P
Sbjct  717   SIKILEKLYHPRHIIIAHELIKLVSIELSMGDGASAAAAFARADAIFSLYYGPDVERILP  776

Query  203   YLQRLQQ  183
             Y+  L++
Sbjct  777   YVDVLRR  783



>gb|EEC67273.1| hypothetical protein OsI_34249 [Oryza sativa Indica Group]
Length=816

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/810 (42%), Positives = 493/810 (61%), Gaps = 45/810 (6%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  LR+ + E T   LP+T S LL F   LP F QV+ ELTDPE+ALC KD 
Sbjct  1     MERLKSAVPAELRRAVGEGTAADLPSTTSRLLAFLEALPLFRQVIGELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A+E+K +GN CFS  ++ +AL FY+QALR  P + + T+ +L A LYVNRAS +HK+G
Sbjct  61    VRAAELKGKGNACFSKREFEQALGFYSQALRYFPISPDGTDASLIATLYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAK-----------------------AWFRRGKANASLGNFE  2019
             L+ ECL+DCDRA+++   YAK                       AW+RRG  NAS  N+ 
Sbjct  121   LLEECLRDCDRAISVSPNYAKDFNLKNGNQVTLMISPVSVYGFQAWYRRGMVNASFKNYS  180

Query  2018  DAIQDLKVSLKMEVSLSGKRQIEDELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRA  1842
              +I DL+V+L MEV+ SGK  IE EL++IL +H+ +       SN   +D+   ++  + 
Sbjct  181   SSIHDLEVALIMEVTSSGKSNIEQELKLILQKHQNVNEVGTSSSNCINADMQHTEQQPKV  240

Query  1841  NMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCE  1662
              ++C S P KGRGM S  DI   SL+H EDP A II+K CR+T+CH+CF+E P   V C 
Sbjct  241   ILECTSTPNKGRGMTSPNDISPASLIHAEDPLAVIIMKPCRDTHCHYCFSEAPADVVFCP  300

Query  1661  SCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAE  1482
             SC+IP+YCS++CQ  + G+       ++  +N + D  +  ++   S     P ++ IAE
Sbjct  301   SCTIPIYCSNRCQEKAIGQMSCNQNTRLESNNNVVDIAKLSVT---STKSKTPDSKQIAE  357

Query  1481  HRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTV-LDLCHNFVQLPPDTK  1305
             HRHEC GVHW AVLP+++VLAGR++ ++IE+Q  +   S +    LDL H++ Q    +K
Sbjct  358   HRHECGGVHWAAVLPADIVLAGRIMAQYIEKQLLAGKRSTISGPNLDLVHHYDQDSSASK  417

Query  1304  LEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDE  1125
              E HIY+ +L  CLQ+ Y   +      +SQLV+L+ QI+VNS+AIV MKS+D    L +
Sbjct  418   FESHIYATVLFLCLQSYYKSGVSWAEDSLSQLVLLICQIKVNSIAIVHMKSMDGGKVLTK  477

Query  1124  HVNALTS----SLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSEL  957
               +  +     S+EQV+V QAIY+ GS FNHSC+PN HAYF SRTL +R+T+ + AGS +
Sbjct  478   GFSGFSGDVMCSVEQVRVAQAIYMSGSFFNHSCQPNIHAYFHSRTLILRSTEYIKAGSPI  537

Query  956   ELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDS  777
             ELSYGPQVG+ D  +RQ+ LR+ Y FSC C  CS L+LSDL +N++ C +  CLG V + 
Sbjct  538   ELSYGPQVGEMDLPERQKSLRENYYFSCGCSSCSVLSLSDLVMNSFCCPQSNCLGAVSE-  596

Query  776   TLASYVKQKLPHVSKQVEKVENERISDVAHY-----AVHKADY------HLKPGHCLNCN  630
              +    K+   HVS     V    + DV+ +      V K  +      ++ PG C++C 
Sbjct  597   LIHHRRKENFVHVSIGESHVCTLSLPDVSKFDEDIVKVGKLFFNSDTMLNIDPGFCMSCR  656

Query  629   LYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEV  450
                DL +A A   +A S I RL +  + ++VP  +++ AL++ + +    HP++K +A+ 
Sbjct  657   SQLDLSSAVAMSDRATSKINRLNELPSPDNVPEVLIAEALQSLEHIEKLRHPYSKALAQA  716

Query  449   EDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGN-RDAA  273
              D +A+A   VG+ + A  HC+AS KILEKLY P HI+I +ELIKL SI+L  G+   AA
Sbjct  717   HDTIAEAFAKVGDQEQARKHCEASFKILEKLYHPRHIIIAHELIKLVSIELSMGDGASAA  776

Query  272   STTKSTAEIFSRYFGSHALVIFPYLQRLQQ  183
             +       IFS Y+G     I PY+  L++
Sbjct  777   AAFARADAIFSLYYGPDVKRILPYVDALRR  806



>ref|XP_007011440.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
2, partial [Theobroma cacao]
 gb|EOY20250.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 
2, partial [Theobroma cacao]
Length=626

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/626 (49%), Positives = 410/626 (65%), Gaps = 24/626 (4%)
 Frame = -3

Query  1985  MEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRN-----ESDVTMLDEPDRANMQCVSL  1821
             ME SL GK+QIE EL I+   H  K +     N+      +S   + D P +  + CV+ 
Sbjct  1     MEPSLGGKKQIESELDILGQHHDRKSAKPVHYNQKSVGIPDSTNHLSDVPHQIKLHCVTT  60

Query  1820  PTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLY  1641
             P KGRGM S+ DIP  SL+H E+PYA +ILK+CRET+CH+C NELP   +PC SCS+PLY
Sbjct  61    PDKGRGMASQFDIPQASLIHTEEPYAVVILKHCRETHCHYCLNELPADTIPCISCSMPLY  120

Query  1640  CSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQG  1461
             CS  CQ+ +GG+       KV    ++   +E+YI++        P+ E I EH+HECQG
Sbjct  121   CSQHCQVRAGGQIHFNYSNKVDICEKMSSSIEEYIADKTVGSNFDPKLECIPEHKHECQG  180

Query  1460  VHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSI  1281
             VHWPA+LPS+VVLAGRV+VK IEQ++      N L  L LC ++ ++PP++KLE++IYSI
Sbjct  181   VHWPAILPSDVVLAGRVVVKSIEQKEQFIEVPNFLETLGLCESYSKMPPESKLELNIYSI  240

Query  1280  ILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDT--------KGSLDE  1125
             +LL CLQ+SY+ +L + GV  S++VILLSQIRVNSMAIVRMKS D         K S  E
Sbjct  241   VLLFCLQHSYSSELSINGVSTSRIVILLSQIRVNSMAIVRMKSSDVYDQQDWFRKFSSGE  300

Query  1124  HVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSY  945
                ALTSS+EQV+VGQA+Y+  S+FNHSCRPN HAYF+SR+L +R T+ V+ G  LELSY
Sbjct  301   AETALTSSVEQVRVGQALYITASLFNHSCRPNIHAYFISRSLVIRATEFVAGGCPLELSY  360

Query  944   GPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLAS  765
             GPQVGQWD KDR + L ++Y F C C GCS++N SDL IN + C  P C GVV D  +A+
Sbjct  361   GPQVGQWDCKDRLRFLDEQYFFRCWCHGCSEVNASDLVINGFCCVNPNCSGVVLDKLVAN  420

Query  764   YVKQKLPHVSK--------QVEKVENERISDVAHYAVH--KADYHLKPGHCLNCNLYRDL  615
               KQK P + +        QV ++ +  I   AH ++   ++   +   +CL C  Y +L
Sbjct  421   CEKQK-PKIPETIGVESHLQVHELNDIDIKKAAHISLDETRSSLRIDSEYCLKCGSYCNL  479

Query  614   EAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVA  435
              +    + KA  ++ RLQD+I   D+    LS+AL++  ILRS LH +NK I E EDN+A
Sbjct  480   ASMSEAVKKAWINLRRLQDSITLKDMHGTELSDALRSVGILRSILHAYNKGIGEAEDNLA  539

Query  434   QAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKST  255
             QA C  G+ Q A DHCKASI+ILEKLY P+HIVIG EL+KL SIQL  G+  A  +    
Sbjct  540   QAFCFTGDLQPARDHCKASIEILEKLYGPDHIVIGYELVKLSSIQLWLGDCAAVDSINRL  599

Query  254   AEIFSRYFGSHALVIFPYLQRLQQEA  177
             + IFSRY+G  A +IFPYL  L++++
Sbjct  600   SLIFSRYYGPDAGIIFPYLGFLRRKS  625



>gb|EMT23836.1| RNA polymerase II-associated protein 3 [Aegilops tauschii]
Length=782

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/816 (41%), Positives = 476/816 (58%), Gaps = 91/816 (11%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  +R+ + E T   LP+T S LL F   LP FHQV+ EL DPE+ALC KD 
Sbjct  1     MERLKSAVPADIRRAVGEGTTRDLPSTTSLLLAFLDDLPLFHQVIGELADPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH---  2139
               A+E+K RGN CFS  ++ +AL FY+QALR AP +S+ T   L   LYVNRAS +H   
Sbjct  61    GRAAELKGRGNACFSRREFEQALGFYSQALRYAPISSDGTGDILVPALYVNRASTMHFSY  120

Query  2138  ----------------KMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQ  2007
                             K+GL+ ECL+DCDRA+++   YAKAW+RRG  NASL N+  A+ 
Sbjct  121   YRTFFPIKNSEHLGRQKLGLLEECLRDCDRAISVSPNYAKAWYRRGMVNASLKNYSSAMH  180

Query  2006  DLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDV--TMLDEPD--RAN  1839
             DL+V+L MEV+ SGK  IE EL++IL    LK   + K  R+ SD     L   D  +  
Sbjct  181   DLEVALSMEVTSSGKSNIEQELKLIL----LKPQCVNKVGRSSSDCKDAGLAHTDAHKVV  236

Query  1838  MQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCES  1659
             ++C++ P KGRGM S  DIP  SL+H EDP AAIILK+CRET+CH+CF+E P   V C  
Sbjct  237   LECIATPNKGRGMTSPDDIPPTSLIHVEDPLAAIILKSCRETHCHYCFSEAPADVVFCPL  296

Query  1658  CSIPLYCSSQCQ-LVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAE  1482
             C+IP+YCS +CQ    GG  + +     S  N     ++  I    S       ++ IAE
Sbjct  297   CTIPVYCSRKCQEQAVGGISWNQDTYLESNSN----AVDLGILSLTSTRCKATDSKQIAE  352

Query  1481  HRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLT--VLDLCHNFVQLPPDT  1308
             HRHEC G HW AVLP+++VLAGR++ ++I+ +   +G S+ ++   +DL  ++    P +
Sbjct  353   HRHECGGAHWAAVLPADIVLAGRLMAQYIDSRM-LTGKSSAISGPKMDLIQHYDVDSPTS  411

Query  1307  KLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLD  1128
             KLE HIY+I+LL+CLQ  Y   L      ++Q+V+L+ Q++VNS+AIV MKS+D    L 
Sbjct  412   KLESHIYAIVLLSCLQKHYKSDLSWKEETLAQMVLLICQVKVNSIAIVCMKSMDGSQGLT  471

Query  1127  EHV------NALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAG  966
             E+       + +  S+EQVKV QAIY+ GS+FNHSCRPNA                    
Sbjct  472   ENKGYSAADDGVMCSVEQVKVAQAIYMSGSLFNHSCRPNA--------------------  511

Query  965   SELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVV  786
                        G+ +   RQ+ L++ Y FSCQC  CS+L+LSDL I+++ C +  CLG V
Sbjct  512   -----------GEMNLVKRQKSLQENYKFSCQCSSCSELHLSDLVIDSFCCPRSSCLGAV  560

Query  785   PDSTL--------------ASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPG  648
              +ST               +   K  LPHVSK  E +  E++  +  +  + AD  + PG
Sbjct  561   SESTCYKSEENCVHVSVDESDICKLSLPHVSKVDEDI--EKVGKL--FFRNNADLKIDPG  616

Query  647   HCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFN  468
             +C++C    +L +A AT  KA S I R ++    + +    +++AL++   ++   HP++
Sbjct  617   YCMSCRSQINLSSAVATSEKAASKINRFKELAVIDGISEIPITDALQSLQQIKKLRHPYS  676

Query  467   KRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRG  288
             K +A+ ED +A+A   +G+ + A  HC+ASI IL+KLY P HI I +ELIKL SI+L  G
Sbjct  677   KALAQAEDAIAEAFAKIGDQEQARKHCEASIMILKKLYHPKHIAIAHELIKLVSIELSLG  736

Query  287   NR-DAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQ  183
             +R  AA+T      IFS Y+G     I PY+  L++
Sbjct  737   DRASAAATFAQAKAIFSLYYGPDVERILPYVDALKR  772



>ref|XP_002323703.2| tetratricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEF05464.2| tetratricopeptide repeat-containing family protein [Populus trichocarpa]
Length=584

 Score =   544 bits (1402),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 303/579 (52%), Positives = 391/579 (68%), Gaps = 24/579 (4%)
 Frame = -3

Query  1859  DEPDRANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPM  1680
             DEP +  +  VS P KGRGM S+ DIP  SLVHKE+PYA IILK+CRET+CH+C N+L  
Sbjct  10    DEPCQLKLSQVSTPDKGRGMASQCDIPQASLVHKEEPYALIILKSCRETHCHYCLNQLRA  69

Query  1679  HAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKV-SRHNELPDELEKYISECVSIGVSGP  1503
               VPC SC+IPLYCS  CQ+ +GG+ F     K+ ++ +      E   + C     S P
Sbjct  70    DTVPCTSCTIPLYCSEHCQIQAGGEPFSNFQDKIGTKESHSHSHGEYKFALCSD---SNP  126

Query  1502  RTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQ  1323
               E   EH+HEC GV+WPA+LPS++VLAGR+LVK   Q+   S  SN L  L L H++ Q
Sbjct  127   -IECFPEHKHECLGVNWPAILPSDIVLAGRILVKSTSQR--CSTESNALCDLGLSHSYTQ  183

Query  1322  LPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDT  1143
             + P++KLE+H+Y+I+LL CLQ+S+  +LP+ GV +SQ +IL+SQIRVNSMAIVRMKS+D 
Sbjct  184   ITPESKLELHMYAIVLLCCLQHSFGFELPINGVSLSQTIILISQIRVNSMAIVRMKSVDD  243

Query  1142  KGS----LDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSV  975
                    L    +ALTSSLEQV VGQAIY   S+FNHSC PN HAYFLSRTL++RTT+ V
Sbjct  244   PPDQFRKLTSVGDALTSSLEQVPVGQAIYKAASLFNHSCLPNIHAYFLSRTLFIRTTEYV  303

Query  974   SAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCL  795
             S G  LELSYGPQVGQ D +DR + L D+YSF CQCRGCSQLNLSDL +NA+ C    C 
Sbjct  304   STGCPLELSYGPQVGQSDCEDRLRYLADKYSFRCQCRGCSQLNLSDLVLNAFCCVNHNCA  363

Query  794   GVVPDSTLASYVKQKLPHVSKQVEKVENER-----------ISDVAHYAV--HKADYHLK  654
             GVV +ST+ +   +KL +  +  EK + +            I+DVA  A+  + +  H++
Sbjct  364   GVVLESTIINGETRKLNNFPRAPEKQKFDSHLQGHKLNIVDINDVASLALKFNNSSLHIQ  423

Query  653   PGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHP  474
             PG CL+C  +RDL+A+   I+KA S I RLQ+AI S D+    L +A +A  ILRSTLH 
Sbjct  424   PGFCLHCGTHRDLDASHEAINKAWSYIKRLQEAIISKDISGTTLLDASRALGILRSTLHA  483

Query  473   FNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQ  294
             +NK +AE EDN+AQA CLV + Q+A +HCK SIKIL+ LYDP+HIVIG EL+KL SIQL 
Sbjct  484   YNKSVAEAEDNLAQAFCLVRDFQSAREHCKESIKILQTLYDPDHIVIGYELVKLASIQLS  543

Query  293   RGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
               +  A  +T     IF+RYFG H   I PY Q L++ A
Sbjct  544   LDDPAAVDSTNHLGLIFARYFGPHVDFIVPYQQFLKRVA  582



>gb|EMS67338.1| RNA polymerase II-associated protein 3 [Triticum urartu]
Length=741

 Score =   546 bits (1407),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 316/755 (42%), Positives = 456/755 (60%), Gaps = 73/755 (10%)
 Frame = -3

Query  2360  VVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKN  2181
             V+ ELTDPE+ALC KD   A+E+K RGN CF+  ++ +AL FY+QALR AP +S+ T+  
Sbjct  21    VIGELTDPELALCRKDKGRAAELKGRGNACFTRREFDQALGFYSQALRYAPISSDGTDDI  80

Query  2180  LSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDL  2001
             L   LYVNRAS +HK+GL+ ECL+DCDRA+++   YAKAW+RRG  NASL N+  A+ DL
Sbjct  81    LVPALYVNRASTMHKLGLLEECLRDCDRAISVSPNYAKAWYRRGMVNASLKNYSSAVHDL  140

Query  2000  KVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESD-----VTMLDEPDRANM  1836
             +V+L MEV+ SGK  IE EL++IL    LK   + +  R+ SD     +    EP +  +
Sbjct  141   EVALSMEVTSSGKSNIEQELKLIL----LKPQYVNEVGRSSSDCKDAGLAHTAEPHKVVL  196

Query  1835  QCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESC  1656
             +C++ P KGRGM S  DIP  SL+H EDP AAIILK+CRET+CH+CF+E P   V C  C
Sbjct  197   ECIATPNKGRGMTSPNDIPPTSLIHVEDPLAAIILKSCRETHCHYCFSEAPADVVFCPLC  256

Query  1655  SIPLYCSSQCQ-LVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEH  1479
             +IP+YCS +CQ    GG  + +     S  N     ++  I    S     P ++ IAEH
Sbjct  257   TIPVYCSRKCQEQAVGGISWNQDTYLESNSN----AVDLGILSLTSTRCMAPNSKQIAEH  312

Query  1478  RHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTV--LDLCHNFVQLPPDTK  1305
             RHEC G HW AVLP+++VLAGR++ ++I+ +   +G S+ ++   LDL  ++    P +K
Sbjct  313   RHECGGAHWAAVLPADIVLAGRLMAQYIDSRM-LTGKSSAISGPNLDLIQHYDVDSPTSK  371

Query  1304  LEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDE  1125
             LE HI +I+LL CLQ  Y   L      +SQLV+L+ Q++VNS+AIV MKS+D    L E
Sbjct  372   LESHICAIVLLLCLQKHYRSDLSWKEETLSQLVLLICQVKVNSIAIVCMKSMDGGQGLTE  431

Query  1124  HV------NALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGS  963
             +       +A+  S+EQVKV QAIY+ GS+FNHSCRPN                      
Sbjct  432   NKGYSAADDAVMCSVEQVKVAQAIYISGSLFNHSCRPN----------------------  469

Query  962   ELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVP  783
                      VG+ +   RQ+ L++ Y F+CQC  CS+L+LSDL I+++ C +  CLG V 
Sbjct  470   ---------VGEMNLVKRQKSLQENYKFTCQCSSCSELHLSDLVIDSFCCPQSSCLGAVS  520

Query  782   DSTL--------------ASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGH  645
             +ST               +   K  LPHVSK  E +  E++  +  +  +  D  + PG+
Sbjct  521   ESTCYKSEKNCVHVSVDESDICKVSLPHVSKVDEDI--EKVGKL--FFRNNVDLKIDPGY  576

Query  644   CLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNK  465
             C++C    +L +A +T  KA S I R ++    +++    +++AL++   ++   HP++K
Sbjct  577   CMSCRSQINLSSAVSTSEKAASMINRFKELAVIDEISEIPITDALRSLQQIKKLRHPYSK  636

Query  464   RIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGN  285
              +A+ ED +A+A   +G+ + A  HC+ASIKILEKLY P HI I +ELIKL SI+L  G+
Sbjct  637   ALAQAEDVIAEAFAKIGDQEQARKHCEASIKILEKLYHPKHIAIAHELIKLVSIELSLGD  696

Query  284   RDAASTTKSTAE-IFSRYFGSHALVIFPYLQRLQQ  183
             R +A+ T + AE IFS Y+G     I PY+  L++
Sbjct  697   RASAAATFTQAEAIFSLYYGPDVQRILPYVDALKR  731



>gb|KHG07263.1| Tomm70a [Gossypium arboreum]
Length=676

 Score =   534 bits (1376),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 328/793 (41%), Positives = 446/793 (56%), Gaps = 146/793 (18%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELT-DP--EMALCG  2319
             MEKLK +VP+ L++ + ES  D LP+  SSLL+ F  LPQFHQ++ EL  +P  +  LCG
Sbjct  1     MEKLKCVVPERLKRRVEESHVDDLPSLSSSLLQLFLSLPQFHQLISELAAEPATQAGLCG  60

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             K+  AA ++K +GNQC+S GD+ +AL  Y+QALRLAP +++ T KNL A LY+NRAS  H
Sbjct  61    KNEGAALDLKEKGNQCYSSGDHSQALRCYSQALRLAPIDAHHTGKNLVATLYLNRASLFH  120

Query  2138  KMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKR  1959
             KMGL +E L+DC RAL I  +Y K W+RRGK NA+LGN+ED++ DL V+  ME S+ GK+
Sbjct  121   KMGLPMESLRDCSRALEISPSYPKVWYRRGKVNATLGNYEDSVHDLSVAKDMEPSIGGKK  180

Query  1958  QIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIP  1779
             QIE EL ++   H+           ++  V + D P    +QCV  P KGRGMVS+ DIP
Sbjct  181   QIERELDMLARHHEKN----IPQPASQKSVEIPDVPSEIKLQCVKTPDKGRGMVSQFDIP  236

Query  1778  IGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEF  1599
               SL+H E+PYA +ILK+CRET+CH+C NELP   +PC SCS+PLYCS  CQ+ +GG   
Sbjct  237   QASLIHAEEPYAVVILKHCRETHCHYCLNELPADTIPCFSCSLPLYCSQHCQVRAGGP--  294

Query  1598  GKTPRKVSRHNELPDELEKYISECVSIGVS-GPRTEDIAEHRHECQGVHWPAVLPSEVVL  1422
                         +PD +         +G +  P  E I EH+HECQGVHWPA+LPS+VVL
Sbjct  295   ----------IHIPDTM---------VGSNFKPTLECIPEHKHECQGVHWPAILPSDVVL  335

Query  1421  AGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPK  1242
             AGRV+VK +EQ+   +   NL   L                     +ILL+ +       
Sbjct  336   AGRVVVKTMEQKGQFTDVPNLSETL--------------------IVILLSQI-------  368

Query  1241  LPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEH---------VNALTSSLEQV  1089
                               RVNS+A+VRMKS +T  S D+               SS+EQV
Sbjct  369   ------------------RVNSIAVVRMKS-NTNDSYDQQDWFQNFSFGEAEAASSVEQV  409

Query  1088  KVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDR  909
             +VGQA+Y   S+FNHSC PN HAYF+S+                                
Sbjct  410   RVGQALYKAASLFNHSCLPNIHAYFISQV-------------------------------  438

Query  908   QQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSK-  732
                                 N SDL I+ + C  P C GV+ D+ +A+  KQK P V + 
Sbjct  439   --------------------NESDLVISGFCCVNPNCSGVILDNLVANCEKQK-PKVPET  477

Query  731   -------QVEKVENERISDVAHYAVH--KADYHLKPGHCLNCNLYRDLEAACATISKAES  579
                    QV ++++  I  VA+ ++   ++ +H+  G+CL C  Y +  +    + KA +
Sbjct  478   ISNESHLQVHELKDIDIKKVANISLDQTQSSFHVGSGYCLKCGSYCNFASRSKEVKKAWT  537

Query  578   SIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAA  399
                RLQD+IAS D     L++AL++  +LRS LH +NK IAE  D +A+A C +G+ + A
Sbjct  538   DFRRLQDSIASKDTCGTNLTDALRSLGLLRSILHAYNKGIAEAGDILAKAFCFIGDFEPA  597

Query  398   MDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHA  219
              DHCKASI+ILEKLY PNHI IG EL KL SIQL  G+  A       + IFS Y+G  A
Sbjct  598   RDHCKASIEILEKLYGPNHIAIGYELAKLASIQLALGDCTAVYNINRLSAIFSTYYGPQA  657

Query  218   LVIFPYLQRLQQE  180
              +IFPYL  L++E
Sbjct  658   GIIFPYLLVLERE  670



>dbj|BAC42319.1| unknown protein [Arabidopsis thaliana]
Length=604

 Score =   529 bits (1363),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 285/594 (48%), Positives = 388/594 (65%), Gaps = 16/594 (3%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKSL+P+ L Q +  S+ D L +T SSLL  F  LPQFHQ V EL +PE+  CGK+ 
Sbjct  1     MEKLKSLIPEDLLQTVKSSSVDDLLSTSSSLLRLFLGLPQFHQAVSELANPELGCCGKNE  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               + ++K RGN CF   D+ +AL  Y++ALR+AP ++ D +K+L A L++NRA+ LH +G
Sbjct  61    ETSLDLKRRGNHCFRSRDFDEALRLYSKALRVAPLDAIDGDKSLLASLFLNRANVLHNLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ E L+DC RAL I   YAKAW+RRGK N  LGN++DA +D+ VS+ +E SL GK+Q++
Sbjct  121   LLKESLRDCHRALRIDPYYAKAWYRRGKLNTLLGNYKDAFRDITVSMSLESSLVGKKQLQ  180

Query  1949  DELRIILD---QHKLKHSSLYKSNRNESD----VTMLDEPDRANMQCVSLPTKGRGMVSR  1791
             +EL+ I D      L+H     SN    D    V M        ++CVS   KGRGMVS 
Sbjct  181   NELKAIPDYQNNQTLEHDEYRPSNDAGVDHLPSVQM-----EVKLRCVSTKEKGRGMVSE  235

Query  1790  ADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSG  1611
              DI   S++H E+P++ +I K+CRET+CHFC NELP   VPC SCSIP+YCS  CQ+ SG
Sbjct  236   CDIEEASVIHVEEPFSVVISKSCRETHCHFCLNELPADTVPCPSCSIPVYCSESCQIQSG  295

Query  1610  GKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSE  1431
             G        K     +LPD++ ++I    S  +    T+ I EH+HEC+G +WPAVLPS+
Sbjct  296   GMLSTNEMDKHHIFQKLPDDIVEHIKGVTSADIYYFATDLIQEHQHECRGANWPAVLPSD  355

Query  1430  VVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSY  1251
              VLAGR+++K I Q K ++  SNL  +L+L H + ++ P+ KLE+H+ SI+L+ CL  S 
Sbjct  356   AVLAGRIIMKLINQGKAATDLSNLQEILELSHTYSKMNPENKLELHLLSIVLIWCLSKSS  415

Query  1250  APKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALT----SSLEQVKV  1083
              P L V    ++Q +ILLSQI+VNS+A+ RMKS           N  T     SLEQ++V
Sbjct  416   CPNLSVCEASVTQTIILLSQIKVNSIAVARMKSSGDSFKCLPSGNISTKEPIQSLEQIRV  475

Query  1082  GQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQ  903
             GQA+Y  GS+FNHSC+PN H YFLSR L ++TT+ V  G  LELSYGP+VG+WD K+R +
Sbjct  476   GQALYKTGSLFNHSCKPNIHLYFLSRGLIMQTTEFVPTGCPLELSYGPEVGKWDCKNRIR  535

Query  902   ILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
              L + Y F C+CRGC+Q+N+SDL IN Y C    C GVV DS +A+   +KL H
Sbjct  536   FLEEEYFFHCRCRGCAQINISDLVINGYGCVNTNCTGVVLDSNVATCESEKLNH  589



>emb|CDY64797.1| BnaCnng44980D [Brassica napus]
Length=915

 Score =   509 bits (1312),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 284/592 (48%), Positives = 386/592 (65%), Gaps = 22/592 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEI-SESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKD  2313
             ME LKS +P+ L Q + S S+ D L ++ SSLL F   LPQFHQ V EL DP++  CGK 
Sbjct  1     METLKSRIPEHLVQTVKSSSSVDDLLSSSSSLLRFLVGLPQFHQAVSELADPDLGCCGKS  60

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               ++ ++K  GN CF    +  AL FY++ALR+A  N+      L A L++NRA+ALH +
Sbjct  61    QESSLDLKRSGNLCFRSRSFDDALRFYSKALRVARDNT------LLASLFLNRANALHNL  114

Query  2132  GLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
             GL+ E L+DC RAL I   YAKAWFRRGK N  LGN++DA +D+ VS+ ++ S +GK+Q+
Sbjct  115   GLLEESLRDCHRALRIDPCYAKAWFRRGKLNTLLGNYKDAFRDITVSMSLDSSSAGKKQL  174

Query  1952  EDELRIILD-QHKLKHSSLYKSNRNESDVTMLDEPD---RANMQCVSLPTKGRGMVSRAD  1785
             ++EL  I D Q+K       +++ N       D P+      ++CVS   KGRGMVS +D
Sbjct  175   QNELLAIPDFQNK-------QTSENTLCFAAADLPNVQSEVKLRCVSTKEKGRGMVSESD  227

Query  1784  IPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGK  1605
             I   S++H E+P+  +I K+CRET+CHFC NELP  +VPC SCS+P+YCS  CQ+ SGG 
Sbjct  228   IEQASVIHVEEPFCVVISKSCRETHCHFCLNELPPDSVPCPSCSVPVYCSESCQIQSGGM  287

Query  1604  EFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVV  1425
                    K S  + LPD++  +I    S       TE + EH+HEC+G +WPAVLPS+ V
Sbjct  288   LSTNEMDKNSIFHNLPDDIVDHIKGVTSAVRYYSETECLQEHQHECRGANWPAVLPSDAV  347

Query  1424  LAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAP  1245
             LAGRV++K I Q + +   SNL   LDL H++ ++ P++KLE+H+ SI+L+ CL  S  P
Sbjct  348   LAGRVIMKLINQGETAMDLSNLHDKLDLSHSYSKMSPESKLELHLLSIVLIWCLNKSCCP  407

Query  1244  KLPVTGviisqlvillsqIRVNSMAIVRMK----SLDTKGSLDEHVNALTSSLEQVKVGQ  1077
              L V    +SQ +ILLSQI+VNSMAIVRMK    S     + +        SLEQ++VGQ
Sbjct  408   DLSVCEASVSQTIILLSQIKVNSMAIVRMKSSGDSFKCIPAGNVSAKEPIQSLEQIRVGQ  467

Query  1076  AIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQIL  897
             A+Y +GS+FNHSC+PN H YFLSR L +RTT+ V  G  LELSYGP+VG+WD KDR + L
Sbjct  468   ALYKIGSLFNHSCKPNIHLYFLSRGLVMRTTEFVPVGCPLELSYGPEVGKWDCKDRIRFL  527

Query  896   RDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
              + Y F+C+CRGCSQ+N+SDL IN Y C    C GVV DS++A+   +KL H
Sbjct  528   EEEYFFNCRCRGCSQMNISDLVINGYCCVNTSCTGVVLDSSVAACESEKLNH  579


 Score =   283 bits (723),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 149/332 (45%), Positives = 211/332 (64%), Gaps = 15/332 (5%)
 Frame = -3

Query  1124  HVNALTSSLEQ---VKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELE  954
             H  A   SL+    ++VGQA+Y +GS+FNHSC+PN H YFLSR L +RTT+ V  G  LE
Sbjct  579   HFLAAAKSLDHHCLIRVGQALYKIGSLFNHSCKPNIHLYFLSRGLVMRTTEFVPVGCPLE  638

Query  953   LSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDST  774
             LSYGP+VG+WD KDR + L + Y F+C+CRGCSQ+N+SDL IN Y C    C GVV DS+
Sbjct  639   LSYGPEVGKWDCKDRIRFLEEEYFFNCRCRGCSQMNISDLVINGYCCVNTSCTGVVLDSS  698

Query  773   LASYVKQKLPHVSKQVEKVENE---------RISDVAHYAVHK--ADYHLKPGHCLNCNL  627
             +A+   +KL H     + +++           +S+VA   + K     H+K   CL C  
Sbjct  699   VAACESEKLNHFLAAAKSLDHHCLVSEKVYAGVSEVASSLLIKPSGSLHIKADKCLKCGS  758

Query  626   YRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVE  447
               ++E +   ++KA + + R+++ + S    + VLS+ L++  +LR+ LH +NK IA+ E
Sbjct  759   RCEVENSHVEVNKAWNHLRRVEELMNSGRANISVLSDCLRSIAVLRTFLHMYNKDIADAE  818

Query  446   DNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-S  270
             D VAQA  L  E + A +HC+ASIKIL++LY   H+VIGNEL+KL SIQL  G+   A  
Sbjct  819   DKVAQACYLAAEMKGAREHCEASIKILKRLYGDEHVVIGNELVKLASIQLASGDSSGAWE  878

Query  269   TTKSTAEIFSRYFGSHALVIFPYLQRLQQEAG  174
             TTK  ++IFS+Y+GSHA  +F YL  L+ EA 
Sbjct  879   TTKRLSQIFSKYYGSHAETLFSYLSCLKLEAA  910



>gb|KCW57456.1| hypothetical protein EUGRSUZ_H002372, partial [Eucalyptus grandis]
Length=546

 Score =   496 bits (1278),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 269/548 (49%), Positives = 353/548 (64%), Gaps = 27/548 (5%)
 Frame = -3

Query  1757  EDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKV  1578
             E+PYAA+ILKNCR   CH+CFNELP   VPC  C+IP YCS  CQL +GG +      +V
Sbjct  1     EEPYAAVILKNCRHRYCHYCFNELPADVVPCSFCAIPRYCSEHCQLKAGGHQSRNNVEEV  60

Query  1577  SRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKF  1398
             S H E+P E+E +I E  S       +E   EHRHEC   +WPAVLP EVVLAGRV+VK 
Sbjct  61    SLHVEVPTEIENHIREVTSENWEEKISEHFPEHRHECLDANWPAVLPHEVVLAGRVVVKS  120

Query  1397  IEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGvii  1218
             + Q++D       +  LDL +++ +L  + KLE+ IY+I+LL CLQ S +  LPV    +
Sbjct  121   LVQRRDLVE----IKALDLSYSYTELAVEVKLELCIYAIVLLVCLQRSPSLDLPVNPYFV  176

Query  1217  sqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKVGQAIYLVGS  1056
              Q++I++ QIR+NSMAI+RMKS D     D H        A  S++EQV VGQAIY VGS
Sbjct  177   YQIIIIMCQIRLNSMAIIRMKSSDPNTLQDPHRKLSSNEAASASTIEQVSVGQAIYAVGS  236

Query  1055  MFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFS  876
             +FNHSCRPN HAYFL+RTL++RTT+ V AG  LELSYGPQVGQW  +DR + L ++Y F 
Sbjct  237   LFNHSCRPNIHAYFLARTLFIRTTELVEAGCSLELSYGPQVGQWSSQDRLKFLGEKYCFR  296

Query  875   CQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-------------PHVS  735
             CQCR CS +NLSDL ++A+ C  P C G+V D+       +KL             P+V 
Sbjct  297   CQCRSCSVVNLSDLVLSAFHCVHPHCSGIVLDTFDIKSETEKLKQSRHAGDIYSLEPYV-  355

Query  734   KQVEKVENERISDVAHYAVHKA--DYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
              QV+K  +    ++ H A  K+    H   G+CL C  + DLE++   +SKA  +I RLQ
Sbjct  356   -QVDKFGDLYAGEMDHNAQEKSYSSLHAGVGYCLKCGSHCDLESSHLMVSKALGNIKRLQ  414

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKA  381
             D I   ++   +LSNAL++ D LR  LH +NK IAE ED++AQA C +GE Q AM+HCK+
Sbjct  415   DGIVRKELSSSLLSNALESVDQLRKVLHAYNKSIAEAEDSIAQAFCFIGELQCAMEHCKS  474

Query  380   SIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPY  201
             SI+ILEKLY P+H+VIG EL+KL SIQL  G+ DA  T      IF  ++GSHA V+FPY
Sbjct  475   SIQILEKLYSPDHVVIGYELVKLLSIQLSLGDVDAGETLNRLGIIFEHHYGSHAAVVFPY  534

Query  200   LQRLQQEA  177
             L+  + EA
Sbjct  535   LKSFKMEA  542



>ref|XP_008444158.1| PREDICTED: uncharacterized protein LOC103487580 isoform X2 [Cucumis 
melo]
Length=670

 Score =   497 bits (1279),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 262/531 (49%), Positives = 352/531 (66%), Gaps = 15/531 (3%)
 Frame = -3

Query  1748  YAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRH  1569
             YA +ILK+CRET+CH+C NELP+  VPC SCSIPLYCS  CQ+ +GG             
Sbjct  140   YAKVILKHCRETHCHYCLNELPVDKVPCPSCSIPLYCSQHCQIQAGGPMLRNVSDIQDIF  199

Query  1568  NELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQ  1389
               L D+L  YI E      S  RTE++ EH+HEC GVHWPA+LPSE+VLAGR++ KFI Q
Sbjct  200   KNLSDDLRMYIQEITLCSFSELRTENVHEHKHECDGVHWPAILPSEIVLAGRIVAKFIAQ  259

Query  1388  QKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisql  1209
             +   +  SNL+ +L+L H+F ++  D+KLE  IYSIILL+CLQ  +  ++ + G   SQ+
Sbjct  260   RGVFADASNLVDMLNLSHHFPEMHTDSKLECIIYSIILLSCLQQFFPSQVEINGNTTSQI  319

Query  1208  villsqIRVNSMAIVRMKSLDTKGSLDE-----HVNALTSSLEQVKVGQAIYLVGSMFNH  1044
              IL+SQIR NS++IVRMKS D  GS D+      V   T ++EQV+VGQAIY  GS+FNH
Sbjct  320   AILISQIRTNSISIVRMKSFDAPGSPDKGERLSSVIPFTCNMEQVRVGQAIYTTGSLFNH  379

Query  1043  SCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCR  864
             SC+PN HAYF SRTL++R T   + G  LELSYGPQVGQ D KDR ++L+D YSF+CQC 
Sbjct  380   SCKPNIHAYFNSRTLFIRATSFAAVGCPLELSYGPQVGQLDCKDRLKLLKDEYSFNCQCS  439

Query  863   GCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHY  684
             GCS +++SDL INA+ C  P C GVV D ++ +    K    +K    V+++ I +    
Sbjct  440   GCSIVHISDLVINAFCCINPNCRGVVLDRSIFNCENTK----TKDFLTVDDQIILE----  491

Query  683   AVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNAL  510
              + + D   H  P HCL C  Y D++++  T+ KA     RLQ  I  N V    +S+AL
Sbjct  492   PIMQTDSFLHAGPSHCLKCGSYCDIKSSRLTVDKAGIHFTRLQQEINLNRVSETTVSDAL  551

Query  509   KASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIG  330
              A   L+STLH +N+RIAE EDN++QA CL+G+ + A +HCKASI+ILEKLY  NHI IG
Sbjct  552   GALISLKSTLHEYNRRIAEAEDNLSQAFCLLGKLELAAEHCKASIRILEKLYGGNHIAIG  611

Query  329   NELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
             NEL+KL SI +  G+ +AA   K +++IF  Y+GS+A  +FP+L  L++E 
Sbjct  612   NELLKLSSILISVGDHNAADCIKRSSKIFRCYYGSNANTMFPFLNILEEET  662


 Score =   157 bits (396),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELT-DPEMALCGKD  2313
             MEKLKSLVP+ L+Q +  +T D LP++ S LL  F +   F QV+ +LT DPE ALCGK 
Sbjct  1     MEKLKSLVPENLKQMVGSTTADDLPSSSSFLLRLFQQSQLFFQVIGDLTMDPENALCGKK  60

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               AA E+K +GNQCF  GDY  AL +Y++AL +AP N+ D +KNL A LYVNRAS LHKM
Sbjct  61    KDAALELKRQGNQCFLNGDYANALVYYSKALLVAPMNAVDMDKNLVATLYVNRASVLHKM  120

Query  2132  GLIVECLQDCDRALAIFSTYAKAWFR  2055
              L +E L+DC+RAL I S YAK   +
Sbjct  121   DLQLESLRDCNRALQISSNYAKVILK  146



>ref|XP_009759172.1| PREDICTED: SET and MYND domain-containing protein DDB_G0284059 
isoform X3 [Nicotiana sylvestris]
Length=664

 Score =   494 bits (1271),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 250/398 (63%), Positives = 317/398 (80%), Gaps = 12/398 (3%)
 Frame = -3

Query  1346  DLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAI  1167
             DL HN+ QLPP++KLEMHIYS+IL++CLQ+ Y  +LP++G++IS+LVILLSQI+VNSMA+
Sbjct  249   DLSHNYPQLPPESKLEMHIYSVILVHCLQHFYTTELPISGIMISKLVILLSQIQVNSMAV  308

Query  1166  VRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRT  987
             VR+++ + +G + E  NALTSSLEQVKVGQA+Y+ GS+FNHSCRPN HAYFLSRTLYV+ 
Sbjct  309   VRVQAPEVRGPVYEPGNALTSSLEQVKVGQAVYVAGSLFNHSCRPNIHAYFLSRTLYVQA  368

Query  986   TDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAK  807
             T+ + AGSELELSYGPQVGQWD K RQQ+L DRYSF+CQC GCS+LN+SDL INAYRC K
Sbjct  369   TEYILAGSELELSYGPQVGQWDCKYRQQLLGDRYSFTCQCTGCSELNVSDLVINAYRCTK  428

Query  806   PGCLGVVPDSTLASYVKQKL------PHV-----SKQVEKVENERISDVAHYAVHKADYH  660
             P CLGV+ DST+A Y KQKL      P V      KQ+EK++   I++VA   + ++DY 
Sbjct  429   PNCLGVILDSTIARYEKQKLKLLLDAPAVYSSSLHKQIEKLKGANINEVAR-CIFQSDYK  487

Query  659   LKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTL  480
             L+P +CL C  YRDLEA+CA  S+ +S   RLQDAIASN+VP  +L +AL+ +D+LR+ L
Sbjct  488   LEPQNCLVCGSYRDLEASCAATSQVDSCCKRLQDAIASNEVPNNILQDALRCTDLLRTIL  547

Query  479   HPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQ  300
             HPFNKRIAEVEDN++QA CLVGE QAA+DHCKASI+ILE LYDPNHI IGNELIKL S+Q
Sbjct  548   HPFNKRIAEVEDNLSQAFCLVGELQAALDHCKASIQILENLYDPNHIAIGNELIKLASLQ  607

Query  299   LQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQ  186
             +  G+  A+ +      IFSRY+GSHA  I+P+L+ L+
Sbjct  608   ISVGDSAASDSMSKITTIFSRYYGSHADDIYPFLRHLK  645


 Score =   327 bits (838),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 207/294 (70%), Gaps = 26/294 (9%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLKS VP+AL+QEI +STP  LP+TCSSLL+FFH LPQFHQ+VK+LTDP MALC KD 
Sbjct  1     MEKLKSAVPEALKQEIWKSTPTELPSTCSSLLDFFHHLPQFHQMVKDLTDPAMALCCKDQ  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             SAA E KL+GN+CFS GDYP AL  Y+QALR AP + +D EKN  A+LYVNRASAL KMG
Sbjct  61    SAALEAKLKGNECFSKGDYPNALLSYSQALRHAPVDIDDMEKNPVAVLYVNRASALQKMG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L++ECL+DC RAL +   YAKAWFRRGKAN SLG FEDAI+DL +SLK E+S SGKRQIE
Sbjct  121   LLLECLRDCSRALRVSPHYAKAWFRRGKANISLGKFEDAIRDLNISLKAEISSSGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL I LD++K   SS  K N+N S+V   DEPD+  ++C+   TKGRGM    D+   S
Sbjct  181   AELNIALDKNKGMGSSGKKRNQNLSEVP--DEPDQVKLRCLFKKTKGRGMFCVDDVSEAS  238

Query  1769  LVHKEDPYAA---------------------IILKNCRETNCHFCFNELPMHAV  1671
             LVHKEDPYAA                     +IL +C +   HF   ELP+  +
Sbjct  239   LVHKEDPYAADLSHNYPQLPPESKLEMHIYSVILVHCLQ---HFYTTELPISGI  289



>gb|KFK45070.1| hypothetical protein AALP_AA1G339400 [Arabis alpina]
Length=692

 Score =   489 bits (1258),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 264/575 (46%), Positives = 372/575 (65%), Gaps = 17/575 (3%)
 Frame = -3

Query  1850  DRAN---MQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPM  1680
             +RAN   ++CVS   KGRGMVS  DI   S++H E+PY+ +I K+CRET+CHFC N+LP 
Sbjct  112   NRANVLHLRCVSTKEKGRGMVSVCDIEHASVIHVEEPYSVVISKSCRETHCHFCLNDLPA  171

Query  1679  HAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPR  1500
               VPC SCS+P+YCS  CQ+ +GG        K      LPD++ +++        +   
Sbjct  172   DTVPCPSCSVPVYCSEACQIQAGGMLSSNEMNKHPIFQNLPDDIAEHLKSVTLADKNYSV  231

Query  1499  TEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQL  1320
             TE + EH+HEC+G +WPAVLPS+ VLAGRV++K I+Q + +   SNL  +L+L H++ ++
Sbjct  232   TECVQEHKHECRGANWPAVLPSDAVLAGRVIMKSIKQGETAMDLSNLPEILELSHSYSKM  291

Query  1319  PPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMK----S  1152
              P++KLE+H+ SI+L+ CL  S  P L +    ++Q +ILLSQI+VNS+A+VRMK    S
Sbjct  292   NPESKLELHLLSIVLIWCLNKSCCPDLLICETSVTQTIILLSQIKVNSIAVVRMKSSGDS  351

Query  1151  LDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVS  972
                  S +  VN    SLEQ++VGQA+Y  GS+FNHSC+PN H YFLSR L +RTT+ V 
Sbjct  352   FKCNPSGNVPVNEPIQSLEQIRVGQALYKTGSLFNHSCKPNIHLYFLSRGLIMRTTEFVP  411

Query  971   AGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLG  792
              G  LELSYGP+VG+WD KDR + L D Y F CQCRGCSQ+N+SDL IN Y C    C G
Sbjct  412   VGCPLELSYGPEVGKWDCKDRIRFLEDEYFFRCQCRGCSQINISDLVINGYCCVNTNCTG  471

Query  791   VVPDSTLASYVKQKL-------PHVSKQVEKVENERISDVAHYAV--HKADYHLKPGHCL  639
             VV D  +A+   +K          +  QV +  +   S+VA   +  H     ++PG CL
Sbjct  472   VVLDRYVATCESEKRNDCLTAPESLDDQVREKMHADGSEVASSLLTKHSGSLPIEPGICL  531

Query  638   NCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRI  459
              C    D+E++   ++KA + + R+++ + S +  V V S+ L++  +LR+ LH +NK I
Sbjct  532   KCGSRCDVESSNGEVNKAWNHLRRVEELMNSGEANVSVFSDCLRSIAVLRTFLHMYNKDI  591

Query  458   AEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGN-R  282
             A+ ED VAQA  L GE + A  HC+ASIKIL++LY+  HIVIGNE++KL SIQL  G+  
Sbjct  592   ADAEDKVAQACYLAGELRDAGKHCEASIKILKRLYEEEHIVIGNEMVKLASIQLASGDSS  651

Query  281   DAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
             +A  TTK  A+IF++Y+GSHA  +F +L  L+QE 
Sbjct  652   EALDTTKRLAQIFTKYYGSHAESLFSHLPCLKQET  686


 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEI-SESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKD  2313
             MEKLKSL+P+ L Q + + S+ D L ++ SSLL     LP FHQ V EL+DP++  CGK+
Sbjct  1     MEKLKSLIPEDLLQTVKTSSSVDDLLSSSSSLLRLLLGLPHFHQAVIELSDPDLGCCGKN  60

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
                + ++K +GN CF   D+  AL FY++ALR+AP+ + D EK+L A L++NRA+ LH
Sbjct  61    EETSLDLKRQGNLCFRSRDFDGALRFYSKALRVAPSQTVDGEKSLLASLFLNRANVLH  118



>gb|AAP54526.2| TPR Domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=687

 Score =   487 bits (1253),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 283/672 (42%), Positives = 415/672 (62%), Gaps = 22/672 (3%)
 Frame = -3

Query  2144  LHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSG  1965
             L K+GL+ ECL+DCDRA+++   YAKAW+RRG  NAS  N+  +I DL+V+L MEV+ SG
Sbjct  10    LQKLGLLEECLRDCDRAISVSPNYAKAWYRRGMVNASFRNYSSSIHDLEVALSMEVTSSG  69

Query  1964  KRQIEDELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRA  1788
             K  IE EL++IL +H+ +       SN   +D+   ++  +  ++C S P KGRGM S  
Sbjct  70    KSNIEQELKLILQKHQNVNEVGTASSNCINADMPHTEQQPKVILECTSTPNKGRGMSSPN  129

Query  1787  DIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGG  1608
             DI   SL+H EDP A II+K+CR+T+CH+CF+E P   V C SC+IP+YCS++CQ  + G
Sbjct  130   DISPASLIHAEDPLAVIIMKSCRDTHCHYCFSEAPADVVVCPSCTIPIYCSNRCQEKAIG  189

Query  1607  KEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEV  1428
             +        +  +N + D  +  ++   S     P ++ IAEHRHEC G  W AVLP+++
Sbjct  190   QMSCNQNTHLESNNNVVDIAKLSVT---STKSKTPDSKQIAEHRHECGGACWAAVLPADI  246

Query  1427  VLAGRVLVKFIEQQKDSSGFSNLLTV-LDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSY  1251
             VLAGR++ ++IE+Q      S +    LDL H++ Q    +K E HIY+ +L  CLQ+ Y
Sbjct  247   VLAGRIMAQYIEKQLLVGKRSTISGPNLDLVHHYDQDSSASKFESHIYATVLFLCLQSYY  306

Query  1250  APKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTS----SLEQVKV  1083
                +      +SQLV+L+ QI+VNS+AIV MKS+D   +L +  +  +     S+EQV+V
Sbjct  307   KSGVSWAEDSLSQLVLLICQIKVNSIAIVHMKSMDGVKALTKGFSGFSGDVMCSVEQVRV  366

Query  1082  GQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQ  903
              QAIY+ GS FNHSCRPN HAYF SRTL +R+T+ + AGS +ELSYGPQVG+ D  +RQ+
Sbjct  367   AQAIYMSGSFFNHSCRPNIHAYFHSRTLILRSTEYIKAGSPIELSYGPQVGEMDLPERQK  426

Query  902   ILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVE  723
              LR+ Y FSC C  CS L+LSDL +N++ C +  CLG V +     + K+   HVS    
Sbjct  427   SLRENYYFSCGCSSCSVLSLSDLVMNSFCCPQSNCLGAVSELIHHRH-KENFVHVSIGES  485

Query  722   KVENERISDVAHY---------AVHKAD--YHLKPGHCLNCNLYRDLEAACATISKAESS  576
              V    + DV+ +            K+D  +++ PG C++C    DL +A A   +A S 
Sbjct  486   HVCTLSLPDVSKFDEDIVKVGKLFFKSDTMFNIDPGFCMSCRSQLDLSSAVAMSDRATSK  545

Query  575   IGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAM  396
             I RL++  + ++VP  +++ AL++ + +    HP++K +A+  D +A+A   VG+ + A 
Sbjct  546   INRLKELPSLDNVPEVLIAEALQSLERIEKLRHPYSKTLAQSHDTIAEAFAKVGDQEQAR  605

Query  395   DHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGN-RDAASTTKSTAEIFSRYFGSHA  219
              HC+ASIKILEKLY P HI+I +ELIKL SI+L  G+   AA+       IFS Y+G   
Sbjct  606   KHCEASIKILEKLYHPRHIIIAHELIKLVSIELSMGDGASAAAAFARADAIFSLYYGPDV  665

Query  218   LVIFPYLQRLQQ  183
               I PY+  L++
Sbjct  666   ERILPYVDVLRR  677



>ref|XP_008813824.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Phoenix dactylifera]
Length=567

 Score =   468 bits (1205),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 256/547 (47%), Positives = 350/547 (64%), Gaps = 23/547 (4%)
 Frame = -3

Query  1739  IILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNEL  1560
             I++K+CRET+CHFCF+E+P   + C SC+IP+YCS  CQ  +GG++F +     +    L
Sbjct  21    IVMKSCRETHCHFCFSEVPADVLFCHSCTIPIYCSQHCQEQAGGQQFLRNEGSFTVQKCL  80

Query  1559  PDELEKYISEC-----VSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFI  1395
               ELEK++        VS   +    +   EHRHEC G HW AVLP +VVLAGRV+ K+I
Sbjct  81    SAELEKHVMNASLANQVSCAAADMNIKKNPEHRHECGGAHWSAVLPHDVVLAGRVMSKYI  140

Query  1394  EQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviis  1215
             E+ K S   SN L  L+  HN+ Q+P   KLE+HIY+ +L  CLQN Y    P  G  +S
Sbjct  141   EK-KSSGKISNPLETLEFAHNYCQIPLANKLELHIYATVLSYCLQNYYGSDFPSIGASVS  199

Query  1214  qlvillsqIRVNSMAIVRMKSLDTKGSLDEHV------NALTSSLEQVKVGQAIYLVGSM  1053
             QLV+L+SQ++VNSMA+V M SLD   +L + +      NA T + EQ +VGQAIY  GS+
Sbjct  200   QLVLLISQVKVNSMAVVHMNSLDGHEALKKPLKLSTIENAFTCNTEQARVGQAIYSTGSL  259

Query  1052  FNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSC  873
             FNHSC+PN HAYFL+R L +R+T+ V A + LELSYGPQVGQ D + RQ +L ++YSF C
Sbjct  260   FNHSCQPNIHAYFLARMLLIRSTEFVPAWNPLELSYGPQVGQLDLQGRQNLLEEQYSFKC  319

Query  872   QCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVE-------  714
             QC  CS+LNLSDL INA+RC+ PGCLGVV        ++  L  VS      +       
Sbjct  320   QCSSCSELNLSDLIINAFRCSHPGCLGVVSHVAHYKKIEDDLLQVSGPSYSCKLSLPFSK  379

Query  713   -NERISDVAHYAVHKADY--HLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASN  543
                 IS VAH  +        + PG+CL+C  YRDL+++    + A  +I RL+D++ S 
Sbjct  380   HKMDISKVAHMLLKDKGVTCDIYPGYCLSCGFYRDLKSSVTASNSAMLNIQRLRDSLNSK  439

Query  542   DVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILE  363
             +VP   +S+AL++   L+   HP++K +AE EDN+A+A   +G+ + AM+HC ASI+IL 
Sbjct  440   EVPEISISDALESLSHLKLIWHPYSKVVAEAEDNIAEAYVRIGDFERAMNHCIASIEILN  499

Query  362   KLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAE-IFSRYFGSHALVIFPYLQRLQ  186
             KLY   HIVIG+EL+KL SIQL   +  AA ++   AE IFS Y+GSH   IFPY++ L+
Sbjct  500   KLYHAEHIVIGHELMKLTSIQLSLDDHAAARSSIKRAEAIFSLYYGSHVTKIFPYIEALK  559

Query  185   QEAGCLA  165
             +EAG LA
Sbjct  560   REAGSLA  566



>gb|KHG07262.1| Tomm70a [Gossypium arboreum]
Length=642

 Score =   459 bits (1181),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 300/749 (40%), Positives = 411/749 (55%), Gaps = 147/749 (20%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELT-DP--EMALCG  2319
             MEKLK +VP+ L++ + ES  D LP+  SSLL+ F  LPQFHQ++ EL  +P  +  LCG
Sbjct  1     MEKLKCVVPERLKRRVEESHVDDLPSLSSSLLQLFLSLPQFHQLISELAAEPATQAGLCG  60

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             K+  AA ++K +GNQC+S GD+ +AL  Y+QALRLAP +++ T KNL A LY+NRAS  H
Sbjct  61    KNEGAALDLKEKGNQCYSSGDHSQALRCYSQALRLAPIDAHHTGKNLVATLYLNRASLFH  120

Query  2138  KMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKR  1959
             KMGL +E L+DC RAL I  +Y K W+RRGK NA+LGN+ED++ DL V+  ME S+ GK+
Sbjct  121   KMGLPMESLRDCSRALEISPSYPKVWYRRGKVNATLGNYEDSVHDLSVAKDMEPSIGGKK  180

Query  1958  QIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIP  1779
             QIE EL ++   H+           ++  V + D P    +QCV  P KGRGMVS+ DIP
Sbjct  181   QIERELDMLARHHEKN----IPQPASQKSVEIPDVPSEIKLQCVKTPDKGRGMVSQFDIP  236

Query  1778  IGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEF  1599
               SL+H E+PYA +ILK+CRET+CH+C NELP   +PC SCS+PLYCS  CQ+ +GG   
Sbjct  237   QASLIHAEEPYAVVILKHCRETHCHYCLNELPADTIPCFSCSLPLYCSQHCQVRAGGP--  294

Query  1598  GKTPRKVSRHNELPDELEKYISECVSIGVS-GPRTEDIAEHRHECQGVHWPAVLPSEVVL  1422
                         +PD +         +G +  P  E I EH+HECQGVHWPA+LPS+VVL
Sbjct  295   ----------IHIPDTM---------VGSNFKPTLECIPEHKHECQGVHWPAILPSDVVL  335

Query  1421  AGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPK  1242
             AGRV+VK +EQ+   +   NL   L                     +ILL+ +       
Sbjct  336   AGRVVVKTMEQKGQFTDVPNLSETL--------------------IVILLSQI-------  368

Query  1241  LPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEH---------VNALTSSLEQV  1089
                               RVNS+A+VRMKS +T  S D+               SS+EQV
Sbjct  369   ------------------RVNSIAVVRMKS-NTNDSYDQQDWFQNFSFGEAEAASSVEQV  409

Query  1088  KVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDR  909
             +VGQA+Y                    +   V  +D V +G                   
Sbjct  410   RVGQALY--------------------KAAKVNESDLVISG-------------------  430

Query  908   QQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQ  729
                      F C    CS + L +L  N  +  KP     VP++           H+  Q
Sbjct  431   ---------FCCVNPNCSGVILDNLVANCEK-QKPK----VPETI------SNESHL--Q  468

Query  728   VEKVENERISDVAHYAVH--KADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDA  555
             V ++++  I  VA+ ++   ++ +H+  G+CL C  Y +  +    + KA +   RLQD+
Sbjct  469   VHELKDIDIKKVANISLDQTQSSFHVGSGYCLKCGSYCNFASRSKEVKKAWTDFRRLQDS  528

Query  554   IASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASI  375
             IAS D     L++AL++  +LRS LH +NK IAE  D +A+A C +G+ + A DHCKASI
Sbjct  529   IASKDTCGTNLTDALRSLGLLRSILHAYNKGIAEAGDILAKAFCFIGDFEPARDHCKASI  588

Query  374   KILEKLYDPNHIVIGNELIKLGSIQLQRG  288
             +ILEKLY PNHI IG EL KL SIQL  G
Sbjct  589   EILEKLYGPNHIAIGYELAKLASIQLALG  617



>ref|XP_010905092.1| PREDICTED: uncharacterized protein LOC105032355, partial [Elaeis 
guineensis]
Length=468

 Score =   444 bits (1143),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 232/454 (51%), Positives = 308/454 (68%), Gaps = 7/454 (2%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKSL+P  L++ I EST + L +TCSSLLEFF  LPQF QV+KELTDPEMALC K  
Sbjct  1     MERLKSLIPNDLKRMIGESTTENLTSTCSSLLEFFRPLPQFQQVIKELTDPEMALCRKSK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             +AA + K +GN+CFS  DY  AL  Y+QALR AP N +D + N +A LYVNRAS++HK+G
Sbjct  61    AAALDSKQKGNECFSKEDYVNALSHYSQALRYAPLNYDDIDVNWAATLYVNRASSMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ EC++DC+RA+A+   Y KAW+RRGKANASL  +E AI DL+V+  ME SL  K  I+
Sbjct  121   LLEECVRDCNRAIALSPGYVKAWYRRGKANASLKCYEVAILDLEVAFNMENSLPRKNHIK  180

Query  1949  DELRIILDQ-HKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
             +EL+++L + +  K +    SN     +    E     +QCV  P+KGRGM S   IP  
Sbjct  181   EELKMVLSELNSTKGTGTSTSNDKNEKLEASAELHPVALQCVVTPSKGRGMTSSCGIPPA  240

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGK  1593
             SL+H E+P AAI++K+CRET+CHFCFNE+P   + C SC+IP+YCS  C   +GG++F +
Sbjct  241   SLLHCEEPLAAIVMKSCRETHCHFCFNEVPADILFCHSCTIPIYCSQHCHEQAGGQQFLR  300

Query  1592  TPRKVSRHNELPDELEKYISEC-----VSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEV  1428
                  +    L  ELEK+I        VS   +    + I+EHRHEC GVHW AVLP +V
Sbjct  301   NKGSFTAQKSLSPELEKHIMNASLANRVSCTTADMNIKQISEHRHECGGVHWSAVLPHDV  360

Query  1427  VLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYA  1248
             VLAGRV+ K+IE +K S   SNL+  L+  HN+ Q+P   KLE+HIY+ +L  CLQ+ Y 
Sbjct  361   VLAGRVMSKYIE-KKSSGKISNLMETLEFAHNYCQIPSANKLELHIYATVLSYCLQHFYG  419

Query  1247  PKLPVTGviisqlvillsqIRVNSMAIVRMKSLD  1146
                P T   +SQLV+L+SQ++VNSMA+V MKSLD
Sbjct  420   SDFPSTRASVSQLVLLISQLKVNSMAVVHMKSLD  453



>ref|XP_006306797.1| hypothetical protein CARUB_v10008336mg [Capsella rubella]
 gb|EOA39695.1| hypothetical protein CARUB_v10008336mg [Capsella rubella]
Length=640

 Score =   449 bits (1155),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 251/541 (46%), Positives = 340/541 (63%), Gaps = 18/541 (3%)
 Frame = -3

Query  1745  AAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHN  1566
             A +I K+CRET+CHFC NELP  AVPC SCS  +YCS  CQ+ SG         K    +
Sbjct  94    AGVISKSCRETHCHFCLNELPADAVPCPSCSRSVYCSESCQIQSGEMMLTSERDKHHIFH  153

Query  1565  ELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQ  1386
              LPD++ ++I       V     E I EH+HEC+G +WPAVLPS+ VLAGRV++K I Q 
Sbjct  154   NLPDDIVEHIKGITPADVYYSENECIQEHQHECRGANWPAVLPSDAVLAGRVIMKLINQG  213

Query  1385  KDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlv  1206
             K     SNL  +L+L H++  + P++KLEMH+ SI+L+ CL  S  P L V    ++Q +
Sbjct  214   KAVMDLSNLQEILELSHSYSMMNPESKLEMHLLSIVLIWCLSKSSCPDLSVCEAAVTQTI  273

Query  1205  illsqIRVNSMAIVRMKS----LDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSC  1038
             ILL+QI+VNS+A+VRMKS    L    S +        SLEQ++VGQA+Y  GS+FNHSC
Sbjct  274   ILLAQIKVNSIAVVRMKSSGDFLKCIPSGNVSAKEQIQSLEQIRVGQALYKTGSLFNHSC  333

Query  1037  RPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC  858
             +PN H YFLSR L VRTT+ V  GS LELSYGP+VG+WD K+R + L + Y F C+CR C
Sbjct  334   KPNIHLYFLSRGLVVRTTEFVPLGSPLELSYGPEVGKWDCKNRIRFLEEEYFFHCRCRCC  393

Query  857   SQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQK----------LPHVSKQVEKVENE  708
             SQ+N+SDL IN Y C    C GVV DS +A+    K          L H  K  EKV  +
Sbjct  394   SQINISDLVINGYCCVNTNCTGVVLDSNVATCESSKLNNFLTAPKSLDHHIKVWEKVHTD  453

Query  707   RISDVAHYAV--HKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVP  534
              + +VA   +  H+   H++P  CL C    D++ + A ++KA + + R+ + I S    
Sbjct  454   -VGEVASSLLSKHRDSLHIEPDICLKCGSRCDVKNSHAAVNKAWNHLRRVDELINSGQAN  512

Query  533   VEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLY  354
             V V+S+ L++  +LR+ LH +NK IA+ ED VAQ   L  E   A  HC+ASIKIL++LY
Sbjct  513   VSVISDCLRSIAVLRTFLHMYNKDIADAEDKVAQVCYLAEELLDARKHCEASIKILKRLY  572

Query  353   DPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
             +  H+VIGNE++KL SIQL  G+   A +TTK  ++IFS+Y+GSHA  +F YL  L+QEA
Sbjct  573   EDEHVVIGNEMVKLASIQLASGDSSGAWNTTKKFSKIFSKYYGSHAETLFSYLPCLKQEA  632

Query  176   G  174
              
Sbjct  633   A  633



>ref|XP_010042039.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like, partial 
[Eucalyptus grandis]
Length=547

 Score =   441 bits (1134),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 265/619 (43%), Positives = 352/619 (57%), Gaps = 94/619 (15%)
 Frame = -3

Query  2012  IQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQ  1833
             + DL V+  ME S  GKRQIE                              D P    ++
Sbjct  1     MADLHVANLMETSSGGKRQIE------------------------------DVPHEVKVK  30

Query  1832  CVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCS  1653
              + +P KGRGM S  +IP   LVH E+PYAA+ILKNC++  CH+CFNELP+  +PC  C 
Sbjct  31    SIVMPHKGRGMASTGEIPPSYLVHSEEPYAAVILKNCQDRYCHYCFNELPVDVIPCSFCV  90

Query  1652  IPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRH  1473
             IP   +S+      G+E  K P                              E   EHRH
Sbjct  91    IPREVTSE-----NGEE--KIP------------------------------EHFPEHRH  113

Query  1472  ECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMH  1293
             EC   +WPAVLP +VVLAG+V+VK + Q++D       +  LDL +++ +L  + KLE+ 
Sbjct  114   ECLDANWPAVLPHKVVLAGQVVVKSLVQRRDLVE----IKALDLSYSYTELAVEVKLELC  169

Query  1292  IYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN-  1116
             IY I+LL CLQ S +  LPV    + Q+ I++ QIR+NSMAI+RMKS D     D H   
Sbjct  170   IYVIVLLVCLQRSLSLDLPVNPYFVYQINIIICQIRLNSMAIIRMKSSDPNAPQDPHRKL  229

Query  1115  -----ALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELEL  951
                  A  S++EQV VGQAIY VGS+FNHSC PN HAYFL+ T ++RTT+ V AG  LEL
Sbjct  230   SSNEAASASTIEQVSVGQAIYAVGSLFNHSCHPNIHAYFLAHTFFIRTTELVEAGCSLEL  289

Query  950   SYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTL  771
             SYGPQVGQW  +DR + L ++Y F CQCR CS +NLSDL ++A+ C  P C G++ D+  
Sbjct  290   SYGPQVGQWICQDRLKFLGEKYCFRCQCRSCSVVNLSDLVLSAFHCVHPHCSGIILDTFD  349

Query  770   ASYVKQKL-------------PHVSKQVEKVENERISDVAHYAVHK--ADYHLKPGHCLN  636
                  +KL             P+V  QV+K  +    ++ H A  K  +  H   G+C+ 
Sbjct  350   IKSETEKLKQSRHAGDIYSLEPYV--QVDKFGDLYAGEMDHNAQEKSYSSLHAGVGYCMK  407

Query  635   CNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIA  456
             C    DLE++   +SKA  +I RLQD I   ++   +LSNAL++ D LR  LH +NK IA
Sbjct  408   CGSCCDLESSRLMVSKALGNIKRLQDGIVRKELSSSLLSNALESLDQLRKVLHAYNKSIA  467

Query  455   EVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDA  276
             E ED++AQA C +GE Q AM+HCK+SI+ILEKLY P+HIVIG EL+KL SIQL  G+ D 
Sbjct  468   EAEDSIAQAFCFIGELQCAMEHCKSSIQILEKLYSPDHIVIGYELMKLLSIQLSLGDVDT  527

Query  275   ASTTKSTAEIFSRYFGSHA  219
               T      IF  ++GSH 
Sbjct  528   GETLNRLGIIFEHHYGSHT  546



>ref|XP_010025866.1| PREDICTED: uncharacterized protein LOC104416130 [Eucalyptus grandis]
Length=675

 Score =   429 bits (1103),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 240/504 (48%), Positives = 320/504 (63%), Gaps = 27/504 (5%)
 Frame = -3

Query  1625  QLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPA  1446
             QL +GG +      +VS H E+P E+E +I E  S       +E   EHRHEC   +WPA
Sbjct  174   QLKAGGHQSRNNVEEVSLHVEVPTEIENHIREVTSENWEEKISEHFPEHRHECLDANWPA  233

Query  1445  VLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNC  1266
             VLP EVVLAGRV+VK + Q++D       +  LDL +++ +L  + KLE+ IY+I+LL C
Sbjct  234   VLPHEVVLAGRVVVKSLVQRRDLVE----IKALDLSYSYTELAVEVKLELCIYAIVLLVC  289

Query  1265  LQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVN------ALTS  1104
             LQ S +  LPV    + Q++I++ QIR+NSMAI+RMKS D     D H        A  S
Sbjct  290   LQRSPSLDLPVNPYFVYQIIIIMCQIRLNSMAIIRMKSSDPNTLQDPHRKLSSNEAASAS  349

Query  1103  SLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQW  924
             ++EQV VGQAIY VGS+FNHSCRPN HAYFL+RTL++RTT+ V AG  LELSYGPQVGQW
Sbjct  350   TIEQVSVGQAIYAVGSLFNHSCRPNIHAYFLARTLFIRTTELVEAGCSLELSYGPQVGQW  409

Query  923   DHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-  747
               +DR + L ++Y F CQCR CS +NLSDL ++A+ C  P C G+V D+       +KL 
Sbjct  410   SSQDRLKFLGEKYCFRCQCRSCSVVNLSDLVLSAFHCVHPHCSGIVLDTFDIKSETEKLK  469

Query  746   ------------PHVSKQVEKVENERISDVAHYAVHKA--DYHLKPGHCLNCNLYRDLEA  609
                         P+V  QV+K  +    ++ H A  K+    H   G+CL C  + DLE+
Sbjct  470   QSRHAGDIYSLEPYV--QVDKFGDLYAGEMDHNAQEKSYSSLHAGVGYCLKCGSHCDLES  527

Query  608   ACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQA  429
             +   +SKA  +I RLQD I   ++   +LSNAL++ D LR  LH +NK IAE ED++AQA
Sbjct  528   SHLMVSKALGNIKRLQDGIVRKELSSSLLSNALESVDQLRKVLHAYNKSIAEAEDSIAQA  587

Query  428   MCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAE  249
              C +GE Q AM+HCK+SI+ILEKLY P+H+VIG EL+KL SIQL  G+ DA  T      
Sbjct  588   FCFIGELQCAMEHCKSSIQILEKLYSPDHVVIGYELVKLLSIQLSLGDVDAGETLNRLGI  647

Query  248   IFSRYFGSHALVIFPYLQRLQQEA  177
             IF  ++GSHA V+FPYL+  + EA
Sbjct  648   IFEHHYGSHAAVVFPYLKSFKMEA  671


 Score =   168 bits (426),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 129/204 (63%), Gaps = 8/204 (4%)
 Frame = -3

Query  2360  VVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKN  2181
             +V++L DPE  +CGK+  AA + K +GN CFS  D+  AL FY+QAL +AP ++ D +KN
Sbjct  1     MVRDLVDPERCVCGKNKDAALDAKQKGNLCFSSADFSGALAFYSQALIVAPFDARDKDKN  60

Query  2180  LSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDL  2001
             L ++LYVNRA AL+K+G  +ECL+DC+RAL I   YAKAW+ RGK NAS  N+EDA+ DL
Sbjct  61    LVSVLYVNRAVALYKLGFKIECLRDCNRALQISPGYAKAWYWRGKINASSENYEDAMADL  120

Query  2000  KVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSL  1821
              V+  ME S  GKRQIE E++++  Q      SL + + N   ++        +++ +S 
Sbjct  121   HVANLMETSSGGKRQIEGEMKLLQVQFTRTSGSLTQHDENIFKIS-------GHIEELST  173

Query  1820  PTKGRGMVSRADIPIGSLVHKEDP  1749
               K  G  SR ++   SL H E P
Sbjct  174   QLKAGGHQSRNNVEEVSL-HVEVP  196



>gb|KCW71434.1| hypothetical protein EUGRSUZ_E00005 [Eucalyptus grandis]
Length=520

 Score =   404 bits (1038),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 221/500 (44%), Positives = 303/500 (61%), Gaps = 32/500 (6%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS+VP  L+  +  S+ D + +T +SLL FF  LP+F  +V++L DPE  + GK+ 
Sbjct  1     MERLKSMVPDTLKAVVGASSADDILSTSASLLHFFLALPEFQLMVRDLVDPERCVSGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA + K +GN+CFS  D+  AL FY+QAL +AP ++ D +KNL ++LYVNRA AL+K+G
Sbjct  61    DAALDAKQKGNRCFSSADFSGALAFYSQALIVAPFDARDKDKNLVSVLYVNRAVALYKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
               +ECL+DC+R L I   YAKAW+ RGK NAS  N+EDA+ DL V+  ME S  GKRQIE
Sbjct  121   FKIECLRDCNRVLQISPGYAKAWYWRGKINASSENYEDAMADLHVANLMETSSGGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              E++++  Q      SL + + N   ++  D P    ++ + +P KGRGM S  +IP   
Sbjct  181   GEMKLLQVQFTTTSGSLTQHDENIFKIS--DVPHEVKVKSIVMPHKGRGMASTGEIPPSY  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYAA+ILKNCR   CH+CFNELP+  VPC  C+IP YCS  CQL +GG +    
Sbjct  239   LVHSEEPYAAVILKNCRHRYCHYCFNELPVDVVPCSFCAIPRYCSEHCQLKAGGHQSRNN  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
               +VS H E+P E+E +I E  S        E   EHRHEC   +WPAVLP EVVLAGRV
Sbjct  299   VEEVSLHVEVPTEIENHIREVTSENWEEKIPEHFPEHRHECLDANWPAVLPHEVVLAGRV  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             +VK + Q++D       +  LDL +++ +L  + KLE+ IY+I+LL CLQ+S +  LPV 
Sbjct  359   VVKSLVQRRDLVE----IKALDLSYSYTELAVEVKLELCIYAIVLLVCLQHSLSLDLPVN  414

Query  1229  Gviisqlvills--------------------qIRVNSMAIVRMKSLDTKGSLDEHVN--  1116
                + Q+V                        QIR+NSMAI+RMKS D     D H    
Sbjct  415   PYFVYQVVRSYLYLVTNASHPFLSMRIIIIMCQIRLNSMAIIRMKSSDPNTPQDPHRKLS  474

Query  1115  ----ALTSSLEQVKVGQAIY  1068
                 A  S++EQV     ++
Sbjct  475   SNEAASASTIEQVSPDSTLF  494



>ref|XP_010058121.1| PREDICTED: uncharacterized protein LOC104445885 [Eucalyptus grandis]
Length=852

 Score =   397 bits (1020),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 199/420 (47%), Positives = 274/420 (65%), Gaps = 3/420 (1%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS+VP  L+  +  S+ D + +T +SLL FF  LP+F  +V++L DPE  + GK+ 
Sbjct  1     MERLKSMVPDTLKAVVGASSADDILSTSASLLHFFLALPEFQLMVRDLVDPERCVSGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA + K +GN+CFS  D+  AL FY+QAL +AP ++ D +KNL ++LYVNRA AL+K+G
Sbjct  61    DAALDAKQKGNRCFSSADFSGALAFYSQALIVAPFDARDKDKNLVSVLYVNRAVALYKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
               +ECL+DC+R L I   YAKAW+ RGK NAS  N+EDA+ DL V+  ME S  GKRQIE
Sbjct  121   FKIECLRDCNRVLQISPGYAKAWYWRGKINASSENYEDAMADLHVANLMETSSGGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              E++++  Q      SL + + N   ++  D P    ++ + +P KGRGM S  +IP   
Sbjct  181   GEMKLLQVQFTTTSGSLTQHDENIFKIS--DVPHEVKVKSIVMPHKGRGMASTGEIPPSY  238

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+PYAA+ILKNCR   CH+CFNELP+  VPC  C+IP YCS  CQL +GG +    
Sbjct  239   LVHSEEPYAAVILKNCRHRYCHYCFNELPVDVVPCSFCAIPRYCSEHCQLKAGGHQSRNN  298

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
               +VS H E+P E+E +I E  S        E   EHRHEC   +WPAVLP EVVLAGRV
Sbjct  299   VEEVSLHVEVPTEIENHIREVTSENWEEKIPEHFPEHRHECLDANWPAVLPHEVVLAGRV  358

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             +VK + Q++D      L++  DL +++ +L  + KLE+ IY+I+LL CLQ+S +  LPV 
Sbjct  359   VVKSLVQRRDLVEIKALVS-YDLSYSYTELAVEVKLELCIYAIVLLVCLQHSLSLDLPVN  417


 Score =   329 bits (843),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 179/358 (50%), Positives = 231/358 (65%), Gaps = 23/358 (6%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKVGQAIYLVGSMFNHSCRPNA  1026
             R+NSMAI+RMKS D     D H        A  S++EQV VGQAIY VGS+FNHSCRPN 
Sbjct  488   RLNSMAIIRMKSSDPNTPQDPHRKLSSNEAASASTIEQVSVGQAIYAVGSLFNHSCRPNI  547

Query  1025  HAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLN  846
             HAYFL+RTL++RTT+ V AG  LELSYGPQVGQW  +DR + L + Y F CQCR CS +N
Sbjct  548   HAYFLARTLFIRTTELVEAGCSLELSYGPQVGQWSCQDRLKFLGENYCFRCQCRSCSVVN  607

Query  845   LSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL-------------PHVSKQVEKVENER  705
             LSDL ++A+ C  P C G+V D+       +KL             P+V  QV+K  +  
Sbjct  608   LSDLVLSAFHCFHPHCSGIVLDTFDIKSETEKLKQSRHAGDIYSLEPYV--QVDKFGDLY  665

Query  704   ISDVAHYAVHKA--DYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPV  531
               ++ H A  K+    H   G+CL C  + DLE++C  +SKA  +I RLQD I   ++  
Sbjct  666   AGEMDHNAQEKSYSSLHAGVGYCLKCGSHCDLESSCLMVSKALGNIKRLQDGIVRKELSS  725

Query  530   EVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYD  351
              +LSNAL++ D LR  LH +NK IAE ED++AQA C +GE Q AM HCK+SI+ILEKLY 
Sbjct  726   SLLSNALESLDQLRKVLHAYNKSIAEAEDSIAQAFCFIGELQCAMGHCKSSIQILEKLYS  785

Query  350   PNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQEA  177
             P+H+VIG EL+KL SIQL  G+ DA  T      IF  ++GSHA V+FPYL+  ++EA
Sbjct  786   PDHVVIGYELVKLLSIQLSLGDVDAGETLNRLVIIFEHHYGSHAAVVFPYLKSFKREA  843



>tpg|DAA49375.1| TPA: hypothetical protein ZEAMMB73_691595 [Zea mays]
Length=437

 Score =   379 bits (973),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 196/423 (46%), Positives = 265/423 (63%), Gaps = 17/423 (4%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  LR+ + E T   L  T S L  FF  LP FHQV++ELTDPE+ALC KD 
Sbjct  1     MERLKSAVPPDLRRAVGEGTAADLANTTSRLFAFFDSLPLFHQVMQELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K  GN CFS  ++ KAL FY+QALR  P NS   + NL + LYVNRAS +HK+G
Sbjct  61    VKAVELKGHGNACFSRREFGKALRFYSQALRHVPINSGGMDVNLVSSLYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L  E L+DCDRA+ I   Y+KAW+R+G    +L N+  AI DL+V+L  EV+ SGK  IE
Sbjct  121   LFEESLRDCDRAITISPNYSKAWYRKGMVKTALKNYSSAIHDLEVALSQEVTSSGKSNIE  180

Query  1949  DELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              EL++IL++H+ +  +     +  + D+ +  +P +  ++ +S P KGRGM+S  DIP  
Sbjct  181   QELKLILEKHESVNEAGTSNCDSKDRDLPLAGQPHKIVIESISTPNKGRGMISTDDIPPA  240

Query  1772  SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGK  1593
             SL+H EDP AAII+K+ RET+CHFCF+E P   V C SC+IP+YCS +CQ  S G     
Sbjct  241   SLIHVEDPLAAIIMKSSRETHCHFCFSETPADVVFCPSCTIPIYCSKRCQEQSAG-----  295

Query  1592  TPRKVSRHNELPDELEKYISECVSIGVS----GPRTEDIAEHRHECQGVHWPAVLPSEVV  1425
                 +SR     D    Y +   ++ ++     PR++  AEHRHEC G HW AVLP++VV
Sbjct  296   ---HISRDE---DTNLGYSTNVANLSITSSCKSPRSKLFAEHRHECGGAHWAAVLPADVV  349

Query  1424  LAGRVLV-KFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYA  1248
             LAGR++    +++      F+     LDL H++ Q  P  KLE HIY+I+LL CLQN Y 
Sbjct  350   LAGRIIAHSIVKRMPSGKSFAFSGPNLDLVHHYDQHSPANKLESHIYAIVLLLCLQNHYR  409

Query  1247  PKL  1239
               L
Sbjct  410   SDL  412



>gb|EPS58929.1| hypothetical protein M569_15882, partial [Genlisea aurea]
Length=428

 Score =   378 bits (970),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 209/432 (48%), Positives = 279/432 (65%), Gaps = 24/432 (6%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTP-DGLPATCSSLLEFFHRLPQFHQVVKELTDPEMA-LCGK  2316
             ME L S +P ++++ ISES+  D L  TCSSLL FF     FHQ+V +LT+ + A LC K
Sbjct  1     MEVLISTIPDSVKRLISESSSVDDLRFTCSSLLNFFRNSLFFHQLVSDLTNLDTAALCRK  60

Query  2315  DHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHK  2136
             +  AA E K +GN+CF  G+Y  AL FY+QALR AP ++ D E NL + LY+NR+S LHK
Sbjct  61    NKEAAMETKAKGNECFDRGEYSGALRFYSQALRTAPNDAQDKENNLVSTLYLNRSSTLHK  120

Query  2135  MGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQ  1956
             +GLI E L+DC+RAL     YAKAW+RRGK N+SLGN EDAI+D  VSL +E SL+GKRQ
Sbjct  121   LGLIQESLRDCNRALMSSPAYAKAWYRRGKINSSLGNSEDAIRDFSVSLIIENSLAGKRQ  180

Query  1955  IEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPI  1776
             IE EL ++  Q  ++ + + K N N S     DE  +  ++CVS   +GRG+V+  DI  
Sbjct  181   IESELNLLSKQPVIRSNDINKPNENSS-----DENIQVELRCVSGEARGRGLVASTDISP  235

Query  1775  GSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKE--  1602
               LVHKEDPYAAII K CRET+C +CFNELP+  VPC SCS PLYCS +C+  +GG+E  
Sbjct  236   ALLVHKEDPYAAIISKPCRETHCAYCFNELPVDTVPCLSCSAPLYCSEKCRFQAGGEELP  295

Query  1601  ------FGKTPRKVSRHNELPDELEKYISE--CVSIGVSGPRTEDIAEHRHECQGVHWPA  1446
                   FG + R      +LP EL ++I      S G S    E   EHRHEC+G++W +
Sbjct  296   RFEDDDFGGSLR------QLPTELLQHIRRNYVTSSGESSSDGEQFHEHRHECRGMNWSS  349

Query  1445  VLPSEVVLAGRVLVKFIEQQK-DSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLN  1269
             VLPS +VLAGR+LV+ IE++   S G     +  DLC N+ + P + KL+ H +S++LL 
Sbjct  350   VLPSPLVLAGRILVRNIEKRTHKSDGIPVNHSFYDLCQNYGRQPAERKLDFHFFSVVLLY  409

Query  1268  CLQNSYAPKLPV  1233
             CL      +LP+
Sbjct  410   CLHQFNPSRLPL  421



>tpg|DAA49376.1| TPA: hypothetical protein ZEAMMB73_691595 [Zea mays]
Length=489

 Score =   350 bits (899),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 213/539 (40%), Positives = 299/539 (55%), Gaps = 77/539 (14%)
 Frame = -3

Query  1739  IILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNEL  1560
             II+K+ RET+CHFCF+E P   V C SC+IP+YCS +CQ  S G         +SR    
Sbjct  3     IIMKSSRETHCHFCFSETPADVVFCPSCTIPIYCSKRCQEQSAGH--------ISRDE--  52

Query  1559  PDELEKYISECVSIGVSG----PRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLV-KFI  1395
              D    Y +   ++ ++     PR++  AEHRHEC G HW AVLP++VVLAGR++    +
Sbjct  53    -DTNLGYSTNVANLSITSSCKSPRSKLFAEHRHECGGAHWAAVLPADVVLAGRIIAHSIV  111

Query  1394  EQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviis  1215
             ++      F+     LDL H++ Q  P  KLE HIY+I+LL CLQN Y   L  T     
Sbjct  112   KRMPSGKSFAFSGPNLDLVHHYDQHSPANKLESHIYAIVLLLCLQNHYRSDLLWT-----  166

Query  1214  qlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCR  1035
                                                  SL QV+V QA+Y+ GS+FNHSC+
Sbjct  167   -----------------------------------EDSLSQVRVAQALYVSGSLFNHSCQ  191

Query  1034  PNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCS  855
             PN HAYFLSR   +RTT+ + +GS +ELSYGPQVG+    +RQ+ L++ Y FSCQC  CS
Sbjct  192   PNVHAYFLSRAFVLRTTEFIKSGSPVELSYGPQVGEMHISERQKSLQENYYFSCQCSSCS  251

Query  854   QLNLSDLCINAYRCAKPGCLGVVPDSTL-------------ASYV-KQKLPHVSKQVEKV  717
             +LNLSDL +N++ C +  CLG + +ST               SYV K  LP VSK    +
Sbjct  252   ELNLSDLVMNSFCCPQSNCLGAISESTYYRSKENFVNVSLGGSYVCKLSLPDVSKVDMDM  311

Query  716   ENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDV  537
             EN   S + +  V     ++  G C++C    DL +A AT  + ES+I RL+     +  
Sbjct  312   ENVAKSLLQNSGV---SLNIDHGCCMSCRSCIDLSSALATSHREESTIDRLKKHTFLDKT  368

Query  536   PVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKL  357
                +++ AL++   L+   HP++K +A+ ED +A+A   VG+ + A  HC+ASI+ILEKL
Sbjct  369   ---LITEALQSLKQLKKLRHPYSKALAQAEDTIAEAFAKVGDQELARKHCEASIQILEKL  425

Query  356   YDPNHIVIGNELIKLGSIQLQRGN-RDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQ  183
             Y P HI+I +ELIKL SI L  G+   AA+T      IFS Y+GSH   +  Y+  L++
Sbjct  426   YHPKHIIIAHELIKLVSILLSLGDGASAAATFAQAEAIFSLYYGSHVEKVLTYMGALKK  484



>ref|XP_002978843.1| hypothetical protein SELMODRAFT_418586 [Selaginella moellendorffii]
 gb|EFJ20290.1| hypothetical protein SELMODRAFT_418586 [Selaginella moellendorffii]
Length=849

 Score =   353 bits (905),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 258/772 (33%), Positives = 387/772 (50%), Gaps = 116/772 (15%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+L++ VP  L + I  S    + +T ++L  F  R P F   +  L  P    CGKD+
Sbjct  1     MERLRARVPGPLLERIERSKEAEIASTAAALAAFLDRDPVFRHALDRLLQP--TTCGKDY  58

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              +A++ K  GN+ F   +Y +A+  YT+AL+L P NS     N  A ++ NRA++ HK G
Sbjct  59    ESAAKYKADGNRAFQQRNYKQAIQDYTKALKLMPWNSASC--NDLATIFSNRATSFHKSG  116

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L +E ++DC RA+A+  +YAKAW+RRG   A L +++ A+ D++ +   E S+SGK+Q+E
Sbjct  117   LKMEGIRDCGRAIALNESYAKAWYRRGLIKADLCDYQGAVLDMEAAHTRECSVSGKKQVE  176

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              EL  +  + KLK +S  ++ R+ S  T L     A         K  G+ + +++  G+
Sbjct  177   VELLQV--RQKLKLASP-QAQRDLS--TSLKAGISAQTAMYWSADKQWGLRTTSEVQAGT  231

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+  A I+LK  R T+CH CF  +P  +VPC  C +  YC+  C            
Sbjct  232   LVHSEEALAGILLKKHRPTHCHGCFGVVPADSVPCIGCGVVSYCNDAC------------  279

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                                          R +   EH+ EC G  W A LP E VLA R+
Sbjct  280   -----------------------------RDDATVEHKLECGGSGWAAALPEEGVLAARI  310

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LV            +NL   +DLCH++  LP  TK+E+++ +  L  CL+ S+   L  +
Sbjct  311   LV------------TNLQCEVDLCHHYNDLPSQTKVELYLLAATLAKCLKASW---LAFS  355

Query  1229  Gv-iisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSM  1053
                ++++LV+LL+ +R N+M I+ + S D  GS      A    +E V V QA+++ GS 
Sbjct  356   FEDLLAKLVLLLAMLRFNAMGIIHIYSSDETGS---SSGAHICGIEHVVVAQALFVRGSK  412

Query  1052  FNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSC  873
             FNHSC PN H  ++ RTL    T+++ A   LE+SYG QVG+ +   R+  LRD Y F C
Sbjct  413   FNHSCSPNVHVSYVKRTLRAHCTEALPAFCPLEISYGVQVGESEKSQRKIWLRDHYLFEC  472

Query  872   QCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDV  693
              C  C    +SDL   AY C +PGC G+V D           P  S +          D+
Sbjct  473   SCEPCRLGLVSDLLHIAYYCCQPGCQGIVLD-----------PDASDE----------DI  511

Query  692   AHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQD--AIASNDVPVEVLS  519
                        L PG        R L   C  + + E     L+D     S     E ++
Sbjct  512   -----------LLPG---GSGTVRFLIEHCNILPQKE-----LEDLQICGSRLNGNEAIA  552

Query  518   NALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVG-EPQAAMDHCKASIKILEKLYDPNH  342
             + L+  +  R   HPFNK++A++ED VA+  C  G +P AA+ H + SI+ILE++Y  +H
Sbjct  553   DGLRLLENGRKCFHPFNKQLAQMEDIVARLYCEAGQQPAAAIVHARRSIEILERIYGKDH  612

Query  341   IVIGNELIKLGSIQLQRGNRDAASTTKSTAE-IFSRYFGSHALVIFPYLQRL  189
             I +  E +KL SI    G   AA    + AE  FS Y+G     +FP L+R+
Sbjct  613   IAMAYERLKLASIA---GITGAARECLAMAERTFSFYYGFDYGAVFPDLKRV  661



>ref|XP_001754073.1| predicted protein [Physcomitrella patens]
 gb|EDQ80974.1| predicted protein [Physcomitrella patens]
Length=671

 Score =   342 bits (878),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 235/677 (35%), Positives = 350/677 (52%), Gaps = 72/677 (11%)
 Frame = -3

Query  2237  FYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWF  2058
             +Y QALR +P  +   +    A L+VNRA+ALH +   V   +DC RA+ +   Y+KAW+
Sbjct  1     YYAQALRYSPL-ATQVDATTIATLFVNRAAALHALEQHVAATRDCSRAIKLQPEYSKAWY  59

Query  2057  RRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNE  1878
             RRG+A A L  +++AI+DL+ +L +E S SGK Q+  EL  +    K     +   N N 
Sbjct  60    RRGRAWAGLHWYKNAIEDLEKALFLESSASGKNQVSHELDKVKVIVKFNKHFIPSENCNA  119

Query  1877  SDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFC  1698
                          +       K RGM +  D+  GSLV +E+P AA+ILK  R T+CHFC
Sbjct  120   G-------FHHDGVSSYWTSEKQRGMHATKDLEAGSLVLEEEPMAALILKGHRNTHCHFC  172

Query  1697  FNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSI  1518
             F  LP   V C +C+IPLYC   C   +               +E  +EL+         
Sbjct  173   FEMLPPDPVVCFTCAIPLYCDVPCMGAAC--------------DESSEELD---------  209

Query  1517  GVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLD-L  1341
                G + +   EH HEC G  W AVLP++ VL  R+  +         G ++L   LD L
Sbjct  210   ---GQKWK--GEHMHECGGASWSAVLPTDAVLGARLFAR-------GQGNAHLGEELDDL  257

Query  1340  CHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVR  1161
             CH++ ++    K+++H+ + +  +CL  +  P     G  +  LV  ++ +R N+M I  
Sbjct  258   CHHYNKMSYAAKVDLHVMATVTAHCLFRN--PANNWLGQTLGDLVRSVAVVRANAMGICA  315

Query  1160  MK-SLDTKG----SLDEHVN-ALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTL  999
             ++ S D K     SL  +++ ++ S +EQV V Q +Y++GS FNHSC  N HA F  R L
Sbjct  316   VQFSADEKSKSTSSLKNNIDKSVVSQVEQVNVAQGVYILGSKFNHSCSTNVHASFKYRQL  375

Query  998   YVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAY  819
              VRT   + AGS LEL YG QVG+    +RQ+ L  RY F+C C  C  ++  DL + A+
Sbjct  376   RVRTIVPIGAGSPLELCYGAQVGEMRRNERQEWLHARYFFTCACLSCKTVSQPDLLLFAF  435

Query  818   RCAKPGCLGVVPDSTLASYVKQK-LPHVSKQVEK---------VENERISDVAHYAVHKA  669
             RC+K  C GVVP  +L   + Q+ L + S +V +         V++ R S ++   +   
Sbjct  436   RCSKAACDGVVPGPSLLKQLDQRVLRNDSTEVSRFILSWTLNLVQDCRSSTISCKILTIL  495

Query  668   DYH---LKPGHCLNC----NLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNAL  510
                   LKPG C++C    NL    +AA A I +  S   +LQ    + ++ V+    AL
Sbjct  496   SMQANALKPGWCISCGTAINLQYFTDAAHAVIEEFASLRSKLQQPSRNQELLVQ---EAL  552

Query  509   KASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIG  330
                 + RS  H  +K +A+ ED +A+A CL+G P  A+ HCK SI+ILE +Y  +HI + 
Sbjct  553   DTLKLCRSIFHASSKEMAKAEDLMAEAFCLMGRPDDALPHCKISIQILENIYGKDHIAVA  612

Query  329   NELIKLGSIQLQRGNRD  279
             NE +KL SI      RD
Sbjct  613   NERLKLVSIARATNARD  629



>gb|EEE51238.1| hypothetical protein OsJ_32096 [Oryza sativa Japonica Group]
Length=718

 Score =   313 bits (803),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 193/458 (42%), Positives = 282/458 (62%), Gaps = 18/458 (4%)
 Frame = -3

Query  1505  PRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTV-LDLCHNF  1329
             P ++ IAEHRHEC G  W AVLP+++VLAGR++ ++IE+Q      S +    LDL H++
Sbjct  252   PDSKQIAEHRHECGGACWAAVLPADIVLAGRIMAQYIEKQLLVGKRSTISGPNLDLVHHY  311

Query  1328  VQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSL  1149
              Q    +K E HIY+ +L  CLQ+ Y   +      +SQLV+L+ QI+VNS+AIV MKS+
Sbjct  312   DQDSSASKFESHIYATVLFLCLQSYYKSGVSWAEDSLSQLVLLICQIKVNSIAIVHMKSM  371

Query  1148  DTKGSLDEHVNALTS----SLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTD  981
             D   +L +  +  +     S+EQV+V QAIY+ GS FNHSCRPN HAYF SRTL +R+T+
Sbjct  372   DGVKALTKGFSGFSGDVMCSVEQVRVAQAIYMSGSFFNHSCRPNIHAYFHSRTLILRSTE  431

Query  980   SVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPG  801
              + AGS +ELSYGPQVG+ D  +RQ+ LR+ Y FSC C  CS L+LSDL +N++ C +  
Sbjct  432   YIKAGSPIELSYGPQVGEMDLPERQKSLRENYYFSCGCSSCSVLSLSDLVMNSFCCPQSN  491

Query  800   CLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHY---------AVHKAD--YHLK  654
             CLG V +  +    K+   HVS     V    + DV+ +            K+D  +++ 
Sbjct  492   CLGAVSE-LIHHRHKENFVHVSIGESHVCTLSLPDVSKFDEDIVKVGKLFFKSDTMFNID  550

Query  653   PGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHP  474
             PG C++C    DL +A A   +A S I RL++  + ++VP  +++ AL++ + +    HP
Sbjct  551   PGFCMSCRSQLDLSSAVAMSDRATSKINRLKELPSLDNVPEVLIAEALQSLERIEKLRHP  610

Query  473   FNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQ  294
             ++K +A+  D +A+A   VG+ + A  HC+ASIKILEKLY P HI+I +ELIKL SI+L 
Sbjct  611   YSKTLAQSHDTIAEAFAKVGDQEQARKHCEASIKILEKLYHPRHIIIAHELIKLVSIELS  670

Query  293   RGN-RDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQ  183
              G+   AA+       IFS Y+G     I PY+  L++
Sbjct  671   MGDGASAAAAFARADAIFSLYYGPDVERILPYVDVLRR  708


 Score =   218 bits (556),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 0/191 (0%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  LR+ + E T   LP+T S LL F   LP F QV+ ELTDPE+ALC KD 
Sbjct  1     MERLKSAVPAELRRAVGEGTAADLPSTTSRLLAFLEALPLFRQVIGELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A+E+K +GN CFS  ++ +AL FY+QALR  P + + T+ +L A LYVNRAS +HK+G
Sbjct  61    GRAAELKGKGNACFSKREFEQALGFYSQALRYFPISPDGTDASLIATLYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ ECL+DCDRA+++   YAKAW+RRG  NAS  N+  +I DL+V+L MEV+ SGK  IE
Sbjct  121   LLEECLRDCDRAISVSPNYAKAWYRRGMVNASFRNYSSSIHDLEVALSMEVTSSGKSNIE  180

Query  1949  DELRIILDQHK  1917
              EL++IL +H+
Sbjct  181   QELKLILQKHQ  191



>ref|XP_008234177.1| PREDICTED: uncharacterized protein LOC103333162 [Prunus mume]
Length=380

 Score =   283 bits (725),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 192/297 (65%), Gaps = 16/297 (5%)
 Frame = -3

Query  1025  HAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLN  846
             HAYFLSRTL++RTT+ V+AG  LELSYGPQVGQWD KDR + L D YSF CQC GC ++N
Sbjct  71    HAYFLSRTLFIRTTEFVAAGVPLELSYGPQVGQWDCKDRVKFLEDEYSFRCQCSGCLKVN  130

Query  845   LSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSK-----------QVEKVEN-ERI  702
              SDL +N++ C KP C G+V  S++    K+KL H+             Q E+  N + I
Sbjct  131   FSDLVLNSFYCVKPNCSGIVLQSSVVDCEKEKLKHLPNIITVGNMEPHLQAEEFINIDDI  190

Query  701   SDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVL  522
               VAH+      +H+ PG CL  + YRDLE++ A  +KA  SI RLQDAI S DV   +L
Sbjct  191   DRVAHHMQINRVFHINPGLCLKSSSYRDLESSSAAANKAWISIRRLQDAIVSKDVSSTIL  250

Query  521   SNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKI----LEKLY  354
              +AL +  +LRST H +++ IAE EDN+AQA C V E Q A +HCKASI++       LY
Sbjct  251   VDALSSLGVLRSTFHAYSRSIAEAEDNLAQAFCSVRELQPAREHCKASIEVKLLLCTTLY  310

Query  353   DPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRLQQ  183
             +PNHIVIG EL+KL SIQL  G+  A  +     +IFS Y+GSH   IFPYLQ L++
Sbjct  311   NPNHIVIGYELVKLSSIQLSLGDCAAVDSINRPCDIFSCYYGSHTYKIFPYLQFLKR  367



>gb|EEC67274.1| hypothetical protein OsI_34250 [Oryza sativa Indica Group]
Length=252

 Score =   254 bits (648),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/252 (50%), Positives = 168/252 (67%), Gaps = 1/252 (0%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  LR+ + E T   LP+T S LL F   LP F QV+ ELTDPE+ALC KD 
Sbjct  1     MERLKSAVPAELRRAVGEGTAADLPSTTSRLLAFLEALPLFRQVIGELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A+E+K +GN CFS  ++ +AL FY+QALR  P + + T+ +L A LYVNRAS +HK+G
Sbjct  61    GRAAELKGKGNACFSKREFEQALGFYSQALRYFPISPDGTDASLIATLYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L+ ECLQDCDRA+++   YAKAW+RRG  NAS  N+  +I DL+V+L MEV+ SGK  IE
Sbjct  121   LLEECLQDCDRAISVSPNYAKAWYRRGMVNASFRNYSSSIHDLEVALSMEVTSSGKSNIE  180

Query  1949  DELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              EL++IL +H+ +       SN   +D+   ++  +  ++C S P KGRGM S  DI   
Sbjct  181   QELKLILQKHQNVNEVGTSSSNCINADMPHTEQQPKVILECTSTPNKGRGMTSPNDISPA  240

Query  1772  SLVHKEDPYAAI  1737
             SL+H EDP A +
Sbjct  241   SLIHAEDPLAVV  252



>tpg|DAA49377.1| TPA: hypothetical protein ZEAMMB73_691595 [Zea mays]
Length=318

 Score =   250 bits (639),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 137/327 (42%), Positives = 186/327 (57%), Gaps = 56/327 (17%)
 Frame = -3

Query  1739  IILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNEL  1560
             II+K+ RET+CHFCF+E P   V C SC+IP+YCS +CQ  S G         +SR    
Sbjct  3     IIMKSSRETHCHFCFSETPADVVFCPSCTIPIYCSKRCQEQSAGH--------ISRDE--  52

Query  1559  PDELEKYISECVSIGVSG----PRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLV-KFI  1395
              D    Y +   ++ ++     PR++  AEHRHEC G HW AVLP++VVLAGR++    +
Sbjct  53    -DTNLGYSTNVANLSITSSCKSPRSKLFAEHRHECGGAHWAAVLPADVVLAGRIIAHSIV  111

Query  1394  EQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviis  1215
             ++      F+     LDL H++ Q  P  KLE HIY+I+LL CLQN Y   L  T     
Sbjct  112   KRMPSGKSFAFSGPNLDLVHHYDQHSPANKLESHIYAIVLLLCLQNHYRSDLLWT-----  166

Query  1214  qlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCR  1035
                                                  SL QV+V QA+Y+ GS+FNHSC+
Sbjct  167   -----------------------------------EDSLSQVRVAQALYVSGSLFNHSCQ  191

Query  1034  PNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCS  855
             PN HAYFLSR   +RTT+ + +GS +ELSYGPQVG+    +RQ+ L++ Y FSCQC  CS
Sbjct  192   PNVHAYFLSRAFVLRTTEFIKSGSPVELSYGPQVGEMHISERQKSLQENYYFSCQCSSCS  251

Query  854   QLNLSDLCINAYRCAKPGCLGVVPDST  774
             +LNLSDL +N++ C +  CLG + +ST
Sbjct  252   ELNLSDLVMNSFCCPQSNCLGAISEST  278



>tpg|DAA49374.1| TPA: hypothetical protein ZEAMMB73_691595 [Zea mays]
Length=261

 Score =   246 bits (628),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 165/252 (65%), Gaps = 1/252 (0%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  LR+ + E T   L  T S L  FF  LP FHQV++ELTDPE+ALC KD 
Sbjct  1     MERLKSAVPPDLRRAVGEGTAADLANTTSRLFAFFDSLPLFHQVMQELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K  GN CFS  ++ KAL FY+QALR  P NS   + NL + LYVNRAS +HK+G
Sbjct  61    VKAVELKGHGNACFSRREFGKALRFYSQALRHVPINSGGMDVNLVSSLYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L  E L+DCDRA+ I   Y+KAW+R+G    +L N+  AI DL+V+L  EV+ SGK  IE
Sbjct  121   LFEESLRDCDRAITISPNYSKAWYRKGMVKTALKNYSSAIHDLEVALSQEVTSSGKSNIE  180

Query  1949  DELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              EL++IL++H+ +  +     +  + D+ +  +P +  ++ +S P KGRGM+S  DIP  
Sbjct  181   QELKLILEKHESVNEAGTSNCDSKDRDLPLAGQPHKIVIESISTPNKGRGMISTDDIPPA  240

Query  1772  SLVHKEDPYAAI  1737
             SL+H EDP AA+
Sbjct  241   SLIHVEDPLAAL  252



>ref|NP_001146688.1| uncharacterized protein LOC100280288 [Zea mays]
 gb|ACL54533.1| unknown [Zea mays]
Length=318

 Score =   247 bits (631),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 136/327 (42%), Positives = 185/327 (57%), Gaps = 56/327 (17%)
 Frame = -3

Query  1739  IILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNEL  1560
             II+K+ RET+CHFCF+E P   V C SC+IP+YCS +CQ  S G         +SR    
Sbjct  3     IIMKSSRETHCHFCFSETPADVVFCPSCTIPIYCSKRCQEQSAGH--------ISRDE--  52

Query  1559  PDELEKYISECVSIGVSG----PRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLV-KFI  1395
              D    Y +   ++ ++     PR++  AEHRHEC G HW AVLP++VVLAGR++    +
Sbjct  53    -DTNLGYSTNVANLSITSSCKSPRSKLFAEHRHECGGAHWAAVLPADVVLAGRIIAHSIV  111

Query  1394  EQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviis  1215
             ++      F+     LDL H++ Q  P  KLE HIY+I+LL CLQN Y   L  T     
Sbjct  112   KRMPSGKSFAFSGPNLDLVHHYDQHSPANKLESHIYAIVLLLCLQNHYRSDLLWT-----  166

Query  1214  qlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCR  1035
                                                  SL QV+V QA+Y+ GS+FNHSC+
Sbjct  167   -----------------------------------EDSLSQVRVAQALYVSGSLFNHSCQ  191

Query  1034  PNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCS  855
             PN HAYFLSR   +RTT+ + +GS +ELSYGPQVG+    +RQ+ L++ Y FSCQC  CS
Sbjct  192   PNVHAYFLSRAFVLRTTEFIKSGSPVELSYGPQVGEMHISERQKSLQENYYFSCQCSSCS  251

Query  854   QLNLSDLCINAYRCAKPGCLGVVPDST  774
             +LNLSDL +N++ C +  C G + +ST
Sbjct  252   ELNLSDLVMNSFCCPQSNCHGAISEST  278



>gb|AGT17023.1| hypothetical protein SHCRBa_022_O03_F_420 [Saccharum hybrid cultivar 
R570]
Length=261

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/252 (47%), Positives = 165/252 (65%), Gaps = 1/252 (0%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS VP  LR+ + E T   LPAT S L  FF  LP FHQV++ELTDPE+ALC KD 
Sbjct  1     MERLKSAVPTELRRAVGEGTAADLPATTSRLFAFFDSLPLFHQVMQELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K  GN CFS  ++ +AL +Y+QALR  P NS+  +  L + +YVNRAS +HK+G
Sbjct  61    VKAVELKGHGNACFSRREFGEALGYYSQALRHVPINSDGMDVKLVSAIYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L  E L+DCDRA+ I   Y+KAW+R+G    +L N+  A+ DL+V+L +EV+ SGK  IE
Sbjct  121   LFKESLRDCDRAITISPNYSKAWYRKGMVKTALKNYSSAVHDLEVALSLEVTSSGKNNIE  180

Query  1949  DELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              EL++I  +H+ +  +     +  + D+ +  +P +  ++ +S P KGRGM S  DIP  
Sbjct  181   QELKLIFQKHESVNEAGTSNCDSKDEDLPLTGQPHKVVIESISTPNKGRGMSSTDDIPPA  240

Query  1772  SLVHKEDPYAAI  1737
             SL+H EDP AA+
Sbjct  241   SLIHVEDPLAAL  252



>ref|XP_002464405.1| hypothetical protein SORBIDRAFT_01g017670 [Sorghum bicolor]
 gb|EER91403.1| hypothetical protein SORBIDRAFT_01g017670 [Sorghum bicolor]
Length=261

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 166/252 (66%), Gaps = 1/252 (0%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME LKS VP  LR+ + E T   LPAT S L  FF  LP FHQV++ELTDPE+ALC KD 
Sbjct  1     MEGLKSAVPTELRRAVGEGTAADLPATTSRLFAFFDSLPLFHQVMQELTDPELALCRKDK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             + A E+K  GN CFS  ++ +AL  Y+QALR  P  S+D +  L + +YVNRAS +HK+G
Sbjct  61    AKAVELKGHGNACFSRREFREALGHYSQALRHVPITSDDMDVKLVSAIYVNRASTMHKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L  E L+DCDRA++I   Y+KAW+R+G    +L N+  A+ DL+V+L +EV+ SGK  IE
Sbjct  121   LFKESLRDCDRAISISPNYSKAWYRKGMVKTALKNYSSAVHDLEVALSLEVTSSGKNNIE  180

Query  1949  DELRIILDQHK-LKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIG  1773
              EL++IL +H+ +  +     +  + D+ +  +P +  ++ +S P KGRGM S  DIP  
Sbjct  181   QELKLILHKHECINEAGTSNCDSKDEDLPLAGQPHKVVIESISTPNKGRGMASTDDIPPA  240

Query  1772  SLVHKEDPYAAI  1737
             SL+H EDP AA+
Sbjct  241   SLIHVEDPLAAL  252



>gb|KCW75607.1| hypothetical protein EUGRSUZ_E04345 [Eucalyptus grandis]
Length=254

 Score =   241 bits (616),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 168/253 (66%), Gaps = 2/253 (1%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+LKS+VP  L+  +  S+ D + +T SSLL FF  LP+F  +V++L DPE  +CGK+ 
Sbjct  1     MERLKSMVPDTLKAVVGASSADDILSTSSSLLHFFLALPEFQLMVRDLVDPERCVCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              AA + K +GN CFS  D+  AL FY+QAL +AP ++ D +KNL ++LYVNRA AL+K+G
Sbjct  61    DAALDAKQKGNLCFSSADFSGALAFYSQALIVAPFDARDKDKNLVSVLYVNRAVALYKLG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
               +ECL+DC+RAL I   YAKAW+ RGK NAS  N+EDA+ DL V+  ME S  GKRQIE
Sbjct  121   FKIECLRDCNRALQISPGYAKAWYWRGKINASSENYEDAMADLHVANLMETSSGGKRQIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              E++++  Q      SL  +  +E+ + + D P    ++ + +P KGRGM S  +IP   
Sbjct  181   GEMKLLQVQFTRMSGSL--TQHDENIIKISDVPHEVKVKSIVMPHKGRGMASTGEIPPSY  238

Query  1769  LVHKEDPYAAIIL  1731
             LVH E+PYAA  L
Sbjct  239   LVHSEEPYAAGFL  251



>ref|XP_010905093.1| PREDICTED: uncharacterized protein LOC105032356 [Elaeis guineensis]
Length=297

 Score =   235 bits (600),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 132/290 (46%), Positives = 179/290 (62%), Gaps = 13/290 (4%)
 Frame = -3

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
             L +R+T+ V A   LELSYGPQVGQ D +DRQ +L ++YSF CQC  CS+LN SDL INA
Sbjct  2     LLIRSTEFVPAWHPLELSYGPQVGQLDLQDRQNLLEEQYSFKCQCSSCSELNFSDLIINA  61

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQ---------VEKVENERISDVAHYAVHK-  672
             +RC K  CLGVV   +    ++  L  VS           V K     IS VAH  + + 
Sbjct  62    FRCPKADCLGVVSHVSHYKKIEDDLLQVSGASYSCRLSLPVSK-HKMGISKVAHMLIKEN  120

Query  671   -ADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDI  495
                  + PG+CL+C  YRDLE +    + A  +I  L+D+I S  VP  ++S+AL++   
Sbjct  121   GVTCDIGPGYCLSCGCYRDLEFSVTASNSAMFNIQMLKDSITSKGVPDILISDALESLSH  180

Query  494   LRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIK  315
             L+   HP++K +A+ EDN+A+A   +GE + AM+HC ASI+ILEKLY   HIVIG+EL+K
Sbjct  181   LKMIRHPYSKVVAQAEDNIAEAYVRIGEFERAMNHCIASIEILEKLYPAEHIVIGHELMK  240

Query  314   LGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVIFPYLQRLQQEAGCL  168
             L SIQL   +  AA S+ K    IFS Y+GSH   IFPY++  ++EA  L
Sbjct  241   LASIQLSLDDHAAALSSIKQVEAIFSLYYGSHMTKIFPYIEAFKREAESL  290



>ref|XP_002975659.1| hypothetical protein SELMODRAFT_415607 [Selaginella moellendorffii]
 gb|EFJ23288.1| hypothetical protein SELMODRAFT_415607 [Selaginella moellendorffii]
Length=1052

 Score =   249 bits (636),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 168/519 (32%), Positives = 255/519 (49%), Gaps = 99/519 (19%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             ME+L++ VP  L + I  S    + +T ++L  F  R P F   +  L  P    CGKD+
Sbjct  1     MERLRARVPGPLLERIERSKEAEIESTAAALAAFLDRDPVFRHALDRLLQP--TTCGKDY  58

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
              +A++ K  GN+ F   DY +A+  YT+AL+L P NS     N  A ++ NRA++ HK G
Sbjct  59    ESAAKHKADGNRAFQQRDYKQAIQDYTKALKLMPWNSASC--NDLATIFSNRATSFHKSG  116

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             L +E ++DCDRA+A+  +YAKAW+RRG   A L +++ A+ D+K+ +   V  S K  I 
Sbjct  117   LKLEGIRDCDRAIALNESYAKAWYRRGLIKADLCDYQGAVLDMKLLILASVRTSLKAGIS  176

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
              +            +++Y S                         K  G+ + +++  G+
Sbjct  177   AQ------------TAMYWS-----------------------ADKQWGLRTTSEVQAGT  201

Query  1769  LVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKT  1590
             LVH E+  A I+LK  R T+CH CF  +P  +VPC  C +  YC+  C            
Sbjct  202   LVHSEEALAGILLKKHRPTHCHGCFGVVPADSVPCIGCGVVSYCNDAC------------  249

Query  1589  PRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRV  1410
                                          R +   EH+ EC G  W A LP E VLA R+
Sbjct  250   -----------------------------RDDATVEHKLECGGSGWAAALPEEGVLAARI  280

Query  1409  LVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVT  1230
             LV            +NL   +DLCH++  LP  TK+E+++ +  L  CL  S+   L  +
Sbjct  281   LV------------TNLQCEVDLCHHYNDLPSQTKVELYLLAATLAKCLMASW---LAFS  325

Query  1229  Gv-iisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSM  1053
                ++++LV+LL+ +R N+M I+ + S D  GS      A    +E V V QA+++ GS 
Sbjct  326   FEDLLAKLVLLLAMLRFNAMGIIHIYSSDETGS---SSGAHICGIEHVVVAQALFVRGSK  382

Query  1052  FNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQ  936
             FNHSC PN H  ++ RTL    T+++ A   LE+SYG Q
Sbjct  383   FNHSCSPNVHVSYVKRTLRAHCTEALPAFCPLEISYGVQ  421


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 69/116 (59%), Gaps = 5/116 (4%)
 Frame = -3

Query  530  EVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGE-PQAAMDHCKASIKILEKLY  354
            E +++ L+  +  R   HPF+K++A++ED VA+  C  G+ P AA+ H + SI+ILE++Y
Sbjct  468  EAIADGLRLLENGRKCFHPFSKQLAQMEDIVARLYCEAGQQPAAAIVHARRSIEILERIY  527

Query  353  DPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAE-IFSRYFGSHALVIFPYLQRL  189
              +HI +  E +KL SI    G   AA    + AE  FS Y+G     +FP L+R+
Sbjct  528  GKDHIAMAYERLKLASIA---GITGAARECLAMAERTFSFYYGFDYGAVFPDLKRV  580



>emb|CAN75589.1| hypothetical protein VITISV_042880 [Vitis vinifera]
Length=816

 Score =   234 bits (597),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 151/222 (68%), Gaps = 14/222 (6%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVN------ALTSSLEQVKVGQAIYLVGSMFNHSCRPNA  1026
             +VNS+AIVRMK +D    LD+ VN      A TS++EQV+VGQAIY V S+FNHSC+PN 
Sbjct  39    KVNSIAIVRMKFMDGYSPLDQSVNFSPAGGAFTSNMEQVRVGQAIYSVASLFNHSCQPNI  98

Query  1025  HAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLN  846
             HAYFLSRTL++R T+ V+ G  LELSYGPQVGQWD KDRQ+ L+D YSF C+C GCS+LN
Sbjct  99    HAYFLSRTLFLRATEHVAVGCPLELSYGPQVGQWDCKDRQKFLKDEYSFRCECSGCSELN  158

Query  845   LSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPH--------VSKQVEKVENERISDVA  690
             +SDL +NA+RC  P C G V DS +  Y  +K           +S+   +++N+ I +VA
Sbjct  159   VSDLVLNAFRCVNPDCFGTVLDSCVIKYENKKFERFQGVPQDCISEPHLQLKNDGIREVA  218

Query  689   HYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRL  564
             H A   + +   PG+CL+C  YRDLEA+ AT+ +A   I  L
Sbjct  219   HQAFANSSFRAAPGYCLHCGAYRDLEASHATVGEAGIYISXL  260


 Score =   152 bits (385),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  575  IGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAM  396
            +  LQ+AI S +VP    S+AL++ D+L+STLH +NK IAE ED +AQA C++GE Q AM
Sbjct  679  VDWLQEAIVSKEVPATTFSDALRSLDLLKSTLHAYNKGIAEAEDWIAQAFCMIGELQPAM  738

Query  395  DHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHAL  216
             HCKASI+ILEKLY  NHIVIG EL+KL SIQL  G+  A  +    A IFS Y+G HA 
Sbjct  739  HHCKASIEILEKLYGSNHIVIGYELMKLSSIQLSLGDTAAMKSISRLAAIFSWYYGPHAD  798

Query  215  VIFPYLQRLQQEA  177
            ++FPYL  L++E 
Sbjct  799  MMFPYLGSLKRET  811



>ref|XP_002323704.1| hypothetical protein POPTR_0016s15100g [Populus trichocarpa]
 gb|EEF05465.1| hypothetical protein POPTR_0016s15100g [Populus trichocarpa]
Length=227

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 136/203 (67%), Gaps = 0/203 (0%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDH  2310
             MEKLK LVP+++++ + ES+ + L +T S+LL     LPQF Q++ +L D + +LCGK+ 
Sbjct  1     MEKLKCLVPESIKRMVGESSDEDLASTSSTLLHCLLNLPQFQQMIDDLADSKNSLCGKNK  60

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
               A E+K +GN+ +   +Y  AL  Y+QALR+AP ++ D +KNL A L++NRAS  HK+G
Sbjct  61    KVALELKQKGNESYLTAEYASALESYSQALRVAPMDAVDMDKNLVATLFLNRASLFHKIG  120

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
              + E L+DC RA++I  TYAKAW+RRGKAN  LGN +DA+ D   +   E+SL GKR IE
Sbjct  121   FLTESLRDCKRAISISPTYAKAWYRRGKANVDLGNLKDAVNDFNNAKSFELSLDGKRHIE  180

Query  1949  DELRIILDQHKLKHSSLYKSNRN  1881
              EL IIL++ K       + N N
Sbjct  181   TELNIILERQKSTSRMAVQENEN  203



>gb|EPS62414.1| hypothetical protein M569_12375, partial [Genlisea aurea]
Length=249

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 156/257 (61%), Gaps = 19/257 (7%)
 Frame = -3

Query  938  QVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYV  759
            QVGQ    DRQ+ L   YSF C+C GCS+L LSDL   +YRC    C GV+ D  +A  V
Sbjct  1    QVGQSSFIDRQKFLDYVYSFRCKCSGCSELILSDLVHGSYRCKVHDCNGVILDYGIAECV  60

Query  758  KQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKP------GHCLNCNLYRDLEAACAT  597
            K+K      Q+ +V++ RI  +    +   + H  P      G CL+C    DL A    
Sbjct  61   KEKF-----QLSQVDDVRIHRLGR--LFNENNHTSPEKSSLFGKCLSCGSSCDLRAPQKA  113

Query  596  ISKAESSIGRLQDAIASNDVPVE-VLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCL  420
            I KA+ ++ RL+++ +  ++P E  +++A+K+   LR  LHP N +IAEVE+ +A+A CL
Sbjct  114  IDKADINVERLRESESRGEIPSEDAITDAVKSLGRLRKVLHPLNYKIAEVENVLAKAFCL  173

Query  419  VGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAE---  249
            +G+ QAA  HCKAS +ILE L+  +HI++GNELIKL S+Q   G   AAS  +S +    
Sbjct  174  IGDMQAAYRHCKASFEILEALHGKDHIIVGNELIKLSSVQHFVG--PAASAAESISRLRA  231

Query  248  IFSRYFGSHALVIFPYL  198
            IFSR++GSHA ++ P+L
Sbjct  232  IFSRHYGSHANLLLPHL  248



>gb|ACN33898.1| unknown [Zea mays]
Length=369

 Score =   174 bits (442),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 158/268 (59%), Gaps = 32/268 (12%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHV---------NALTSSLEQVKVGQAIYLVGSMFNHSCR  1035
             +VNS+AIV M+S+D +G   EH           A   S+EQV+V QA+Y+ GS+FNHSC+
Sbjct  90    KVNSIAIVCMRSMD-RG--PEHTINRGFYVAEGAKMCSVEQVRVAQALYVSGSLFNHSCQ  146

Query  1034  PNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCS  855
             PN HAYFLSR   +RTT+ + +GS +ELSYGPQVG+    +RQ+ L++ Y FSCQC  CS
Sbjct  147   PNVHAYFLSRAFVLRTTEFIKSGSPVELSYGPQVGEMHISERQKSLQENYYFSCQCSSCS  206

Query  854   QLNLSDLCINAYRCAKPGCLGVVPDSTL-------------ASYV-KQKLPHVSKQVEKV  717
             +LNLSDL +N++ C +  CLG + +ST               SYV K  LP VSK    +
Sbjct  207   ELNLSDLVMNSFCCPQSNCLGAISESTYYRSKENFVNVSLGGSYVCKLSLPDVSKVDMDM  266

Query  716   ENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDV  537
             EN   S + +  V     ++  G C++C    DL +A AT  + ES+I RL+     +  
Sbjct  267   ENVAKSLLQNSGV---SLNIDHGCCMSCRSCIDLSSALATSHREESTIDRLKKHTFLDKT  323

Query  536   PVEVLSNALKASDILRSTLHPFNKRIAE  453
                +++ AL++   L+   HP++K +A+
Sbjct  324   ---LITEALQSLKQLKKLRHPYSKALAQ  348



>gb|KCW57457.1| hypothetical protein EUGRSUZ_H002371, partial [Eucalyptus grandis]
Length=186

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = -3

Query  2360  VVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKN  2181
             +V++L DPE  +CGK+  AA + K +GN CFS  D+  AL FY+QAL +AP ++ D +KN
Sbjct  1     MVRDLVDPERCVCGKNKDAALDAKQKGNLCFSSADFSGALAFYSQALIVAPFDARDKDKN  60

Query  2180  LSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDL  2001
             L ++LYVNRA AL+K+G  +ECL+DC+RAL I   YAKAW+ RGK NAS  N+EDA+ DL
Sbjct  61    LVSVLYVNRAVALYKLGFKIECLRDCNRALQISPGYAKAWYWRGKINASSENYEDAMADL  120

Query  2000  KVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRN  1881
              V+  ME S  GKRQIE E++++  Q      SL + + N
Sbjct  121   HVANLMETSSGGKRQIEGEMKLLQVQFTRTSGSLTQHDEN  160



>gb|ACN31967.1| unknown [Zea mays]
Length=262

 Score =   156 bits (394),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 100/259 (39%), Positives = 148/259 (57%), Gaps = 21/259 (8%)
 Frame = -3

Query  914  DRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTL------------  771
            +RQ+ L++ Y FSCQC  CS+LNLSDL +N++ C +  CLG + +ST             
Sbjct  5    ERQKSLQENYYFSCQCSSCSELNLSDLVMNSFCCPQSNCLGAISESTYYRSKENFVNVSL  64

Query  770  -ASYV-KQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACAT  597
              SYV K  LP VSK    +EN   S + +  V     ++  G C++C    DL +A AT
Sbjct  65   GGSYVCKLSLPDVSKVDMDMENVAKSLLQNSGV---SLNIDHGCCMSCRSCIDLSSALAT  121

Query  596  ISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLV  417
              + ES+I RL+     +     +++ AL++   L+   HP++K +A+ ED +A+A   V
Sbjct  122  SHREESTIDRLKKHTFLDKT---LITEALQSLKQLKKLRHPYSKALAQAEDTIAEAFAKV  178

Query  416  GEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGN-RDAASTTKSTAEIFS  240
            G+ + A  HC+ASI+ILEKLY P HI+I +ELIKL SI L  G+   AA+T      IFS
Sbjct  179  GDQELARKHCEASIQILEKLYHPKHIIIAHELIKLVSILLSLGDGASAAATFAQAEAIFS  238

Query  239  RYFGSHALVIFPYLQRLQQ  183
             Y+GSH   +  Y+  L++
Sbjct  239  LYYGSHVEKVLTYMGALKK  257



>emb|CAN75590.1| hypothetical protein VITISV_042881 [Vitis vinifera]
Length=163

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 104/154 (68%), Gaps = 16/154 (10%)
 Frame = -3

Query  1787  DIPIG--SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVS  1614
             D PIG  S+ ++++    IILK+CR+T+CHFCFNELP  +VPC  CSIPLYCS  CQ+ +
Sbjct  8     DDPIGGKSITYEDE----IILKHCRDTHCHFCFNELPADSVPCTXCSIPLYCSQHCQMQA  63

Query  1613  GGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTED-----IAEHRHECQGVHWP  1449
             GG+E     +       L  +LEKY++     G++ P+  D     IAEH+HEC+GV+WP
Sbjct  64    GGQELRNNSKNHGICKNLSSDLEKYVA-----GITLPKDSDSNIEWIAEHKHECKGVNWP  118

Query  1448  AVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVL  1347
             AVLP E+VLAGRV+VK +EQ+K S   SNL+  L
Sbjct  119   AVLPPEIVLAGRVMVKSVEQKKHSCNASNLMDTL  152



>ref|XP_007011436.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
 gb|EOY20246.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
Length=132

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 93/161 (58%), Gaps = 35/161 (22%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDP------EMA  2328
             MEKL+ LVP+++++ ++EST D LP+  SSL+  F  LP+FHQV+ +L DP      +  
Sbjct  1     MEKLRCLVPESVKRRVAESTADDLPSVSSSLVHLFLSLPEFHQVIGDLADPGPNPKRKAG  60

Query  2327  LCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRAS  2148
             LC K+  AA ++K +GNQC+S GDY +AL  Y+Q                          
Sbjct  61    LCCKNKEAALDLKQKGNQCYSTGDYSQALRCYSQ--------------------------  94

Query  2147  ALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGN  2025
                KM L +E L+DC RAL I   Y KAW+RRGK NA+LGN
Sbjct  95    ---KMDLPMESLRDCSRALQISPCYPKAWYRRGKVNATLGN  132



>ref|XP_007894676.1| PREDICTED: SET and MYND domain-containing protein 4 [Callorhinchus 
milii]
Length=788

 Score =   130 bits (328),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 187/759 (25%), Positives = 292/759 (38%), Gaps = 148/759 (19%)
 Frame = -3

Query  2321  GKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASAL  2142
             GKD +AA   K RGN+ F  GDY +A   YT+ +  A  +S++      A+LY NR++AL
Sbjct  68    GKDPAAAQGYKERGNEQFKAGDYARAAGSYTKGISHASQDSSEI-----AILYANRSAAL  122

Query  2141  HKMGLIVECLQDCDRALAIFSTYA---KAWFRRGKANASLGNFEDAIQDLKVSLKMEVSL  1971
               +    + + D + ALA     A   K   RR +    LG+ +  +  +  +      L
Sbjct  123   CHLQRYRDSMGDVESALAHGYPPALEPKLLVRRAECQLHLGSAQQFLSAVAQAESKLSEL  182

Query  1970  SGKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLP---------  1818
              G  Q    LR  L Q +         +   S     DE +R  ++  +LP         
Sbjct  183   GG--QTATWLRRRLGQLQPWAPPGDTPSPGPSARLQADE-ERPLLENETLPGASRSVRLR  239

Query  1817  ---TKGRGMVSRADIPIGSLVHKEDPYAAIILKNCR----ETNCHFCFNELPMHAVPCES  1659
                 +GR +V+  D   G  V +E+ YAA++L   +    +++CH C ++     +PC S
Sbjct  240   FDGVRGRHLVATKDFAAGETVLREEAYAAVLLARAQPSPQDSHCHHCLSQ-AWALLPCPS  298

Query  1658  CSIPLYCSS-------------QCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSI  1518
             CS   YCS+             +C L S     G     +S    L   LE+   +    
Sbjct  299   CSYATYCSALCRQKAWADHHQVECPLGSELLALGAFA-HLSLRMVLAAGLEEV--QRTQA  355

Query  1517  GVSGPRTEDIAEHRHECQGV----HWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTV  1350
               SGPR+ +         G      W A  P   V     L+    QQ     F   LT 
Sbjct  356   AQSGPRSSEAPRATEPGDGAEAEGRWEAHPPYRAV---HSLLAHTHQQSAQHRFLCGLTA  412

Query  1349  LDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMA  1170
               LC         +++       +++     +        G + + L+  + Q+  N+ A
Sbjct  413   AALC---------SRIRAKGLEPLVVGKGLEAGDGGGQAMGALGTALLTHMLQLGCNAQA  463

Query  1169  IVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVR  990
             I +++  DT GS    V       EQV++  A+Y   S+ NHSCRPN    F  +T+ +R
Sbjct  464   ITQLR--DT-GSGRSQVEGS----EQVRIATAVYCTLSLLNHSCRPNTSLSFCRQTVTIR  516

Query  989   TTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLN------------  846
              +  + AG E+   YGP   +    +RQ+ LR +Y F C+C  CS               
Sbjct  517   ASQPIQAGQEILHCYGPHWCRLAVSERQRALRAQYFFECECSACSGEQEAARGGGGGAAE  576

Query  845   ----LSDLCINAY--------RCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERI  702
                 L   C +A         RC+   C  V+P+S L S   +    +S     ++ +R 
Sbjct  577   LGQFLCPRCGSALQSWEPELSRCSNTECGQVLPESLLLSRRAELAEQLSAASGLIDEDRT  636

Query  701   SDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVL  522
              + A                L C            + +AE                 E+L
Sbjct  637   EEAAR-------------GLLEC------------VRRAE-----------------ELL  654

Query  521   SNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNH  342
             S    A D LR          A+V D +A+A    G   AA DH K S+  +   Y  + 
Sbjct  655   S----AQDPLR----------AQVHDQLARAHATTGNWAAAADHLKRSLAAVRARYGSSS  700

Query  341   IVIGNELIKLGSIQLQ-RGNRDAASTTKSTAEIFSRYFG  228
             +  G EL KL  I    R   +A S  +   E+ + + G
Sbjct  701   VECGQELYKLSQILFNGRAVTEALSVIEEAVEVLTVHRG  739



>ref|XP_003742261.1| PREDICTED: SET and MYND domain-containing protein 4-like [Metaseiulus 
occidentalis]
Length=775

 Score =   125 bits (313),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 183/753 (24%), Positives = 302/753 (40%), Gaps = 130/753 (17%)
 Frame = -3

Query  2327  LCGKDH----SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAP------TNSNDTEKNL  2178
             LC   H      A E++  GN  F    Y +A  FYT+++  AP      +  N      
Sbjct  58    LCSSRHKKFWEKAFELRSAGNLSFGAKKYREAAEFYTRSILFAPFPDQCTSGPNQGHAEE  117

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRAL----AIFSTYAKAWFRRGKANASLGNFEDA-  2013
              A+   NR++A   +      L D  +AL       S Y K   R+G+    LG F++A 
Sbjct  118   LALSLANRSAAWFYLNKYSLALTDIAQALNNDYPSHSRY-KLHLRQGQCLLKLGKFDEAA  176

Query  2012  --IQDLKVSLKMEVSLSGKR---QIEDELRIILDQHKLK-----HSSLYKSNRNESDVTM  1863
               + D ++SL++   L  ++   QI D   I + Q+K        SS    +  E D  +
Sbjct  177   VALTDAEMSLELSPGLDEEKLSKQIRD---IEMLQNKCSAKIPVESSPETDDEPEEDEIV  233

Query  1862  LDEPDRA------NMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHF  1701
                P  +       + C+    KGR +V+  D+  G  +  E PYA+++L    +T+CH 
Sbjct  234   QPSPHSSIPNASSALDCLYSTEKGRFIVANRDVRPGDNLFVESPYASVLLPAFTKTHCHH  293

Query  1700  CFNELPMHAVPCESCSIPLY----CSSQCQLVSGGKEFGKTPRKVSRHNELPDE------  1551
             C+  +   A PC  C+   Y    CS +   +   +E G     +S       E      
Sbjct  294   CYRRIKA-AFPCRQCAQVRYCSMSCSGESWNLYHSQECGNLDLLISVGIAHLAERVILVT  352

Query  1550  ----LEKYISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQK  1383
                 ++ ++  C ++  S      +  H  +   +H   +   +      +L+K++E+Q 
Sbjct  353   GLGLIKDFMKSCNTLECSYLPVYQLVTHEED---MHIADLF--QYSFTATLLLKYLERQ-  406

Query  1382  DSSGFSNLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvi  1203
                  +   T   L   F  L             I + C   S   KL V G+++     
Sbjct  407   -----TTFFTESHLSERFQDLNLRHAERAQPKGQIRIEC---SRPLKLFVGGLLL-----  453

Query  1202  llsqIRVNSMAIVRMKSLDTKGSLDEHV---NALTSSLEQVKVGQAIYLVGSMFNHSCRP  1032
                  R     I    ++ T     +HV   + +    EQV+V  AIY   S+ NHSC P
Sbjct  454   -----RHIQQLICNAHAITTIQQPGDHVIEEDGIILEQEQVRVATAIYPSASLMNHSCNP  508

Query  1031  NAHAYFLS-RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCS  855
             N  + F S  TL V++   +++G E+   YGP   +   ++RQ  L+++Y F C C  C 
Sbjct  509   NIISGFRSGSTLVVKSVRPIASGEEVFNCYGPHFRRMTFQERQTALQEQYFFRCDCTACQ  568

Query  854   QLNLSDLCINAYRCAK-PGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAV  678
             + +L D    A RC    G L  V  S                                 
Sbjct  569   KGDLDDQISMALRCEYCEGPLSAVQSSG--------------------------------  596

Query  677   HKADYHLKPGHCLNCNLYRD-LEAACATISKAESSIGRLQDA-IASNDVPVEVLSNALKA  504
              KAD       CL C+  +D LE         +  +  LQ A + S+   +E L   L +
Sbjct  597   -KAD-------CLQCSTTQDCLEKEQKVFRMHDLFVQGLQLAEMDSHGEALERLQKCLAS  648

Query  503   SDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNE  324
              + L   L+  NK++    D VA+++C +G  + A+   K++++ +  +Y  N I +GNE
Sbjct  649   QEKL---LYRHNKQLMITRDMVAKSLCALGRFRDAVGVLKSAVESVRHMYGKNSIELGNE  705

Query  323   LIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGS  225
             L+K G + +   N    S  KS    +SR  G+
Sbjct  706   LLKFGDVLM---NATEESFAKSG---YSRELGT  732



>ref|XP_011060496.1| PREDICTED: SET and MYND domain-containing protein 4-like [Acromyrmex 
echinatior]
Length=752

 Score =   122 bits (306),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 166/753 (22%), Positives = 300/753 (40%), Gaps = 137/753 (18%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             K+   ++  KL GN+ F    Y  +L  YT +   AP++S     NLS  +  NR+++L 
Sbjct  64    KNLEKSTAFKLSGNKEFQSKKYAASLESYTNSAIYAPSSS----INLSIAI-ANRSASLF  118

Query  2138  KMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLGNFEDAIQDLKVSLKM-----  1983
              M    +C+ D + A+ +    +   K   R  +    LGN   A++ +   L+M     
Sbjct  119   YMDRWEDCINDINLAIKLGYPENLRYKLHLRAAQCYLKLGNKTSAVETV---LQMHSILN  175

Query  1982  --EVSLSGKRQIEDELRIILDQHK-LKHSSLYKSNRNE----SDVTMLDEPD----RANM  1836
                +S   K Q++ ++  I+ +   ++ ++   ++  E     DV   + P+     A +
Sbjct  176   EPNISNETKEQLQRQINDIMSKISCMEENADSTTDTAEFPSLPDVAFGENPNFRFASAAV  235

Query  1835  QCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESC  1656
             +    P KGR +V+  DI  G ++  E  +A + L + +  NC+ C        VPC  C
Sbjct  236   EIKCTPKKGRYVVANRDIKRGQILFVEKAFAFVPLCHIKSDNCYNCCRSSGNTPVPCTEC  295

Query  1655  SIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHR  1476
                +YC+  C                       DE                     + HR
Sbjct  296   VDSIYCNITCW----------------------DEAHS------------------SYHR  315

Query  1475  HECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEM  1296
              EC G      L +E+ +A   +    +   D +  + L  V  L  NF +LPP   +  
Sbjct  316   WECLGNQMG--LWAEIGIAYLAVRMLFKCTTDVTDDNRLDEVQKLVTNFSKLPPGDVISY  373

Query  1295  HIYSIILL----------------NCLQNSYAPKLPVTGviisqlvillsqIR------V  1182
              I +I+L+                 CL+        +T     +L +    +R       
Sbjct  374   GITAIMLMMYLSKYTDFFKTINLKECLKFYNDFNCDLTTEDDERLYVSSLLLRHVLQLIS  433

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N  AI ++K++      +++   +    ++ ++  AIY   SM NHSC PN    FL + 
Sbjct  434   NGHAITKIKAVVNNTRYNKNKVFIQ---QEDRIATAIYPSASMMNHSCDPNIINSFLGQF  490

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
             L  + T  ++AG E+   YG    +   KDRQ+ +  +Y F C C  CS     D+    
Sbjct  491   LITKATRDIAAGEEVFNCYGADFRRMLRKDRQEKMESQYCFKCNCAACSAPEYEDI----  546

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
                             L  +  +K P  S  +    N+  S +          H    HC
Sbjct  547   ----------------LKKFTAKKCPECSGPL----NDNCSVL----------HRSSIHC  576

Query  641   LNCN--LYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFN  468
             ++C   +Y ++     T+ +A+    + +  I  N+   E L    K   + +  L+ ++
Sbjct  577   MDCGTAVYENIYDF--TLRQAQHYFEKAEICI-ENENYDEALDKLKKCLRLRKDALYKYH  633

Query  467   KRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI---QL  297
               IA+  D +A+   ++G+   ++ + + SI  +E+ Y P  I + NE+ KL  I    L
Sbjct  634   DDIADTMDFIAKVYAIIGQWLNSISYLEHSIVAIEEKYGPWSIEVCNEINKLTDICLEYL  693

Query  296   QRGNRDAASTTKSTAEIFSRYFG-SHALVIFPY  201
             Q  +  ++   K+T +   RY   +  ++ F Y
Sbjct  694   QEESNTSSKFYKNTLKKTRRYLNRAQEIIDFTY  726



>gb|EGI61760.1| SET and MYND domain-containing protein 4 [Acromyrmex echinatior]
Length=749

 Score =   121 bits (303),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 166/751 (22%), Positives = 295/751 (39%), Gaps = 136/751 (18%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             K+   ++  KL GN+ F    Y  +L  YT +   AP++S     NLS  +  NR+++L 
Sbjct  64    KNLEKSTAFKLSGNKEFQSKKYAASLESYTNSAIYAPSSS----INLSIAI-ANRSASLF  118

Query  2138  KMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLS  1968
              M    +C+ D + A+ +    +   K   R  +    LGN   A++ +   L+M  S+ 
Sbjct  119   YMDRWEDCINDINLAIKLGYPENLRYKLHLRAAQCYLKLGNKTSAVETV---LQMH-SIL  174

Query  1967  GKRQIEDELRIILDQHKLKHSSLYKSNRNES----------DVTMLDEPD----RANMQC  1830
              +  I +E +       +   S  + N + +          DV   + P+     A ++ 
Sbjct  175   NEPNISNETKGKQINDIMSKISCMEENADSTTDTAEFPSLPDVAFGENPNFRFASAAVEI  234

Query  1829  VSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSI  1650
                P KGR +V+  DI  G ++  E  +A + L + +  NC+ C        VPC  C  
Sbjct  235   KCTPKKGRYVVANRDIKRGQILFVEKAFAFVPLCHIKSDNCYNCCRSSGNTPVPCTECVD  294

Query  1649  PLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHE  1470
              +YC+  C                       DE                     + HR E
Sbjct  295   SIYCNITCW----------------------DEAHS------------------SYHRWE  314

Query  1469  CQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTKLEMHI  1290
             C G      L +E+ +A   +    +   D +  + L  V  L  NF +LPP   +   I
Sbjct  315   CLGNQMG--LWAEIGIAYLAVRMLFKCTTDVTDDNRLDEVQKLVTNFSKLPPGDVISYGI  372

Query  1289  YSIILL----------------NCLQNSYAPKLPVTGviisqlvillsqIR------VNS  1176
              +I+L+                 CL+        +T     +L +    +R       N 
Sbjct  373   TAIMLMMYLSKYTDFFKTINLKECLKFYNDFNCDLTTEDDERLYVSSLLLRHVLQLISNG  432

Query  1175  MAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLY  996
              AI ++K++      +++   +    ++ ++  AIY   SM NHSC PN    FL + L 
Sbjct  433   HAITKIKAVVNNTRYNKNKVFIQ---QEDRIATAIYPSASMMNHSCDPNIINSFLGQFLI  489

Query  995   VRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYR  816
              + T  ++AG E+   YG    +   KDRQ+ +  +Y F C C  CS     D+      
Sbjct  490   TKATRDIAAGEEVFNCYGADFRRMLRKDRQEKMESQYCFKCNCAACSAPEYEDI------  543

Query  815   CAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLN  636
                           L  +  +K P  S  +    N+  S +          H    HC++
Sbjct  544   --------------LKKFTAKKCPECSGPL----NDNCSVL----------HRSSIHCMD  575

Query  635   CN--LYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKR  462
             C   +Y ++     T+ +A+    + +  I  N+   E L    K   + +  L+ ++  
Sbjct  576   CGTAVYENIYDF--TLRQAQHYFEKAEICI-ENENYDEALDKLKKCLRLRKDALYKYHDD  632

Query  461   IAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI---QLQR  291
             IA+  D +A+   ++G+   ++ + + SI  +E+ Y P  I + NE+ KL  I    LQ 
Sbjct  633   IADTMDFIAKVYAIIGQWLNSISYLEHSIVAIEEKYGPWSIEVCNEINKLTDICLEYLQE  692

Query  290   GNRDAASTTKSTAEIFSRYFG-SHALVIFPY  201
              +  ++   K+T +   RY   +  ++ F Y
Sbjct  693   ESNTSSKFYKNTLKKTRRYLNRAQEIIDFTY  723



>ref|XP_002425634.1| set and mynd domain-containing protein, putative [Pediculus humanus 
corporis]
 gb|EEB12896.1| set and mynd domain-containing protein, putative [Pediculus humanus 
corporis]
Length=666

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 126/525 (24%), Positives = 225/525 (43%), Gaps = 82/525 (16%)
 Frame = -3

Query  2321  GKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASAL  2142
              KD   A ++K  GN+ F  GD+ KAL  Y++++       NDT KNLS  L  NR++A 
Sbjct  63    NKDEDLALKLKELGNKAFVKGDFEKALKNYSESILKMTQYKNDT-KNLSLAL-ANRSAAF  120

Query  2141  HKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLGNFEDAIQDLKVSLKM----  1983
             + + L    + D D  L +        K + R+ K+  +L   E+ I++ K +L+     
Sbjct  121   YNLQLYNLAIDDIDLVLKLNYPKELKYKIYERKAKSLLALKKHEEGIEEFKKTLQALDDC  180

Query  1982  EVSLSGKRQIEDELRI---ILDQHKLKHSSLYKSNRNE-----SDVTMLDEPDRANMQCV  1827
             ++ +  K ++E +++I   I+++   K+ +    N N      S+   + E     +   
Sbjct  181   KLPMEKKLKMEKDIQIMLQIMNKSNDKNDNSNVENENYKLHIISEKNKIYESASVKIFMK  240

Query  1826  SLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIP  1647
             +  T GR   +  +I  G  +  E PY +++L++    NC  CF        PCE+CS  
Sbjct  241   NDSTVGRFASASENIFPGETILVEKPYCSVLLEDYHLINCQHCFKR-TQGPYPCENCSQV  299

Query  1646  LYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHEC  1467
             ++CS  C+                                          E    H++EC
Sbjct  300   IFCSLNCR------------------------------------------ESANYHKYEC  317

Query  1466  ---QGVHWPAVLPSEVVLAGRVL----VKFIEQQK----DSSGF------SNLLTVLDLC  1338
                Q +H   V  + V++A R++    +K+    K    D   F      S+ L V +L 
Sbjct  318   SILQTLHKSGVSIT-VLMALRMITQNNLKYFLNLKSKLVDEKNFDGVYKSSDYLRVYNLV  376

Query  1337  -HNFVQLPPDTKLEMHIYSIILLNCLQ-NSYAPKLPVTGviisqlvillsqIRVNSMAIV  1164
              H  ++   D   E  + ++ LL CL+  +Y  K       +++  I +  + +  + I+
Sbjct  377   RHEDLRETKDF-FERTVMALFLLKCLKLVNYFNKTDNLLETLTEDEIFIGGLILRHLQIL  435

Query  1163  RMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTT  984
             +  + +      E+ N L  S + + VG  +Y   ++FNHSC P    YF+   + VR  
Sbjct  436   QFNAHEISELEMENKNILDDS-KSLFVGGGLYPTLALFNHSCDPGIVRYFIGTQVIVRAA  494

Query  983   DSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQL  849
               +  G  +  +YGP   Q    +RQ+ L+ +Y F+C C  C +L
Sbjct  495   KPIKKGEIVAENYGPIYSQMKKLERQEKLKSQYWFTCTCTPCLEL  539



>gb|EZA53989.1| SET and MYND domain-containing protein [Cerapachys biroi]
Length=668

 Score =   108 bits (270),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 126/532 (24%), Positives = 210/532 (39%), Gaps = 93/532 (17%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             KD + A ++K  GN+ F  G++ KAL  Y+ A+ LAP+        LS +L  NR++AL+
Sbjct  65    KDSNGAIQLKDAGNKLFGRGEFAKALATYSNAVLLAPSTE------LSIIL-ANRSAALY  117

Query  2138  KMGLIVECLQDCDRALAI---FSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKM----E  1980
              +      L D + AL +    +   K   RR +   SL   +DA++  + +L+     +
Sbjct  118   HLEHHEHALGDIEEALRLGYPHNLLYKLEERRARCLLSLKRHDDAVEAFRRALRALDDAK  177

Query  1979  VSLSGKRQIEDELRIIL---DQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTK-  1812
             +    KR+ E ++R++L   D+ K   +     N+ + +V     P        S+  + 
Sbjct  178   IPSERKRKFEADIRVMLAVMDKGKRLLNEAASKNQPQVNVKQKSNPRSEENHGRSIEIRN  237

Query  1811  -----GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNEL--PMHAVPCESCS  1653
                  GR  V+  +I  G +V  E P+ A +L   R T+CH CF  +  P+ A  C +CS
Sbjct  238   EGGDVGRHAVATREIAPGEIVIAERPHCASLLAENRLTHCHLCFVRILVPISAA-CRTCS  296

Query  1652  IPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRH  1473
                 C + C                SRH             C        R  D   H  
Sbjct  297   ----CVAYC----------------SRH-------------C--------RDVDAQVHLR  315

Query  1472  ECQ--GVHWPAVLPSEVVLAGRVLVK--------FIEQQKDSSGFSNL-----------L  1356
             EC+   + W +       LA R +V+          E+ KDS   +N+           +
Sbjct  316   ECKLLPILWHSKASVTCFLALRAIVQKPYEQVLELKERIKDSGSATNITAGNPYRGDDYM  375

Query  1355  TVLDL-CHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVN  1179
             T  +L  H   +LP D     ++ + +      + Y P+   T       +         
Sbjct  376   TFYNLITHEDKRLPEDIFHRAYMAAWLFRLLKTSEYLPENVKTADSADSKLSDEELFIAG  435

Query  1178  SMAIVRMKSLDTKGSLDEHVN----ALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFL  1011
              +             + E V        +  + + +G  +Y   +M NHSC P    YF+
Sbjct  436   LLLHNLQLLQFNTHEISELVKPKGETTLAKAKSIFIGGGVYPTVAMLNHSCNPGVVRYFI  495

Query  1010  SRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCS  855
               T+ VR   +++   E+  +YGP        DR++ LR +Y F C C  CS
Sbjct  496   GTTMIVRAIRTINTSEEISENYGPIFTTMPENDRKRRLRVQYWFDCNCEACS  547



>ref|XP_002865337.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41596.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=95

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -3

Query  422  LVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEI  246
            L GE   A  HC+ASIKIL++LY+  H+VIGNE++KL SIQL  G+R  A  TTKS ++I
Sbjct  4    LAGELVVARKHCEASIKILKRLYEDEHVVIGNEMVKLASIQLASGDRSGAWDTTKSLSQI  63

Query  245  FSRYFGSHALVIFPYLQRLQQEAG  174
            FS+Y+GSHA  +F YL  L+QEA 
Sbjct  64   FSKYYGSHAETLFSYLPCLKQEAA  87



>gb|KFK45067.1| hypothetical protein AALP_AA1G339200 [Arabis alpina]
Length=143

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 77/134 (57%), Gaps = 5/134 (4%)
 Frame = -3

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIE  1950
             LI E L+DC RAL I   YAKAW RRGK N  LGN+ DA  D+ VSL +E SL GK+Q++
Sbjct  5     LIEESLRDCHRALRIDPCYAKAWHRRGKLNTILGNYRDAFCDITVSLSLESSLVGKKQLQ  64

Query  1949  DELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGS  1770
             ++L+ I D    K      S  N+    +        ++CV    KG GMVS  DI   S
Sbjct  65    NKLKAISDYQNKK-----VSKYNDVVDHLPSVQSEVKLRCVLTKEKGWGMVSECDIEQAS  119

Query  1769  LVHKEDPYAAIILK  1728
             ++H E+P++ +I K
Sbjct  120   VIHVEEPFSVVISK  133



>gb|KFK22698.1| hypothetical protein AALP_AAs70005U000100, partial [Arabis alpina]
Length=110

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 5/114 (4%)
 Frame = -3

Query  2135  MGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQ  1956
             +GLI E L+DC RAL I   YAKAW+RRGK N  LGN+ DA +D+ VSL +E SL GK+Q
Sbjct  2     LGLIEESLRDCHRALRIDPCYAKAWYRRGKLNTILGNYRDAFRDITVSLSLESSLVGKKQ  61

Query  1955  IEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVS  1794
             +++EL+ I D    K      S  N++   +        ++CVS   KGRGMVS
Sbjct  62    LQNELKAISDYQNKK-----VSEHNDAVDHLPSVQSEVKLRCVSTKEKGRGMVS  110



>ref|XP_007221772.1| hypothetical protein PRUPE_ppb024678mg [Prunus persica]
 gb|EMJ22971.1| hypothetical protein PRUPE_ppb024678mg [Prunus persica]
Length=130

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 82/174 (47%), Gaps = 52/174 (30%)
 Frame = -3

Query  710  ERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPV  531
            E I  VAH+    + +H+ PG CL C  YRDLE++ A+ +KA  SI R            
Sbjct  8    EDIDRVAHHMQINSVFHINPGLCLKCCSYRDLESSSASANKAWISIRR------------  55

Query  530  EVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYD  351
                                                   E Q AM+HCKASI+ILEKLY+
Sbjct  56   ---------------------------------------ELQPAMEHCKASIEILEKLYN  76

Query  350  PNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYLQRL  189
            PNHIVIG EL+KL SIQL  G   A  +     +IFS Y+GS+ +  FPY   +
Sbjct  77   PNHIVIGYELVKLSSIQLSLGECAAVDSINRPCDIFSCYYGSY-IQDFPYFHSI  129



>ref|XP_004525269.1| PREDICTED: SET and MYND domain-containing protein 4-like [Ceratitis 
capitata]
Length=648

 Score =   102 bits (254),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 121/535 (23%), Positives = 217/535 (41%), Gaps = 81/535 (15%)
 Frame = -3

Query  2321  GKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTE--KNLS-AMLYVNRA  2151
             GKD   + + + + ++    GD+ +AL     A+  AP    D +    LS AM Y +RA
Sbjct  81    GKDGVFSVQRRAQADKFNLLGDFKQALAHANLAVMRAPAKDVDIDIDNGLSLAMAYRSRA  140

Query  2150  SALHKMGLIVECLQDCDRALAI---FSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKME  1980
             + L  +G     + D   A +           + +  KA A LG    +   LK++ K+ 
Sbjct  141   TILINLGDGQTAISDLKLAASYGLELKDNVDYYIKLAKAYALLGETARSEISLKIAEKLS  200

Query  1979  VSLSGKRQIEDELRIILDQHKLK-------HSSLYKSNRNESDVTMLDEPDRANMQCVSL  1821
              +++ +   E EL +I    + +        S    + +  S++  L E           
Sbjct  201   GNIALREAFEKELSLIRSYERSQPAVAPPLASGENAALKGASNLVKLAETKE--------  252

Query  1820  PTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLY  1641
               KGR +V+   I  G +V  E+P  A +      ++CH CF  L +  +PC +CS   +
Sbjct  253   --KGRFIVADNYIKTGDVVLCENPLTACLSPTYFGSHCHHCFERL-ITPIPCVNCSGIAF  309

Query  1640  CSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQG  1461
             CS+QC                     + +  + Y                   HR ECQ 
Sbjct  310   CSAQC---------------------MGEACDSY-------------------HRFECQF  329

Query  1460  VHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVL--DLCHNFVQLPPDTKLEMHIY  1287
             +     + S + +   + ++   Q K       +   +  +LC +      +  L+  + 
Sbjct  330   MDL--FIGSGMSILSYLALRVFTQAKSVESAIQVANAMYENLCAHVENRQAEDYLQRSLM  387

Query  1286  SIILLNCLQNS-YAPKLPVTGviisqlvillsqIRVNSMAIVRMKS---LDTKGSLDEHV  1119
             +  LL CLQ + Y  +    GV  + + + +    +  + +++  +    +TK + + H 
Sbjct  388   AAFLLRCLQKADYFGRRKSEGVNPTAVELQVGTALLGLLQVLQYNAHEVFETKITEEHHF  447

Query  1118  NALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGP  939
                    + V VG AIY  G+ FNH C P+   YF+ + L + T         L  +YGP
Sbjct  448   EGS----KVVYVGAAIYSTGAYFNHECWPSVARYFVGKKLVLTTIKPHKPNQLLAENYGP  503

Query  938   QVGQWDHKDRQQILRDRYSFSCQCRGCSQ----LNLSDLCINAYRCAKPGCLGVV  786
                + + K+RQ+ LR RY F C+C  C +    ++  D  +  +RC  P C+ V+
Sbjct  504   IFTKNNLKERQRALRGRYLFDCKCMACQENWPTIHKIDKQVR-FRCPTPSCMNVL  557



>ref|XP_002719091.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Oryctolagus cuniculus]
Length=801

 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 148/646 (23%), Positives = 253/646 (39%), Gaps = 169/646 (26%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+P A++  I+ + T   +    SSLL+     P+    +K L+       GKD +A  
Sbjct  17    SLLPTAVQLTIATAETLSDVFLLSSSLLQ-----PEDEMFLKSLS--RGYFVGKDPAAPL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   DY  A   Y++ +  +  ++ D      A+ Y NR++AL  +G    
Sbjct  70    FYREEGNKKFQEKDYTGAAVLYSKGVSHSRPHTEDI-----ALCYANRSAALFHLGQFEA  124

Query  2117  CLQDCDRA-LAIFST--YAKAWFRRGKANASLGNFEDA---IQDLKVSLKMEVSL-----  1971
             CL+D  RA L  +      K   R+ +   +LG  ++A   I DL+ +L  + SL     
Sbjct  125   CLEDIGRAQLHGYPERLLPKMLLRKAECLVALGRPQEASQTITDLESNLTSQASLALSPF  184

Query  1970  -SGKRQIEDELRIILDQHKLKHS--SLYKSNRNESDVTMLDEPDRANMQCVSL---PTKG  1809
              + +R +      + D+  +  +  ++  +     D+    E   +    VSL   P+KG
Sbjct  185   QTLQRNLHHLKMKVRDKEAVMETFPAVLANALENMDLREESEQVSSASSSVSLGTDPSKG  244

Query  1808  RGMVSRADIPIGSLVHKEDPYAAIILK--------------NCRETN----CHFCFNELP  1683
             R +V+  D+  G L+ KED + ++++               + R +N    CH C     
Sbjct  245   RCLVATKDVLPGELLVKEDAFVSVLIPGEVPPLPHGLGSRWDTRISNGDLYCHRCLKH-T  303

Query  1682  MHAVPCESCSIPLYCSSQC--------------------------------QLVSGGKEF  1599
             +  VPC+ CS   YCS +C                                 LV+  ++F
Sbjct  304   LATVPCDGCSYAKYCSLECLRRAWELYHSAECALGGLLLTLGIFCHVALRLTLVARFQDF  363

Query  1598  GKTPRKV-----SRHNELPDE--------------------LEKYISECVSIGVSG----  1506
             GK  RK+     SR   +P+                     +E  I  C   GV+G    
Sbjct  364   GKVIRKLCDEINSRAVCVPESKDPVKTLSNGLGERETSGTAVETPIPGC---GVNGKYEN  420

Query  1505  ---------PRTEDIA-EHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLL  1356
                      P+TE+ + EH+  C                  + V  + +Q  ++GF  L 
Sbjct  421   NYNAVFNLLPQTENHSPEHKFLCA-----------------LSVSALCKQLQAAGFQALT  463

Query  1355  TVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNS  1176
               L        + PD   ++H++ + LL  +                       Q++ N+
Sbjct  464   AGLKSSKLKAAVAPDLCPDLHVWGVALLRHM----------------------LQLQCNA  501

Query  1175  MAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLY  996
              AI  ++   +K         + +S  QV++   ++ V S+ NHSC PN    F+     
Sbjct  502   QAITTIQQTGSK-------EGIITSSRQVRLATGVFPVISLLNHSCSPNTSVSFVGTVAT  554

Query  995   VRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC  858
             VR +  +  G E+   YGP V +     RQQ L+ +Y F+C C  C
Sbjct  555   VRASQHIRRGQEILHCYGPHVSRLGIAARQQKLKSQYFFNCSCLAC  600



>gb|KDR23054.1| SET and MYND domain-containing protein 4 [Zootermopsis nevadensis]
Length=688

 Score =   100 bits (248),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 142/596 (24%), Positives = 234/596 (39%), Gaps = 98/596 (16%)
 Frame = -3

Query  2384  HRLPQFHQVVKE---LTDPEMALCGKDHSAASEVKLR--GNQCFSGGDYPKALHFYTQAL  2220
             +R+    Q++KE   +  P   L G + S    + LR  GN+ F   D   AL  YTQ++
Sbjct  39    NRVEIASQLLKEHNLIATPGRYLRGNEKSLTRSIDLRNSGNKAFQKKDDKTALMLYTQSI  98

Query  2219  RLAP-----------------TNSNDTEKNLSAMLYVNRASALHKMGLIVECLQDCDRAL  2091
               AP                  N +DT   L A+   NR++ L  M     CL D  +A+
Sbjct  99    ATAPFPSMSKISNEELETDFAENEDDTSVAL-ALALANRSAVLFSMSNYEACLSDIKQAM  157

Query  2090  AIF---STYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDELRIILDQH  1920
                       K + R+GK   +LGN + A++ L  + K   S S   + + E   +  ++
Sbjct  158   KYNYPNKLLYKLFERQGKCFQALGNLKSAMESLFDARKWLFSASALTEEKKETIRLEIEN  217

Query  1919  KLKHSSLYKSNRNE-SDVTMLDEP--------DRANMQCVS-------LPTKGRGMVSRA  1788
              ++H  L  S   E S    +++P            + C S       +P  GR +V+  
Sbjct  218   FVQH--LANSKTTEISHSLQIEQPLLPSCSYGKNHEILCASDCVELKFIPEMGRYIVATR  275

Query  1787  DIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSG-  1611
             DI  G ++  E P+A+++L +C  T+C+ C  +     +PC  CS  +YCS +C+  S  
Sbjct  276   DIRPGDVLVVEKPFASVLLPDCYWTHCYNCL-QPSQSLLPCYHCSTVMYCSEKCRTSSWD  334

Query  1610  GKEFGKTPR-------KVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQGVHW  1452
                +   P        K+   + L   +   + +C  I       ED  +     +G + 
Sbjct  335   NSHYIDCPMLDILQKLKIGNMSFLALRIVILVCKCQDIQSLITSLEDEGKCIDRNRGFNN  394

Query  1451  PAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLT---VLDLCHNFVQL--------PPDTK  1305
                  S    A   LV   E+++    F   +T   +L+       L        PPD  
Sbjct  395   NGTYSSSDYSAIYWLVGNTEKREVGDLFRRAVTAACILNCLETMTDLFSVDTSSSPPDIT  454

Query  1304  LEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDE  1125
                 +   +LL  LQN       V+G                   +VR ++   K  +  
Sbjct  455   NYKLLVGGLLLRHLQNLPCNAHEVSG-------------------LVRSETRTLKDGV--  493

Query  1124  HVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNA--HAYFLSRTLYVRTTDSVSAGSELEL  951
                      + V+VG A + V S+ NHSC PN   H+Y    T  +R    ++ G ++  
Sbjct  494   ------PVWKSVEVGAAAHAVLSLLNHSCDPNVVRHSY-QGDTAVLRAIRPIAKGEQVLD  546

Query  950   SYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQ----LNLSDLCINAYRCAKPGCL  795
             +YG      D  +R+  L  +Y F+C C  C++     NL       Y CA+  C+
Sbjct  547   NYGYHYALHDRTERKSHLETQYHFTCMCVACTEDWPSYNLLPNINPIYLCARCRCI  602



>ref|XP_002063397.1| GK21416 [Drosophila willistoni]
 gb|EDW74383.1| GK21416 [Drosophila willistoni]
Length=661

 Score =   100 bits (248),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 131/602 (22%), Positives = 243/602 (40%), Gaps = 107/602 (18%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISESTPDGLPATCSSLLEFFHRLPQFHQVV  2355
             +  P+ + +   +E+  KLK     +   +I++ +       C S  E    + Q   V 
Sbjct  1     MKTPLSQTTGFFAEYYLKLKETAGSSCESDITKLS------KCQSDDERVAYVDQLEWVQ  54

Query  2354  KELTDPEMA--LCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKN  2181
             K   D ++A     KD   A+E+K R    F    + +A+  YT+     P++     + 
Sbjct  55    KGDADLQVAQEFHNKDEKLAAEIKERATAAFKAKKWLEAMLLYTRNYITLPSDKVPEVR-  113

Query  2180  LSAMLYVNRASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLGNFEDAI  2010
                +   NR++ L+ +    ECL D  R++ +        K + R+ + + +L ++   I
Sbjct  114   ---IALANRSATLYHLQKYKECLLDIQRSIDLGYPKDLIYKLYERQARCHMALKDYPHTI  170

Query  2009  QDLK--VSLKMEVSLSGKRQIE---DELRII-------------LDQHKLKHSSLYKSNR  1884
             +  K  ++   + +LS  ++ +   D + +I               Q KL  SS   +  
Sbjct  171   ESFKKCITAMDDSTLSSDKRAKLNLDAMTMIKMLQHDPRTAKQDAKQKKLATSSASSTAL  230

Query  1883  NE-----SDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCR  1719
              E     SD+  +D+    N Q      +GR   + AD+ IG  +  E PY A++L+   
Sbjct  231   QEEKEFLSDLVRIDQ----NKQ------EGRFARAAADVKIGQELLVERPYVAVLLEKYA  280

Query  1718  ETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKY  1539
             +T+C  CF    +  V C  C+  +YCS +CQ ++  K                      
Sbjct  281   KTHCEACFMRTVV-PVACPRCADVVYCSEKCQQLAANK----------------------  317

Query  1538  ISECVSIGVSGPRTEDIAEHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNL  1359
                                H++EC G+  P++  S   +   + ++ I   K  S F +L
Sbjct  318   ------------------YHKYEC-GI-LPSIWRSGASINNHIALR-IFASKPWSYFKDL  356

Query  1358  LTVLDL---CHNFVQLPPD-----TKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvi  1203
               ++D+       + LP D      +LE H       N  Q+    +     +  S  + 
Sbjct  357   KPLIDVELPVEKLISLPKDDFRRVAQLERHQTERQPSNFFQHVLMARFLAKCLRASNYLG  416

Query  1202  llsqIR--VNSMAIVRMKSL-----DTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNH  1044
                  +  V ++  + ++SL     +T    + H  + + S + + +G AIY   ++FNH
Sbjct  417   SEEPQKEDVQALTSLILRSLQFIQFNTHEVAELHKFSSSKSEKSIFIGGAIYPTLALFNH  476

Query  1043  SCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCR  864
             SC P    YF   T+++ +   + AG  +  +YGP   Q   ++RQ  L++ Y F C C 
Sbjct  477   SCDPGVVRYFRGSTIHINSVRPIEAGLPINENYGPIYTQDKREERQSRLKELYWFECCCD  536

Query  863   GC  858
              C
Sbjct  537   AC  538



>ref|XP_781331.1| PREDICTED: SET and MYND domain-containing protein 4-like [Strongylocentrotus 
purpuratus]
Length=704

 Score = 98.2 bits (243),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 79/332 (24%), Positives = 142/332 (43%), Gaps = 58/332 (17%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLS  1008
             + NS AI  ++S + + +  E V      + Q ++  A+Y   S+ NH+C+PN  A F  
Sbjct  402   KSNSHAITEVRSSEGENTAGESVGGSVQQISQGRIATAVYPTVSLMNHACQPNVIASFRK  461

Query  1007  RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLS----  840
               + VR  + +  G E++  YGPQVG     DRQQ L ++Y F+C+CR C++   +    
Sbjct  462   GIISVRAIEKIMRGDEIQHCYGPQVGHMTTSDRQQALLNQYCFTCRCRACTRKPRTFDKE  521

Query  839   -DLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADY  663
              DLCI   +C +P                                               
Sbjct  522   EDLCIKCPQCGQP----------------------------------------------L  535

Query  662   HLKPGHCLNCNLYRDLEAACATISKAESSIGRLQD----AIASNDVPVEVLSNALKASDI  495
             +++   C  C    D+      ++ A +++  L++    A+  + +  EV+S      D+
Sbjct  536   NIQTSMCGKCAERIDVGVLIHELTNAGTTLIGLEEMFSAAVNDDTLMREVISKTKSCIDV  595

Query  494   LRSTLHPFNKRIAEVEDNVAQAMCLVGE-PQAAMDHCKASIKILEKLYDPNHIVIGNELI  318
             L   + P + ++A   D++A+    + E  +AA+   KA+  I E  +  + I + +EL 
Sbjct  596   LERIIIPPDMQLATAYDDMAKCHVELDEFKEAALWLAKATPSI-ESRFGRDSIEVAHELY  654

Query  317   KLGSIQLQ-RGNRDAASTTKSTAEIFSRYFGS  225
             KL  I    +    A  T     E+F R++G+
Sbjct  655   KLAQIYFNGKEIAPAMETIDRALELFIRHYGN  686


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 87/183 (48%), Gaps = 24/183 (13%)
 Frame = -3

Query  2114  LQDCDRALAI---FSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDE  1944
             +QD D ALA     + + K   R+G+    L  F +A ++   +L+   S++G+ +   E
Sbjct  77    IQDIDEALARGYPTNKHFKVLQRKGQCFLKLHYFSEAEEEFSKALQCLDSITGEDKKRQE  136

Query  1943  LRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANM--------QCVSLPTKGRGMVSRA  1788
             ++ +L +     +  Y S  +  D+   +  ++++M         C     KGR + +  
Sbjct  137   IKTLLQESS---NPTYVSFADHFDIPDEEIKEKSSMLANASAAVTCKHQEGKGRFLEATR  193

Query  1787  DIPIG--------SLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSS  1632
             DI  G         L+ KE PYAAIILK    ++CH CF +     +PC +C    YCSS
Sbjct  194   DIAAGDRLLKAVSELLIKEKPYAAIILKEEESSHCHQCFEQCS--PIPCSNCIHARYCSS  251

Query  1631  QCQ  1623
             +C+
Sbjct  252   RCR  254



>ref|XP_007011437.1| Uncharacterized protein TCM_045604 [Theobroma cacao]
 gb|EOY20247.1| Uncharacterized protein TCM_045604 [Theobroma cacao]
Length=136

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 2/130 (2%)
 Frame = -3

Query  749  LPHVSKQVEKVENERISDVAHYAVHK--ADYHLKPGHCLNCNLYRDLEAACATISKAESS  576
            +  V+ Q  ++ +  I  VAH ++ +  +   +   +CL C  Y +L +    + KA  +
Sbjct  4    VTFVNLQAHELNDIDIKKVAHISLDETCSSLRIDSEYCLKCGSYCNLASMSEAVKKAWVN  63

Query  575  IGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAM  396
            + RLQD+I   D+    LS+AL++  ILRS LH +NK I E EDN+AQA C  G+ Q A 
Sbjct  64   LRRLQDSITLKDMHGTELSDALRSVGILRSMLHAYNKGIGEAEDNLAQAFCFTGDLQPAR  123

Query  395  DHCKASIKIL  366
            DHCKASI+ L
Sbjct  124  DHCKASIEGL  133



>ref|XP_002065883.1| GK20590 [Drosophila willistoni]
 gb|EDW76869.1| GK20590 [Drosophila willistoni]
Length=661

 Score = 95.9 bits (237),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 143/334 (43%), Gaps = 49/334 (15%)
 Frame = -3

Query  1841  NMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCE  1662
              ++ V    KGR +V+   +  G +V  E+P AA +L N   TNCH CF  L  + V C 
Sbjct  256   GVKLVETKEKGRFVVANGGLKTGDVVLCENPVAACLLPNFFGTNCHHCFKRL-RNPVACL  314

Query  1661  SCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAE  1482
              CS   +CS+QC                     + +  E Y                   
Sbjct  315   HCSGVAFCSAQC---------------------MGEASESY-------------------  334

Query  1481  HRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQ---KDSSGFSNLLTVLDLCHNFVQLPPD  1311
             HR EC+ +    ++ S + +   + ++   Q    +D    +NLL    LC +      D
Sbjct  335   HRFECEFMDL--LIGSGMSILCFIALRVFTQASSLEDGLNTANLL-FEHLCSHEDVRQAD  391

Query  1310  TKLEMHIYSIILLNCLQNS-YAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGS  1134
               L+  + +  LL  LQ + Y  +    GV  + + + ++   +  + +++  + +   +
Sbjct  392   DYLQRSLMAGFLLRILQKAQYFGRRKTEGVNPTAVELQVATSLLGLLQVLQYNAHEIYQT  451

Query  1133  LDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELE  954
             L    +    S + + VG  +Y  GS FNH C P+  +YF+ + L +RTT        + 
Sbjct  452   LVTDDHRFEGS-KTIHVGAGLYGTGSYFNHECWPSVASYFVGKKLVLRTTKPHRPNEVVA  510

Query  953   LSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQ  852
             ++YGP       K+RQ+ LR RY+FSC C  C +
Sbjct  511   VNYGPIFTTMHLKERQRSLRGRYAFSCNCMACQE  544



>ref|XP_001627273.1| predicted protein [Nematostella vectensis]
 gb|EDO35173.1| predicted protein [Nematostella vectensis]
Length=750

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/327 (24%), Positives = 138/327 (42%), Gaps = 48/327 (15%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSL---EQVKVGQAIYLVGSMFNHSCRPNAHAYFL  1011
             N  AI  + S  +    DE + +    +   EQ ++  AIY   S+ NH+C P+    F+
Sbjct  437   NVHAITAIVSTSSSDEEDEEMGSSHDQVVAREQRRIASAIYPTASLLNHACDPDVLVSFV  496

Query  1010  SRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCS---QLNLS  840
                L  R T +++ GS +   YGP V     ++RQ++L  +Y F+CQC  C+   ++  +
Sbjct  497   DGVLVARATHNIAPGSGITHCYGPHVNHMPREERQKLLYKQYFFTCQCSACTSDEEMENT  556

Query  839   DLCINAYRCAKPGC-LGVVP-DSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKAD  666
              LC +A+ C +  C +   P + +LA    +K       +EK   E +S           
Sbjct  557   RLCFSAFACPRCKCPMKTSPLEPSLARCQNKKCT-----LEKSIEEELS-----------  600

Query  665   YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRS  486
              H +    L     R +E         + ++G  Q+ + +                    
Sbjct  601   -HSRQAELLFFKAVRTMERI-----GVQEALGLFQECLRTRT-----------------Q  637

Query  485   TLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGS  306
              LHP +K +AE  D +A+   ++G+ + A  HC  S + +EK +    +   +EL KL  
Sbjct  638   ILHPHHKDLAETHDALARCYAMIGDFKLASQHCLQSSEAVEKAFGSTSVEYAHELHKLSQ  697

Query  305   IQLQ-RGNRDAASTTKSTAEIFSRYFG  228
             +    R  + A       A + + Y+G
Sbjct  698   LLFNDRQAKKALPMIDKAASLLATYYG  724


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 61/247 (25%), Positives = 105/247 (43%), Gaps = 49/247 (20%)
 Frame = -3

Query  2327  LCGKDHSAASEVKLR----GNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYV  2160
             L  K    + E+ LR    G+  F+   + +AL +Y+QA++  P  + D +  L   L  
Sbjct  22    LANKSSCKSKELSLRWCLAGDLAFTKSQFHRALSYYSQAIQYFPHQTGDQQSTLQICL--  79

Query  2159  NRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKME  1980
                                    +I S  A+  F  G+  ASL +  +A           
Sbjct  80    ----------------------PSILSKRAEVLFLVGEYEASLNDIAEA-----------  106

Query  1979  VSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESD----VTMLDEPDRAN----MQCVS  1824
              SL     I D+L + L +  L+  + +  N+N S     ++    P  AN    ++   
Sbjct  107   SSLQYNHVIRDKL-LKLQKSCLRKQARHSQNKNGSSGSACLSGGRHPKMANGSSLLKINY  165

Query  1823  LPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPL  1644
                +GR + + ++I  G  +  E+PY+A++L    +T+C  C+  L +  VPC  CS  L
Sbjct  166   DQNQGRFLQASSEIRAGDTLIAEEPYSAVLLPENAKTHCECCYKSL-VAPVPCNHCSSVL  224

Query  1643  YCSSQCQ  1623
             YCS+ C+
Sbjct  225   YCSAACR  231



>ref|XP_002589088.1| hypothetical protein BRAFLDRAFT_75068 [Branchiostoma floridae]
 gb|EEN45099.1| hypothetical protein BRAFLDRAFT_75068 [Branchiostoma floridae]
Length=909

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 139/329 (42%), Gaps = 59/329 (18%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLS  1008
             R N+ AI  ++  D+   L++         +QV++  A++   ++ NHSCRPN    F  
Sbjct  614   RCNAQAITTLQEQDSVSLLED---------KQVRLATAVFPTEALLNHSCRPNVFVSFQG  664

Query  1007  RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQL----NLS  840
             +TL VR    +  G EL   YGP  G+  + +RQ  L+++Y FSC C  C +     N  
Sbjct  665   KTLIVRAVSHIKPGEELLHCYGPHAGRMVYGERQAALKEQYFFSCSCDACQEQVGNPNTV  724

Query  839   DLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYH  660
             D+  +AY+C  P C      +  A    +KL   S                         
Sbjct  725   DM-FSAYKC--PVC------NNAAKLQDKKLVCTSP------------------------  751

Query  659   LKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILR-ST  483
                    NC+   D +    T  K +     +Q +    +  ++   + LK   +L+   
Sbjct  752   -------NCDAQGDTDDIKTTSKKIQDLF--VQSSAFLEEGQIQEAVSGLKQCLVLQWKI  802

Query  482   LHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI  303
             LHP NK IA   D +A+     G+ + +++H K S+  +E  +    + + +EL KL  +
Sbjct  803   LHPSNKDIARTHDALARCYATSGDCKKSVEHLKKSLSTVELQFGACSVELAHELHKLAQL  862

Query  302   QLQRGNRDAA--STTKSTAEIFSRYFGSH  222
             Q   G + A    T +    IF  ++G H
Sbjct  863   QF-NGQQVAECLDTIERALTIFGCHYGDH  890


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 110/263 (42%), Gaps = 44/263 (17%)
 Frame = -3

Query  2321  GKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTN--SNDTEKNLSAMLYVNRAS  2148
             GK    A+ ++ +GN  +    + +A   YT ++  +P    ++D      ++   NR++
Sbjct  64    GKSTEKANHLRDKGNAAYKAQKFQEAFTLYTDSISYSPVTHVNDDNGTECLSLALANRSA  123

Query  2147  ALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDAIQDLKVSL--  1989
              L  +     CLQD     +I S Y      K   R+ +A   LG  +DA +++K +L  
Sbjct  124   VLFHLQEYKLCLQDIQ--ASIDSGYPENLQYKLLHRKVQALFKLGKKDDAKKEVKGTLEA  181

Query  1988  --KMEVSLSGKRQIEDELRI----ILDQH---------------KLKHSSLYKSNRNESD  1872
               K ++    K  +  EL++    I  Q                KL++    +       
Sbjct  182   IEKADIPEDRKEAMRKELKLAGRNISKQEEGKEGEESAEEVKVPKLQYGESQQVAHASGG  241

Query  1871  VTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFN  1692
             V M +E D           KGR +V++     GS++  E PYAA++L+    T+CH C  
Sbjct  242   VEMREEED-----------KGRMLVAQKAFEPGSVLIVEQPYAAVLLQKHHSTHCHTCVT  290

Query  1691  ELPMHAVPCESCSIPLYCSSQCQ  1623
              + +   PC  C    YCS  C+
Sbjct  291   PV-LVPHPCRGCQYVQYCSGTCE  312



>gb|KFK22697.1| hypothetical protein AALP_AAs70005U000100, partial [Arabis alpina]
Length=92

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -3

Query  2135  MGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQ  1956
             +GLI E L+DC RAL I   YAKAW+RRGK N  LGN+ DA +D+ VSL +E SL GK+Q
Sbjct  2     LGLIEESLRDCHRALRIDPCYAKAWYRRGKLNTILGNYRDAFRDITVSLSLESSLVGKKQ  61

Query  1955  IEDELRIILDQHKLKHS  1905
             +++EL+ I D    K S
Sbjct  62    LQNELKAISDYQNKKVS  78



>ref|XP_009066029.1| hypothetical protein LOTGIDRAFT_169490 [Lottia gigantea]
 gb|ESO83273.1| hypothetical protein LOTGIDRAFT_169490 [Lottia gigantea]
Length=862

 Score = 92.8 bits (229),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 127/256 (50%), Gaps = 35/256 (14%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             K    A++ K  GN  F   +Y  A+ FYT+++ L+P N+     N  A+ Y NR++AL+
Sbjct  66    KSSEKAAKCKNNGNIHFKKRNYGNAIEFYTESVLLSPVNNG----NDLALAYGNRSAALY  121

Query  2138  KMGLIVECLQDCDRAL-AIF--STYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLS  1968
              +    ECL D +RA+ + F   +  K + RR +    L +F+ A  +L+ +L    S  
Sbjct  122   HLCKYEECLTDIERAVESGFPEESLYKLYTRRIQCRLQLNDFQHAGYELESTLTFINSQK  181

Query  1967  GK---RQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPT------  1815
              K   ++ E  ++ I    K  H      N++ES +T   +  +     VS  T      
Sbjct  182   DKIESKKFESVMKEIEGLQKTLH------NKSES-LTETKKTAQLKEHVVSYGTNDILTQ  234

Query  1814  ------------KGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAV  1671
                         +GR + +  +I +G  +  E P+++++L +  +T+CH C+++LP++ V
Sbjct  235   ASNCIDMRYTKEQGRYLTTNREIEVGDTLIVEKPFSSVLLPDHYKTHCHHCYHKLPLNLV  294

Query  1670  PCESCSIPLYCSSQCQ  1623
              C  CS+  YCSS+CQ
Sbjct  295   GCIQCSVVRYCSSKCQ  310


 Score = 90.5 bits (223),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 83/325 (26%), Positives = 137/325 (42%), Gaps = 36/325 (11%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++  DT        +++     QV++  AIY   S+ NHSC P   + F   T
Sbjct  537   NAHAITEVQCTDTIN------DSMILDTSQVRIATAIYPTASLMNHSCDPTIISSFHGDT  590

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
             L V++   V  G E+   YGP   +   K RQ++L ++Y F C+C  C +    D+  NA
Sbjct  591   LIVKSVKKVLEGEEIYNCYGPHHKRMVRKRRQEVLENQYFFHCKCPPCCEERAGDIKFNA  650

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHV--SKQVEKVENERISDVAHYAVHKADYHLKPG  648
               C    C G++  ++       +LP      Q E   ++ I       +H+    L   
Sbjct  651   AIC--NSCTGIIDTTS-------ELPQCLDCGQTEDTASKEIRQQIEGLLHQGVTSL---  698

Query  647   HCLNCNLYRDLEAACATISKAESSIGRLQDAIAS---NDVPVEVLSNALKASDILRSTLH  477
                       L+ +     K    +  L   + S   +    E L   L    +    LH
Sbjct  699   ----------LQHSNTQAFKYTRLVMFLHQGVTSLLQHSNTQEALKFLLLCYKLCCKHLH  748

Query  476   PFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQL  297
              +N   A V+D++A+   + G+   A+ H + SIK+ E +Y  + I +G+EL KL  I  
Sbjct  749   EYNVIRASVDDSLARGYTVQGDHIKAVHHLQDSIKVTEAMYGSDSIEVGHELQKLADILF  808

Query  296   --QRGNRDAASTTKSTAEIFSRYFG  228
               QR   +A         IF+ ++G
Sbjct  809   NAQRA-EEALRVLHRAIYIFTAHYG  832



>gb|ETN65695.1| hypothetical protein AND_002531 [Anopheles darlingi]
Length=648

 Score = 92.0 bits (227),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 120/552 (22%), Positives = 226/552 (41%), Gaps = 106/552 (19%)
 Frame = -3

Query  2321  GKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASAL  2142
             GK   +A +++  G Q  +G D+  AL  Y Q+  L P    D   +  A+L   R+  L
Sbjct  62    GKCLESALKLQADGLQLQNGDDWVGALRAYNQSYLLLP----DDCPHEKALLLDKRSQVL  117

Query  2141  HKMGLIVECLQDCDRALA----------IFSTYAKAWFRRGKANASLGNFEDAIQDLKVS  1992
              ++G   + L+D DRA+           ++   A+ + ++    +++  F+  ++ L  S
Sbjct  118   LQLGKHDQSLEDIDRAIGYGYPVEFLHDLWERKARLYQQKRDLKSAVECFDKTVECLAHS  177

Query  1991  LKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTM----LDEPDRANMQCVS  1824
                E   S +  IE ELR + D    ++ ++ K         +    LD+  R +    S
Sbjct  178   QLNEADRSVR--IE-ELRKLTDIVYFQYKNVKKYLEPPRGTRVFHPHLDDAVRYD----S  230

Query  1823  LPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPL  1644
               T GR   ++ ++     + KE P+ A +++    T+C  CF  + +    C +C   +
Sbjct  231   NETDGRYATAQKNLKPNQHILKEKPHGATLVQEYSGTHCSTCFERVEI-LFCCPNCVDVV  289

Query  1643  YCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAEHRHECQ  1464
             +CS +C+                                        +T + + HR+EC 
Sbjct  290   FCSGRCE----------------------------------------KTANQSYHRYECG  309

Query  1463  GVH--WPAVLPSEVVLAGRVLVK----FIEQQKD-----SSGFSNLLT------VLDLCH  1335
              +   W +      +LA R++ +    + E  +D     ++ F++ L+      V +L  
Sbjct  310   FLRSLWSSGATIVSLLALRIVTQKPYSYFEAIRDELPNLTANFTDKLSSDDYRKVFNLVT  369

Query  1334  NFVQLPPDTKLEMHIYSIILLNCLQ-----NSYAPKLPVTGviisqlvillsqIRVNSMA  1170
             +  +  P+  L   + + +L   L+     N+  P     G ++           ++++ 
Sbjct  370   HSDKRDPEDYLVWTLMAAMLNTILRHGNYTNTEQPDDGFIGYLL-----------LHNLQ  418

Query  1169  IVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVR  990
             IV   + D      +  N    S   V +G A+Y + ++FNHSC P    YF   T++VR
Sbjct  419   IVNYSAHDVAELQRKRPNEAGKS---VAIGAALYPLLALFNHSCDPGIVRYFSGTTVHVR  475

Query  989   TTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQ----LNLSDLCINA  822
             T  +++AG  +  +YGP   + +  +R+Q L   Y F C C  C Q        D  +  
Sbjct  476   TIKNIAAGQIIAENYGPLYTKMERTERRQSLAANYKFQCNCDACRQDWQLYTHMDESVIR  535

Query  821   YRCAKPGCLGVV  786
             +RC  P C G +
Sbjct  536   FRCTGPACQGAL  547



>ref|XP_002733823.1| PREDICTED: SET and MYND domain-containing protein 4-like [Saccoglossus 
kowalevskii]
Length=644

 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 119/299 (40%), Gaps = 41/299 (14%)
 Frame = -3

Query  1115  ALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQ  936
             +  ++ +Q+++  A+Y   SM NHSC PN  A +    L +R T+ +  G E+   YGP+
Sbjct  362   SFVATTQQIRIAVAVYGTASMLNHSCTPNVIAGYDGNQLTIRATEMIKKGGEVLHCYGPR  421

Query  935   VGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVK  756
             V      +R ++LRD+Y F+C+C  C     +     A RC         P  +  S V 
Sbjct  422   VSDMFRDERLKVLRDQYYFTCKCMFCGIPQEAITPSGALRC---------PRCSDMSGVY  472

Query  755   QKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLN--CNLYRDLEAACATISKAE  582
             Q  P V+                            G C N  C+    L      I  A 
Sbjct  473   QT-PEVT----------------------------GQCCNFDCHHSWKLGETDEKIENAR  503

Query  581   SSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQA  402
                   +  I   +   E LS   KA  I +S L+  NK +AE ED +A      G    
Sbjct  504   QLFRVGKTLIGDKNKVKECLSTLHKAYKIQQSVLYKHNKELAETEDCLALCYASFGNYHY  563

Query  401   AMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGN-RDAASTTKSTAEIFSRYFG  228
             A  + K SIK    LY  + I IG+EL KL  I     N  +         +I S ++G
Sbjct  564   AAKYLKLSIKSNIILYGEDSIEIGHELYKLAQILFNCKNVTEGLGVIDKAVKIISDHYG  622



>ref|XP_002865338.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41597.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=81

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = -3

Query  380  SIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAA-STTKSTAEIFSRYFGSHALVIFP  204
            SI+IL++LY+  H+VIGNE++KL SIQL  G+R  A  TTKS ++IFS+Y+GSHA  +F 
Sbjct  4    SIEILKRLYEDEHVVIGNEMVKLASIQLASGDRSGAWDTTKSLSQIFSKYYGSHAETLFS  63

Query  203  YLQRLQQEAG  174
            YL  L+QEA 
Sbjct  64   YLPCLKQEAA  73



>ref|XP_002740933.1| PREDICTED: SET and MYND domain-containing protein 4-like [Saccoglossus 
kowalevskii]
Length=669

 Score = 89.4 bits (220),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 67/251 (27%), Positives = 119/251 (47%), Gaps = 18/251 (7%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             K  + + +++ +GN  F    + KAL+ YT+++  AP       + LS + + NRA+ L 
Sbjct  69    KTSAESKKLRSKGNTAFQKKQFDKALYLYTESVMTAPIQEESNCEELS-LAFGNRAAVLL  127

Query  2138  KMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLS  1968
              MG    CL D DRA           K + RRG+   +L    DAI   K ++       
Sbjct  128   HMGKFEYCLDDIDRAFEYGYPEDLKYKLYDRRGQCFYNLKRKFDAIACFKDAMSWVDKSK  187

Query  1967  GKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDR----ANMQ--CVSL-----  1821
               R+     ++ LD+   K   + +S  +      L  P +    +N+   C+S      
Sbjct  188   LDRKKRKSFKVCLDKQLDKCQKMMESTESVGLQKKLKIPPKLSYGSNLHVPCMSSAVTIE  247

Query  1820  --PTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIP  1647
               P KGR  V+  D+ +G ++  E+PY+++ L+ C  ++CH C+  + + ++PC  C+  
Sbjct  248   SSPDKGRYAVATRDVKVGDVLIVENPYSSVGLQPCNVSHCHHCYIRV-LASIPCLQCAGI  306

Query  1646  LYCSSQCQLVS  1614
             +YCS +C+  S
Sbjct  307   VYCSKECRNAS  317



>ref|XP_008208924.1| PREDICTED: SET and MYND domain-containing protein 4-like [Nasonia 
vitripennis]
Length=751

 Score = 88.6 bits (218),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 130/316 (41%), Gaps = 47/316 (15%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N  AI R+   D+     E  N +T    Q ++  AIY   SM NHSC PN    F  + 
Sbjct  440   NGHAITRLNISDS-----ESGNVVTEY--QCRIATAIYPSASMMNHSCDPNIINSFKDQY  492

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
             L V+ T  ++A  E+   YGP   +   KDRQ  L+++Y F+C+C  C+Q  L +     
Sbjct  493   LIVKATKDIAAKEEVFNCYGPHYRRMRKKDRQIALQNQYCFTCECEACTQRALQNFSDKF  552

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
              R     C G V          + + H S +                            C
Sbjct  553   QRFNCEECNGPV----------EIISHSSMR----------------------------C  574

Query  641   LNCNLYRDL-EAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNK  465
             L+C    DL ++    + +A       +  + S  V  E L NA +  +I +  L+ +++
Sbjct  575   LDCETTFDLVKSQLLELEEANKLFEAAKINLKSQKVK-EALENAKQCLEIRKRILYEYHE  633

Query  464   RIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGN  285
              +    D + +   + G    ++ H + S+  +E+ + P+ I + NEL K+  I +Q   
Sbjct  634   SVTLTYDLIGKIFAVTGRWLDSISHLEHSLAAVEERFGPDSIELANELNKITDICIQYLR  693

Query  284   RDAASTTKSTAEIFSR  237
              +  + TK    I  +
Sbjct  694   EETNTNTKQYKNILKK  709


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 66/249 (27%), Positives = 120/249 (48%), Gaps = 24/249 (10%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             K+   + E++ +GN+ F    Y  ++  YT +L+ AP  S D    L+     NR++AL 
Sbjct  61    KNIQKSEELRKQGNKEFQNKKYLTSIKSYTLSLQYAPWESEDLPLALA-----NRSAALF  115

Query  2138  KMGLIVECLQDCDRALAI---FSTYAKAWFRRGKANASLGN---FEDAIQDLKVSLKME-  1980
              M     C++D + AL      S   K + R  +    LGN    E+A++ +   L+   
Sbjct  116   YMEKYEACIKDIELALEYDYPKSMLYKLYLRAAQCYLKLGNKSCMEEALRKVHECLESNS  175

Query  1979  VSLSGKRQ-IEDELRIILDQH-KLKHSSLYKSNRNE-SDVTMLDEPDRAN----MQCVSL  1821
             + LS K++ IE ++ ++L +  K++ +++   +  +  D    + PD  N    +     
Sbjct  176   IFLSSKKESIEKQIDMLLAEAIKIEETTICCDDDCKLPDPAFGENPDFPNASAALDLKFS  235

Query  1820  PTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHA---VPCESCSI  1650
               KGR +V+  D+  G ++  E P+A ++L N  E +   C N L       VPC+ C+ 
Sbjct  236   VDKGRHVVANRDVQKGEVLFVEKPFAFVLLDN--EYSDAVCANCLKFRGDVPVPCKFCAS  293

Query  1649  PLYCSSQCQ  1623
              +YC+ QC+
Sbjct  294   TVYCTEQCR  302



>ref|XP_001181205.2| PREDICTED: SET and MYND domain-containing protein 4-like [Strongylocentrotus 
purpuratus]
Length=679

 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 68/130 (52%), Gaps = 2/130 (2%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLS  1008
             + NS AI  ++  + + +  +        + Q +V  A+Y   SM NH+C PN    F  
Sbjct  380   KSNSHAITEVRPSEGENTAGKSAGGTVEEISQFRVATAVYPTVSMMNHACIPNIIPSFRK  439

Query  1007  RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQ--LNLSDL  834
               L VR T  +  G E++  YGPQVG     DRQQ L ++Y F+C+CR C++   +  +L
Sbjct  440   GILCVRATKKIMHGDEIQHCYGPQVGHMTTSDRQQALLNQYCFTCRCRACTRDPKSRDNL  499

Query  833   CINAYRCAKP  804
             C+   +C +P
Sbjct  500   CMKCPKCGQP  509


 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 106/227 (47%), Gaps = 48/227 (21%)
 Frame = -3

Query  2285  RGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECLQD  2106
             +GNQ F   +Y  AL  YT+++++AP +  DT     A+ + NR++AL  +G     +QD
Sbjct  49    KGNQLFQKRNYRGALECYTKSVQVAPHDGKDT----LALAHANRSAALFHLGRYKASIQD  104

Query  2105  CDRALAI---FSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDELR-  1938
              D AL      + + K   R+G+    L N  +A ++   +L+   S++G    ED+ R 
Sbjct  105   IDEALTRGYPTNKHVKVLQRKGQCFLKLHNLSEAEEEFSKALRCLDSITG----EDKKRR  160

Query  1937  --IILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGSLV  1764
               I+ +  K  H S +++ R                                DI  G L+
Sbjct  161   GIILPNPFKYWHFSYFQATR--------------------------------DIAAGELL  188

Query  1763  HKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQ  1623
              KE PYAAIILK    ++CH CF +     +PC +C    YCSS+C+
Sbjct  189   IKEKPYAAIILKEEESSHCHHCFEQCS--PIPCPNCIHARYCSSRCR  233



>dbj|BAH72397.1| ACYPI003270 [Acyrthosiphon pisum]
Length=256

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = -3

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
             E K +GN  F+  +Y  A+ FYTQAL + P     TEK L + LY NRA+A  K+     
Sbjct  89    EFKKQGNAEFTKQNYDAAITFYTQALSMCPL----TEKGLLSTLYQNRAAAYSKLNNNEN  144

Query  2117  CLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKME  1980
             C+ DCD+ALA+  TY KA  RR +A   LGNF+ A++D+   + ++
Sbjct  145   CVADCDKALALVPTYKKALSRRARALTELGNFKLALEDITAVVMLD  190



>ref|XP_002128556.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Ciona 
intestinalis]
Length=430

 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 85/331 (26%), Positives = 136/331 (41%), Gaps = 67/331 (20%)
 Frame = -3

Query  1844  ANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPC  1665
              N++  +    GRG+ ++ ++  GS V   +PYA ++ K  +   C FCF +     + C
Sbjct  3     VNVELFTSEKSGRGLKAKRNLNPGSTVLSSEPYAYLLSKKQKGVYCDFCFKKQD-GLLQC  61

Query  1664  ESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIA  1485
               C    YC+  CQ ++                      E + +EC ++    P+     
Sbjct  62    SGCKYMKYCNRNCQKMAWN--------------------EHHKAECPALKNVMPKRP---  98

Query  1484  EHRHECQGVHWPAVLPSEVVLAGRVLVKFIEQQKDSSGFSNLLTVLDLCHNFVQLPPDTK  1305
                            P  V+L GR+L     QQ  S+      ++LDL  N+ +L  + K
Sbjct  99    ---------------PDFVILLGRLLWNM--QQYSSAKLPEKNSILDLESNYNKLSQNQK  141

Query  1304  LEMHIYSIILLNCLQNSYAPK-LPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLD  1128
               +  + +IL       ++PK LP        L+ L ++I+ NS AI            +
Sbjct  142   EALMNFLVIL----HTFWSPKPLPPQVTDNKMLLELCARIKNNSFAIC-----------N  186

Query  1127  EHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELS  948
             E +        Q  VG  +YL  S  NHSC PN  A F  RTL +R   +++AG E+ +S
Sbjct  187   EEL--------QSDVGTGVYLNCSFINHSCEPNCVAEFNMRTLKIRAVKNITAGEEVLIS  238

Query  947   YGPQVGQWDHKDRQQILRDRYSFSCQCRGCS  855
             Y          +RQ+ L   Y F C C  C+
Sbjct  239   YVDLFA--TSFERQRELMSIYHFQCTCHSCN  267



>ref|XP_001943918.1| PREDICTED: mitochondrial import receptor subunit TOM70 [Acyrthosiphon 
pisum]
Length=571

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = -3

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
             E K +GN  F+  +Y  A+ FYTQAL + P     TEK L + LY NRA+A  K+     
Sbjct  89    EFKKQGNAEFTKQNYDAAITFYTQALSMCPL----TEKGLLSTLYQNRAAAYSKLNNNEN  144

Query  2117  CLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKME  1980
             C+ DCD+ALA+  TY KA  RR +A   LGNF+ A++D+   + ++
Sbjct  145   CVADCDKALALVPTYKKALSRRARALTELGNFKLALEDITAVVMLD  190



>ref|XP_004594020.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Ochotona princeps]
Length=797

 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 84/316 (27%), Positives = 126/316 (40%), Gaps = 51/316 (16%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLS  1008
             + N+ AI  ++  D+K SL      +TSS  QV++   ++ V S+ NHSC PN    F+ 
Sbjct  494   QCNAQAITAIQQTDSKESL------ITSS-RQVRLATGVFPVLSLLNHSCSPNTSVSFVG  546

Query  1007  RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCI  828
                 VR +  +  G EL   YGP V   D   RQQ L+ +Y F C C  C        C 
Sbjct  547   TVATVRASQHIGQGQELLHCYGPHVSHLDVAVRQQKLKSQYFFDCSCPAC--------CS  598

Query  827   NAY-RCAKPGCLGVVPDSTLASYVKQKLPHVSKQV--EKVENERISDVAHYAVHKADYHL  657
              A    A P   G    S  A      + H       E V  +R++              
Sbjct  599   EAQPSTAGPRWAGFCCSSCRALLQGDAVLHCGSGSCPEAVSRDRLASRLR----------  648

Query  656   KPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLH  477
                     +L R + AA   +       G+L+ AI       + L     +++      H
Sbjct  649   --------DLKRQIAAALELLGS-----GKLKGAI-------QQLQGCQHSAESFLWVEH  688

Query  476   PFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQL  297
                  + E+ D +AQA   +G+ Q A  H + S+ ++E  Y  + I +G+EL KL  I  
Sbjct  689   SL---LGEIADYLAQAYATLGDWQKAAAHLRKSLAVVEARYGTSSIEMGHELFKLAQILF  745

Query  296   QRGNRDAASTTKSTAE  249
                    A +T   AE
Sbjct  746   NGMEIHEALSTIQKAE  761


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 84/340 (25%), Positives = 145/340 (43%), Gaps = 55/340 (16%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEIS--ESTPDGLPATCSSLLEFFHRLPQFHQ  2361
             ++LPV+   +    H+ +  SL+P +++  IS  E+  D        LL + H  P+   
Sbjct  1     MDLPVEPWKL----HLLQKWSLLPTSVQGAISTAETLSDIF------LLSYSHLQPEDEL  50

Query  2360  VVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKN  2181
              +K L+     L GKD  A    +  GN+ F   D+  A   Y++ +  A  N+ D    
Sbjct  51    FLKSLSGD--YLVGKDPKAPLFYREEGNRKFEEKDFAGAAVLYSKGVSHAGPNTEDM---  105

Query  2180  LSAMLYVNRASALHKMGLIVECLQDCDRA-LAIFST--YAKAWFRRGKANASLGNFEDA-  2013
               ++ Y NR++AL  +G    CL+D  RA L  +      K   R+ +   +LG  ++A 
Sbjct  106   --SLCYGNRSAALFHLGQFEACLEDISRAELHRYPERLLPKMLLRKAECLLALGRPQEAS  163

Query  2012  --IQDLKVSLKMEVSLSGKR-----QIEDELRI-ILDQHKLKHSSLYKSNRNESDVTMLD  1857
               I  L+  L  + +L+  R        D L++ + +Q     +S    +    D  +L+
Sbjct  164   LTIAALEGHLAAQPNLAPSRLRALQSSLDGLKLKVQNQETFPETSPAAPSHTVEDTEILE  223

Query  1856  EPDRANMQCVSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCR---------  1719
             +  +      S+     P KGR +V+  DI  G L+ KED + ++++   +         
Sbjct  224   KSKQVPGASSSVRLDTDPVKGRCLVATRDILPGELLVKEDAFVSVLIPGEKPPLRCGLGS  283

Query  1718  ---------ETNCHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                      +  CH C     +  VPC  CS   YCS +C
Sbjct  284   RWDAGISNGDLYCHQCLKPT-LATVPCPRCSYAKYCSPRC  322



>ref|XP_004376314.1| PREDICTED: SET and MYND domain-containing protein 4 [Trichechus 
manatus latirostris]
Length=800

 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 135/317 (43%), Gaps = 47/317 (15%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLS  1008
             + N+ AI  ++   +K S+      +T S  QV++   I+ V S+ NHSC PN    F+S
Sbjct  498   QCNAQAITTIQQTGSKESI------ITDS-RQVRLATGIFPVVSLLNHSCSPNTSVSFIS  550

Query  1007  RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCI  828
                 +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C +        
Sbjct  551   TVATIRASQQIGKGQEILHCYGPHESRMGVAERQQKLRSQYFFECNCPACHE--------  602

Query  827   NAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPG  648
                           P +T     +    H  + V + +     DV           +  G
Sbjct  603   -------------EPRATAGPRWEAFCCHSCRAVMQGD-----DVLSCGNRSCMESVSRG  644

Query  647   HCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFN  468
             H +  +  +DL+       K   + G+L+ AI       ++L     A   L +     +
Sbjct  645   HLV--SRLQDLQQQVGMAQKLLRN-GKLEQAIQ------QLLGCQRDAESFLSAE----H  691

Query  467   KRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQ-R  291
               + E+ED++AQA   +G+ Q +  H + S++++E  + P+ I +G+EL KL  I    R
Sbjct  692   TMVGEIEDDLAQAYAALGDWQKSATHLQKSLRVVEVRHGPSSIEMGHELFKLAQIFFNGR  751

Query  290   GNRDAASTTKSTAEIFS  240
                +A +T +   ++ S
Sbjct  752   AVPEALNTIQKAEKVLS  768


 Score = 67.4 bits (163),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 78/327 (24%), Positives = 139/327 (43%), Gaps = 65/327 (20%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLE-----FFHRLPQFHQVVKELTDPEMALCGKD  2313
             SL+P  ++  IS + T   +   CSSL +     F  RL + + +            GKD
Sbjct  17    SLLPTPIQDTISAAETLSDIFLHCSSLFQPEDEMFLERLSRGYSL------------GKD  64

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
              +A+   K  GN+ F   DY  A   Y++ +  +  N+        ++ Y NR++AL  +
Sbjct  65    SNASLFCKEGGNRKFQEKDYMGAAVLYSKGVSHSRPNTEAI-----SLCYANRSAALFHL  119

Query  2132  GLIVECLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGK  1962
             G    CL+D  RA +         K   R+ +   +LG  ++A Q +     +E   + +
Sbjct  120   GQYETCLEDIIRAQSHGYPERLQPKMMLRKAECLVTLGRLQEASQTIS---DLEGIFAAR  176

Query  1961  RQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDR-----ANMQ  1833
               +      +L +  H LK     K N +E+          D+ +++E ++     +++ 
Sbjct  177   PTLAASHFQVLQRNLHHLKTKVQEKENISETFPAAPTKAFKDMDLMEESEQIPSASSSVS  236

Query  1832  CVSLPTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----C  1707
               + P KGR +++  DI  G ++ KED + +++                + R TN    C
Sbjct  237   LCTDPLKGRYLIATKDILPGEILVKEDAFVSVLNPGEMPQLHHGLESKWDTRVTNGDLHC  296

Query  1706  HFCFNELPMHAVPCESCSIPLYCSSQC  1626
             H C     +  VPC+ CS   YCS +C
Sbjct  297   HRCLKHT-LATVPCDQCSYAKYCSQEC  322



>ref|XP_010977200.1| PREDICTED: SET and MYND domain-containing protein 4 [Camelus 
dromedarius]
Length=801

 Score = 83.6 bits (205),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 74/353 (21%), Positives = 139/353 (39%), Gaps = 74/353 (21%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLS  1008
             + N+ AI  ++   +K         L +   QV++   ++ V S+ NHSC PN    F+S
Sbjct  498   QCNAQAITTIQQTGSK-------EKLITDSRQVRLATGLFPVISLLNHSCSPNTSVSFIS  550

Query  1007  RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCI  828
              +  +R +  +  G E+   YGP   +    +R Q L+ +Y F C C  C +        
Sbjct  551   TSATIRASQQIRKGQEILHCYGPHESRMGVAERHQKLKSQYFFDCNCSPCER--------  602

Query  827   NAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPG  648
                                               EK  +++      +  H     L+ G
Sbjct  603   ----------------------------------EKQSSQKGPGREAFCCHACGALLQGG  628

Query  647   HCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNA---------LKASDI  495
               L+C       A+C      +  + RLQ+      +  ++L N          L+    
Sbjct  629   DVLSCG-----TASCTESVSRDHLVSRLQNLQQQVGMARKLLRNGKLERAIQLLLRGQHD  683

Query  494   LRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIK  315
               S L   +  + E+ED++A+A   +G+ + +  H + S++++E  + P+ I +G+EL K
Sbjct  684   AESFLSSEHSMVGEIEDHLARAYAALGDWEKSAAHLQKSLRVVEACHGPSSIEMGHELFK  743

Query  314   LGSIQLQR-GNRDAASTTKSTAEIFSRYFGSHALVIFPY---LQRLQQEAGCL  168
             L  I        +A +T +   E+   ++G       P+   +Q LQ+   C+
Sbjct  744   LAQIFFNGFAIPEALNTIQKAEEVLLVHYG-------PWNNEVQELQKMKSCI  789


 Score = 66.6 bits (161),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 88/348 (25%), Positives = 156/348 (45%), Gaps = 71/348 (20%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQV  2358
             ++LPV++     + H+ +  SL+PK+++  IS + T + +    SSLL+     P+    
Sbjct  1     MDLPVEE----WTSHILQKWSLLPKSIQVTISTAETLNDIFLHSSSLLQ-----PEDEIF  51

Query  2357  VKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNL  2178
             +K L+     L GKD  A    +  GN+ F   DY +A   Y++ +  +  ++ D     
Sbjct  52    LKRLSGD--YLVGKDPDAPLFYREEGNKKFQKKDYLEATVLYSKGVSHSRPHTEDI----  105

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDA  2013
              ++ Y NR++AL  +G    CL+D +RA      Y      K   R+ +   +LG   +A
Sbjct  106   -SLCYANRSAALFHLGQYETCLKDINRAQ--MHGYPERLQPKMLLRKAECLVTLGRLPEA  162

Query  2012  ---IQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLY---KSNRNES--------  1875
                I DL+ +   + +L+       +L+I+  Q  L H  +    K N  E+        
Sbjct  163   SQAISDLESNFAAKPTLAA-----SQLQIL--QRTLCHLKIKVQEKENLTEAFPAALTKA  215

Query  1874  --DVTMLDEPDR-----ANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAII------  1734
               DV +  E ++     +++   + P KGR +V+  DI  G L+ KE  + +++      
Sbjct  216   FEDVDLRQENEQISSASSSVSLCTDPLKGRYLVATKDILPGELLVKEHAFVSVLNPGEMP  275

Query  1733  -----LKNCRETN-------CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                  L++  +T        CH C     +  VPC+ CS   YCS +C
Sbjct  276   PRHHSLESKWDTRVTTGDLYCHRCLKH-TLATVPCDGCSYAKYCSQEC  322



>ref|XP_006185117.1| PREDICTED: SET and MYND domain-containing protein 4 [Camelus 
ferus]
 ref|XP_010956495.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Camelus bactrianus]
 ref|XP_010956496.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Camelus bactrianus]
 ref|XP_010956497.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Camelus bactrianus]
Length=801

 Score = 83.6 bits (205),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 76/353 (22%), Positives = 141/353 (40%), Gaps = 74/353 (21%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLS  1008
             + N+ AI  ++   +K  L      +T S  QV++   ++ V S+ NHSC PN    F+S
Sbjct  498   QCNAQAITTIQQTGSKEKL------ITDS-RQVRLATGLFPVISLLNHSCSPNTSVSFIS  550

Query  1007  RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCI  828
              +  +R +  +  G E+   YGP   +    +R Q L+ +Y F C C  C +        
Sbjct  551   TSATIRASQQIRKGQEILHCYGPHESRMGVAERHQKLKSQYFFDCNCSPCER--------  602

Query  827   NAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPG  648
                                               EK  +++      +  H     L+ G
Sbjct  603   ----------------------------------EKQSSQKGPGREAFCCHACGALLQGG  628

Query  647   HCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNA---------LKASDI  495
               L+C       A+C      +  + RLQ+      +  ++L N          L+    
Sbjct  629   DVLSCG-----TASCTESVSRDHLVSRLQNLQQQVGMARKLLRNGKLERAIQLLLRGQHD  683

Query  494   LRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIK  315
               S L   +  + E+ED++A+A   +G+ + +  H + S++++E  + P+ I +G+EL K
Sbjct  684   AESFLSSEHSMVGEIEDHLARAYAALGDWEKSAAHLQKSLRVVEACHGPSSIEMGHELFK  743

Query  314   LGSIQLQR-GNRDAASTTKSTAEIFSRYFGSHALVIFPY---LQRLQQEAGCL  168
             L  I        +A +T +   E+   ++G       P+   +Q LQ+   C+
Sbjct  744   LAQIFFNGFAIPEALNTIQKAEEVLLVHYG-------PWNNEVQELQKMKSCI  789


 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 88/348 (25%), Positives = 156/348 (45%), Gaps = 71/348 (20%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQV  2358
             ++LPV++     + H+ +  SL+PK+++  IS + T + +    SSLL+     P+    
Sbjct  1     MDLPVEE----WTSHILQKWSLLPKSIQVTISTAETLNDIFLHSSSLLQ-----PEDEIF  51

Query  2357  VKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNL  2178
             +K L+     L GKD  A    +  GN+ F   DY +A   Y++ +  +  ++ D     
Sbjct  52    LKRLSGD--YLVGKDPDAPLFYREEGNKKFQKKDYLEATVLYSKGVSHSRPHTEDI----  105

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDA  2013
              ++ Y NR++AL  +G    CL+D +RA      Y      K   R+ +   +LG   +A
Sbjct  106   -SLCYANRSAALFHLGQYETCLKDINRAQ--MHGYPERLQPKMLLRKAECLVTLGRLPEA  162

Query  2012  ---IQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLY---KSNRNES--------  1875
                I DL+ +   + +L+       +L+I+  Q  L H  +    K N  E+        
Sbjct  163   SQAISDLESNFAAKPTLAA-----SQLQIL--QRTLCHLKIKVQEKENLTEAFPAALTKA  215

Query  1874  --DVTMLDEPDR-----ANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAII------  1734
               DV +  E ++     +++   + P KGR +V+  DI  G L+ KE  + +++      
Sbjct  216   FEDVDLRQENEQISSASSSVSLCTDPLKGRYLVATKDILPGELLVKERAFVSVLNPGEMP  275

Query  1733  -----LKNCRETN-------CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                  L++  +T        CH C     +  VPC+ CS   YCS +C
Sbjct  276   PRHHSLESKWDTRVTTGDLYCHRCLKH-TLATVPCDGCSYAKYCSQEC  322



>gb|EZA60897.1| SET and MYND domain-containing protein [Cerapachys biroi]
Length=651

 Score = 83.2 bits (204),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 108/271 (40%), Gaps = 51/271 (19%)
 Frame = -3

Query  1097  EQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDH  918
             +Q ++  AIY   S+ NHSC PN    F+   L V+    ++AG E+   YG    +   
Sbjct  413   QQDRIATAIYPSASLMNHSCDPNILNSFIGHLLIVKAIKDIAAGEEVFHCYGTDFRRMSK  472

Query  917   KDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV  738
              +RQ+ L+ +Y F+C C  C+     +          P C G +PD+             
Sbjct  473   AERQERLKSQYCFTCACEPCTMPRYENFMERFLALKCPECRGPLPDN-------------  519

Query  737   SKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQD  558
                                      H  P  C +C        A ATI+ A   +G  Q 
Sbjct  520   -------------------------HNSPACCFDC-------GAIATINHAPEKLGEAQS  547

Query  557   AIASNDVPVE------VLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAM  396
                  ++ VE       L++  K   I +  L+ ++  IA   D +A+   ++G    ++
Sbjct  548   DFLRAEIAVENEKYDVALTHLKKCLSIRQDVLYKYHNDIAVTWDFIAKVYVMMGRWSDSI  607

Query  395   DHCKASIKILEKLYDPNHIVIGNELIKLGSI  303
                + S+ ++E+ Y P+ I + NE+ KL  +
Sbjct  608   LCLEHSVAVIEERYGPSGIELCNEMNKLTDL  638



>ref|XP_005110357.1| PREDICTED: SET and MYND domain-containing protein 4-like [Aplysia 
californica]
Length=611

 Score = 82.8 bits (203),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 114/255 (45%), Gaps = 27/255 (11%)
 Frame = -3

Query  2324  CGKDHSAASEV----KLRGNQCFSGGDYPKALHFYTQALRLAPT-NSNDTEKNLSAMLYV  2160
             C K H  ++EV    + +GN+ F    Y +A+  YTQ    AP  +  D   +L      
Sbjct  62    CRKWHGKSTEVAQVWRNKGNRLFQRKRYQEAVAAYTQCHLSAPVQDGGDYVISLG-----  116

Query  2159  NRASALHKMGLIVECLQDCDRALA----------IFSTYAKAWFRRG---KANASLGNFE  2019
             NR++AL  M    ECL D  RALA          + S   +A  R G   KA +S    +
Sbjct  117   NRSAALFHMEKYQECLTDVTRALASGFPKESRHKLLSRRVQAQIRLGQKVKAESSFLKLQ  176

Query  2018  DAIQDLKVSL---KMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPD  1848
             D +      L   K +  L     +E +++ + +Q  LK SS  +  +  S V       
Sbjct  177   DFVSGGSFCLTGEKRDAFLKEIESMEKDIKNLNNQSTLKASS-QEPPKVFSGVNSTVPQA  235

Query  1847  RANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVP  1668
              A +     P +GR +V+    P GS +  E P+AA++L    E++CH CF  LP + V 
Sbjct  236   TAAVTLTITPDQGRFLVANQSFPKGSTLIVERPFAAVLLPEHYESHCHHCFTALPSNPVG  295

Query  1667  CESCSIPLYCSSQCQ  1623
             C  CS   +C+  C+
Sbjct  296   CCQCSAVRFCNESCR  310


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = -3

Query  1103  SLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQW  924
             +++QV++  AIY   S+ NHSC P   + F+   L VR    V  G E+   YGP   + 
Sbjct  509   NVQQVRIATAIYPTASLMNHSCDPTIISSFMGDVLIVRNIKDVKKGDEIYNCYGPHYCRM  568

Query  923   DHKDRQQILRDRYSFSCQCRGCSQLNLS  840
                +RQ++L+ +Y F C C  C+Q ++S
Sbjct  569   RTGERQEVLKSQYHFDCLCEACAQGDVS  596



>ref|XP_004594021.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Ochotona princeps]
Length=797

 Score = 82.8 bits (203),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 83/316 (26%), Positives = 124/316 (39%), Gaps = 51/316 (16%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLS  1008
             + N+ AI  ++     GSL      +TSS  QV++   ++ V S+ NHSC PN    F+ 
Sbjct  494   QCNAQAITAIQQTGPGGSL------ITSS-RQVRLATGVFPVLSLLNHSCSPNTSVSFVG  546

Query  1007  RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCI  828
                 VR +  +  G EL   YGP V   D   RQQ L+ +Y F C C  C        C 
Sbjct  547   TVATVRASQHIGQGQELLHCYGPHVSHLDVAVRQQKLKSQYFFDCSCPAC--------CS  598

Query  827   NAY-RCAKPGCLGVVPDSTLASYVKQKLPHVSKQV--EKVENERISDVAHYAVHKADYHL  657
              A    A P   G    S  A      + H       E V  +R++              
Sbjct  599   EAQPSTAGPRWAGFCCSSCRALLQGDAVLHCGSGSCPEAVSRDRLASRLR----------  648

Query  656   KPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLH  477
                     +L R + AA   +       G+L+ AI       + L     +++      H
Sbjct  649   --------DLKRQIAAALELLGS-----GKLKGAI-------QQLQGCQHSAESFLWVEH  688

Query  476   PFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQL  297
                  + E+ D +AQA   +G+ Q A  H + S+ ++E  Y  + I +G+EL KL  I  
Sbjct  689   SL---LGEIADYLAQAYATLGDWQKAAAHLRKSLAVVEARYGTSSIEMGHELFKLAQILF  745

Query  296   QRGNRDAASTTKSTAE  249
                    A +T   AE
Sbjct  746   NGMEIHEALSTIQKAE  761


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 84/340 (25%), Positives = 145/340 (43%), Gaps = 55/340 (16%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEIS--ESTPDGLPATCSSLLEFFHRLPQFHQ  2361
             ++LPV+   +    H+ +  SL+P +++  IS  E+  D        LL + H  P+   
Sbjct  1     MDLPVEPWKL----HLLQKWSLLPTSVQGAISTAETLSDIF------LLSYSHLQPEDEL  50

Query  2360  VVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKN  2181
              +K L+     L GKD  A    +  GN+ F   D+  A   Y++ +  A  N+ D    
Sbjct  51    FLKSLSGDY--LVGKDPKAPLFYREEGNRKFEEKDFAGAAVLYSKGVSHAGPNTEDM---  105

Query  2180  LSAMLYVNRASALHKMGLIVECLQDCDRA-LAIFST--YAKAWFRRGKANASLGNFEDA-  2013
               ++ Y NR++AL  +G    CL+D  RA L  +      K   R+ +   +LG  ++A 
Sbjct  106   --SLCYGNRSAALFHLGQFEACLEDISRAELHRYPERLLPKMLLRKAECLLALGRPQEAS  163

Query  2012  --IQDLKVSLKMEVSLSGKR-----QIEDELRI-ILDQHKLKHSSLYKSNRNESDVTMLD  1857
               I  L+  L  + +L+  R        D L++ + +Q     +S    +    D  +L+
Sbjct  164   LTIAALEGHLAAQPNLAPSRLRALQSSLDGLKLKVQNQETFPETSPAAPSHTVEDTEILE  223

Query  1856  EPDRANMQCVSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCR---------  1719
             +  +      S+     P KGR +V+  DI  G L+ KED + ++++   +         
Sbjct  224   KSKQVPGASSSVRLDTDPVKGRCLVATRDILPGELLVKEDAFVSVLIPGEKPPLRCGLGS  283

Query  1718  ---------ETNCHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                      +  CH C     +  VPC  CS   YCS +C
Sbjct  284   RWDAGISNGDLYCHQCLKPT-LATVPCPRCSYAKYCSPRC  322



>gb|EZA61542.1| SET and MYND domain-containing protein [Cerapachys biroi]
Length=646

 Score = 82.4 bits (202),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 126/266 (47%), Gaps = 33/266 (12%)
 Frame = -3

Query  2321  GKDHSAASEVKLR--GNQCFSGGDYPK-----ALHFYTQALRLAPTNSNDTEKNLSAMLY  2163
             G   SA    KLR  GN+ F  G +       AL  Y +A+  AP  S        A+ Y
Sbjct  53    GMPKSAKESEKLREEGNKVFVKGAFNNITCVDALKLYAKAVAFAPYPSEQL-----ALAY  107

Query  2162  VNRASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLGN--FEDAIQDLK  1998
              NR++ L ++GL  EC+QD DRALA+    +  AK + R+ +    LGN   ED +++ +
Sbjct  108   ANRSAVLFQLGLHTECIQDIDRALALNYPDNLRAKLYIRKTECLIILGNRSVEDVLEEAR  167

Query  1997  VSL-KMEVSLSGKRQIEDELRIILDQHKLKHSSLYK--------SNRNESDVTML-----  1860
               L KM ++ S + ++  +++++  +     SS           S  NE+ +  +     
Sbjct  168   HWLDKMSLNDSSREKLRTKVQVLRRKTLQTESSTQDIRVQRRTGSAENEAPLPTIASCNN  227

Query  1859  DEPDRANMQCVSLPTK-GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELP  1683
             + P  ++   +    + GR +V+  +I  G +V  E PY+ I+ ++  +T+C  C   + 
Sbjct  228   EVPCASDAVAIKYDKRYGRHVVATRNIRPGEVVAVEQPYSLILKQHNMQTHCSNCL-RVS  286

Query  1682  MHAVPCESCSIPLYCSSQCQLVSGGK  1605
                +PC  C+  +YCS +C+     K
Sbjct  287   WANIPCNHCTYAMYCSEECRYTEWKK  312



>ref|XP_008827011.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Nannospalax galili]
Length=801

 Score = 82.4 bits (202),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 122/301 (41%), Gaps = 61/301 (20%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   ++ S+      +T+S  Q+++   I+ V S+ NHSC PN    F S  
Sbjct  500   NAQAITSIQHTGSRESI------ITNS-RQIRLATGIFPVVSLLNHSCSPNTSVSFTSTV  552

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLS------  840
               VR    +  G E+   YGP   +    +RQQ LR +Y F C C  C    L       
Sbjct  553   ATVRAAQQIGKGQEIVHCYGPHESRMGVAERQQRLRSQYFFDCSCPACRTEALGAAAGPR  612

Query  839   --DLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKAD  666
                 C N  R    G  G V      S            +E V  +R+  V+H    +  
Sbjct  613   WEAFCCNTCRALMQG--GAVLSCGNRSC-----------MESVNRDRL--VSHLQDLQQQ  657

Query  665   YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRS  486
              ++         L RD               G+L++AI             L   +   S
Sbjct  658   VYMAQ------RLLRD---------------GKLEEAIL----------QLLGCQEDAES  686

Query  485   TLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGS  306
              L   +  + E+ED +AQA   +G+ Q +  H + S++++E  + P+ + IG+EL KL  
Sbjct  687   FLSAEHAMVGEIEDGLAQAYAALGDWQKSATHLRKSLRVVEARHGPSSVEIGHELFKLAQ  746

Query  305   I  303
             +
Sbjct  747   V  747


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 144/326 (44%), Gaps = 64/326 (20%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             S +P++++  +S + T   +    SSLL+     P+    +K L+     L  KD++A  
Sbjct  17    SFLPQSVQVTMSAAKTLSSVFLHASSLLQ-----PEDEMFLKRLSSN--YLVEKDYNAPL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   +Y  A   Y++ +  +  ++ D      ++ Y NR+++L  +G    
Sbjct  70    FYREEGNKKFQEKEYTGAAVLYSKGISHSRPDTEDI-----SLCYANRSASLFHLGQYEL  124

Query  2117  CLQDCDRALAIFSTY-----AKAWFRRGKANASLGNFEDA---IQDLKVSL--KMEVSLS  1968
             CL+D  RA      Y      K   R+ +   +LG  ++A   I DL+ +L  K  +++S
Sbjct  125   CLEDIVRAQ--MHGYPERLQCKIMLRKAECLVNLGRLQEARQAISDLESNLTAKSTLAVS  182

Query  1967  GKRQIEDELRIILDQHKLKHSSLYKSNRNES---------DVTMLDEPDRANMQ--CVSL  1821
               + ++  L      H LK     + N  E+         D+ + +E  + +    CVSL
Sbjct  183   PCQTLQRNL------HHLKMKMQEEKNPPETSDALTKAFEDMDLREENKQISKASLCVSL  236

Query  1820  ---PTKGRGMVSRADIPIGSLVHKEDPYAAII-----------LKNCRETN-------CH  1704
                P KGR +V+  DI  G L+ KED + +++           L+N  +T        CH
Sbjct  237   CTDPLKGRCLVATRDIHPGELLVKEDAFVSVLNPGELLPLHLGLENKWDTRVANVDLYCH  296

Query  1703  FCFNELPMHAVPCESCSIPLYCSSQC  1626
              C     +  VPC  CS   YCS +C
Sbjct  297   RCLKH-TLATVPCSGCSYAKYCSQEC  321



>emb|CCF49883.1| related to tetratricopeptide repeat protein 2, dnajc7 [Ustilago 
hordei]
Length=570

 Score = 82.0 bits (201),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 77/139 (55%), Gaps = 7/139 (5%)
 Frame = -3

Query  2291  KLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDT--EKNLSAMLYVNRASALHKMGLIVE  2118
             K +GN  F  GD+  A+  +TQALRLA  NS+         A+LY NRA+A  K G    
Sbjct  300   KEQGNSAFKQGDHALAVQTFTQALRLAEENSDKDGPAAGFKAILYSNRATANSKNGDHQA  359

Query  2117  CLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIED---  1947
              ++DCD AL + S Y KA   R +A  +   +EDA++D K +L+ E SL+G +Q+E    
Sbjct  360   AIKDCDAALQLDSGYVKALRTRARALLATEQYEDAVRDFKRALQ-EASLAGGKQVEQLKC  418

Query  1946  ELRII-LDQHKLKHSSLYK  1893
             ELR   +D  + +    YK
Sbjct  419   ELRSAEIDFKRSRKKDYYK  437



>gb|EFZ17321.1| hypothetical protein SINV_03681 [Solenopsis invicta]
Length=464

 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/257 (26%), Positives = 127/257 (49%), Gaps = 25/257 (10%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYP-----KALHFYTQALRLAPTNSNDTEKNLSAMLYVNR  2154
             K+   + +++ +GN+ F  G        +AL  YT+++ +AP  S        A+ Y NR
Sbjct  56    KNAKESEKLREKGNKIFIKGALNNIRCIEALKLYTKSISVAPYPSEQL-----ALGYANR  110

Query  2153  ASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLGN--FEDAIQDLKVSL  1989
             ++ L ++GL +EC+QD DRALA+    +  AK + R+ +    LGN   +D ++ ++  L
Sbjct  111   SAVLFQLGLYLECIQDIDRALALNYPDNLRAKLYLRKSECLMILGNQSVDDTLKKVQHWL  170

Query  1988  -KMEVSLSGKRQIEDELRIILD---QHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSL  1821
              KM ++ + + +++ +L ++ +   Q KL  +   +        T+    D       ++
Sbjct  171   DKMSLNDTSREKLKTKLDVLRNRNTQTKLCATDTRRKVLESPLPTIASHNDEVPCASDAV  230

Query  1820  PTK-----GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESC  1656
               K     GR +V+  DI  G ++  E PY+ I+ +   +T+C  C   +    +PC  C
Sbjct  231   VIKYNNHYGRHIVATRDICPGEVIAVEKPYSLILKQENMQTHCSNCL-RVCWANIPCNYC  289

Query  1655  SIPLYCSSQCQLVSGGK  1605
             +  +YCS +C+ +   K
Sbjct  290   TYAMYCSEECKNIEWKK  306



>ref|XP_008693504.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Ursus maritimus]
Length=796

 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 75/302 (25%), Positives = 121/302 (40%), Gaps = 60/302 (20%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++     GS +   N +T S   V++   I+ V S+ NHSC PN    F+S  
Sbjct  492   NAQAITTIQQTALSGSKE---NNVTDS-RLVRLATGIFPVVSLLNHSCSPNTSMSFMSTV  547

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               +R ++ +  G E+   YGP   +    DRQQ LR +Y F C C  C            
Sbjct  548   ATIRASEKIGKGQEILHCYGPHHSRMGVADRQQKLRSQYFFDCGCPAC------------  595

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
                                   QK  H +    + E         +  ++    L+ G  
Sbjct  596   ----------------------QKEKHRAAVGPRWEA--------FCCNRCGAVLQGGDV  625

Query  641   LNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNAL--KASDILRSTLHPF-  471
             L+C        +C      E  I RLQD          +LSN    +A  +L +  H   
Sbjct  626   LSCG-----STSCTESVSREHLISRLQDLQQRVGSARNLLSNGQLEQAIQLLLAYRHDAE  680

Query  470   ------NKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLG  309
                   +  + E+ED +AQA   +G+ Q +  H + S++++E  + P  + +G+EL KL 
Sbjct  681   NFLSAEHSMVGEMEDALAQAYAALGDWQKSATHLQKSLRVVEVQHGPASVEMGHELFKLA  740

Query  308   SI  303
              +
Sbjct  741   QL  742


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 83/322 (26%), Positives = 139/322 (43%), Gaps = 55/322 (17%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+++  IS + T   L    SSLL+     P+    +K L+     L GKD SA  
Sbjct  17    SLLPKSIQDAISTADTLRDLFLHSSSLLQ-----PEDEMFLKSLSGG--YLVGKDPSAPP  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   DY  A   Y++ +  A  ++ D      ++ Y NR++AL  +     
Sbjct  70    FYREEGNKKFQKKDYTGATVLYSKGISHARPHTADI-----SLCYANRSAALFYLDEYEM  124

Query  2117  CLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIED  1947
             CL+D  RA       S   K   R+ +   +LG  ++A Q ++    +E S + K  +  
Sbjct  125   CLKDITRAQMHGYPESLQPKVTLRKVECLVTLGRLQEAGQTIR---HLESSFAAKPTLAA  181

Query  1946  ELRIILDQH--KLKHSSLYKSNRNES----------DVTMLDEPDRANMQCVSL-----P  1818
                 IL ++  +LK     + N   +          D+ + +E ++      S+     P
Sbjct  182   AQFQILQRNLCRLKMKVKERENLTATFPEVVTKVFEDMDLREENEQIASASSSVGLRVDP  241

Query  1817  TKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFN  1692
              +GR +++  DI  G L+ KED + +++                + R TN    CH C  
Sbjct  242   LRGRYLIATKDILPGELLVKEDAFVSVLNPGERPPLHHGLESKWDTRVTNGDLYCHRCLK  301

Query  1691  ELPMHAVPCESCSIPLYCSSQC  1626
                +  VPC+ CS   YCS +C
Sbjct  302   HT-LAMVPCDGCSYAKYCSHEC  322



>ref|XP_006099237.1| PREDICTED: SET and MYND domain-containing protein 4 [Myotis lucifugus]
Length=802

 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 70/281 (25%), Positives = 113/281 (40%), Gaps = 57/281 (20%)
 Frame = -3

Query  1118  NALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGP  939
             N +T S  QV++   ++ V S+ NHSC PN    F+S    VR +  +  G E+   YGP
Sbjct  516   NIITDS-RQVRLATGLFPVVSLLNHSCSPNTSVSFVSTVATVRASQPIGEGQEILHCYGP  574

Query  938   QVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYV  759
                +    +RQQ LR +Y F C C  C          N  R A  G              
Sbjct  575   HESRMGVAERQQKLRSQYFFDCDCLACQ---------NGKRRAAAG--------------  611

Query  758   KQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAES  579
                 P                   +  H+    ++    L+C       A+C   +  + 
Sbjct  612   ----PRWEA---------------FRCHRCGELMQGDDVLSCG-----RASCTESASRDH  647

Query  578   SIGRLQDAIASNDVPVEVLSNAL--KASDIL-------RSTLHPFNKRIAEVEDNVAQAM  426
              + RLQD         ++L N    +A  +L        S L   +  + E+ED +AQA 
Sbjct  648   LVSRLQDLQQRVGKAQKLLRNGKVERAIQLLLGCQHDAESFLSAEHSLVGEIEDALAQAY  707

Query  425   CLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI  303
               +G+ Q +  H + S++++E  + P+ + +G+EL KL  I
Sbjct  708   AALGDWQKSAAHLRKSLRVVEVRHGPSSVEMGHELFKLAQI  748


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 137/324 (42%), Gaps = 59/324 (18%)
 Frame = -3

Query  2474  SLVPKALRQEI-SESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+ +  + +  T   +    SSLL+     P+    +K L+     L GKD  A  
Sbjct  17    SLLPKSTQVTVCTAETLSDIFLHSSSLLQ-----PEDEMFLKRLSSG--YLVGKDPGAPL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               + +GN+ F   DY  A   YT+ +  +  N+ D      ++ Y NR++AL ++G    
Sbjct  70    FYREQGNKKFQEKDYMGATVLYTKGVSHSRPNTEDI-----SLCYANRSAALFRLGQYET  124

Query  2117  CLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
             CLQD  RA      Y      K   R+ +   +LG  ++A Q +     +E   + ++ +
Sbjct  125   CLQDITRAQ--MHGYPERLQLKMMLRKAECLVTLGKRQEASQFIS---DLESHFTDRQTL  179

Query  1952  EDELRIILDQH--KLKHSSLYKSNRNES----------DVTMLDEPDRANMQCVSL----  1821
                   IL     +LK     K N  E+          D+ + +E ++ +    S+    
Sbjct  180   AASQFQILQSTLCRLKRKVQEKENPTETFPAALTTGFEDMNLREENEQISCASSSVTLCT  239

Query  1820  -PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFC  1698
              P KGR +++  DI  G L+ +E+ + +++                + R TN    CH C
Sbjct  240   DPLKGRSLIATKDILPGELLVREEAFVSVLNPGEMPPRRNGLESKWDTRVTNGDLYCHRC  299

Query  1697  FNELPMHAVPCESCSIPLYCSSQC  1626
                  +  VPC  CS   YCS +C
Sbjct  300   LKH-TLATVPCGGCSYAKYCSQEC  322



>ref|XP_008693503.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Ursus maritimus]
Length=832

 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 120/302 (40%), Gaps = 60/302 (20%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++     GS + +V    +    V++   I+ V S+ NHSC PN    F+S  
Sbjct  492   NAQAITTIQQTALSGSKENNV----TDSRLVRLATGIFPVVSLLNHSCSPNTSMSFMSTV  547

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               +R ++ +  G E+   YGP   +    DRQQ LR +Y F C C  C            
Sbjct  548   ATIRASEKIGKGQEILHCYGPHHSRMGVADRQQKLRSQYFFDCGCPAC------------  595

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
                                   QK  H +    + E         +  ++    L+ G  
Sbjct  596   ----------------------QKEKHRAAVGPRWEA--------FCCNRCGAVLQGGDV  625

Query  641   LNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNAL--KASDILRSTLHPF-  471
             L+C        +C      E  I RLQD          +LSN    +A  +L +  H   
Sbjct  626   LSCG-----STSCTESVSREHLISRLQDLQQRVGSARNLLSNGQLEQAIQLLLAYRHDAE  680

Query  470   ------NKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLG  309
                   +  + E+ED +AQA   +G+ Q +  H + S++++E  + P  + +G+EL KL 
Sbjct  681   NFLSAEHSMVGEMEDALAQAYAALGDWQKSATHLQKSLRVVEVQHGPASVEMGHELFKLA  740

Query  308   SI  303
              +
Sbjct  741   QL  742


 Score = 67.4 bits (163),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 83/322 (26%), Positives = 139/322 (43%), Gaps = 55/322 (17%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+++  IS + T   L    SSLL+     P+    +K L+     L GKD SA  
Sbjct  17    SLLPKSIQDAISTADTLRDLFLHSSSLLQ-----PEDEMFLKSLSG--GYLVGKDPSAPP  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   DY  A   Y++ +  A  ++ D      ++ Y NR++AL  +     
Sbjct  70    FYREEGNKKFQKKDYTGATVLYSKGISHARPHTADI-----SLCYANRSAALFYLDEYEM  124

Query  2117  CLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIED  1947
             CL+D  RA       S   K   R+ +   +LG  ++A Q ++    +E S + K  +  
Sbjct  125   CLKDITRAQMHGYPESLQPKVTLRKVECLVTLGRLQEAGQTIR---HLESSFAAKPTLAA  181

Query  1946  ELRIILDQH--KLKHSSLYKSNRNES----------DVTMLDEPDRANMQCVSL-----P  1818
                 IL ++  +LK     + N   +          D+ + +E ++      S+     P
Sbjct  182   AQFQILQRNLCRLKMKVKERENLTATFPEVVTKVFEDMDLREENEQIASASSSVGLRVDP  241

Query  1817  TKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFN  1692
              +GR +++  DI  G L+ KED + +++                + R TN    CH C  
Sbjct  242   LRGRYLIATKDILPGELLVKEDAFVSVLNPGERPPLHHGLESKWDTRVTNGDLYCHRCLK  301

Query  1691  ELPMHAVPCESCSIPLYCSSQC  1626
                +  VPC+ CS   YCS +C
Sbjct  302   HT-LAMVPCDGCSYAKYCSHEC  322



>ref|XP_005298338.1| PREDICTED: SET and MYND domain-containing protein 4 [Chrysemys 
picta bellii]
Length=803

 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 123/275 (45%), Gaps = 36/275 (13%)
 Frame = -3

Query  1127  EHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELS  948
             E  +++ +  EQV++  A++ V S+ NHSC PN    F    + VR +  +  G E+   
Sbjct  511   ESGDSIVADSEQVRLATALFPVTSLLNHSCDPNTSVTFSGTAVTVRASQPIPRGQEIVHC  570

Query  947   YGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLA  768
             YGP   +    +R+Q L  +Y F C+C+ C    L +L  +    A  G +         
Sbjct  571   YGPHRCRMGAAERRQRLLCQYFFECRCQAC----LDELGSDVTGIAATGDIFCCSSC---  623

Query  767   SYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISK  588
                     H S Q E V   R S  A   +   DY L+        L+ DL        +
Sbjct  624   --------HASMQGEDV--LRCSSGACTLLVGRDYLLR-------QLW-DLRL------Q  659

Query  587   AESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEP  408
               +++G L+D     +  VE+L      ++   S  H     + E+ED++AQ+   +G+ 
Sbjct  660   VRTALGLLKD--NQPNQAVELLMRCRVDAENFLSAEHML---VGEIEDHLAQSYATLGKW  714

Query  407   QAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI  303
             Q A  H + SI+I+E  + P+ +  G+EL KL  I
Sbjct  715   QEAARHLRRSIQIVEARHGPSSVETGHELFKLAQI  749


 Score = 73.9 bits (180),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 94/347 (27%), Positives = 154/347 (44%), Gaps = 72/347 (21%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISESTPDG------LPATCSSLLEFFHRLP  2373
             + LP +K +        K  SL P  L+Q++S + P G      LP    +  EF H L 
Sbjct  1     MELPAEKWAAYARR---KWASLDP-CLQQKLSVAGPLGDTFLLCLPLFQPADEEFLHSLA  56

Query  2372  QFHQVVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSND  2193
               + V            GKD  AA   K  GN+ F   +Y  AL  Y++A+     + N 
Sbjct  57    ARNGV------------GKDPRAALFYKEEGNKRFQNKEYTAALILYSKAV-----SHNS  99

Query  2192  TEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTY-----AKAWFRRGKANASLG  2028
              E +L    Y NR++AL  +G   +CL+D DRA A   +Y      K   R+ +    LG
Sbjct  100   PEMSLC---YANRSAALFHLGHFEDCLEDIDRAQA--QSYPNRLQPKILLRKTECLLLLG  154

Query  2027  NFEDA---IQDLKVSLKMEVSLSGKRQIEDELRII----LDQHKLKHSSLY---KSNRNE  1878
               ++A   I   +  + M+ SL+   + +  LR I    ++ H+++ S +      ++  
Sbjct  155   RLQEAAEVISKAESKIAMDQSLTSTTR-QSLLRKISQLKVNAHEMESSPVSVPEAPSKTR  213

Query  1877  SDVTMLDEPDR--ANMQCVSL---PTKGRGMVSRADIPIGSLVHKEDPYAAI-------I  1734
              D+   +E  +  +    VSL     +GR +V+  DI  G  + KE+ + ++       +
Sbjct  214   KDLEFWEENGKISSAFSSVSLNFNSCRGRHLVATRDILPGENLVKEEAFVSVLSPGKSLL  273

Query  1733  LKNCRET-----------NCHFCFNELPMHAVPCESCSIPLYCSSQC  1626
             L++  ET           +CH C  +L + +VPCE CS   YCS +C
Sbjct  274   LQDSAETTWDTRVTNADLHCHRCLKQL-LGSVPCEGCSYAKYCSKKC  319



>ref|XP_392262.3| PREDICTED: SET and MYND domain-containing protein 4-like [Apis 
mellifera]
Length=677

 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 77/287 (27%), Positives = 138/287 (48%), Gaps = 36/287 (13%)
 Frame = -3

Query  2405  SSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQ  2226
             S  ++F  R PQ + +  ++ + E  +  K+   A ++K  GN+ F  G++ KAL  Y+ 
Sbjct  39    SERIDFMLRYPQVYDLAIKIGEVEDQML-KNGEKALKLKDVGNKYFGRGEFIKALEIYSN  97

Query  2225  ALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAI---FSTYAKAWFR  2055
             A+ LAP      +K++  +L  NR++ L+ +      L D + AL +        K   R
Sbjct  98    AVLLAP------QKDVGIVL-ANRSATLYHLEKHTYALTDAEEALRMGYPRELRYKIEER  150

Query  2054  RGKANASLGNFEDAIQDLKVSLKM--EVSLSG--KRQIEDELRIILDQHKLKHSSLYKSN  1887
             R +   +L   ++A+   + +LK   +  LSG  K + E ++RI+L   + K + L +  
Sbjct  151   RARCLLALKRHDEAVLAFRNALKALDDGKLSGEKKEKFEADIRIMLAVIE-KGNQLARKG  209

Query  1886  RNESDVTMLDEPDRANMQ---CVSL--------------PTKGRGMVSRADIPIGSLVHK  1758
                 +   +DEP+++ ++   C  L                 GR  ++  DI  G ++  
Sbjct  210   PKIPEKRNIDEPEKSTLKIEDCNPLYPSCSKAVEIKDEGGNIGRHAIATKDIEPGEILAI  269

Query  1757  EDPYAAIILKNCRETNCHFCFNEL--PMHAVPCESCSIPLYCSSQCQ  1623
             E PY+A +L   R  NC +CF ++  P+ AV C++CS   YCS  C+
Sbjct  270   EKPYSAFLLAEYRLINCFYCFTKIFVPIPAV-CQTCSCVAYCSISCR  315


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 53/109 (49%), Gaps = 5/109 (5%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y   S+FNHSC P    YF+  T+ VR   S+S+G E+  +YG         +R+
Sbjct  480   IGGGLYPTISLFNHSCNPGIIRYFIGTTMVVRAIRSISSGEEISENYGQIFTTTPESERK  539

Query  905   QILRDRYSFSCQCRGCSQ----LNLSDLCINAYRC-AKPGCLGVVPDST  774
             + LR +Y F C C  C +    L   D  I  ++C     C  V+P  T
Sbjct  540   RKLRLQYFFDCNCEACREHWPLLEEIDPTILRFKCETGKECGNVLPVRT  588



>gb|KDO29854.1| hypothetical protein SPRG_04933 [Saprolegnia parasitica CBS 223.65]
Length=220

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 80/151 (53%), Gaps = 6/151 (4%)
 Frame = -3

Query  2336  EMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVN  2157
             EM+L  KD   AS+ K  GN  F  G Y  A+  Y++ALRL P     TE   +  +Y N
Sbjct  33    EMSLDAKDVKLASDAKEEGNSFFKEGRYLDAIDCYSKALRLCPIG---TEYAYNRAVYSN  89

Query  2156  -RASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKME  1980
              RA+ L  +G   E ++DC  A+ +   Y KA+ RR +A   L   E+A++D+K  L+++
Sbjct  90    NRAACLFHLGRQEEAIEDCTVAIELSPNYVKAFLRRAQAYEKLDKLEEALKDVKSVLEID  149

Query  1979  VSLSGKRQIEDELRIILD--QHKLKHSSLYK  1893
              +++  R  E  L  ++   Q K+K   L K
Sbjct  150   PTIASARDSEKRLSALVTERQEKMKAEMLEK  180



>gb|KDO16803.1| hypothetical protein SPRG_15594 [Saprolegnia parasitica CBS 223.65]
Length=220

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 80/151 (53%), Gaps = 6/151 (4%)
 Frame = -3

Query  2336  EMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVN  2157
             EM+L  KD   AS+ K  GN  F  G Y  A+  Y++ALRL P     TE   +  +Y N
Sbjct  33    EMSLDAKDVKLASDAKEEGNSFFKEGRYLDAVDCYSKALRLCPIG---TEYAYNRAVYSN  89

Query  2156  -RASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKME  1980
              RA+ L  +G   E ++DC  A+ +   Y KA+ RR +A   L   E+A++D+K  L+++
Sbjct  90    NRAACLFYLGRQEEAIEDCTVAIELSPNYVKAFLRRAQAYEKLDKLEEALKDVKSVLEID  149

Query  1979  VSLSGKRQIEDELRIILD--QHKLKHSSLYK  1893
              +++  R  E  L  ++   Q K+K   L K
Sbjct  150   PTIASARDSEKRLSALVTERQEKMKAEMLEK  180



>ref|XP_011058840.1| PREDICTED: SET and MYND domain-containing protein 4 [Acromyrmex 
echinatior]
 ref|XP_011058841.1| PREDICTED: SET and MYND domain-containing protein 4 [Acromyrmex 
echinatior]
 gb|EGI62819.1| SET and MYND domain-containing protein 4 [Acromyrmex echinatior]
Length=637

 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/270 (27%), Positives = 124/270 (46%), Gaps = 47/270 (17%)
 Frame = -3

Query  2321  GKDHSAASEVKLR--GNQCFSGGDYPK-----ALHFYTQALRLAPTNSNDTEKNLSAMLY  2163
             G   +A    KLR  GN+ F  G         AL  YT+++  AP  S    ++     Y
Sbjct  53    GMPKNAKESEKLREEGNKVFVTGILNNTICIDALKLYTKSIAFAPYPSEQLARS-----Y  107

Query  2162  VNRASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLGN--FEDAIQDLK  1998
              NR++ L K+GL  EC+QD DRALA+    +   K + R+ +    +GN   ED +++ +
Sbjct  108   ANRSAVLFKLGLYSECIQDIDRALALNYPDNLRVKLYLRKTECLMIMGNHSVEDTLKEAQ  167

Query  1997  VSL-KMEVSLSGKRQIEDELRII---LDQHKLKHSS-----------LYKSNRNE----S  1875
               L KM ++ + + +   +L ++   + Q K+  ++           + KS  NE    S
Sbjct  168   HWLEKMSINDTSRERFTAKLDVLHNKITQTKVNKNTKVKTEETPALPIIKSYNNEVPCAS  227

Query  1874  DVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCF  1695
             D   +   +R           GR +V+   I  G ++  E PYA I+++   +T+C  C 
Sbjct  228   DAVAIKYNERY----------GRHIVATRKIHPGEIIAVEKPYALILVQENMQTHCSNCL  277

Query  1694  NELPMHAVPCESCSIPLYCSSQCQLVSGGK  1605
               +    +PC  C+  +YCS +C+ +   K
Sbjct  278   -RVCWANIPCNYCTYAMYCSEECRNIEWEK  306



>ref|XP_009841908.1| hypothetical protein H257_15485 [Aphanomyces astaci]
 gb|ETV68683.1| hypothetical protein H257_15485 [Aphanomyces astaci]
Length=224

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 81/157 (52%), Gaps = 5/157 (3%)
 Frame = -3

Query  2357  VKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNL  2178
             + EL D E+++  KD   ASE K +GN+ F  G Y  A   Y++ALRL P    D     
Sbjct  31    LNELMD-ELSVETKDVKKASEAKEQGNEFFKAGRYLDAYDLYSKALRLCPLE--DEYAYN  87

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLK  1998
              A+ + NRA+ L  +G   E ++DC  A+     Y KA+ RR +A   L   ++A+QD+K
Sbjct  88    KAVYFSNRAACLLHLGRPEESIEDCTMAITSSPKYVKAYMRRSQAYEKLDKMDEALQDVK  147

Query  1997  VSLKMEVSLSGKRQIEDELRIIL--DQHKLKHSSLYK  1893
               L+++ ++      E  L  ++   Q K+K   L K
Sbjct  148   AVLEIDATIPSAIDAEKRLSAVVAERQEKMKAEMLDK  184



>gb|KDP32756.1| hypothetical protein JCGZ_12048 [Jatropha curcas]
Length=482

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/305 (21%), Positives = 125/305 (41%), Gaps = 50/305 (16%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  R   VR    +  G+E+ +SY    G      RQ
Sbjct  201   LGTGLYPVVSIINHSCLPNAVLVFEGRLAVVRAVQHIPKGAEVVISYIETAG--STMTRQ  258

Query  905   QILRDRYSFSCQCRGCSQLNLSD-----LCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
             + L+ +Y F+C C  C ++   D       +  YRC    C+G +               
Sbjct  259   KALKQQYFFTCTCSRCIKVGQQDDVRESAILEGYRCKDDRCIGFLL--------------  304

Query  740   VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
                        R SD   +A            C  C L+R  E      ++ +++  +  
Sbjct  305   -----------RDSDDKGFA------------CQQCGLHRSKEEVKKIAAEIQATSDKAS  341

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKA  381
              +++S ++  E +S       + R   HPF+  + +  + + + +  + + + A+ +CK 
Sbjct  342   KSVSSGNLQ-EAISMYKTVEKLQRKLCHPFSISLMQTREKLLKMLMELEDWREALSYCKL  400

Query  380   SIKILEKLYDPNHIVIGNELIKLGSIQLQRG-NRDAASTTKSTAEIFSRYFGSHALVIFP  204
             +I + + +Y   H ++G +    G ++   G   DA  +     +I     G+++    P
Sbjct  401   TIPVYQSVYPQFHPLLGLQYYTSGKLEWLLGETEDAIRSLTKAVDILRITHGTNS----P  456

Query  203   YLQRL  189
             +++ L
Sbjct  457   FMKEL  461



>ref|XP_004927446.1| PREDICTED: tetratricopeptide repeat protein 1-like [Bombyx mori]
Length=280

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 75/136 (55%), Gaps = 10/136 (7%)
 Frame = -3

Query  2348  LTDPEMALCGKDHSA-----ASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEK  2184
             L D E+AL   D  A     A E+K  GN  +  G+Y +++  YT+ LRL P   +    
Sbjct  91    LKDDEVALTD-DQKAERLIMAEELKQAGNNSYKCGEYERSVEKYTEGLRLCPLQFD----  145

Query  2183  NLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQD  2004
              + A+LY NR++A  K+    + ++DC +AL +   Y KA+ RR  +N  L  ++DA+ D
Sbjct  146   KVRAILYCNRSAARMKLKKYQKSIKDCTKALELDDKYVKAYLRRASSNELLEKYQDALSD  205

Query  2003  LKVSLKMEVSLSGKRQ  1956
              + +L+++ SL   R+
Sbjct  206   YEKALELDPSLEETRK  221



>ref|XP_004535928.1| PREDICTED: RNA polymerase II-associated protein 3-like isoform 
X1 [Ceratitis capitata]
Length=498

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 94/192 (49%), Gaps = 29/192 (15%)
 Frame = -3

Query  2546  QSEVLNLPVQKPSVLTSEHMEKLKSLVPKALRQEIS---ESTPDGLPATCSSLLEFFHRL  2376
             + EV N+P+ +  +L  E + K  S + +  +Q ++   E++P    AT  +        
Sbjct  50    KKEVENVPI-RSHILAEEQLTKAGSNIQREQQQSVAKENENSPTSSSATTPT--------  100

Query  2375  PQFHQVVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSN  2196
                     E T+  +    +    A+EVK RGN+C   G+Y KA++ YT A+ + P +  
Sbjct  101   --------EKTEEPLNANEEKRKRANEVKDRGNKCVKLGEYEKAIYEYTTAIDIFPED--  150

Query  2195  DTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFED  2016
                     + + NRA    KM    EC++DC+ A+ I +   KA++RR +AN  LGN  D
Sbjct  151   -------PVFFSNRALCYLKMERYNECIEDCEHAIEIDNLAVKAYYRRMQANECLGNDMD  203

Query  2015  AIQDLKVSLKME  1980
             A++D    L +E
Sbjct  204   ALKDCTTVLMIE  215



>ref|XP_008603818.1| hypothetical protein SDRG_00131 [Saprolegnia diclina VS20]
 gb|EQC42395.1| hypothetical protein SDRG_00131 [Saprolegnia diclina VS20]
Length=222

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 81/151 (54%), Gaps = 6/151 (4%)
 Frame = -3

Query  2336  EMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVN  2157
             EM+L  KD   AS+ K  GN  F  G Y  A+  Y++AL+L P     TE   +  +Y N
Sbjct  35    EMSLETKDVKLASDAKEEGNSFFKEGRYLDAIDCYSKALQLCPIG---TEYAYNRAVYSN  91

Query  2156  -RASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKME  1980
              RA+ L  +G   E ++DC  A+ +  TY KA+ RR +A   L   E+A++D+K  L+++
Sbjct  92    NRAACLFHLGRQEEAVEDCTVAIELSPTYVKAFLRRAQAYEKLDKLEEALKDVKSVLEID  151

Query  1979  VSLSGKRQIEDELRIILD--QHKLKHSSLYK  1893
              +++  R  E  L  ++   Q K+K   L K
Sbjct  152   PTIASARDSEKRLSALVTERQEKMKAEMLEK  182



>gb|ENN78715.1| hypothetical protein YQE_04887, partial [Dendroctonus ponderosae]
 gb|ERL86214.1| hypothetical protein D910_03625 [Dendroctonus ponderosae]
Length=505

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 81/158 (51%), Gaps = 20/158 (13%)
 Frame = -3

Query  2282  GNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECLQDC  2103
             GN+ F    +  A+  YT+AL + P N     K  +A L+ NRA+AL ++  I + + DC
Sbjct  269   GNEAFKLCKFHDAVKLYTEALEIDPLN-----KKTNAKLFFNRATALSRLTKIKDAILDC  323

Query  2102  DRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDELRIILDQ  1923
               AL +  TY KA  RR K    +G FEDA++D + +LKM+ S   KR ++ E ++ L  
Sbjct  324   SSALRLDDTYLKALLRRAKCYMDIGEFEDAVKDYEKALKMDKSRENKRLLQ-EAKLAL--  380

Query  1922  HKLKHSSLYK-----SNRNESDV-------TMLDEPDR  1845
              K K    YK      N NE ++        ++  PDR
Sbjct  381   KKSKRKDYYKILGVEKNANEDEIKKAYRKRALIHHPDR  418



>emb|CDS10959.1| hypothetical protein LRAMOSA03224 [Absidia idahoensis var. thermophila]
Length=413

 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 66/117 (56%), Gaps = 12/117 (10%)
 Frame = -3

Query  2291  KLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECL  2112
             K +GN CF   D+  A+  YT+A+ L P+N         A+ ++NRA A  K+ + +E  
Sbjct  97    KDKGNACFQKQDFKAAITHYTKAIDLDPSN---------AVFFINRAMAYLKLQMYLEAE  147

Query  2111  QDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDEL  1941
             QDC R L +  T  KA +RRG A  SLG   +A QDL  +L++E S    + ++DEL
Sbjct  148   QDCTRGLNLQPTNVKALWRRGIARRSLGRVTEARQDLTKALEIEPS---NKSVKDEL  201



>gb|EFN83374.1| SET and MYND domain-containing protein 4 [Harpegnathos saltator]
Length=628

 Score = 80.5 bits (197),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 70/308 (23%), Positives = 127/308 (41%), Gaps = 54/308 (18%)
 Frame = -3

Query  1097  EQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDH  918
             +Q ++  AIY   SM NHSC PN    F+ + L VR    + AG E+   YGP   +   
Sbjct  340   QQDRIATAIYPSASMMNHSCDPNIITSFVDQYLIVRAMKDIQAGEEVSNCYGPNFRRMSR  399

Query  917   KDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKL---  747
             + RQ+IL+++Y F C+C  C      +     +    P C G + +    SY    L   
Sbjct  400   EHRQEILKNQYGFECRCDPCVMPEYENFMERFHAIKCPECGGALEE--FHSYSMHCLDCG  457

Query  746   --PHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSI  573
               P+++ Q+E        D A                    +Y +LE       + E ++
Sbjct  458   ATPYINCQIELKNAVTAFDAAQ-------------------IYIELE-------REEEAV  491

Query  572   GRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMD  393
              +L++ ++                 I R+ L+ +++ +    D + +   ++G    ++ 
Sbjct  492   VKLKECLS-----------------IRRNLLYKYHQDLTATLDILGKVYAIMGRWLESIS  534

Query  392   HCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIFS---RYFG-S  225
             H + S+  +E+ Y  + + + NEL KL  I ++    +   TTK    +     RY   +
Sbjct  535   HIEHSMAAIEERYGCSSMEVANELNKLTDICIRYLQEEPNRTTKWYKNVLKKTRRYLDRA  594

Query  224   HALVIFPY  201
               +V F Y
Sbjct  595   EEIVNFTY  602



>gb|AEE62160.1| unknown [Dendroctonus ponderosae]
Length=496

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 81/158 (51%), Gaps = 20/158 (13%)
 Frame = -3

Query  2282  GNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECLQDC  2103
             GN+ F    +  A+  YT+AL + P N     K  +A L+ NRA+AL ++  I + + DC
Sbjct  260   GNEAFKLCKFHDAVKLYTKALEIDPLN-----KKTNAKLFFNRATALSRLTKIKDAILDC  314

Query  2102  DRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDELRIILDQ  1923
               AL +  TY KA  RR K    +G FEDA++D + +LKM+ S   KR ++ E ++ L  
Sbjct  315   SSALRLDDTYLKALLRRAKCYMDIGEFEDAVKDYEKALKMDKSRENKRLLQ-EAKLAL--  371

Query  1922  HKLKHSSLYK-----SNRNESDV-------TMLDEPDR  1845
              K K    YK      N NE ++        ++  PDR
Sbjct  372   KKSKRKDYYKILGVEKNANEDEIKKAYRKRALIHHPDR  409



>ref|XP_008545176.1| PREDICTED: SET and MYND domain-containing protein 4-like [Microplitis 
demolitor]
Length=745

 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 113/273 (41%), Gaps = 48/273 (18%)
 Frame = -3

Query  1097  EQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDH  918
             +Q ++   IY   SM NHSC P     F +  L V+    V  G E+   YGP   +   
Sbjct  456   QQQRIAVGIYPSASMMNHSCDPTIITTFSNDYLIVKAIKDVLTGEEVFNCYGPHFRRMPF  515

Query  917   KDRQQILRDRYSFSCQCRGCSQLNLSDLC--INAYRCAKPGCLGVVPDSTLASYVKQKLP  744
              +RQ+ L+D+Y F C+C+ C+   L       +A +C  P C G +  ST          
Sbjct  516   DERQKSLKDQYRFDCKCKPCTDPTLKQFLDRFDAVQC--PKCSGPLEKST---------T  564

Query  743   HVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACAT-ISKAESSIGR  567
             H+S+                             CL+CN+   ++    T +  A      
Sbjct  565   HLSR-----------------------------CLDCNVSSKIDIKVQTELKTANDLFAS  595

Query  566   LQD--AIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMD  393
              QD   I  N   ++ L + L   +I +  L+ ++  IA   D +A+   ++G    +M 
Sbjct  596   AQDYLQIGKNKDAIDYLKHCL---NIRQKWLYKYHDDIAITLDTLAKVNIMMGNWLDSMP  652

Query  392   HCKASIKILEKLYDPNHIVIGNELIKLGSIQLQ  294
             + + S+ ++E  +    I + NE+ K+  + LQ
Sbjct  653   YLEKSLTVIEIKFGNESIEVANEINKITDVSLQ  685


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/252 (27%), Positives = 115/252 (46%), Gaps = 27/252 (11%)
 Frame = -3

Query  2303  ASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLI  2124
             A  +K +GN  F   +Y  ++  YT++ + A  N+ D      ++   NR++A   M   
Sbjct  65    AKRLKDKGNLFFKEKNYIASIESYTESAKYADFNNGDY-----SIALANRSAAFFFMSKY  119

Query  2123  VECLQDCDRALAIFSTYAKAW-----FRRGKANASLGNFEDAIQDLKVSLKM-----EVS  1974
              +CL+D   A+ I S Y K        R  +    L  F  A ++L  + K+     ++S
Sbjct  120   EQCLEDI--AVVIESNYPKKLKYKLHLRATQCYIKLHKFHQATKELSEAEKLIINNEDIS  177

Query  1973  LSGKRQIEDELRIILDQ--HKLKHSSL------YKSNRNESDVTMLDEPDRA-NMQCVSL  1821
              S +  +  ++  +  Q   +LK++S+      Y  N NE  V  ++ P  +  +     
Sbjct  178   KSSRENLMTQIDNLSSQITEELKNNSINYNNSKYLINPNELLVPNINFPSASFKLTRKHS  237

Query  1820  PTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCR-ETNCHFCFNELPMHAVPCESCSIPL  1644
             PT+GR +V+  DI  G ++  E P+A + L N   +  C  C   +   A+PC SCS  L
Sbjct  238   PTRGRHIVANEDIKKGDVLFVEKPFAFVPLDNATSDILCTHCCGLIIDSAIPCRSCSSVL  297

Query  1643  YCSSQCQLVSGG  1608
             YC  +C + S  
Sbjct  298   YCCRECWMKSWS  309



>ref|XP_005858368.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Myotis brandtii]
 gb|EPQ02744.1| SET and MYND domain-containing protein 4 [Myotis brandtii]
Length=802

 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 120/302 (40%), Gaps = 63/302 (21%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +K       N +T S  QV++   ++ V S+ NHSC PN    F+S  
Sbjct  501   NAQAITTIQQTGSKE------NIITDS-RQVRLATGLFPVVSLLNHSCSPNTSVSFVSTV  553

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               VR +  +  G E+   YGP   +    +RQQ LR +Y F C C  C          N 
Sbjct  554   ATVRASQPIGKGQEILHCYGPHESRMGVAERQQKLRSQYFFDCDCLACQ---------NG  604

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
              R A  G                  P                   +  H+    ++    
Sbjct  605   KRRAAAG------------------PRWEA---------------FHCHRCGELMQGDDV  631

Query  641   LNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNAL--KASDIL-------R  489
             L+C       A+C   +  +  + R QD         ++L N    +A  +L        
Sbjct  632   LSCG-----SASCTESASRDHLVSRFQDLQQRVGKAQKLLRNGKVERAIQLLFGCQHDAE  686

Query  488   STLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLG  309
             S L   +  + E+ED +AQA   +G+ Q +  H + S++++E  + P+ + +G+EL KL 
Sbjct  687   SFLSAEHSLVGEIEDALAQAYAALGDWQKSAAHLQKSLRVVEVRHGPSSVEMGHELFKLA  746

Query  308   SI  303
              I
Sbjct  747   QI  748


 Score = 70.9 bits (172),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 138/324 (43%), Gaps = 59/324 (18%)
 Frame = -3

Query  2474  SLVPKALRQEI-SESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+++  I +  T   +    SSLL+     P+    +K L+     L GKD  A  
Sbjct  17    SLLPKSIQVTICTAETLSDIFLHSSSLLQ-----PEDEMFLKRLS--RGYLVGKDPGAPL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               + +GN+ F   DY  A   YT+ +  +  N+ D      ++ Y NR++AL ++G    
Sbjct  70    FYREQGNKKFQEKDYMGATVLYTKGVSHSRPNTEDI-----SLCYANRSAALFRLGQYET  124

Query  2117  CLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
             CLQD  RA      Y      K   R+ +   +LG  ++A Q +     +E   + ++ +
Sbjct  125   CLQDITRAQ--MHGYPERLQLKMMLRKAECLVTLGKLQEASQIIS---DLESHFTDRQTL  179

Query  1952  EDELRIILDQH--KLKHSSLYKSNRNES----------DVTMLDEPDRANMQCVSL----  1821
                   IL     +LK     K N  E+          D+ + +E ++ +    S+    
Sbjct  180   AASQFQILQSTLCRLKRKVQEKENPTETFPAALTTGFEDMNLREENEQISCASSSVTLCT  239

Query  1820  -PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFC  1698
              P KGR +++  DI  G L+ +E+ + +++                + R TN    CH C
Sbjct  240   DPLKGRSLIATKDILPGELLVREEAFVSVLNPGEMPPRRDGLESKWDTRVTNGDLYCHRC  299

Query  1697  FNELPMHAVPCESCSIPLYCSSQC  1626
                  +  VPC  CS   YCS +C
Sbjct  300   LKH-TLATVPCGGCSYAKYCSQEC  322



>ref|XP_006863296.1| PREDICTED: SET and MYND domain-containing protein 4 [Chrysochloris 
asiatica]
Length=796

 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 131/328 (40%), Gaps = 64/328 (20%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ A+  ++   +K S+      +T+S  QV++   I+ V S+ NHSC PN    F++  
Sbjct  497   NAQAVTTIQQTGSKESI------ITNS-RQVRIATGIFPVISLLNHSCSPNTSVSFINNV  549

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               +R +  +  G E+   YGP   + D  +RQQ LR +Y F C C  C     S+ C  A
Sbjct  550   ASIRASQQIGKGQEILHCYGPHKSRMDVTERQQKLRSQYFFECNCPACQ----SEECRPA  605

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
                A+P       +S  A                                    L+    
Sbjct  606   ---ARPRWEAFCCNSCRAV-----------------------------------LQGDDV  627

Query  641   LNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILR---------  489
             L+C        +C  +   E    RLQD      +  ++L N      I R         
Sbjct  628   LSCG-----TRSCTELVSREHLASRLQDLQQQVGMAQKLLRNGELEQAIQRLLGCQHDAE  682

Query  488   STLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLG  309
             S L   +  + EV+D +AQA   +G+ Q +  H + S++++E  +  + I +G EL KL 
Sbjct  683   SFLSAEHTVVGEVQDVLAQAYAALGDWQKSATHLQKSLRVVEVRHGTSSIEMGRELFKLA  742

Query  308   SIQLQR-GNRDAASTTKSTAEIFSRYFG  228
              I        +A +T +   ++ S + G
Sbjct  743   QIFFNGFAVSEALNTIQKAEQVLSVHCG  770


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 83/322 (26%), Positives = 139/322 (43%), Gaps = 55/322 (17%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+P +++  IS + T + +   C  LL+     P+    +K L+   M    KD +A+ 
Sbjct  17    SLLPASIQVTISSAGTLNDVFLHCCLLLQ-----PEDEMFLKRLSSGYMV--AKDPTASL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               K  GN+ F   DY  A   Y++ +    ++S    +++S + Y NR++A   +G    
Sbjct  70    FYKEEGNRKFQEKDYMGAAVMYSKGV----SHSLPATEHIS-LCYANRSAAFFHLGQYET  124

Query  2117  CLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIED  1947
             CL+D  RA           K   R+ +   SLG  ++A Q L     +E   + K  +  
Sbjct  125   CLKDITRAQRHGYPERLQPKMLLRKAECLVSLGQLQEASQTLS---DLERIFTAKPTLAA  181

Query  1946  ELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDR--ANMQCVSL---P  1818
                 ++ +  H LK     K    E+          DV +++E ++       VSL   P
Sbjct  182   SHFQVMQRNLHHLKIKVQGKETVAETFPADLTKAFKDVDLMEENEQIPGASSSVSLRTDP  241

Query  1817  TKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFN  1692
              KGR +++  DI  G L+ KE+ + +++                + R TN    CH C  
Sbjct  242   LKGRYLIATKDIHPGELLVKEEAFVSVLNPGEMLQLHHGLESKWDIRVTNGDLHCHRCL-  300

Query  1691  ELPMHAVPCESCSIPLYCSSQC  1626
             +  +  VPCE CS   YCS +C
Sbjct  301   KYSLALVPCEQCSYAKYCSQEC  322



>ref|XP_008863387.1| hypothetical protein H310_01849 [Aphanomyces invadans]
 gb|ETW07294.1| hypothetical protein H310_01849 [Aphanomyces invadans]
Length=227

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 76/150 (51%), Gaps = 4/150 (3%)
 Frame = -3

Query  2336  EMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVN  2157
             E+++  KD   ASE K  GN+ F  G Y  A   YT+ALRL P  S D      A+ + N
Sbjct  39    ELSVETKDVKKASEAKEAGNELFKAGRYLDAFDLYTKALRLCP--SEDEYAYNKAVYFSN  96

Query  2156  RASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEV  1977
             RA+ L  +G   E ++DC  A+     Y KA  RR +A   +   ++A+QD+K  L+++ 
Sbjct  97    RAACLLHLGRPEESIEDCTMAITHSPKYVKALMRRSQAYEKMDKMDEALQDVKTVLEIDP  156

Query  1976  SLSGKRQIEDELRIIL--DQHKLKHSSLYK  1893
             ++      E  L  ++   Q K+K   L K
Sbjct  157   TVPSAIDAEKRLSAVVAERQEKMKAEMLDK  186



>ref|XP_007621471.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X3 [Cricetulus griseus]
 ref|XP_007621472.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X3 [Cricetulus griseus]
 ref|XP_007621473.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X3 [Cricetulus griseus]
 gb|ERE67968.1| SET and MYND domain-containing protein 4 [Cricetulus griseus]
Length=800

 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 116/280 (41%), Gaps = 55/280 (20%)
 Frame = -3

Query  1118  NALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGP  939
             N +T+S  QV++   I+ V S+ NHSC PN    F S    +R T  +  G E+   YGP
Sbjct  514   NVITNS-RQVRLATGIFPVVSLLNHSCSPNTSVSFTSTVATIRATQQIRKGQEIVHCYGP  572

Query  938   QVGQWDHKDRQQILRDRYSFSCQCRGCSQLNL--------SDLCINAYRCAKPGCLGVVP  783
                +    +RQ+ L  +Y F C C  C    L           C N  R    G      
Sbjct  573   HESRMGVAERQKKLSSQYFFDCICPACHTETLRAAAEPKWEAFCCNTCRALMQG------  626

Query  782   DSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAAC  603
             +  L+   K     VS+      + R+ D+    V+ A             L RD     
Sbjct  627   NDVLSCNNKSCTESVSRD---HLDSRLRDLQQ-QVYMAQ-----------KLLRD-----  666

Query  602   ATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMC  423
                       G+L+ A       V+ L    +A++   S  H     + E+ED++AQA  
Sbjct  667   ----------GKLEKA-------VQQLLGCREAAESFLSAEHTV---VGEIEDSLAQAYA  706

Query  422   LVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI  303
              +G+ Q +  H + S++++E  + P+ + IG+EL KL  +
Sbjct  707   ALGDWQTSATHVRKSVRVVEARHGPSSVEIGHELFKLAQV  746


 Score = 73.9 bits (180),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 142/324 (44%), Gaps = 59/324 (18%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             +L+PK+++ EIS + T  G+    SSLL+     P+    +K+L      L  KD  A  
Sbjct  17    ALLPKSVQDEISTAETLSGIFLHSSSLLQ-----PEDEVFLKQLAS--AYLVEKDCDAPL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   DY  A   Y++ +  +  N+ D      ++ Y NR++AL  +     
Sbjct  70    FYREEGNKTFQKKDYMGAAVLYSKGVSHSRPNTEDI-----SLCYANRSAALFHLDQYEA  124

Query  2117  CLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
             CL+D  RA      Y      K   R+ +   +LG  ++A Q +   + +E SL+ K  +
Sbjct  125   CLEDIVRA--GMHGYPERLQPKMMLRKAECLVNLGRLQEARQTV---IHLESSLNAKPTL  179

Query  1952  EDELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDRANMQCVSL----  1821
                   IL +  H LK     K N  E+          D+ + +E  + +   +S+    
Sbjct  180   VSSSHQILQRNLHHLKVKIREKENLPETFPKALTRAFEDMALGEENKQISGASLSVSLHT  239

Query  1820  -PTKGRGMVSRADIPIGSLVHKEDPYAAII-----------LKN---CRETN----CHFC  1698
              P KGR +V+  DI  G L+ KED + +++           L+N    R TN    CH C
Sbjct  240   DPLKGRHLVAAKDILPGELLVKEDAFVSVLNPGETPPLHYGLENKWDTRVTNGDLYCHRC  299

Query  1697  FNELPMHAVPCESCSIPLYCSSQC  1626
                  +  VPC  CS   YCS +C
Sbjct  300   LKH-TLATVPCGGCSYARYCSQEC  322



>ref|XP_008620154.1| hypothetical protein SDRG_15750 [Saprolegnia diclina VS20]
 gb|EQC26405.1| hypothetical protein SDRG_15750 [Saprolegnia diclina VS20]
Length=790

 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 66/247 (27%), Positives = 110/247 (45%), Gaps = 29/247 (12%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             K  +    +K RGN  F    + +A+  +++ LRL   +   T + L ++L+ NR +A H
Sbjct  70    KTSTTPDALKDRGNAAFKAKHFKEAIAAFSEGLRLLTIDDEPTAQ-LQSILFTNRCAAWH  128

Query  2138  KMGLIVECLQDCDRALAIFSTYAKAWFRRGKA-NASLGNFEDAIQDLKVSLKMEVSLSGK  1962
              +G +     D  RA+  +  Y KAWFRR K   A +         L  SL+ EV     
Sbjct  129   ALGALEHAFADATRAITSYPPYPKAWFRRAKVLEACVATDSTLAATLCASLRPEV-----  183

Query  1961  RQIEDELRIILDQHKLKHSSLYKSNRN----ESDVTMLDEP----------DRANMQCVS  1824
                 + L I  D   +   +L ++ R     ++ V +L  P             +++  +
Sbjct  184   ----EPLNIARDDLAMA-KALVETPRAVDPFKAAVVVLPPPLAETIYSHPAYHKHVRVAT  238

Query  1823  LPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPL  1644
                 GR + +   IP G++V  EDP A+  L     T C  CF  +  + VPC++C+  +
Sbjct  239   SELAGRYLEATQPIPAGTVVLVEDPVASAGLDPV--TRCERCF-AVCANLVPCDACACAV  295

Query  1643  YCSSQCQ  1623
             YCS  C+
Sbjct  296   YCSDVCR  302


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 8/109 (7%)
 Frame = -3

Query  1184  VNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSR  1005
             +N +AI    S   +G +D         + Q ++G  ++   +M NHSC PNA  +F  R
Sbjct  531   INQVAITTTASAIAQGGVD--------VVGQARLGTGLFPAMAMCNHSCAPNASVHFDGR  582

Query  1004  TLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC  858
             TL + TT +V+ G  + +SYGP   +    +RQ++L+++Y F C C  C
Sbjct  583   TLRLVTTRAVAQGDGIAISYGPHRAKMPTAERQRMLQEQYGFDCACAAC  631



>ref|XP_005858367.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Myotis brandtii]
Length=803

 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 120/303 (40%), Gaps = 64/303 (21%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +K       N +T S  QV++   ++ V S+ NHSC PN    F+S  
Sbjct  501   NAQAITTIQQTGSKE------NIITDS-RQVRLATGLFPVVSLLNHSCSPNTSVSFVSTV  553

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               VR +  +  G E+   YGP   +    +RQQ LR +Y F C C  C          N 
Sbjct  554   ATVRASQPIGKGQEILHCYGPHESRMGVAERQQKLRSQYFFDCDCLACQ---------NG  604

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
              R A  G                  P                   +  H+    ++    
Sbjct  605   KRRAAAG------------------PRWEA---------------FHCHRCGELMQGDDV  631

Query  641   LNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNAL---KASDIL-------  492
             L+C       A+C   +  +  + R QD         ++L N     +A  +L       
Sbjct  632   LSCG-----SASCTESASRDHLVSRFQDLQQRVGKAQKLLRNGKLTERAIQLLFGCQHDA  686

Query  491   RSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKL  312
              S L   +  + E+ED +AQA   +G+ Q +  H + S++++E  + P+ + +G+EL KL
Sbjct  687   ESFLSAEHSLVGEIEDALAQAYAALGDWQKSAAHLQKSLRVVEVRHGPSSVEMGHELFKL  746

Query  311   GSI  303
               I
Sbjct  747   AQI  749


 Score = 70.9 bits (172),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 138/324 (43%), Gaps = 59/324 (18%)
 Frame = -3

Query  2474  SLVPKALRQEI-SESTPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+++  I +  T   +    SSLL+     P+    +K L+     L GKD  A  
Sbjct  17    SLLPKSIQVTICTAETLSDIFLHSSSLLQ-----PEDEMFLKRLS--RGYLVGKDPGAPL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               + +GN+ F   DY  A   YT+ +  +  N+ D      ++ Y NR++AL ++G    
Sbjct  70    FYREQGNKKFQEKDYMGATVLYTKGVSHSRPNTEDI-----SLCYANRSAALFRLGQYET  124

Query  2117  CLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
             CLQD  RA      Y      K   R+ +   +LG  ++A Q +     +E   + ++ +
Sbjct  125   CLQDITRAQ--MHGYPERLQLKMMLRKAECLVTLGKLQEASQIIS---DLESHFTDRQTL  179

Query  1952  EDELRIILDQH--KLKHSSLYKSNRNES----------DVTMLDEPDRANMQCVSL----  1821
                   IL     +LK     K N  E+          D+ + +E ++ +    S+    
Sbjct  180   AASQFQILQSTLCRLKRKVQEKENPTETFPAALTTGFEDMNLREENEQISCASSSVTLCT  239

Query  1820  -PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFC  1698
              P KGR +++  DI  G L+ +E+ + +++                + R TN    CH C
Sbjct  240   DPLKGRSLIATKDILPGELLVREEAFVSVLNPGEMPPRRDGLESKWDTRVTNGDLYCHRC  299

Query  1697  FNELPMHAVPCESCSIPLYCSSQC  1626
                  +  VPC  CS   YCS +C
Sbjct  300   LKH-TLATVPCGGCSYAKYCSQEC  322



>ref|XP_006214533.1| PREDICTED: SET and MYND domain-containing protein 4 [Vicugna 
pacos]
Length=787

 Score = 80.5 bits (197),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 77/351 (22%), Positives = 138/351 (39%), Gaps = 88/351 (25%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +K  L      +T S  QV++   ++ V S+ NHSC PN    F+S +
Sbjct  500   NAQAITTIQQTGSKEKL------ITDS-RQVRLATGLFPVISLLNHSCSPNTSVSFISTS  552

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               VR +  +  G E+   YGP   +    +R Q L+ +Y F C C  C +          
Sbjct  553   ATVRASQQIRKGQEILHCYGPHESRMGVAERHQKLKSQYFFDCNCSPCER----------  602

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
                                                E +R+S           +  + G  
Sbjct  603   -----------------------------------EKQRVS-----------FPYRGGDV  616

Query  641   LNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNA---------LKASDILR  489
             L+C       A+C      +  + RLQ+      +  ++L N          L+      
Sbjct  617   LSCG-----TASCTESVSRDHLVSRLQNLQQQVGMARKLLRNGKLEQAIQLLLRGQHDAE  671

Query  488   STLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLG  309
             S L   +  + E+ED++A+A   +G+ + +  H + S++++E  + P+ I +G+EL KL 
Sbjct  672   SFLSAEHSMVGEIEDHLARAYAALGDWEKSAAHLQKSLRVVEACHGPSSIEMGHELFKLA  731

Query  308   SIQLQR-GNRDAASTTKSTAEIFSRYFGSHALVIFPY---LQRLQQEAGCL  168
              I        +A +T +   E+   ++G       P+   +Q LQ+   CL
Sbjct  732   QIFFNGFAIPEALNTIQKAEEVLLVHYG-------PWNDEVQELQKMKSCL  775


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 87/345 (25%), Positives = 153/345 (44%), Gaps = 65/345 (19%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQV  2358
             ++LPV++     + H+ +  SL+PK+++  IS + T   +    SSLL+     P+    
Sbjct  1     MDLPVEE----WTSHILQKWSLLPKSIQVTISTAETLSDIFLHSSSLLQ-----PEDEIF  51

Query  2357  VKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNL  2178
             +K L+     L GKD  A    +  GN+ F   DY +A   Y++ +  +  ++ D     
Sbjct  52    LKRLSGD--YLVGKDPDAPLFYREEGNKKFQKKDYLEATVLYSKGVSHSRPHTEDI----  105

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDA  2013
              ++ Y NR++AL  +G    CL+D +RA      Y      K   R+ +   +LG   +A
Sbjct  106   -SLCYANRSAALFHLGQYETCLKDINRAQ--MHGYPERLQPKMLLRKAECLVTLGRLPEA  162

Query  2012  ---IQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNES----------D  1872
                I DL+ +   + +L+   Q++   R +    +LK     K N  E+          D
Sbjct  163   SQAISDLESNFAAKPTLAAS-QLQILQRTLC---RLKIKVQEKENLTEAFPAALTKAFED  218

Query  1871  VTMLDEPDR-----ANMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAII---------  1734
             V +  E  +     +++   + P KGR +V+  DI  G L+ KE  + +++         
Sbjct  219   VDLRQENKQISSASSSVSLCTDPLKGRYLVATKDILPGELLVKEHAFVSVLNPGEMPPRH  278

Query  1733  --LKNCRETN-------CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
               L++  +T        CH C     +  VPC+ CS   YCS +C
Sbjct  279   RGLESKWDTRVTTGDLYCHRCLKH-TLATVPCDGCSYAKYCSQEC  322



>emb|CBY24692.1| unnamed protein product [Oikopleura dioica]
Length=475

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 77/335 (23%), Positives = 131/335 (39%), Gaps = 73/335 (22%)
 Frame = -3

Query  1841  NMQCVSLPTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCE  1662
             N++  +    GRG+ S  +   G  +    PY   +        C  C    P   + C 
Sbjct  4     NVEIRNTKEAGRGLYSTKNFETGMNILNSTPYVHTLALKYHGVRCAQCCVFKP-KLLRCA  62

Query  1661  SCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELPDELEKYISECVSIGVSGPRTEDIAE  1482
              C +  YCS  CQ         K+  K+                                
Sbjct  63    GCKLQYYCSKDCQ---------KSAWKI--------------------------------  81

Query  1481  HRHECQGVHWPAVLPSEVVL-AGRVLVKFIEQQKDSSGFSN----LLTVLDLCHNFVQLP  1317
             H+ EC+ +     +P ++ L  GR+L++   +  DS   +N     + VL L  +F +L 
Sbjct  82    HKEECKMLKSEKSMPDDITLFLGRILIRVENEFGDSDEPNNKIDSFIHVLQLESHFDRLD  141

Query  1316  PDTKLEMHIYSIILLNCLQNSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKG  1137
             P  + ++ I+ +       N Y  K P+ G                S+   R K LD   
Sbjct  142   PSQQEDLGIFLMKF-----NLYWKK-PIPG----------------SLRSSR-KLLDLVA  178

Query  1136  SLDEHVNALTSSLEQV-KVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSE  960
             ++  +  A+      +  +G A+YL  S+ NHSC+PNA   F    L ++  + ++ G E
Sbjct  179   AIKNNQFAICDEESSICDIGSALYLNHSLINHSCKPNAFPVFNGTNLVIKALEKIAPGEE  238

Query  959   LELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCS  855
             ++++Y         +DR+  L D Y F CQC+GC+
Sbjct  239   IKIAYTDTKAV--IQDRRDYLNDIYRFVCQCQGCT  271



>ref|XP_005858369.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X3 
[Myotis brandtii]
Length=754

 Score = 80.1 bits (196),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 120/303 (40%), Gaps = 64/303 (21%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +K       N +T S  QV++   ++ V S+ NHSC PN    F+S  
Sbjct  452   NAQAITTIQQTGSKE------NIITDS-RQVRLATGLFPVVSLLNHSCSPNTSVSFVSTV  504

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               VR +  +  G E+   YGP   +    +RQQ LR +Y F C C  C          N 
Sbjct  505   ATVRASQPIGKGQEILHCYGPHESRMGVAERQQKLRSQYFFDCDCLACQ---------NG  555

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
              R A  G                  P                   +  H+    ++    
Sbjct  556   KRRAAAG------------------PRWEA---------------FHCHRCGELMQGDDV  582

Query  641   LNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNAL---KASDIL-------  492
             L+C       A+C   +  +  + R QD         ++L N     +A  +L       
Sbjct  583   LSCG-----SASCTESASRDHLVSRFQDLQQRVGKAQKLLRNGKLTERAIQLLFGCQHDA  637

Query  491   RSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKL  312
              S L   +  + E+ED +AQA   +G+ Q +  H + S++++E  + P+ + +G+EL KL
Sbjct  638   ESFLSAEHSLVGEIEDALAQAYAALGDWQKSAAHLQKSLRVVEVRHGPSSVEMGHELFKL  697

Query  311   GSI  303
               I
Sbjct  698   AQI  700


 Score = 68.6 bits (166),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 115/274 (42%), Gaps = 51/274 (19%)
 Frame = -3

Query  2327  LCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRAS  2148
             L GKD  A    + +GN+ F   DY  A   YT+ +  +  N+ D      ++ Y NR++
Sbjct  11    LVGKDPGAPLFYREQGNKKFQEKDYMGATVLYTKGVSHSRPNTEDI-----SLCYANRSA  65

Query  2147  ALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDAIQDLKVSLKM  1983
             AL ++G    CLQD  RA      Y      K   R+ +   +LG  ++A Q +     +
Sbjct  66    ALFRLGQYETCLQDITRAQ--MHGYPERLQLKMMLRKAECLVTLGKLQEASQIIS---DL  120

Query  1982  EVSLSGKRQIEDELRIILDQH--KLKHSSLYKSNRNES----------DVTMLDEPDRAN  1839
             E   + ++ +      IL     +LK     K N  E+          D+ + +E ++ +
Sbjct  121   ESHFTDRQTLAASQFQILQSTLCRLKRKVQEKENPTETFPAALTTGFEDMNLREENEQIS  180

Query  1838  MQCVSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRE  1716
                 S+     P KGR +++  DI  G L+ +E+ + +++                + R 
Sbjct  181   CASSSVTLCTDPLKGRSLIATKDILPGELLVREEAFVSVLNPGEMPPRRDGLESKWDTRV  240

Query  1715  TN----CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
             TN    CH C     +  VPC  CS   YCS +C
Sbjct  241   TNGDLYCHRCLKH-TLATVPCGGCSYAKYCSQEC  273



>ref|XP_002513816.1| protein with unknown function [Ricinus communis]
 gb|EEF48399.1| protein with unknown function [Ricinus communis]
Length=482

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 71/286 (25%), Positives = 123/286 (43%), Gaps = 51/286 (18%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  R   V T   +  GSE+ +SY    G      RQ
Sbjct  201   LGTGLYPVVSIINHSCLPNAVLVFDGRLAVVHTVQHIPKGSEVLISYIETAG--STMTRQ  258

Query  905   QILRDRYSFSCQCRGCSQLNLSD-----LCINAYRCAKPGCLG-VVPDSTLASYVKQKLP  744
             + L+ +Y F+C C  C ++ L D       +  YRC    C G ++ DS    ++ Q+  
Sbjct  259   KALKQQYFFTCTCPRCIKMGLLDDIQESAILEGYRCKDNRCNGFLLRDSDDRGFICQQCG  318

Query  743   HVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSI--G  570
              +  + E              V K+   +K                 AT  KA  SI  G
Sbjct  319   LLRSKEE--------------VKKSAAEIK-----------------ATSDKASKSISSG  347

Query  569   RLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDH  390
              LQ+A++   + +E L          R   HPF+  + +  + + + +  + +   A+ +
Sbjct  348   NLQEAVSIYKL-IEKLQ---------RKLCHPFSTSLMQTREKLLKMLMELEDWGEALSY  397

Query  389   CKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTA  252
             CK +I + +++Y   H ++G +    G ++   G+ +AA  + + A
Sbjct  398   CKLTIPVYQRVYPEFHPLLGLQYFSCGKLEWLLGDTEAAIKSLTKA  443



>ref|XP_002918077.1| PREDICTED: SET and MYND domain-containing protein 4-like [Ailuropoda 
melanoleuca]
 gb|EFB17941.1| hypothetical protein PANDA_006471 [Ailuropoda melanoleuca]
Length=793

 Score = 80.1 bits (196),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 75/302 (25%), Positives = 120/302 (40%), Gaps = 63/302 (21%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +K       N +T S   V++   I+ V S+ NHSC PN    F+S  
Sbjct  492   NAQAITTIQQTGSKE------NNITDS-RLVRLATGIFPVVSLLNHSCSPNTSMSFVSTV  544

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               +R ++ +  G E+   YGP   +    DRQQ LR +Y F C C  C +          
Sbjct  545   ATIRASEKIGKGQEILHCYGPHHSRMGVADRQQKLRSQYFFDCGCPACQK--------EK  596

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
             +R A                       V  + E     R   V           L+ G  
Sbjct  597   HRAA-----------------------VGPRWEAFCCSRCGAV-----------LQGGDV  622

Query  641   LNCNLYRDLEAACATISKAESSIGRLQD-----AIASNDVPVEVLSNALKASDILRSTLH  477
             L+C        +C      E  + RLQD       A N +    L  A++   + R    
Sbjct  623   LSCG-----STSCTESVSREHLVSRLQDLRQRVGSARNLLSNGQLEQAIQLLLVYRHDAE  677

Query  476   PF----NKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLG  309
              F    +  + E+ED +AQA   +G+ Q +  H + S++++E  + P  + +G+EL KL 
Sbjct  678   NFLSAEHSMVGEMEDALAQAYAALGDWQKSATHLQKSLRVVEVQHGPASVEMGHELFKLA  737

Query  308   SI  303
              +
Sbjct  738   QL  739


 Score = 67.0 bits (162),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 81/319 (25%), Positives = 137/319 (43%), Gaps = 49/319 (15%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+++  +S + T   L    SSLL+     P+    +K L+     L GKD +A  
Sbjct  17    SLLPKSIQDAVSTADTLRDLFLHSSSLLQ-----PEDEMFLKSLSGG--YLVGKDPNAPP  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   DY  A   Y++ +  A  ++ D      ++ Y NR++AL  +     
Sbjct  70    FYREEGNKKFQKKDYTGATVLYSKGISHARPHTADI-----SLCYANRSAALFYLDEYEM  124

Query  2117  CLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDA---IQDLKVSLKMEVSLSGKRQ  1956
             CL+D  RA       S   K   R+ +   +LG  ++A   I+DL+ S   + +L+  + 
Sbjct  125   CLKDITRAQMHGYPESLQPKVTLRKVECLVTLGRLQEAGQTIRDLESSFAAKPTLAAAQF  184

Query  1955  IEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPD--RANMQCVSL---------PTKG  1809
                +  +   + K+K      +   E    + ++ D    N Q  S          P +G
Sbjct  185   QILQRNLCRLKMKVKERENLTATFPEVVTKVFEDMDLREENEQIASASSSVGLRVDPLRG  244

Query  1808  RGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFNELP  1683
             R +++  DI  G L+ KED + +++                + R TN    CH C     
Sbjct  245   RYLIATKDILPGELLVKEDAFVSVLNPGERPPLHHGLESKWDTRVTNGDLYCHRCLKHT-  303

Query  1682  MHAVPCESCSIPLYCSSQC  1626
             +  VPC+ CS   YCS +C
Sbjct  304   LAMVPCDGCSYAKYCSHEC  322



>gb|KDO80753.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=335

 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 125/308 (41%), Gaps = 56/308 (18%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  R   VR    V  G+E+ +SY    G      RQ
Sbjct  55    LGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHVPKGAEVLISYIETAG--STMTRQ  112

Query  905   QILRDRYSFSCQCRGCSQLNLSD-----LCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
             + L+++Y F+C C  C +L   D       +  YRC   GC G +               
Sbjct  113   KALKEQYLFTCTCPRCIKLGQFDDIQESAILEGYRCKDDGCSGFLL--------------  158

Query  740   VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
                        R SD   +             C  C L R  E     I K  S +  L 
Sbjct  159   -----------RDSDDKGFT------------CQQCGLVRSKEE----IKKIASEVNILS  191

Query  560   D---AIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDH  390
                 A+ S     EV+S       + +   HPF+  + +  + + + +  + + + A+ +
Sbjct  192   KKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLIKILMELEDWKEALAY  251

Query  389   CKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTA-EIFSRYFGSHALV  213
             C+ +I + +++Y   H ++G +    G ++   G+ + A  + + A EI     G+++  
Sbjct  252   CQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTEAVEILRITHGTNS--  309

Query  212   IFPYLQRL  189
               P+++ L
Sbjct  310   --PFMKEL  315



>gb|ELU01530.1| hypothetical protein CAPTEDRAFT_197951 [Capitella teleta]
Length=614

 Score = 79.7 bits (195),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 72/291 (25%), Positives = 119/291 (41%), Gaps = 43/291 (15%)
 Frame = -3

Query  1097  EQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDH  918
             +QV++  AIY   S+ NHSC P+  A      L+VR    V AG E+   YGP   +   
Sbjct  346   QQVRIATAIYPTTSLLNHSCDPSIIAR--KNELFVRLVKDVKAGEEIFNCYGPHYARMPK  403

Query  917   KDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHV  738
             K+RQ++L+ +Y F C C  C+     +  + AYRC K           + S   Q++   
Sbjct  404   KERQEVLQSQYFFKCDCSECTAEEPLENLLKAYRCQKCS-------HAIISTGTQEVLKC  456

Query  737   SKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQD  558
             SK V  V+  ++S         +D  +    CL                           
Sbjct  457   SKCVTMVDMNQLSAAEK---QSSDDFMSSLKCLQ--------------------------  487

Query  557   AIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKAS  378
              +   D  ++ L N+L   DI +   H  +K + E +D +A+  C+ G+   A+   K  
Sbjct  488   -VEDIDGAIKKLKNSL---DIRKMIYHRNHKLLTEAKDALARCYCIKGQFTRAVPLLKDC  543

Query  377   IKILEKLYDPNHIVIGNELIKLGSIQLQ-RGNRDAASTTKSTAEIFSRYFG  228
             +  +E  +    I + NEL K   + +  R   +A  T   + +I    +G
Sbjct  544   LLCVETAFGSRSIELANELHKYAEVLVNARKLDEALETVNQSIDILRLNYG  594



>ref|XP_008007961.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X4 
[Chlorocebus sabaeus]
Length=758

 Score = 79.7 bits (195),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 126/302 (42%), Gaps = 56/302 (19%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +KGS+        +   QV++   I+ V S+ NHSC PN    F+S  
Sbjct  500   NAQAITTVQHTGSKGSI-------VTDSRQVRLATGIFPVISLLNHSCSPNTSVSFISTV  552

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C           A
Sbjct  553   ATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPACQ--------TEA  604

Query  821   YRCA-----KPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHL  657
             +R A     K  C         AS +++                            D  L
Sbjct  605   HRMAAGPRWKAFCCNSCRAPMQASLLRE---------------------------GDGML  637

Query  656   KPGH--CLNCNLYRDLEAACATISKAESSIGRLQDAIASNDV--PVEVLSNALKASDILR  489
             + G+  C    + RD     + +   +  +G  Q  +   ++   V++LS   + ++   
Sbjct  638   RCGNRSCAESVVSRD--HLVSRLQDLQQQVGVAQKLLRDGELERAVQLLSGCQRDAE---  692

Query  488   STLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLG  309
             S L   +  + E+ D +A+A   +G+ Q +  H + S++++E  + P+ + +G+EL KL 
Sbjct  693   SFLWAEHAMVGEIADGLARACAALGDWQKSATHLQKSLRVVEVRHGPSSVEMGHELFKLA  752

Query  308   SI  303
              +
Sbjct  753   QV  754


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 90/344 (26%), Positives = 149/344 (43%), Gaps = 63/344 (18%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQV  2358
             ++LPV +     S  ++K  SL PK+++  IS + T   +    SSLL+     P+    
Sbjct  1     MDLPVDE---WKSYLLQKWASL-PKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELF  51

Query  2357  VKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNL  2178
             +K L+  +  L GKD  A    + +GN+ F   DY  A   Y++ +  +  N+ D     
Sbjct  52    LKRLS--KGYLVGKDSDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM----  105

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDA  2013
              ++ Y NR++AL  +G    CL+D  RA      Y      K   R+ +   +LG  ++A
Sbjct  106   -SLCYANRSAALFHLGQYETCLKDISRAQ--MHGYPERLQPKIMLRKAECLVALGRLQEA  162

Query  2012  IQDLKVSLKMEVSLSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DV  1869
              Q +     +E + +    + D     L +  H LK     K +  E+          DV
Sbjct  163   SQTVG---DLERNFTATPTLADVPPQTLQRNLHHLKMKLQEKESPTETLPATLAKTLEDV  219

Query  1868  TMLDEPDRANMQCVSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII----------  1734
              +  E +R +    S+     P KGR +V+  +I  G L+ +ED + +I+          
Sbjct  220   ALRGENERLSNASSSVGLCIDPLKGRYLVATKEILPGELLVREDAFVSILNPGELPPLHH  279

Query  1733  ----LKNCRETN----CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                  ++ R TN    CH C     +  VPC+ CS   YCS +C
Sbjct  280   GLDSQRDTRVTNGDLYCHRCLKH-TLATVPCDGCSYAKYCSQEC  322



>ref|XP_006343573.1| PREDICTED: tetratricopeptide repeat protein 1-like [Solanum tuberosum]
Length=265

 Score = 76.3 bits (186),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 75/131 (57%), Gaps = 2/131 (2%)
 Frame = -3

Query  2303  ASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLI  2124
             A++ K+ GN  F  G Y +AL  Y  AL++A    + TE  + ++ Y NRA+   K+G I
Sbjct  93    ANDAKVEGNALFKDGLYEEALSKYELALQVAADIPSSTE--IRSICYANRAACFTKLGKI  150

Query  2123  VECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDE  1944
              E +++C +AL +  TY KA  RR +A+  L +FE+AI D+   L++E S    R+    
Sbjct  151   EETIKECTKALELNPTYIKALVRRAEAHEKLEHFEEAITDMTKILELEPSHDQARRTVMR  210

Query  1943  LRIILDQHKLK  1911
             L+ + D+ + K
Sbjct  211   LKPLADEKREK  221



>ref|XP_010262948.1| PREDICTED: tetratricopeptide repeat protein 1-like isoform X2 
[Nelumbo nucifera]
Length=252

 Score = 76.3 bits (186),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = -3

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             S A++ K  GN+ F  G Y  AL  Y  AL+LAP   +  E  + ++ + NRA    K+G
Sbjct  78    SQAADAKAEGNKLFGAGQYEDALSQYELALQLAPEMPSSVE--IRSICHANRAICFLKLG  135

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLK  1998
                + +++C RAL +  TY KA  RRG+A+  L N+E+AI D+K
Sbjct  136   KYNDTIKECTRALELNPTYMKALVRRGEAHEKLENYEEAISDMK  179



>ref|XP_011097714.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Sesamum 
indicum]
Length=486

 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 73/309 (24%), Positives = 130/309 (42%), Gaps = 50/309 (16%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PN+   F  R   VR    +  G+E+ +SY    G      RQ
Sbjct  205   LGTGLYPVISIINHSCLPNSVLVFEGRLAVVRAMQHIPKGTEVLISYVEIAG--STITRQ  262

Query  905   QILRDRYSFSCQCRGCSQLNLSD-----LCINAYRCAKPGCLG-VVPDSTLASYVKQKLP  744
             + L+++Y F+C C  C +L  SD       +  YRC    C G ++ DS    ++ Q+  
Sbjct  263   KALKEQYFFTCTCPRCMKLGQSDDIQESATLEGYRCKDSKCNGFLLRDSDNKGFICQQCG  322

Query  743   HVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRL  564
              +    +K E + I++       KA      GH                  KAE+S+   
Sbjct  323   LLR---DKEEIKNITNEVKLISEKASTSFSSGH------------------KAEASV---  358

Query  563   QDAIASNDVPVEVLSNALKASDILRSTL-HPFNKRIAEVEDNVAQAMCLVGEPQAAMDHC  387
                             A K  + L+  L HPF+  +    + + +    + E + A+ +C
Sbjct  359   ----------------AYKMVEELQMKLYHPFSINLMRTRETLLKIFMELQEWKEALLYC  402

Query  386   KASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTA-EIFSRYFGSHALVI  210
             + +I + E++Y   H ++G +    G ++   G  +AA  + + A +I     G+    +
Sbjct  403   RLTIPVYERVYPRCHPLLGLQYYMSGKLEWLLGETEAAVRSLTKALDILRITHGTLTPFM  462

Query  209   FPYLQRLQQ  183
                L +L++
Sbjct  463   LELLSKLEE  471



>gb|KDO80752.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=368

 Score = 77.8 bits (190),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 125/308 (41%), Gaps = 56/308 (18%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  R   VR    V  G+E+ +SY    G      RQ
Sbjct  88    LGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHVPKGAEVLISYIETAG--STMTRQ  145

Query  905   QILRDRYSFSCQCRGCSQLNLSD-----LCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
             + L+++Y F+C C  C +L   D       +  YRC   GC G +               
Sbjct  146   KALKEQYLFTCTCPRCIKLGQFDDIQESAILEGYRCKDDGCSGFLL--------------  191

Query  740   VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
                        R SD   +             C  C L R  E     I K  S +  L 
Sbjct  192   -----------RDSDDKGFT------------CQQCGLVRSKEE----IKKIASEVNILS  224

Query  560   D---AIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDH  390
                 A+ S     EV+S       + +   HPF+  + +  + + + +  + + + A+ +
Sbjct  225   KKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLIKILMELEDWKEALAY  284

Query  389   CKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTA-EIFSRYFGSHALV  213
             C+ +I + +++Y   H ++G +    G ++   G+ + A  + + A EI     G+++  
Sbjct  285   CQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTEAVEILRITHGTNS--  342

Query  212   IFPYLQRL  189
               P+++ L
Sbjct  343   --PFMKEL  348



>ref|XP_010262946.1| PREDICTED: tetratricopeptide repeat protein 1-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010262947.1| PREDICTED: tetratricopeptide repeat protein 1-like isoform X1 
[Nelumbo nucifera]
Length=253

 Score = 76.3 bits (186),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = -3

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             S A++ K  GN+ F  G Y  AL  Y  AL+LAP   +  E  + ++ + NRA    K+G
Sbjct  79    SQAADAKAEGNKLFGAGQYEDALSQYELALQLAPEMPSSVE--IRSICHANRAICFLKLG  136

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLK  1998
                + +++C RAL +  TY KA  RRG+A+  L N+E+AI D+K
Sbjct  137   KYNDTIKECTRALELNPTYMKALVRRGEAHEKLENYEEAISDMK  180



>ref|XP_003386610.1| PREDICTED: RNA polymerase II-associated protein 3-like [Amphimedon 
queenslandica]
Length=419

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 56/104 (54%), Gaps = 9/104 (9%)
 Frame = -3

Query  2291  KLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECL  2112
             K RGNQ F  G Y  A+  YT A+ L P         LSA+L  NRA AL K+       
Sbjct  116   KERGNQLFKDGKYEAAIERYTAAINLDP---------LSAVLPANRAMALLKLDRYAAAE  166

Query  2111  QDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKME  1980
             +DCD ++++   Y KAW RR  A   L  +E A +D+K+ L++E
Sbjct  167   KDCDVSISLDDKYVKAWMRRAAAKTKLKKYESATEDIKMVLQLE  210



>ref|XP_005328011.1| PREDICTED: SET and MYND domain-containing protein 4 [Ictidomys 
tridecemlineatus]
Length=796

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 119/301 (40%), Gaps = 61/301 (20%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +K S+        ++  QV++   I+ V S+ NHSC PN    F S  
Sbjct  495   NAQAITTLQHTGSKESI-------IANSRQVRLATGIFPVVSLLNHSCSPNTSMSFTSTV  547

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSD-----  837
               +R    +  G E+   YGP   +    +RQQ LR +Y F C C  C    L       
Sbjct  548   ATIRAAQRIRKGQEILHCYGPHQNRMGIAERQQKLRSQYFFDCSCPACHTEELRTAAGPR  607

Query  836   ---LCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKAD  666
                 C N+ R    G      D  L+   +     VS+                      
Sbjct  608   WEAFCCNSCRAIMQG------DDVLSCGNRFCTESVSRD---------------------  640

Query  665   YHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRS  486
              HL        +  +DL+       K   S G+L+ AI             L+      S
Sbjct  641   -HL-------VSRLQDLQQQVGMAQKLLRS-GKLEKAI----------QQLLRCQQDAES  681

Query  485   TLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGS  306
              L   +  + E+ED++AQA   +G+ Q +  H + S++++E  + P+ + +G+EL KL  
Sbjct  682   FLSIEHTMVGEIEDDLAQAYAALGDWQKSAAHLQKSLRVVEAHHGPSSVEMGHELFKLAQ  741

Query  305   I  303
             +
Sbjct  742   V  742


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 118/274 (43%), Gaps = 53/274 (19%)
 Frame = -3

Query  2327  LCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRAS  2148
             L  KD +A    + +GN  F   DY  A   Y++ +  +  N+ D      ++ Y NR++
Sbjct  58    LVEKDPNAPLFYREKGNNKFQEKDYTGAAVLYSKGISHSKPNTEDI-----SLCYANRSA  112

Query  2147  ALHKMGLIVECLQDCDRALAIFSTYA-------KAWFRRGKANASLGNFEDAIQDLKVSL  1989
             AL  +G    CL+D  RA     T+        K   R+ +   +LG  ++A Q +    
Sbjct  113   ALFHLGQYELCLEDIIRA----QTHGYPERLQPKMNLRKAECLVTLGKLQEASQTVS---  165

Query  1988  KMEVSLSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDR  1845
              +E   + K+ +      IL +  H+LK     K +  E+          D+ + +E ++
Sbjct  166   DLESDFAAKQTLAASSFQILQKNLHRLKKKVQEKESLPETFPPSLAKAFEDMDLKEENEQ  225

Query  1844  ANMQCVSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII---------LKNCRETN-  1710
              +    S+     P KGR +++  DI  G L+ KED + +++         L+N  +T  
Sbjct  226   ISSASPSVSLCTDPLKGRCLIATKDILPGELLVKEDAFVSVLIPGEMPHHSLENKWDTRI  285

Query  1709  ------CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                   CH C     +  VPC+ CS   YCS +C
Sbjct  286   AIGDLYCHRCLKHT-LATVPCDGCSYAKYCSQEC  318



>ref|XP_002403605.1| SET and MYND domain-containing protein (SMYD), putative [Ixodes 
scapularis]
 gb|EEC01028.1| SET and MYND domain-containing protein (SMYD), putative [Ixodes 
scapularis]
Length=770

 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 119/294 (40%), Gaps = 58/294 (20%)
 Frame = -3

Query  1160  MKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYF-LSRTLYVRTT  984
             + SL++K S ++ V   T   EQV++  AIY   S+ NHSC PN  + F    TL VR  
Sbjct  466   ITSLESKTSQEDDVVMTT---EQVRIATAIYPSASLMNHSCDPNIFSSFRCGSTLVVRAI  522

Query  983   DSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAK-  807
               +  G E+   YGP   +    +RQQ+L+++Y F C C  CS    ++  + A +C   
Sbjct  523   RRIQEGEEVLNCYGPHHRRMSFAERQQLLQEQYFFVCSCTACSSGEDAEQRLQALKCEYC  582

Query  806   PGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNL  627
              G L    DS  A+                                        CL+C  
Sbjct  583   EGPLKQPDDSGKAT----------------------------------------CLDCGT  602

Query  626   YRDLEAACATISKAESSIGRLQD------AIASNDVPVEVLSNALKASDILRSTLHPFNK  465
              ++          +E    R+ D       +A     VE L    K        ++  N 
Sbjct  603   TQECLG-------SEQKAFRMHDLYVQGVQLAEKGNHVEALQRLNKCLKTREKVMYKHNL  655

Query  464   RIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI  303
             ++ EV+D VA+ +C +G+ ++A    K ++  +  +Y  N I +  EL KL  +
Sbjct  656   KLLEVKDMVAKCLCSLGDFRSASGVLKPAVDAVRVIYGENSIELAYELQKLSDV  709


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 74/266 (28%), Positives = 118/266 (44%), Gaps = 40/266 (15%)
 Frame = -3

Query  2327  LCGKDH----SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAP-TNSNDTEKNLSAML-  2166
             LC   H      ASE++  GN CF+   Y KA   YTQ++  AP  ++ D E +   M  
Sbjct  57    LCSSKHRKFWEKASELRSEGNLCFNRKQYAKAAELYTQSVLSAPFPDTPDAEGHSEEMSL  116

Query  2165  -YVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDAIQD  2004
              + NR++A    G   + L  CD   A    Y      K + R+G+    LG   +A+++
Sbjct  117   GFANRSAAFFHAGKYKQAL--CDVRYAFELGYPVHLRYKLYLRKGQCYLRLGKPREALEN  174

Query  2003  LKVSLK--MEVSLSGKRQIE-----DELRIILDQH-KLKHSSLYKSNRNESDVTMLDEPD  1848
               ++ K     +L G++  +     D  + +  Q      +S  +   +ES V     PD
Sbjct  175   FDLANKSLRRAALEGRKLAQQCKEIDTFKALCSQDCAPTPTSEEEDPDDESQV-----PD  229

Query  1847  RANMQCVSLPT------------KGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCH  1704
              A     ++P+            KGR +V+  D+  G  +  E PYA+++L    +TNC 
Sbjct  230   VAYGAHGTVPSCSMAVDMLYSTEKGRFLVANRDLQPGDAIFVERPYASVLLPGHTKTNCQ  289

Query  1703  FCFNELPMHAVPCESCSIPLYCSSQC  1626
              C   L ++AVPC  C+   YCS  C
Sbjct  290   HCHKRL-LNAVPCAQCNQVRYCSFAC  314



>ref|XP_006434126.1| hypothetical protein CICLE_v10001105mg [Citrus clementina]
 gb|ESR47366.1| hypothetical protein CICLE_v10001105mg [Citrus clementina]
Length=455

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 125/308 (41%), Gaps = 56/308 (18%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  R   VR    V  G+E+ +SY    G      RQ
Sbjct  175   LGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHVPKGAEVLISYIETAG--STMTRQ  232

Query  905   QILRDRYSFSCQCRGCSQLNLSD-----LCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
             + L+++Y F+C C  C +L   D       +  YRC   GC G +               
Sbjct  233   KALKEQYLFTCTCPRCIKLGQFDDIQESAILEGYRCKDDGCSGFLL--------------  278

Query  740   VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
                        R SD   +             C  C L R  E     I K  S +  L 
Sbjct  279   -----------RDSDDKGFT------------CQQCGLVRSKEE----IKKIASEVNILS  311

Query  560   D---AIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDH  390
                 A+ S     EV+S       + +   HPF+  + +  + + + +  + + + A+ +
Sbjct  312   KKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLIKILMELEDWKEALAY  371

Query  389   CKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTA-EIFSRYFGSHALV  213
             C+ +I + +++Y   H ++G +    G ++   G+ + A  + + A EI     G+++  
Sbjct  372   CRLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTEAVEILRITHGTNS--  429

Query  212   IFPYLQRL  189
               P+++ L
Sbjct  430   --PFMKEL  435



>gb|AAS07242.1| putative MYND finger protein [Oryza sativa Japonica Group]
 gb|ABF98445.1| MYND finger family protein, expressed [Oryza sativa Japonica 
Group]
Length=480

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/305 (24%), Positives = 120/305 (39%), Gaps = 48/305 (16%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  RT YVR    +S   E+ +SY           RQ
Sbjct  205   LGTGLYPVLSIINHSCVPNAVLIFEGRTAYVRALQPISKNEEVSISYIETAAT--TMKRQ  262

Query  905   QILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQV  726
               L+  Y F+C C  C + +  D  +  YRC    C G +            LP+     
Sbjct  263   DDLK-HYYFTCTCPRCVKDSEEDALLEGYRCNDQKCDGFL------------LPNAGN--  307

Query  725   EKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAIA-  549
                                    K   C  C+  RD E     + K  S +  L D ++ 
Sbjct  308   -----------------------KGYTCQKCSTSRDGEE----LQKMASDVLLLSDKVSS  340

Query  548   --SNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASI  375
               S+    EV S      ++ R   HP +  +    + + +    + + Q A+ +C+ +I
Sbjct  341   LVSSGNNSEVGSMYKTIEELERKLYHPLSITLLHTRETLLKIYMELQDWQTALMYCRLTI  400

Query  374   KILEKLYDPNHIVIGNELIKLGSIQ-LQRGNRDAASTTKSTAEIFSRYFGSHALVIFPYL  198
              + E++Y P H +IG +    G ++ L     DA  +    A+I     G+ +  +   L
Sbjct  401   PVYERIYPPFHPMIGLQFYTCGKLEWLLEYTEDALMSLTRAADILRITHGTKSEFMKELL  460

Query  197   QRLQQ  183
              +L++
Sbjct  461   GKLEE  465



>ref|XP_008061604.1| PREDICTED: SET and MYND domain-containing protein 4 [Tarsius 
syrichta]
Length=800

 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/302 (24%), Positives = 120/302 (40%), Gaps = 63/302 (21%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +K       N +T S  QV++   I+   S+ NHSC PN    F++  
Sbjct  499   NAQAITTIQQTGSKK------NIITDS-RQVRLATGIFPAVSLLNHSCSPNTSVSFINTV  551

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINA  822
               +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C           A
Sbjct  552   ATIRASQQIGKGQEILHCYGPHENRMGVAERQQKLRSQYFFDCNCPACQ--------TEA  603

Query  821   YRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHC  642
             +R A                          + E    +R       A+ + D  L  G+ 
Sbjct  604   HRMA-----------------------TGPRWEAFSCDRCR-----ALMQGDDVLSCGN-  634

Query  641   LNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNA---------LKASDILR  489
                        +CA     +  + RLQD      +  ++L N          L+     +
Sbjct  635   ----------RSCAESVGRDHLVSRLQDLQQQVGMARKLLRNGKLEQAIQQLLECQHDAK  684

Query  488   STLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLG  309
             S L   +  + E+ED +AQA   +G  Q +  H + S++++E  + P+ + +G+EL KL 
Sbjct  685   SFLSTEHSMVGEIEDGLAQAYAALGNWQKSAIHLQKSLQVVEVRHGPSSVEMGHELFKLA  744

Query  308   SI  303
              I
Sbjct  745   QI  746


 Score = 70.1 bits (170),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 142/324 (44%), Gaps = 60/324 (19%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+P +++  IS + T   +    SSLL+     P+    +K L+     L GKD  A  
Sbjct  17    SLLPASIQVTISTAETLSEIFLHSSSLLQ-----PEDEMFLKRLS--RGYLVGKDSDAPL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   DY  A   Y++ +    ++S    +N+S + Y NR++AL  +G    
Sbjct  70    FYREEGNKKFQEKDYTGAAVLYSKGI----SHSKPNTRNIS-LCYANRSAALFHLGQYET  124

Query  2117  CLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQI  1953
             CL+D  RA      Y      K  FR+ +   +LG  ++A Q +     +E + + +  +
Sbjct  125   CLKDIIRAQ--MHGYPERLQPKIMFRKAECLVTLGRLQEASQTIN---DLESNFAARLTL  179

Query  1952  EDELRIILDQHKLKHSSLYKSNRNES------------DVTMLDEPDRANMQCVSL----  1821
              D    IL Q  L+H  +    +N +            D+ + +E ++ +    S+    
Sbjct  180   ADSPFQIL-QGNLRHLKMKVQEKNLTETFPEPLAKAFEDMDLKEENEQISSVSSSVRLCM  238

Query  1820  -PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFC  1698
              P KGR +++  DI  G L+ KED + +++                + R T+    CH C
Sbjct  239   DPLKGRCLIATKDILPGELLVKEDAFVSVLNPGEMPPLHHGLDGKWDTRVTSGDLYCHQC  298

Query  1697  FNELPMHAVPCESCSIPLYCSSQC  1626
                  +  +PC+ CS   YCS +C
Sbjct  299   LKH-TLAIIPCDGCSYAKYCSQEC  321



>gb|KDO80750.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=455

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 125/308 (41%), Gaps = 56/308 (18%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  R   VR    V  G+E+ +SY    G      RQ
Sbjct  175   LGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHVPKGAEVLISYIETAG--STMTRQ  232

Query  905   QILRDRYSFSCQCRGCSQLNLSD-----LCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
             + L+++Y F+C C  C +L   D       +  YRC   GC G +               
Sbjct  233   KALKEQYLFTCTCPRCIKLGQFDDIQESAILEGYRCKDDGCSGFLL--------------  278

Query  740   VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
                        R SD   +             C  C L R  E     I K  S +  L 
Sbjct  279   -----------RDSDDKGFT------------CQQCGLVRSKEE----IKKIASEVNILS  311

Query  560   D---AIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDH  390
                 A+ S     EV+S       + +   HPF+  + +  + + + +  + + + A+ +
Sbjct  312   KKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLIKILMELEDWKEALAY  371

Query  389   CKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTA-EIFSRYFGSHALV  213
             C+ +I + +++Y   H ++G +    G ++   G+ + A  + + A EI     G+++  
Sbjct  372   CQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTEAVEILRITHGTNS--  429

Query  212   IFPYLQRL  189
               P+++ L
Sbjct  430   --PFMKEL  435



>gb|KDO80748.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=481

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 125/308 (41%), Gaps = 56/308 (18%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  R   VR    V  G+E+ +SY    G      RQ
Sbjct  201   LGTGLYPVISIINHSCLPNAVLVFEGRLAVVRAVQHVPKGAEVLISYIETAG--STMTRQ  258

Query  905   QILRDRYSFSCQCRGCSQLNLSD-----LCINAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
             + L+++Y F+C C  C +L   D       +  YRC   GC G +               
Sbjct  259   KALKEQYLFTCTCPRCIKLGQFDDIQESAILEGYRCKDDGCSGFLL--------------  304

Query  740   VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
                        R SD   +             C  C L R  E     I K  S +  L 
Sbjct  305   -----------RDSDDKGFT------------CQQCGLVRSKEE----IKKIASEVNILS  337

Query  560   D---AIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDH  390
                 A+ S     EV+S       + +   HPF+  + +  + + + +  + + + A+ +
Sbjct  338   KKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLIKILMELEDWKEALAY  397

Query  389   CKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTA-EIFSRYFGSHALV  213
             C+ +I + +++Y   H ++G +    G ++   G+ + A  + + A EI     G+++  
Sbjct  398   CQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTEAVEILRITHGTNS--  455

Query  212   IFPYLQRL  189
               P+++ L
Sbjct  456   --PFMKEL  461



>ref|XP_006564918.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X4 [Apis mellifera]
Length=500

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 126/260 (48%), Gaps = 22/260 (8%)
 Frame = -3

Query  2339  PEMALCGKDHSAASEVKLRGNQCFSGG---DYP--KALHFYTQALRLAPTNSNDTEKNLS  2175
             P++    KD   + +++ +GN+ F      +Y   +AL  YT+++  AP  S        
Sbjct  49    PQVCDNKKDAKESEKLREQGNKIFISTPLKNYTCVEALKLYTKSIAYAPYPSEQL-----  103

Query  2174  AMLYVNRASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLG--NFEDAI  2010
             A+ Y NR++ L K+     C+QD DR LA+    +  AK + R+ +   +L   N ED I
Sbjct  104   ALAYANRSAVLIKLHKYKLCIQDIDRTLALAYPNNLRAKLYVRKVECLNALKNPNVEDTI  163

Query  2009  QDLKVSLKMEVSLSGKRQIEDELRII---LDQHKLKHSSLYKSNRNESDVTM-LDEPDRA  1842
             ++ +  L+ +VSL  ++++ ++L+ I   L   K K     K        T  ++ P  +
Sbjct  164   KEAQYWLE-KVSLDNRKKLNEKLKSIKNMLPSQKFKKEKFMKQAPLPKIKTHNIEVPCAS  222

Query  1841  NMQCVSLPTK-GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPC  1665
             +   +    K GR +V+   I  G ++  E PY+ I+  +   T+C  C  E+    +PC
Sbjct  223   DAITIKYNDKYGRHIVATRKINPGEVIAIEKPYSLILTPDNIYTHCSNCL-EVSWANIPC  281

Query  1664  ESCSIPLYCSSQCQLVSGGK  1605
             E C+  +YCS +C+ +   K
Sbjct  282   EYCTYAMYCSEECKAMEWKK  301



>ref|XP_002533434.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus 
communis]
 gb|EEF28954.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus 
communis]
Length=253

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 67/110 (61%), Gaps = 2/110 (2%)
 Frame = -3

Query  2303  ASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLI  2124
             A+E KL GN+ F  G Y +AL  Y  AL++AP   +  E  L ++ + NR     K+G  
Sbjct  81    ANEAKLEGNKVFGEGKYEEALLKYEVALQVAPEIPSSVE--LRSICHSNRGVCFLKLGKY  138

Query  2123  VECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
              + +++C +AL + S+Y KA  RRG+A+  L +FE+AI D+K  L+++ S
Sbjct  139   EDTIKECTKALELNSSYIKALLRRGEAHEKLEHFEEAIADMKKILELDPS  188



>gb|KDR12448.1| SET and MYND domain-containing protein 4 [Zootermopsis nevadensis]
Length=784

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/251 (29%), Positives = 116/251 (46%), Gaps = 25/251 (10%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALH  2139
             K  S AS+ +  GN+ F   D   +L  YTQ++  AP +S +    L+     NR++AL 
Sbjct  89    KSASRASKFRREGNEKFKKCDNAGSLALYTQSVVNAPRDSEELSLALA-----NRSAALF  143

Query  2138  KMGLIVECLQDCDRALAI---FSTYAKAWFRRGKANASLGNFEDAIQDLKVSLK-MEV--  1977
              +G   ECLQD   AL      S + K   RRG+  A L   ++ I+ L+ + K +E+  
Sbjct  144   HLGAYKECLQDISLALQSDYPTSLHYKLHVRRGQCLAELNRPKEQIEALQSAQKCLELVK  203

Query  1976  ------SLSGKRQIEDELRIILDQHKL--KHSSLYKSNRNESDVTMLDEPDRANMQCVSL  1821
                     S KR IE  L     Q  +    ++   S   +  V    E +R     ++L
Sbjct  204   DMPLCKKASLKRDIETALAKASSQLSVDSTQNTFDGSEPFQIPVPTYGENERFAYASIAL  263

Query  1820  -----PTKGRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESC  1656
                    KGR +++  D+ +G ++  E PYA ++L    + +CH C     +  +PC  C
Sbjct  264   DLRYSEGKGRHVIANRDVKMGDILFVERPYAFVVLPAQYKAHCHNCCRTY-VSPIPCWEC  322

Query  1655  SIPLYCSSQCQ  1623
             ++ LYCS  C+
Sbjct  323   TMVLYCSEACR  333


 Score = 70.1 bits (170),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 68/284 (24%), Positives = 110/284 (39%), Gaps = 45/284 (16%)
 Frame = -3

Query  1094  QVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHK  915
             QV++  AIY   SM NHSC PN    F ++ L VR    +  G E+   YGP        
Sbjct  499   QVRIATAIYPSASMMNHSCDPNIINSFYNQYLIVRACKDIHEGEEVFNCYGPHFRHMSSP  558

Query  914   DRQQILRDRYSFSCQCRGCSQLNLSDLC--INAYRCAKPGCLGVVPDSTLASYVKQKLPH  741
             +R+ ILR +Y F C CR CS     D     +A  C +  C G +  S            
Sbjct  559   ERKDILRSQYFFYCNCRPCSLSGQEDFHERFSALLCLE--CSGPLLQS------------  604

Query  740   VSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQ  561
                          SD AH+             C +C   +   +      KA +      
Sbjct  605   -------------SDSAHHMT-----------CSDCGHRQSFSSLAGATFKAHALFNEGS  640

Query  560   DAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKA  381
              A+   D+  E +       ++ +  L+  +K ++   D VA+   ++G+   +++    
Sbjct  641   MALDMGDMK-EAVKKFEACWNLRQRCLYRSHKDLSACGDQVAKCYSMLGDYGRSVECLLR  699

Query  380   SIKILEKLYDPNHIVIGNELIKLGSIQL----QRGNRDAASTTK  261
              +  +E+ +  N I + NEL K+  + +    Q G   AA   K
Sbjct  700   CLPAVEEQFGCNSIEVANELQKISDVMMCDVSQHGQGSAAYLEK  743



>ref|XP_008557095.1| PREDICTED: dnaJ homolog subfamily C member 7-like [Microplitis 
demolitor]
Length=696

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/230 (28%), Positives = 112/230 (49%), Gaps = 12/230 (5%)
 Frame = -3

Query  2543  SEVLNLPVQKPSVLT-SEHMEKLKSLVPKALRQEISESTPDG--LPATCSSLLEFFHRLP  2373
             S+ ++  ++K   L   E  ++ K+L+   L+   + S PD   +   C   L+    + 
Sbjct  391   SQCVSYKIKKAECLALMEKFKEAKTLINDVLK--YNRSNPDAVYILGLCLYHLDTDRAVA  448

Query  2372  QFHQVVKELTDPEMAL-CGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSN  2196
             Q  +V++   D   AL   K      + K  GN  F    Y KA H YT+AL + P+N  
Sbjct  449   QLKEVLRLAPDHSDALKLYKKAKVLIDKKNEGNNAFVHKKYIKAHHIYTEALGIDPSN--  506

Query  2195  DTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFED  2016
                + +    Y N A A +K+  I  C+++C +AL I   YAKA  RRG+ +    ++E+
Sbjct  507   ---RGMMKKFYYNLAQASYKLQKITRCIEECTKALNIDPNYAKALLRRGQCHLDNKDYEE  563

Query  2015  AIQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLKHSSL-YKSNRNESDV  1869
             A+ DL  SL ++ +   +R +E   ++++      H  L  KSN +++D+
Sbjct  564   AVADLSKSLDIDSNSECQRLLETARKLLVKAKSDYHGILGIKSNASQADI  613



>ref|XP_003691021.1| PREDICTED: SET and MYND domain-containing protein 4-like [Apis 
florea]
Length=678

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 77/288 (27%), Positives = 137/288 (48%), Gaps = 38/288 (13%)
 Frame = -3

Query  2405  SSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQ  2226
             S  +EF  R PQ + +  ++ + E  +  K+   A ++K  GN+ F  G++ KAL  Y+ 
Sbjct  40    SERIEFMLRYPQVYDLSIKIGEVEDQML-KNGEKALKLKDVGNKYFGRGEFIKALEIYSN  98

Query  2225  ALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAW  2061
             A+ LAP      +K++  +L  NR++ L+ +      L D + AL   + Y      K  
Sbjct  99    AVLLAP------QKDVGVLL-ANRSATLYHLEKHSYALTDAEEALR--AGYPRELRYKIE  149

Query  2060  FRRGKANASLGNFEDAIQDLKVSLKM--EVSLSG--KRQIEDELRIILDQHKLKHSSLYK  1893
              RR +   +L   ++A+   + +LK   +  LSG  K+++E ++RI+L   +  +    K
Sbjct  150   ERRARCLLALKRHDEAVLAFRSALKALDDGKLSGEKKQKLEADIRIMLAVIEKGNQLARK  209

Query  1892  SNR--NESDVTMLDEPDRANMQCVSL--------------PTKGRGMVSRADIPIGSLVH  1761
               +   + ++  L++P      C  L                 GR  ++  DI  G ++ 
Sbjct  210   GPKIPEKRNIGELEKPTLKIEDCNPLYPSCSKAVEIRDEGGNIGRHAIATKDIEPGEILA  269

Query  1760  KEDPYAAIILKNCRETNCHFCFNEL--PMHAVPCESCSIPLYCSSQCQ  1623
              E PY+A +L   R  NC +CF ++  P+ AV C++CS   YCS  C+
Sbjct  270   IEKPYSAFLLAEYRLINCFYCFTKIFVPVPAV-CQTCSCVAYCSISCR  316


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 54/109 (50%), Gaps = 5/109 (5%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y   S+FNHSC P    YF+  T+ VR   S+S+G E+  +YG        K+R+
Sbjct  481   IGGGLYPTISLFNHSCNPGIIRYFIGTTMVVRAIRSISSGEEISENYGQIFTTTPEKERK  540

Query  905   QILRDRYSFSCQCRGCSQ----LNLSDLCINAYRC-AKPGCLGVVPDST  774
             + LR +Y F C C  C +    L   D  I  ++C     C  V+P  T
Sbjct  541   RKLRLQYFFDCNCEACREHWPLLEEIDPTILRFKCETGKECGNVLPVKT  589



>ref|XP_006564919.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X5 [Apis mellifera]
Length=499

 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 126/260 (48%), Gaps = 22/260 (8%)
 Frame = -3

Query  2339  PEMALCGKDHSAASEVKLRGNQCFSGG---DYP--KALHFYTQALRLAPTNSNDTEKNLS  2175
             P++    KD   + +++ +GN+ F      +Y   +AL  YT+++  AP  S        
Sbjct  49    PQVCDNKKDAKESEKLREQGNKIFISTPLKNYTCVEALKLYTKSIAYAPYPSEQL-----  103

Query  2174  AMLYVNRASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLG--NFEDAI  2010
             A+ Y NR++ L K+     C+QD DR LA+    +  AK + R+ +   +L   N ED I
Sbjct  104   ALAYANRSAVLIKLHKYKLCIQDIDRTLALAYPNNLRAKLYVRKVECLNALKNPNVEDTI  163

Query  2009  QDLKVSLKMEVSLSGKRQIEDELRII---LDQHKLKHSSLYKSNRNESDVTM-LDEPDRA  1842
             ++ +  L+ +VSL  ++++ ++L+ I   L   K K     K        T  ++ P  +
Sbjct  164   KEAQYWLE-KVSLDNRKKLNEKLKSIKNMLPSQKFKKEKFMKQAPLPKIKTHNIEVPCAS  222

Query  1841  NMQCVSLPTK-GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPC  1665
             +   +    K GR +V+   I  G ++  E PY+ I+  +   T+C  C  E+    +PC
Sbjct  223   DAITIKYNDKYGRHIVATRKINPGEVIAIEKPYSLILTPDNIYTHCSNCL-EVSWANIPC  281

Query  1664  ESCSIPLYCSSQCQLVSGGK  1605
             E C+  +YCS +C+ +   K
Sbjct  282   EYCTYAMYCSEECKAMEWKK  301



>ref|XP_004535929.1| PREDICTED: RNA polymerase II-associated protein 3-like isoform 
X2 [Ceratitis capitata]
Length=497

 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 91/187 (49%), Gaps = 29/187 (16%)
 Frame = -3

Query  2531  NLPVQKPSVLTSEHMEKLKSLVPKALRQEIS---ESTPDGLPATCSSLLEFFHRLPQFHQ  2361
             N+P+ +  +L  E + K  S + +  +Q ++   E++P    AT  +             
Sbjct  54    NVPI-RSHILAEEQLTKAGSNIQREQQQSVAKENENSPTSSSATTPT-------------  99

Query  2360  VVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKN  2181
                E T+  +    +    A+EVK RGN+C   G+Y KA++ YT A+ + P +       
Sbjct  100   ---EKTEEPLNANEEKRKRANEVKDRGNKCVKLGEYEKAIYEYTTAIDIFPED-------  149

Query  2180  LSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDL  2001
                + + NRA    KM    EC++DC+ A+ I +   KA++RR +AN  LGN  DA++D 
Sbjct  150   --PVFFSNRALCYLKMERYNECIEDCEHAIEIDNLAVKAYYRRMQANECLGNDMDALKDC  207

Query  2000  KVSLKME  1980
                L +E
Sbjct  208   TTVLMIE  214



>ref|XP_007177539.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Balaenoptera acutorostrata scammoni]
Length=786

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/324 (23%), Positives = 124/324 (38%), Gaps = 76/324 (23%)
 Frame = -3

Query  1118  NALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGP  939
             N +T S  QV++   ++ V S+ NHSC PN    F+S    VR +  +  G E+   YGP
Sbjct  516   NLITDS-RQVRLATGLFPVVSLLNHSCSPNTSVSFISTVATVRASQQIRKGQEILHCYGP  574

Query  938   QVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYV  759
                +    +R Q LR +Y F C C  C +                               
Sbjct  575   HESRMGVAERCQKLRSQYFFDCNCPPCER-------------------------------  603

Query  758   KQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAES  579
             +++ P    + E            +  H+    L+ G  L+C        +C      + 
Sbjct  604   EKQRPSQGPRWEA-----------FCCHRCGALLQGGDVLSCG-----STSCTESVSRDH  647

Query  578   SIGRLQDAIASNDVPVEVLSNA---------LKASDILRSTLHPFNKRIAEVEDNVAQAM  426
              + +LQD      +  ++L N          L       S L   +  + E+ED++AQA 
Sbjct  648   LVSQLQDLQQQVGMARKLLRNGELERAIQLLLGCQHDAESFLLAEHSVVGEIEDDLAQAY  707

Query  425   CLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEI  246
               +G+ + +  H + S++++E  + P+ + +G+EL KL                   A+I
Sbjct  708   AALGDWEKSATHLQKSLRVVEVRHGPSSVEMGHELFKL-------------------AQI  748

Query  245   FSRYFGSHALVIFPYLQRLQQEAG  174
             F   F    L+I  Y+Q    E G
Sbjct  749   FFNGFVCQQLLIICYVQSPGPEMG  772


 Score = 72.4 bits (176),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 85/319 (27%), Positives = 143/319 (45%), Gaps = 49/319 (15%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+++  IS + T   L    SSLL+     P+    +K L+     L GKD +A  
Sbjct  17    SLLPKSIQVTISTAETLSDLFLHSSSLLQ-----PEDEMFLKRLS--RGYLVGKDPNAPL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   DY  A   Y++ +  +  NS D      ++ Y NR++AL  +G    
Sbjct  70    FYREEGNKKFQKKDYMGATVLYSKGVSHSRPNSEDI-----SLCYANRSAALFHLGQYET  124

Query  2117  CLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDA---IQDLKVSLKMEVSLSGKR-  1959
             CL+D  RA           K   R+ +   +LG  ++A   I DL+ +   + +L+  + 
Sbjct  125   CLKDIVRAQTHGYPEGLQPKLLLRKAECLVTLGRPQEASQTISDLESNFAAKPTLAASQF  184

Query  1958  QIEDE----LRI-ILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSL-----PTKG  1809
             QI       L++ + ++  L  +S     +   D+ + +E ++ +    S+     P KG
Sbjct  185   QILQRTLCRLKVKVQEKGNLTETSPAALTKAFEDMDLREENEQISNTSSSVSLCTDPLKG  244

Query  1808  RGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFNELP  1683
             R +V+  DI  G L+ KED + +++                + R TN    CH C     
Sbjct  245   RYLVATKDILPGELLVKEDAFVSVLNPGEMPPWHHGLESKWDTRATNADLYCHRCLKHT-  303

Query  1682  MHAVPCESCSIPLYCSSQC  1626
             +  VPC+ CS   YCS +C
Sbjct  304   LAPVPCDGCSYAKYCSQEC  322



>ref|XP_004294618.1| PREDICTED: tetratricopeptide repeat protein 1-like [Fragaria 
vesca subsp. vesca]
Length=251

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 67/110 (61%), Gaps = 2/110 (2%)
 Frame = -3

Query  2303  ASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLI  2124
             A+EVKL+GN  F  G Y +AL  Y  AL+LAP   +  E  L ++ + NRA    K+G  
Sbjct  79    ANEVKLQGNGLFGNGQYEEALSQYELALQLAPDMPSSVE--LRSICHSNRAICFSKLGKY  136

Query  2123  VECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
              + +++C +A+ +  +Y KA  RR +A+  L +FE+AI D+K  L+++ S
Sbjct  137   EDAVKECTKAVELNPSYLKALIRRAEAHEKLEHFEEAITDMKKILELDPS  186



>ref|XP_006741459.1| PREDICTED: SET and MYND domain-containing protein 4 [Leptonychotes 
weddellii]
Length=792

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/281 (24%), Positives = 116/281 (41%), Gaps = 57/281 (20%)
 Frame = -3

Query  1118  NALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGP  939
             N++T+S  QV++   I+ V S+ NHSC PN    F+S    +R ++ +  G E+   YGP
Sbjct  506   NSVTNS-RQVRLATGIFPVVSLLNHSCSPNTSVSFISTVATIRASEKIGKGQEILHCYGP  564

Query  938   QVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYV  759
                +    +R+Q LR +Y F C C  C                                 
Sbjct  565   HRSRMAVAERRQKLRSQYFFDCSCLAC---------------------------------  591

Query  758   KQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAES  579
              QK  H +    + E         +   +    L+ G  L+C        +C      + 
Sbjct  592   -QKEKHRAAVRPRWEA--------FCCDRCRAPLQGGDVLSCG-----STSCTESVSRDH  637

Query  578   SIGRLQDAIASNDVPVEVLSNAL--KASDIL-------RSTLHPFNKRIAEVEDNVAQAM  426
              I RLQD         ++L++    +A  +L        S L   +  + E+ED +AQA 
Sbjct  638   LISRLQDLQQQVGQARKLLTSGQLEQAIQLLLGCRHDAESFLSAEHSMVGEMEDALAQAY  697

Query  425   CLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI  303
               +G+ Q +  H + S++++E  + P+ + +G+EL KL  +
Sbjct  698   AALGDWQKSATHLQKSLRVVEVQHGPSSVEMGHELFKLAQL  738


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 83/319 (26%), Positives = 140/319 (44%), Gaps = 49/319 (15%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+++  IS + T   +    SSLL+     P+    +K L+     L GK+ +A  
Sbjct  17    SLLPKSIQDTISTADTLRDIFLHSSSLLQ-----PEDEMFLKSLS--RGYLVGKEPNAPP  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   DY  A   Y++ +  A  +S D      ++ Y NR++AL  +     
Sbjct  70    FYREEGNKKFQKKDYMGATVLYSKGISHARPHSADI-----SLCYANRSAALFYLDEYEM  124

Query  2117  CLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDA---IQDLKVSLKMEVSLSG---  1965
             CL+D  RA       S   K   R+ +   +LG  ++A   I+DL+ +   + SL+    
Sbjct  125   CLKDITRAQMHGYPESLQPKVTLRKVECLVTLGRLQEAGQTIRDLESNFAAKPSLAAAQF  184

Query  1964  ---KRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDR--ANMQCVSL---PTKG  1809
                +R +      + ++  L  S      +   D+ + +E ++       VSL   P KG
Sbjct  185   QILQRNLCRLKMKVQERENLTASFPTTLTKAFEDMDLREENEQIPGASSSVSLCMDPLKG  244

Query  1808  RGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFNELP  1683
             R +++  DI  G L+ KED + +++                + R TN    CH C     
Sbjct  245   RYLIATKDILPGELLVKEDAFVSVLNPGERPPLHHGLESKWDTRVTNGDLYCHRCLRHT-  303

Query  1682  MHAVPCESCSIPLYCSSQC  1626
             +  VPC+ CS   YCS +C
Sbjct  304   LATVPCDGCSYAKYCSHEC  322



>ref|XP_309411.4| AGAP011232-PA [Anopheles gambiae str. PEST]
 gb|EAA05175.4| AGAP011232-PA [Anopheles gambiae str. PEST]
Length=434

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 107/234 (46%), Gaps = 30/234 (13%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGD--YPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASA  2145
             KD + A+ ++ +GN+ F   +  Y  A  +Y +++  +P  S      + A+ Y NRA+ 
Sbjct  17    KDEARAAVLRTKGNELFHKRERKYIAATVYYNESIAHSPKGSE-----VRAIGYGNRAAV  71

Query  2144  LHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSG  1965
               ++G   +CL +    LA  S Y  A    GK    L   E A Q       M+ S   
Sbjct  72    CLQLGRYEDCLANVR--LARESNYPAALM--GK----LTMREVAAQS------MQASAEA  117

Query  1964  KRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDR-ANMQCVSLPTKGRGMVSRA  1788
              R+  D+  +  DQH  +    Y ++           P R A++Q  +    GR +V+  
Sbjct  118   ARRFADDPMVPEDQHAQELKLSYPAHPTV--------PQRVADLQLCNNQQYGRHVVATR  169

Query  1787  DIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQC  1626
              + +G +V  E PYA ++  + +   C FC  E P   +PCE C+I +YCS +C
Sbjct  170   QLRVGDVVMVEKPYATVLSDHMKRVRCAFCHAEEPFLLIPCEECTIAMYCSQKC  223



>ref|XP_007177538.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Balaenoptera acutorostrata scammoni]
Length=802

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/330 (22%), Positives = 131/330 (40%), Gaps = 68/330 (21%)
 Frame = -3

Query  1118  NALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGP  939
             N +T S  QV++   ++ V S+ NHSC PN    F+S    VR +  +  G E+   YGP
Sbjct  516   NLITDS-RQVRLATGLFPVVSLLNHSCSPNTSVSFISTVATVRASQQIRKGQEILHCYGP  574

Query  938   QVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYV  759
                +    +R Q LR +Y F C C  C +                               
Sbjct  575   HESRMGVAERCQKLRSQYFFDCNCPPCER-------------------------------  603

Query  758   KQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAES  579
             +++ P    + E            +  H+    L+ G  L+C        +C      + 
Sbjct  604   EKQRPSQGPRWEA-----------FCCHRCGALLQGGDVLSCG-----STSCTESVSRDH  647

Query  578   SIGRLQDAIASNDVPVEVLSNA---------LKASDILRSTLHPFNKRIAEVEDNVAQAM  426
              + +LQD      +  ++L N          L       S L   +  + E+ED++AQA 
Sbjct  648   LVSQLQDLQQQVGMARKLLRNGELERAIQLLLGCQHDAESFLLAEHSVVGEIEDDLAQAY  707

Query  425   CLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQR-GNRDAASTTKSTAE  249
               +G+ + +  H + S++++E  + P+ + +G+EL KL  I        +A +T +   +
Sbjct  708   AALGDWEKSATHLQKSLRVVEVRHGPSSVEMGHELFKLAQIFFNGFAIPEALNTIQQAEK  767

Query  248   IFSRYFGSHALVIFPY---LQRLQQEAGCL  168
             +   ++G       P+   +Q LQ+   CL
Sbjct  768   VLLVHYG-------PWNDEIQELQKMKSCL  790


 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 85/319 (27%), Positives = 143/319 (45%), Gaps = 49/319 (15%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+++  IS + T   L    SSLL+     P+    +K L+     L GKD +A  
Sbjct  17    SLLPKSIQVTISTAETLSDLFLHSSSLLQ-----PEDEMFLKRLS--RGYLVGKDPNAPL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               +  GN+ F   DY  A   Y++ +  +  NS D      ++ Y NR++AL  +G    
Sbjct  70    FYREEGNKKFQKKDYMGATVLYSKGVSHSRPNSEDI-----SLCYANRSAALFHLGQYET  124

Query  2117  CLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDA---IQDLKVSLKMEVSLSGKR-  1959
             CL+D  RA           K   R+ +   +LG  ++A   I DL+ +   + +L+  + 
Sbjct  125   CLKDIVRAQTHGYPEGLQPKLLLRKAECLVTLGRPQEASQTISDLESNFAAKPTLAASQF  184

Query  1958  QIEDE----LRI-ILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSL-----PTKG  1809
             QI       L++ + ++  L  +S     +   D+ + +E ++ +    S+     P KG
Sbjct  185   QILQRTLCRLKVKVQEKGNLTETSPAALTKAFEDMDLREENEQISNTSSSVSLCTDPLKG  244

Query  1808  RGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFNELP  1683
             R +V+  DI  G L+ KED + +++                + R TN    CH C     
Sbjct  245   RYLVATKDILPGELLVKEDAFVSVLNPGEMPPWHHGLESKWDTRATNADLYCHRCLKHT-  303

Query  1682  MHAVPCESCSIPLYCSSQC  1626
             +  VPC+ CS   YCS +C
Sbjct  304   LAPVPCDGCSYAKYCSQEC  322



>gb|KDO28341.1| hypothetical protein SPRG_06580 [Saprolegnia parasitica CBS 223.65]
Length=1288

 Score = 78.6 bits (192),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/239 (28%), Positives = 107/239 (45%), Gaps = 29/239 (12%)
 Frame = -3

Query  2294  VKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVEC  2115
             +K RGN  F    Y +A+  +++ LRL   +   T + L ++L+ NR +A H +G +   
Sbjct  575   LKDRGNAAFKAKHYKEAIAAFSEGLRLLTIDDEPTAQ-LQSILFTNRCAAWHALGALEHA  633

Query  2114  LQDCDRALAIFSTYAKAWFRRGKA-NASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDELR  1938
               D  RA+  +  Y KAWFRR K   A +         L  SL+ +       Q  D+L 
Sbjct  634   FADATRAITSYPPYPKAWFRRAKVLEACIATDSALAATLCASLRPDTEPLAMAQ--DDLG  691

Query  1937  IILDQHKLKHSSLYKSNRN----ESDVTM----LDEPDRA------NMQCVSLPTKGRGM  1800
             +          +L ++ R+    ++ V +    +DE   A      +++  +    GR +
Sbjct  692   MA--------KTLVETPRDVDPFQAAVVLPPRHMDEAIYAHPNYHKHVRVATSAHAGRYL  743

Query  1799  VSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQ  1623
                  IP GS+V  EDP A+  L +     C  CF       VPC++C+  +YCS  CQ
Sbjct  744   EVTHAIPAGSVVLVEDPVASAGLDHV--GRCELCFAACE-SLVPCDACTCAVYCSDACQ  799


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -3

Query  1094  QVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHK  915
             Q ++G  ++   +M NHSC PNA  +F  RTL + TT +V+ G E+ +SYGP   +    
Sbjct  1052  QARLGTGLFPAMAMCNHSCAPNASVHFTGRTLRLVTTRAVAQGDEIAISYGPHRAKMPTT  1111

Query  914   DRQQILRDRYSFSCQCRGC  858
              RQ+IL ++Y F+C C  C
Sbjct  1112  QRQRILNEQYGFACHCAAC  1130



>ref|XP_001122116.2| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Apis mellifera]
Length=629

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 126/260 (48%), Gaps = 22/260 (8%)
 Frame = -3

Query  2339  PEMALCGKDHSAASEVKLRGNQCFSGG---DYP--KALHFYTQALRLAPTNSNDTEKNLS  2175
             P++    KD   + +++ +GN+ F      +Y   +AL  YT+++  AP  S        
Sbjct  49    PQVCDNKKDAKESEKLREQGNKIFISTPLKNYTCVEALKLYTKSIAYAPYPSEQL-----  103

Query  2174  AMLYVNRASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLG--NFEDAI  2010
             A+ Y NR++ L K+     C+QD DR LA+    +  AK + R+ +   +L   N ED I
Sbjct  104   ALAYANRSAVLIKLHKYKLCIQDIDRTLALAYPNNLRAKLYVRKVECLNALKNPNVEDTI  163

Query  2009  QDLKVSLKMEVSLSGKRQIEDELRII---LDQHKLKHSSLYKSNRNESDVTM-LDEPDRA  1842
             ++ +  L+ +VSL  ++++ ++L+ I   L   K K     K        T  ++ P  +
Sbjct  164   KEAQYWLE-KVSLDNRKKLNEKLKSIKNMLPSQKFKKEKFMKQAPLPKIKTHNIEVPCAS  222

Query  1841  NMQCVSLPTK-GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPC  1665
             +   +    K GR +V+   I  G ++  E PY+ I+  +   T+C  C  E+    +PC
Sbjct  223   DAITIKYNDKYGRHIVATRKINPGEVIAIEKPYSLILTPDNIYTHCSNCL-EVSWANIPC  281

Query  1664  ESCSIPLYCSSQCQLVSGGK  1605
             E C+  +YCS +C+ +   K
Sbjct  282   EYCTYAMYCSEECKAMEWKK  301



>ref|XP_006564917.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X3 [Apis mellifera]
Length=581

 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 126/260 (48%), Gaps = 22/260 (8%)
 Frame = -3

Query  2339  PEMALCGKDHSAASEVKLRGNQCFSGG---DYP--KALHFYTQALRLAPTNSNDTEKNLS  2175
             P++    KD   + +++ +GN+ F      +Y   +AL  YT+++  AP  S        
Sbjct  49    PQVCDNKKDAKESEKLREQGNKIFISTPLKNYTCVEALKLYTKSIAYAPYPSEQL-----  103

Query  2174  AMLYVNRASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLG--NFEDAI  2010
             A+ Y NR++ L K+     C+QD DR LA+    +  AK + R+ +   +L   N ED I
Sbjct  104   ALAYANRSAVLIKLHKYKLCIQDIDRTLALAYPNNLRAKLYVRKVECLNALKNPNVEDTI  163

Query  2009  QDLKVSLKMEVSLSGKRQIEDELRII---LDQHKLKHSSLYKSNRNESDVTM-LDEPDRA  1842
             ++ +  L+ +VSL  ++++ ++L+ I   L   K K     K        T  ++ P  +
Sbjct  164   KEAQYWLE-KVSLDNRKKLNEKLKSIKNMLPSQKFKKEKFMKQAPLPKIKTHNIEVPCAS  222

Query  1841  NMQCVSLPTK-GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPC  1665
             +   +    K GR +V+   I  G ++  E PY+ I+  +   T+C  C  E+    +PC
Sbjct  223   DAITIKYNDKYGRHIVATRKINPGEVIAIEKPYSLILTPDNIYTHCSNCL-EVSWANIPC  281

Query  1664  ESCSIPLYCSSQCQLVSGGK  1605
             E C+  +YCS +C+ +   K
Sbjct  282   EYCTYAMYCSEECKAMEWKK  301



>ref|XP_002428677.1| set and mynd domain-containing protein, putative [Pediculus humanus 
corporis]
 gb|EEB15939.1| set and mynd domain-containing protein, putative [Pediculus humanus 
corporis]
Length=697

 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 127/587 (22%), Positives = 227/587 (39%), Gaps = 109/587 (19%)
 Frame = -3

Query  2375  PQFHQVVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSN  2196
             P+ +  +K +T      C ++   + E K++ +  F  GDY K++  Y+Q +  AP    
Sbjct  66    PKLNNFLKNITKIYRKKCLEN---SKENKIQADFLFKNGDYKKSIMLYSQCIIRAPC---  119

Query  2195  DTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALA-IF--STYAKAWFRRGKANASLGN  2025
               ++ L  + Y  RA+AL+K+    ECL D + AL   F  S   K +   GK   +LG+
Sbjct  120   -CDEYLLPLAYKGRANALYKLEKYKECLNDLNMALKEKFPDSLKYKIYKDMGKCYYNLGD  178

Query  2024  FEDAIQDLKVSLKM---------EVSLSGKRQIEDELRIIL----DQHKLKHSSLYKSNR  1884
                A   L++S K+          ++ S K +IE  +  +     D   +K   +   N 
Sbjct  179   LNKAKISLQISDKLLNEQLLNLKNLNQSDKEEIEKIIDNLTSSNNDDETMKKQQVENLNF  238

Query  1883  N-----ESDVTMLDEPDR-----ANMQCVSLPTK-GRGMVSRADIPIGSLVHKEDPYAAI  1737
             N     E    +  EP+      +N+  +   T  GR   +   I IG  +  E+P  ++
Sbjct  239   NVPYEGEPLPKVSGEPNEMYPNASNLLKIRQGTDCGRFAAAANKIEIGDTIVVEEPQTSV  298

Query  1736  ILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQCQLVSGGKEFGKTPRKVSRHNELP  1557
             +L                M++  C  C   L+    C+  SG                  
Sbjct  299   LLP--------------KMNSSHCHHCFTRLFAPIPCKTCSG------------------  326

Query  1556  DELEKYISECVSIGVSGPRTEDIAEHRHECQ--------GVHWPAVLPSEVVL-AGRVLV  1404
                   ++ C    V    +     HR+ECQ        G+   + L   +V   G +  
Sbjct  327   ------VAFC---SVQCRDSASNTYHRYECQLLGFFMGSGMSLISYLSLRMVTQEGLIFF  377

Query  1403  KFIEQQ--------KDSSGFS----NLLTVLDLCHNFVQLPPDTKLEMHIYSIILLNCLQ  1260
             K +  +        +DS   +    N L V +L  N             + +I L+ CL+
Sbjct  378   KQLHSKLKQMGKCPEDSCDLTKREKNYLNVYNLTTNCKLRTSKDFFTRTVMAIFLVKCLK  437

Query  1259  --NSYAPKLPVTGviisqlvillsqIRVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVK  1086
               N +      T    ++  IL + I ++ + +++  + +   +  E +   T   + V 
Sbjct  438   LTNYFESPENKTTDDFNEDEILTASIILHHLELLQFNAHEIYETRVEELYK-TEDSKTVF  496

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +   +Y   ++FNH C P+   YF  + + ++    ++    L  +YGP  G+    +R 
Sbjct  497   IAIGVYPTVALFNHECSPSVTRYFSGKNIIIKAVRPLATNDILSDNYGPHYGKKTLLERT  556

Query  905   QILRDRYSFSCQCRGCSQ-------LNLSDLCINAYRCAKPGCLGVV  786
             + L  RY F C+C+ C +       +N  D  I   RC   GC  V 
Sbjct  557   RELTSRYWFRCRCQACIENWPLIQDINAEDFKI---RCTSLGCQNVF  600



>gb|EFX61914.1| hypothetical protein DAPPUDRAFT_68494 [Daphnia pulex]
Length=680

 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 76/284 (27%), Positives = 130/284 (46%), Gaps = 35/284 (12%)
 Frame = -3

Query  2396  LEFFHRLPQFHQVVKELTDP--EMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQA  2223
             L + H LP  H+V  E++         GK  + A + +  GN+ F   DYP A+  Y++A
Sbjct  43    LVYVHSLPYVHEVPHEMSSAMGNSLPSGKSATVAQKKRTEGNEFFKKKDYPSAVRLYSEA  102

Query  2222  LRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAWF  2058
             +  APTN  + E  L AM + NR++AL  +      L D D+AL+  S Y      K   
Sbjct  103   VSKAPTNITN-EPQL-AMAFANRSAALFHLAEYARALVDIDQALS--SGYPTELRYKLAE  158

Query  2057  RRGKANASLGNFEDAIQDLKVSLKMEVSLS----GKRQI-EDELRIILDQHKLKHSSLYK  1893
             R+ K   +LG   D +     S   +V+ S     KR +   ++++++++ K  +  +  
Sbjct  159   RQAKCLMALGKPVDQVTAACKSAMKDVNDSRLDPAKRDLFVRDIKLLMEESKSPNKKV--  216

Query  1892  SNRNESDVTMLDEPDRANMQCV-SLPT------------KGRGMVSRADIPIGSLVHKED  1752
                 E+    L  P R  +  + S P+             GR  V+ + I +G ++  + 
Sbjct  217   ---PETGSPSLILPKRGTVYPINSHPSFSKKILVEEDAVSGRYGVAASPIRVGDVIAVDA  273

Query  1751  PYAAIILKNCRETNCHFCFNELPMHAV-PCESCSIPLYCSSQCQ  1623
             PYA+++      T+CH C+  L +  V PC  C +  +CS  C+
Sbjct  274   PYASVMNPEKFSTHCHHCYQILELGEVLPCSHCDLVSFCSVNCR  317


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 55/118 (47%), Gaps = 12/118 (10%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y   ++ NHSC P    +F+   + VR   S   G  +  +YGP   Q    DRQ
Sbjct  476   LGAGVYSTVALLNHSCEPGVIRHFIGDVMVVRAIKSFQPGEMVNENYGPIFTQKRRVDRQ  535

Query  905   QILRDRYSFSCQCRGCS-------QLNLSDLCINAYRCAKPGCLG--VVPDSTLASYV  759
             + L+DRY F C+C  C+       ++    LC   +RCA   C    VV   T+  ++
Sbjct  536   RSLKDRYWFDCRCNPCTENWPLIGEMTEEALC---FRCADRRCRKPLVVQSDTMTPFI  590



>emb|CDY51514.1| BnaC04g02370D [Brassica napus]
Length=669

 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 87/167 (52%), Gaps = 16/167 (10%)
 Frame = -3

Query  2345  TDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAML  2166
             T+PE+     +     + + RGN+ FS G Y +A   Y   L+L  +NS         +L
Sbjct  422   TNPELVSVLNNVKMVVKARTRGNELFSSGRYSEASVAYGDGLKLDGSNS---------VL  472

Query  2165  YVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLK  1986
             Y NRA+  +K+GL  + ++DCD+AL I  +Y KA  RR  +   LG +EDA++D +    
Sbjct  473   YCNRAACWYKLGLWEKSVEDCDQALKIHPSYIKALLRRAASYGKLGQWEDAVRDYEF---  529

Query  1985  MEVSLSGKRQIEDEL---RIILDQHKLKHSSLYKSNRNESDVTMLDE  1854
             +   L G  ++ + L   +I +     +  SL  +N+ E+ V+ LD+
Sbjct  530   VRRELPGDGEVAESLERAKIAVMNRSQESKSLGYNNQVEA-VSTLDK  575



>ref|XP_003694793.1| PREDICTED: SET and MYND domain-containing protein 4-like [Apis 
florea]
Length=629

 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 126/260 (48%), Gaps = 22/260 (8%)
 Frame = -3

Query  2339  PEMALCGKDHSAASEVKLRGNQCFSGG---DYP--KALHFYTQALRLAPTNSNDTEKNLS  2175
             P++    KD   + +++ +GN+ F      +Y   +AL  YT+++  AP  S        
Sbjct  49    PQICDNKKDAKESEKLREQGNKIFVSTPLKNYTCVEALKLYTKSIACAPYPSEQL-----  103

Query  2174  AMLYVNRASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLG--NFEDAI  2010
             A+ Y NR++ L K+     C+QD DR LA+    +  AK + R+ +   +L   N ED I
Sbjct  104   ALAYANRSAVLLKLHKYELCIQDIDRTLALAYPNNLRAKLYVRKVECLNALKHPNIEDTI  163

Query  2009  QDLKVSLKMEVSLSGKRQIEDELRII---LDQHKLKHSSLYKSNRNESDVTM-LDEPDRA  1842
             ++ +  L+ ++SL  ++++ ++L+ I   L   K K     K        T  ++ P  +
Sbjct  164   KEAQYWLE-KMSLDDRKKLNEKLKSIKNVLPSQKFKKEKFMKQAPLPKIKTHNIEVPCAS  222

Query  1841  NMQCVSLPTK-GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAVPC  1665
             +   +    K GR +V+   I  G +V  E PY+ I+  +   T+C  C  E+    +PC
Sbjct  223   DAITIKYNDKYGRHIVATRKISPGEVVAIEKPYSLILTPDNIHTHCSNCL-EVSWANIPC  281

Query  1664  ESCSIPLYCSSQCQLVSGGK  1605
             E C+  +YCS +C+ +   K
Sbjct  282   EYCTYAMYCSEECKAMEWKK  301



>ref|XP_008007962.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X5 
[Chlorocebus sabaeus]
Length=755

 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 128/303 (42%), Gaps = 56/303 (18%)
 Frame = -3

Query  1184  VNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSR  1005
              ++ A+  ++   +KGS+      +T S  QV++   I+ V S+ NHSC PN    F+S 
Sbjct  496   TDAQAMTTIQHTGSKGSI------VTDS-RQVRLATGIFPVISLLNHSCSPNTSVSFIST  548

Query  1004  TLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCIN  825
                +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C           
Sbjct  549   VATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPACQ--------TE  600

Query  824   AYRCA-----KPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYH  660
             A+R A     K  C         AS +++                            D  
Sbjct  601   AHRMAAGPRWKAFCCNSCRAPMQASLLRE---------------------------GDGM  633

Query  659   LKPGH--CLNCNLYRDLEAACATISKAESSIGRLQDAIASNDV--PVEVLSNALKASDIL  492
             L+ G+  C    + RD     + +   +  +G  Q  +   ++   V++LS   + ++  
Sbjct  634   LRCGNRSCAESVVSRD--HLVSRLQDLQQQVGVAQKLLRDGELERAVQLLSGCQRDAE--  689

Query  491   RSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKL  312
              S L   +  + E+ D +A+A   +G+ Q +  H + S++++E  + P+ + +G+EL KL
Sbjct  690   -SFLWAEHAMVGEIADGLARACAALGDWQKSATHLQKSLRVVEVRHGPSSVEMGHELFKL  748

Query  311   GSI  303
               +
Sbjct  749   AQV  751


 Score = 70.9 bits (172),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 90/344 (26%), Positives = 149/344 (43%), Gaps = 63/344 (18%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQV  2358
             ++LPV +     S  ++K  SL PK+++  IS + T   +    SSLL+     P+    
Sbjct  1     MDLPVDE---WKSYLLQKWASL-PKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELF  51

Query  2357  VKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNL  2178
             +K L+  +  L GKD  A    + +GN+ F   DY  A   Y++ +  +  N+ D     
Sbjct  52    LKRLS--KGYLVGKDSDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM----  105

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDA  2013
              ++ Y NR++AL  +G    CL+D  RA      Y      K   R+ +   +LG  ++A
Sbjct  106   -SLCYANRSAALFHLGQYETCLKDISRAQ--MHGYPERLQPKIMLRKAECLVALGRLQEA  162

Query  2012  IQDLKVSLKMEVSLSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DV  1869
              Q +     +E + +    + D     L +  H LK     K +  E+          DV
Sbjct  163   SQTVG---DLERNFTATPTLADVPPQTLQRNLHHLKMKLQEKESPTETLPATLAKTLEDV  219

Query  1868  TMLDEPDRANMQCVSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII----------  1734
              +  E +R +    S+     P KGR +V+  +I  G L+ +ED + +I+          
Sbjct  220   ALRGENERLSNASSSVGLCIDPLKGRYLVATKEILPGELLVREDAFVSILNPGELPPLHH  279

Query  1733  ----LKNCRETN----CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                  ++ R TN    CH C     +  VPC+ CS   YCS +C
Sbjct  280   GLDSQRDTRVTNGDLYCHRCLKH-TLATVPCDGCSYAKYCSQEC  322



>ref|XP_003622987.1| Tetratricopeptide repeat protein [Medicago truncatula]
Length=271

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 66/112 (59%), Gaps = 2/112 (2%)
 Frame = -3

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             S A+E K+ GN+ F  G Y +AL  Y  AL++AP   +  E  + ++ + NRA    K+G
Sbjct  93    SEANEAKVEGNKLFVDGKYEEALSQYEHALQVAPDMPSSVE--IRSICHANRAVCFMKLG  150

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
                  +++C +AL +   Y KA  RRG+A+  L +FE+AI D+K  L+++ S
Sbjct  151   KYENTIKECTKALELNPAYVKALVRRGEAHEKLEHFEEAIADMKKILEIDPS  202



>ref|XP_008007958.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Chlorocebus sabaeus]
Length=790

 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 126/303 (42%), Gaps = 56/303 (18%)
 Frame = -3

Query  1184  VNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSR  1005
              ++ A+  ++   +KGS+        +   QV++   I+ V S+ NHSC PN    F+S 
Sbjct  531   TDAQAMTTIQHTGSKGSI-------VTDSRQVRLATGIFPVISLLNHSCSPNTSVSFIST  583

Query  1004  TLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCIN  825
                +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C           
Sbjct  584   VATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPACQ--------TE  635

Query  824   AYRCA-----KPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYH  660
             A+R A     K  C         AS +++                            D  
Sbjct  636   AHRMAAGPRWKAFCCNSCRAPMQASLLRE---------------------------GDGM  668

Query  659   LKPGH--CLNCNLYRDLEAACATISKAESSIGRLQDAIASNDV--PVEVLSNALKASDIL  492
             L+ G+  C    + RD     + +   +  +G  Q  +   ++   V++LS   + ++  
Sbjct  669   LRCGNRSCAESVVSRD--HLVSRLQDLQQQVGVAQKLLRDGELERAVQLLSGCQRDAE--  724

Query  491   RSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKL  312
              S L   +  + E+ D +A+A   +G+ Q +  H + S++++E  + P+ + +G+EL KL
Sbjct  725   -SFLWAEHAMVGEIADGLARACAALGDWQKSATHLQKSLRVVEVRHGPSSVEMGHELFKL  783

Query  311   GSI  303
               +
Sbjct  784   AQV  786


 Score = 70.9 bits (172),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 90/344 (26%), Positives = 149/344 (43%), Gaps = 63/344 (18%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQV  2358
             ++LPV +     S  ++K  SL PK+++  IS + T   +    SSLL+     P+    
Sbjct  1     MDLPVDE---WKSYLLQKWASL-PKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELF  51

Query  2357  VKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNL  2178
             +K L+  +  L GKD  A    + +GN+ F   DY  A   Y++ +  +  N+ D     
Sbjct  52    LKRLS--KGYLVGKDSDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM----  105

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDA  2013
              ++ Y NR++AL  +G    CL+D  RA      Y      K   R+ +   +LG  ++A
Sbjct  106   -SLCYANRSAALFHLGQYETCLKDISRAQ--MHGYPERLQPKIMLRKAECLVALGRLQEA  162

Query  2012  IQDLKVSLKMEVSLSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DV  1869
              Q +     +E + +    + D     L +  H LK     K +  E+          DV
Sbjct  163   SQTVG---DLERNFTATPTLADVPPQTLQRNLHHLKMKLQEKESPTETLPATLAKTLEDV  219

Query  1868  TMLDEPDRANMQCVSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII----------  1734
              +  E +R +    S+     P KGR +V+  +I  G L+ +ED + +I+          
Sbjct  220   ALRGENERLSNASSSVGLCIDPLKGRYLVATKEILPGELLVREDAFVSILNPGELPPLHH  279

Query  1733  ----LKNCRETN----CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                  ++ R TN    CH C     +  VPC+ CS   YCS +C
Sbjct  280   GLDSQRDTRVTNGDLYCHRCLKH-TLATVPCDGCSYAKYCSQEC  322



>gb|EEC76031.1| hypothetical protein OsI_13199 [Oryza sativa Indica Group]
Length=481

 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 73/306 (24%), Positives = 119/306 (39%), Gaps = 49/306 (16%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  RT YVR    +S   E+ +SY           RQ
Sbjct  205   LGTGLYPVLSIINHSCVPNAVLIFEGRTAYVRALQPISKNEEVSISYIETAAT--TMKRQ  262

Query  905   QILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQV  726
               L+  Y F+C C  C + +  D  +  YRC    C G +            LP+     
Sbjct  263   DDLK-HYYFTCTCPRCVKDSEEDALLEGYRCNDQKCDGFL------------LPNAGN--  307

Query  725   EKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDA---  555
                                    K   C  C+  RD E     + K  S +  L D    
Sbjct  308   -----------------------KGYTCQKCSTSRDGEE----LQKMASDVLLLSDKVSS  340

Query  554   -IASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKAS  378
              ++S     EV S      ++ R   HP +  +    + + +    + + Q A+ +C+ +
Sbjct  341   LVSSGIDNSEVGSMYKTIEELERKLYHPLSITLLHTRETLLKIYMELQDWQTALMYCRLT  400

Query  377   IKILEKLYDPNHIVIGNELIKLGSIQ-LQRGNRDAASTTKSTAEIFSRYFGSHALVIFPY  201
             I + E++Y P H +IG +    G ++ L     DA  +    A+I     G+ +  +   
Sbjct  401   IPVYERIYPPFHPMIGLQFYTCGKLEWLLEYTEDALMSLTRAADILRITHGTKSEFMKEL  460

Query  200   LQRLQQ  183
             L +L++
Sbjct  461   LGKLEE  466



>ref|XP_002309374.2| hypothetical protein POPTR_0006s19280g [Populus trichocarpa]
 gb|EEE92897.2| hypothetical protein POPTR_0006s19280g [Populus trichocarpa]
Length=271

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = -3

Query  2303  ASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLI  2124
              +E KL GN+ F  G Y +AL  Y  AL++AP +   + + L ++ + NR     K+G  
Sbjct  98    GNEAKLEGNRLFGNGQYEEALLQYELALQVAPQDVPSSVE-LRSICHFNRGVCFLKLGKY  156

Query  2123  VECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
              + +++C RAL +  +Y KA  RRG+A+  L +FE+AI D+K +L+ + S
Sbjct  157   EDTIKECSRALELNPSYTKALVRRGEAHEKLEHFEEAIADMKKTLEFDPS  206



>gb|ABF98444.1| MYND finger family protein, expressed [Oryza sativa Japonica 
Group]
Length=481

 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 73/306 (24%), Positives = 119/306 (39%), Gaps = 49/306 (16%)
 Frame = -3

Query  1085  VGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQ  906
             +G  +Y V S+ NHSC PNA   F  RT YVR    +S   E+ +SY           RQ
Sbjct  205   LGTGLYPVLSIINHSCVPNAVLIFEGRTAYVRALQPISKNEEVSISYIETAAT--TMKRQ  262

Query  905   QILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQV  726
               L+  Y F+C C  C + +  D  +  YRC    C G +            LP+     
Sbjct  263   DDLK-HYYFTCTCPRCVKDSEEDALLEGYRCNDQKCDGFL------------LPNAGN--  307

Query  725   EKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDA---  555
                                    K   C  C+  RD E     + K  S +  L D    
Sbjct  308   -----------------------KGYTCQKCSTSRDGEE----LQKMASDVLLLSDKVSS  340

Query  554   -IASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKAS  378
              ++S     EV S      ++ R   HP +  +    + + +    + + Q A+ +C+ +
Sbjct  341   LVSSGIDNSEVGSMYKTIEELERKLYHPLSITLLHTRETLLKIYMELQDWQTALMYCRLT  400

Query  377   IKILEKLYDPNHIVIGNELIKLGSIQ-LQRGNRDAASTTKSTAEIFSRYFGSHALVIFPY  201
             I + E++Y P H +IG +    G ++ L     DA  +    A+I     G+ +  +   
Sbjct  401   IPVYERIYPPFHPMIGLQFYTCGKLEWLLEYTEDALMSLTRAADILRITHGTKSEFMKEL  460

Query  200   LQRLQQ  183
             L +L++
Sbjct  461   LGKLEE  466



>gb|EFN70437.1| SET and MYND domain-containing protein 4 [Camponotus floridanus]
Length=646

 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/265 (26%), Positives = 127/265 (48%), Gaps = 47/265 (18%)
 Frame = -3

Query  2318  KDHSAASEVKLRGNQCFSGGDYPK-----ALHFYTQALRLAPTNSNDTEKNLSAMLYVNR  2154
             K+   + +++ +GN+ F  G         AL  YT+++  AP  S        A+ Y NR
Sbjct  56    KNAKESEKLREQGNKVFIKGALNNMTCIDALKLYTKSIAFAPYPSEQL-----ALAYANR  110

Query  2153  ASALHKMGLIVECLQDCDRALAIF---STYAKAWFRRGKANASLGN--FEDAIQDLKVSL  1989
             ++ L ++GL  EC+QD DRALA+       AK + R+ +    LGN   ED +++ +  L
Sbjct  111   SAVLFQLGLHSECIQDIDRALALNYPDDLRAKLYVRKTECLMILGNCSVEDILKEAQHWL  170

Query  1988  -KMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTK  1812
              KM ++ + +    ++LR+ LD     HS   ++ ++  D ++  E  +   + + LPT 
Sbjct  171   DKMTLNHANR----EKLRLKLDSL---HSKAVQTEQSVKDNSLCTEVKKLGSE-LPLPTI  222

Query  1811  ----------------------GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFC  1698
                                   GR +++  +I  G ++  E PYA ++++   +T+C  C
Sbjct  223   ASYNDEVPCASDAVAIKYNTRCGRHVIATRNINPGEVIAVEKPYALLLVQQNMQTHCSNC  282

Query  1697  FNELPMHAVPCESCSIPLYCSSQCQ  1623
               ++    +PC  C+  +YCS +C+
Sbjct  283   L-KVCWANIPCNYCTYAMYCSEECR  306



>ref|XP_008007960.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X3 
[Chlorocebus sabaeus]
Length=774

 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 126/303 (42%), Gaps = 56/303 (18%)
 Frame = -3

Query  1184  VNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSR  1005
              ++ A+  ++   +KGS+        +   QV++   I+ V S+ NHSC PN    F+S 
Sbjct  515   TDAQAMTTIQHTGSKGSI-------VTDSRQVRLATGIFPVISLLNHSCSPNTSVSFIST  567

Query  1004  TLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCSQLNLSDLCIN  825
                +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C           
Sbjct  568   VATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPACQ--------TE  619

Query  824   AYRCA-----KPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYH  660
             A+R A     K  C         AS +++                            D  
Sbjct  620   AHRMAAGPRWKAFCCNSCRAPMQASLLRE---------------------------GDGM  652

Query  659   LKPGH--CLNCNLYRDLEAACATISKAESSIGRLQDAIASNDV--PVEVLSNALKASDIL  492
             L+ G+  C    + RD     + +   +  +G  Q  +   ++   V++LS   + ++  
Sbjct  653   LRCGNRSCAESVVSRD--HLVSRLQDLQQQVGVAQKLLRDGELERAVQLLSGCQRDAE--  708

Query  491   RSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKL  312
              S L   +  + E+ D +A+A   +G+ Q +  H + S++++E  + P+ + +G+EL KL
Sbjct  709   -SFLWAEHAMVGEIADGLARACAALGDWQKSATHLQKSLRVVEVRHGPSSVEMGHELFKL  767

Query  311   GSI  303
               +
Sbjct  768   AQV  770


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 90/344 (26%), Positives = 149/344 (43%), Gaps = 63/344 (18%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQV  2358
             ++LPV +     S  ++K  SL PK+++  IS + T   +    SSLL+     P+    
Sbjct  1     MDLPVDE---WKSYLLQKWASL-PKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELF  51

Query  2357  VKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNL  2178
             +K L+  +  L GKD  A    + +GN+ F   DY  A   Y++ +  +  N+ D     
Sbjct  52    LKRLS--KGYLVGKDSDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM----  105

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDA  2013
              ++ Y NR++AL  +G    CL+D  RA      Y      K   R+ +   +LG  ++A
Sbjct  106   -SLCYANRSAALFHLGQYETCLKDISRAQ--MHGYPERLQPKIMLRKAECLVALGRLQEA  162

Query  2012  IQDLKVSLKMEVSLSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DV  1869
              Q +     +E + +    + D     L +  H LK     K +  E+          DV
Sbjct  163   SQTVG---DLERNFTATPTLADVPPQTLQRNLHHLKMKLQEKESPTETLPATLAKTLEDV  219

Query  1868  TMLDEPDRANMQCVSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII----------  1734
              +  E +R +    S+     P KGR +V+  +I  G L+ +ED + +I+          
Sbjct  220   ALRGENERLSNASSSVGLCIDPLKGRYLVATKEILPGELLVREDAFVSILNPGELPPLHH  279

Query  1733  ----LKNCRETN----CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                  ++ R TN    CH C     +  VPC+ CS   YCS +C
Sbjct  280   GLDSQRDTRVTNGDLYCHRCLKH-TLATVPCDGCSYAKYCSQEC  322



>ref|XP_005582512.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Macaca fascicularis]
 ref|XP_005582513.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Macaca fascicularis]
 ref|XP_005582514.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X3 
[Macaca fascicularis]
 ref|XP_005582515.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X4 
[Macaca fascicularis]
Length=806

 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 89/331 (27%), Positives = 143/331 (43%), Gaps = 64/331 (19%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKD  2313
             ++K  SL PK+++  IS + T   +    SSLL+     P+    +K L+  +  L GKD
Sbjct  17    LQKWASL-PKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELFLKRLS--KGYLVGKD  68

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               A    + +GN+ F   DY  A   Y++ +  +  N+ D      ++ Y NR++AL  +
Sbjct  69    SDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM-----SLCYANRSAALFHL  123

Query  2132  GLIVECLQDCDRALAIFSTYA-------KAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
             G    C++D  RA     T+        K   RR +   +LG  ++A Q +     +E +
Sbjct  124   GQYETCIKDISRA----QTHGYPERLQPKIMLRRAECLVALGRLQEASQTVG---DLERN  176

Query  1973  LSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDRANMQC  1830
              +    + D  R  L +  H LK     K N  E+          DV +  E +R +   
Sbjct  177   FTATPTLADVPRQTLQRNLHHLKMKVQEKENPTETFPATLAKTLEDVALRGENERLSNAS  236

Query  1829  VSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN-  1710
              S+     P KGR +V+  DI  G L+ KED + +++                + R TN 
Sbjct  237   SSVGLCIDPLKGRYLVATKDILPGELLVKEDAFVSVLNPGELPPPHHGLDSQWDTRVTNG  296

Query  1709  ---CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                CH C     +  VPC+ CS   YCS +C
Sbjct  297   DLYCHRCLKHT-LATVPCDGCSYAKYCSQEC  326


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 92/232 (40%), Gaps = 29/232 (13%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +KGS+        +   QV++   I+ V S+ NHSC PN    F+S  
Sbjct  504   NAQAITTVQHTGSKGSI-------VTDSRQVRLATGIFPVISLLNHSCSPNTSVSFISTV  556

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC--------SQLN  846
               +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C        +   
Sbjct  557   ATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPACQTEAHRLAAGPR  616

Query  845   LSDLCINA----------YRCAKPGCL-GVVPDSTLASY---VKQKLPHVSKQVEKVENE  708
                 C N+           RC    C   VV    L S    ++Q++    K +   E E
Sbjct  617   WKAFCCNSCRAPMQGDGVLRCGNRSCAESVVSRDHLVSRLQDLQQQVGVAQKLLRDGELE  676

Query  707   RISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAI  552
             R   +       A+  L   H +   +   L  ACA +   + S   LQ ++
Sbjct  677   RAVQLLSGCQRDAESFLWAEHAMVGEIADGLARACAALGDWQKSATHLQKSL  728



>ref|XP_005349613.1| PREDICTED: SET and MYND domain-containing protein 4 [Microtus 
ochrogaster]
Length=797

 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 78/335 (23%), Positives = 127/335 (38%), Gaps = 79/335 (24%)
 Frame = -3

Query  1115  ALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQ  936
             ++ ++  QV++   I+ V S+ NHSC PN    F      +R    +  G E+   YGP 
Sbjct  512   SIVTNSRQVRLATGIFPVVSLLNHSCSPNTSVSFTGTVATIRAAQHIRKGQEIVHCYGPH  571

Query  935   VGQWDHKDRQQILRDRYSFSCQCRGCSQLNL--------SDLCINA----------YRCA  810
               +    +RQQ LR +Y F C C  C    L           C NA            C+
Sbjct  572   QSRMGVAERQQKLRSQYFFDCSCPACHTETLRAAVEPRWEAFCCNACSALMQGNDVLSCS  631

Query  809   KPGCLGVVPDSTLASYVKQKLPHVSKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCN  630
                C   V  + LAS    +L  + +QV                           C    
Sbjct  632   NESCRESVSRAHLAS----RLQDLQQQV---------------------------CEAQK  660

Query  629   LYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEV  450
             L R+               G+L+ A       V+ L    +A++   S  H     + E+
Sbjct  661   LLRN---------------GKLEQA-------VQQLLGCREAAESFLSAEHTM---VGEI  695

Query  449   EDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSIQLQR-GNRDAA  273
             ED +AQA   +G+ + +  H + S+ ++E  + P+ + IG+EL KL  +        +A 
Sbjct  696   EDGLAQAHAALGDWRKSAAHIQKSVHVVEARHGPSSVEIGHELFKLAQVLFNGLAVPEAL  755

Query  272   STTKSTAEIFSRYFGSHALVIFPYLQRLQQEAGCL  168
             S      +I   + G  +    P +Q L++   CL
Sbjct  756   SAIWKAEKILLVHCGPES----PEVQELREMKSCL  786


 Score = 70.1 bits (170),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 88/339 (26%), Positives = 148/339 (44%), Gaps = 53/339 (16%)
 Frame = -3

Query  2534  LNLPVQKPSVLTSEHMEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQV  2358
             ++LPV K     S  ++K  +L+PK+++  IS + T + +    SSLL+     P+    
Sbjct  1     MDLPVDK---WISYLLDKW-ALLPKSVQDTISTAKTLNDIFLRSSSLLQ-----PEDEVF  51

Query  2357  VKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNL  2178
             +K L+     L  KD+ A    + +GN+ F   DY  A   Y++ +  +  N+ D     
Sbjct  52    LKRLSS--AYLVEKDYDAPLFYREKGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDI----  105

Query  2177  SAMLYVNRASALHKMGLIVECLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDA--  2013
              ++ Y NR++AL  +G    CL+D  RA           K   R+ +   +LG  ++A  
Sbjct  106   -SLCYANRSAALFHLGQYEACLKDIVRADVHGYPERLQPKMMLRKIECLVNLGRLQEARQ  164

Query  2012  -IQDLKVSLKMEVSLSG------KRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDE  1854
              I DL+ SL  + +L        +R +      I ++  L  +      R   D+ + +E
Sbjct  165   TITDLESSLAAKPTLVPSSHQILQRNLHHLKMKIQEKESLPETFPAALTRAFEDMALGEE  224

Query  1853  PDRANMQCVSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------L  1731
                 +   +S+     P KGR +V+  DI  G L+ KED + +++               
Sbjct  225   NKEISGASLSVSLHMDPLKGRHLVATKDILPGELLVKEDAFVSVLNPGEMPPLHHGLETK  284

Query  1730  KNCRETN----CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
              + R TN    CH C     +  VPC  CS   YCS +C
Sbjct  285   WDTRVTNGDLYCHRCLKHT-LATVPCGGCSYARYCSQEC  322



>ref|XP_005582516.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X5 
[Macaca fascicularis]
Length=756

 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 89/331 (27%), Positives = 143/331 (43%), Gaps = 64/331 (19%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKD  2313
             ++K  SL PK+++  IS + T   +    SSLL+     P+    +K L+  +  L GKD
Sbjct  17    LQKWASL-PKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELFLKRLS--KGYLVGKD  68

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               A    + +GN+ F   DY  A   Y++ +  +  N+ D      ++ Y NR++AL  +
Sbjct  69    SDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM-----SLCYANRSAALFHL  123

Query  2132  GLIVECLQDCDRALAIFSTYA-------KAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
             G    C++D  RA     T+        K   RR +   +LG  ++A Q +     +E +
Sbjct  124   GQYETCIKDISRA----QTHGYPERLQPKIMLRRAECLVALGRLQEASQTVG---DLERN  176

Query  1973  LSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDRANMQC  1830
              +    + D  R  L +  H LK     K N  E+          DV +  E +R +   
Sbjct  177   FTATPTLADVPRQTLQRNLHHLKMKVQEKENPTETFPATLAKTLEDVALRGENERLSNAS  236

Query  1829  VSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN-  1710
              S+     P KGR +V+  DI  G L+ KED + +++                + R TN 
Sbjct  237   SSVGLCIDPLKGRYLVATKDILPGELLVKEDAFVSVLNPGELPPPHHGLDSQWDTRVTNG  296

Query  1709  ---CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                CH C     +  VPC+ CS   YCS +C
Sbjct  297   DLYCHRCLKHT-LATVPCDGCSYAKYCSQEC  326


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 92/232 (40%), Gaps = 29/232 (13%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +KGS+        +   QV++   I+ V S+ NHSC PN    F+S  
Sbjct  504   NAQAITTVQHTGSKGSI-------VTDSRQVRLATGIFPVISLLNHSCSPNTSVSFISTV  556

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC--------SQLN  846
               +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C        +   
Sbjct  557   ATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPACQTEAHRLAAGPR  616

Query  845   LSDLCINA----------YRCAKPGCL-GVVPDSTLASY---VKQKLPHVSKQVEKVENE  708
                 C N+           RC    C   VV    L S    ++Q++    K +   E E
Sbjct  617   WKAFCCNSCRAPMQGDGVLRCGNRSCAESVVSRDHLVSRLQDLQQQVGVAQKLLRDGELE  676

Query  707   RISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAI  552
             R   +       A+  L   H +   +   L  ACA +   + S   LQ ++
Sbjct  677   RAVQLLSGCQRDAESFLWAEHAMVGEIADGLARACAALGDWQKSATHLQKSL  728



>gb|EHH57568.1| hypothetical protein EGM_07234 [Macaca fascicularis]
Length=806

 Score = 77.0 bits (188),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 87/322 (27%), Positives = 138/322 (43%), Gaps = 59/322 (18%)
 Frame = -3

Query  2468  VPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAASEV  2292
             VPK+++  IS + T   +    SSLL+     P+    +K L+  +  L GKD  A    
Sbjct  23    VPKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELFLKRLS--KGYLVGKDSDAPLFY  75

Query  2291  KLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECL  2112
             + +GN+ F   DY  A   Y++ +  +  N+ D      ++ Y NR++AL  +G    C+
Sbjct  76    REQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM-----SLCYANRSAALFHLGQYETCI  130

Query  2111  QDCDRALAIFSTYA-----KAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIED  1947
             +D  RA      Y      K   RR +   +LG  ++A Q +     +E + +    + D
Sbjct  131   KDISRAQ--MHGYPERLQPKIMLRRAECLVALGRLQEASQTVG---DLERNFTATPTLAD  185

Query  1946  ELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDRANMQCVSL-----P  1818
               R  L +  H LK     K N  E+          DV +  E +R +    S+     P
Sbjct  186   VPRQTLQRNLHHLKMKVQEKENPTETFPATLAKTLEDVALRGENERLSNASSSVGLCIDP  245

Query  1817  TKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFN  1692
              KGR +V+  DI  G L+ KED + +++                + R TN    CH C  
Sbjct  246   LKGRYLVATKDILPGELLVKEDAFVSVLNPGELPPPHHGLDSQWDTRVTNGDLYCHRCLK  305

Query  1691  ELPMHAVPCESCSIPLYCSSQC  1626
                +  VPC+ CS   YCS +C
Sbjct  306   HT-LATVPCDGCSYAKYCSQEC  326


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 94/232 (41%), Gaps = 29/232 (13%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +KGS+      +T S  QV++   I+ V S+ NHSC PN    F+S  
Sbjct  504   NAQAITTVQHTGSKGSI------VTDS-RQVRLATGIFPVISLLNHSCSPNTSVSFISTV  556

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC--------SQLN  846
               +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C        +   
Sbjct  557   ATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPACQTEAHRMAAGPR  616

Query  845   LSDLCINA----------YRCAKPGCL-GVVPDSTLASY---VKQKLPHVSKQVEKVENE  708
                 C N+           RC    C   VV    L S    ++Q++    K +   E E
Sbjct  617   WKAFCCNSCRAPMQGDGVLRCGNRSCAESVVSRDHLVSRLQDLQQQVGVAQKLLRDGELE  676

Query  707   RISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAI  552
             R   +       A+  L   H +   +   L  ACA +   + S   LQ ++
Sbjct  677   RAVQLLSGCQRDAESFLWAEHAMVGEIADGLARACAALGDWQKSATHLQKSL  728



>ref|XP_001117365.1| PREDICTED: SET and MYND domain-containing protein 4-like [Macaca 
mulatta]
Length=802

 Score = 77.0 bits (188),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 89/331 (27%), Positives = 143/331 (43%), Gaps = 64/331 (19%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKD  2313
             ++K  SL PK+++  IS + T   +    SSLL+     P+    +K L+  +  L GKD
Sbjct  13    LQKWASL-PKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELFLKRLS--KGYLVGKD  64

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               A    + +GN+ F   DY  A   Y++ +  +  N+ D      ++ Y NR++AL  +
Sbjct  65    SDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM-----SLCYANRSAALFHL  119

Query  2132  GLIVECLQDCDRALAIFSTYA-------KAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
             G    C++D  RA     T+        K   RR +   +LG  ++A Q +     +E +
Sbjct  120   GQYETCIKDISRA----QTHGYPERLQPKIMLRRAECLVALGRLQEASQTVG---DLERN  172

Query  1973  LSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDRANMQC  1830
              +    + D  R  L +  H LK     K N  E+          DV +  E +R +   
Sbjct  173   FTATPTLADVPRQTLQRNLHHLKMKVQEKENPTETFPATLAKTLEDVALRGENERLSNAS  232

Query  1829  VSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN-  1710
              S+     P KGR +V+  DI  G L+ KED + +++                + R TN 
Sbjct  233   SSVGLCIDPLKGRYLVATKDILPGELLVKEDAFVSVLNPGELPPPHHGLDSQWDTRVTNG  292

Query  1709  ---CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                CH C     +  VPC+ CS   YCS +C
Sbjct  293   DLYCHRCLKHT-LATVPCDGCSYAKYCSQEC  322


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 92/232 (40%), Gaps = 29/232 (13%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +KGS+        +   QV++   I+ V S+ NHSC PN    F+S  
Sbjct  500   NAQAITTVQHTGSKGSI-------VTDSRQVRLATGIFPVISLLNHSCSPNTSVSFISTV  552

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC--------SQLN  846
               +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C        +   
Sbjct  553   ATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPACQTEAHRMAAGPR  612

Query  845   LSDLCINA----------YRCAKPGCL-GVVPDSTLASY---VKQKLPHVSKQVEKVENE  708
                 C N+           RC    C   VV    L S    ++Q++    K +   E E
Sbjct  613   WKAFCCNSCRAPMQGDGVLRCGNRSCAESVVSRDHLVSRLQDLQQQVGVAQKLLRDGELE  672

Query  707   RISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAI  552
             R   +       A+  L   H +   +   L  ACA +   + S   LQ ++
Sbjct  673   RAVQLLSGCQRDAESFLWAEHAMVGEIADGLARACAALGDWQKSATHLQKSL  724



>gb|EHH24346.1| hypothetical protein EGK_07991 [Macaca mulatta]
Length=806

 Score = 77.0 bits (188),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 89/331 (27%), Positives = 143/331 (43%), Gaps = 64/331 (19%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKD  2313
             ++K  SL PK+++  IS + T   +    SSLL+     P+    +K L+  +  L GKD
Sbjct  17    LQKWASL-PKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELFLKRLS--KGYLVGKD  68

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               A    + +GN+ F   DY  A   Y++ +  +  N+ D      ++ Y NR++AL  +
Sbjct  69    SDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM-----SLCYANRSAALFHL  123

Query  2132  GLIVECLQDCDRALAIFSTYA-------KAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
             G    C++D  RA     T+        K   RR +   +LG  ++A Q +     +E +
Sbjct  124   GQYETCIKDISRA----QTHGYPERLQPKIMLRRAECLVALGRLQEASQTVG---DLERN  176

Query  1973  LSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDRANMQC  1830
              +    + D  R  L +  H LK     K N  E+          DV +  E +R +   
Sbjct  177   FTATPTLADVPRQTLQRNLHHLKMKVQEKENPTETFPATLAKTLEDVALRGENERLSNAS  236

Query  1829  VSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN-  1710
              S+     P KGR +V+  DI  G L+ KED + +++                + R TN 
Sbjct  237   SSVGLCIDPLKGRYLVATKDILPGELLVKEDAFVSVLNPGELPPPHHGLDSQWDTRVTNG  296

Query  1709  ---CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                CH C     +  VPC+ CS   YCS +C
Sbjct  297   DLYCHRCLKHT-LATVPCDGCSYAKYCSQEC  326


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 92/232 (40%), Gaps = 29/232 (13%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +KGS+        +   QV++   I+ V S+ NHSC PN    F+S  
Sbjct  504   NAQAITTVQHTGSKGSI-------VTDSRQVRLATGIFPVISLLNHSCSPNTSVSFISTV  556

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC--------SQLN  846
               +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C        +   
Sbjct  557   ATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPACQTEAHRMAAGPR  616

Query  845   LSDLCINA----------YRCAKPGCL-GVVPDSTLASY---VKQKLPHVSKQVEKVENE  708
                 C N+           RC    C   VV    L S    ++Q++    K +   E E
Sbjct  617   WKAFCCNSCRAPMQGDGVLRCGNRSCAESVVSRDHLVSRLQDLQQQVGVAQKLLRDGELE  676

Query  707   RISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQDAI  552
             R   +       A+  L   H +   +   L  ACA +   + S   LQ ++
Sbjct  677   RAVQLLSGCQRDAESFLWAEHAMVGEIADGLARACAALGDWQKSATHLQKSL  728



>gb|EFX74155.1| hypothetical protein DAPPUDRAFT_307492 [Daphnia pulex]
Length=240

 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 73/125 (58%), Gaps = 9/125 (7%)
 Frame = -3

Query  2354  KELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLS  2175
             +E+ +P+  +   D    SE++ +    F+ GDY KA  F+T+A++L   NS       S
Sbjct  101   QEMGNPDQEMSESDEEKLSEIRQQATAAFADGDYEKAAGFFTEAIQL---NSQ------S  151

Query  2174  AMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKV  1995
             A+++  RA+    +     C++DC+RA+ +    A A   RG+A+  LGN+E+A++DL++
Sbjct  152   ALMFAKRANCYIHLNKPNACIRDCNRAIELNPDSAPAHKFRGRAHRLLGNWEEAVKDLRL  211

Query  1994  SLKME  1980
             + K++
Sbjct  212   ACKID  216



>ref|XP_005582519.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X8 
[Macaca fascicularis]
Length=681

 Score = 76.6 bits (187),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 89/331 (27%), Positives = 143/331 (43%), Gaps = 64/331 (19%)
 Frame = -3

Query  2489  MEKLKSLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKD  2313
             ++K  SL PK+++  IS + T   +    SSLL+     P+    +K L+  +  L GKD
Sbjct  17    LQKWASL-PKSIQLTISTAETLSDIFLHSSSLLQ-----PEDELFLKRLS--KGYLVGKD  68

Query  2312  HSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKM  2133
               A    + +GN+ F   DY  A   Y++ +  +  N+ D      ++ Y NR++AL  +
Sbjct  69    SDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDM-----SLCYANRSAALFHL  123

Query  2132  GLIVECLQDCDRALAIFSTYA-------KAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
             G    C++D  RA     T+        K   RR +   +LG  ++A Q +     +E +
Sbjct  124   GQYETCIKDISRA----QTHGYPERLQPKIMLRRAECLVALGRLQEASQTVG---DLERN  176

Query  1973  LSGKRQIEDELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDRANMQC  1830
              +    + D  R  L +  H LK     K N  E+          DV +  E +R +   
Sbjct  177   FTATPTLADVPRQTLQRNLHHLKMKVQEKENPTETFPATLAKTLEDVALRGENERLSNAS  236

Query  1829  VSL-----PTKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN-  1710
              S+     P KGR +V+  DI  G L+ KED + +++                + R TN 
Sbjct  237   SSVGLCIDPLKGRYLVATKDILPGELLVKEDAFVSVLNPGELPPPHHGLDSQWDTRVTNG  296

Query  1709  ---CHFCFNELPMHAVPCESCSIPLYCSSQC  1626
                CH C     +  VPC+ CS   YCS +C
Sbjct  297   DLYCHRCLKHT-LATVPCDGCSYAKYCSQEC  326


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 7/108 (6%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +KGS+        +   QV++   I+ V S+ NHSC PN    F+S  
Sbjct  504   NAQAITTVQHTGSKGSI-------VTDSRQVRLATGIFPVISLLNHSCSPNTSVSFISTV  556

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC  858
               +R +  +  G E+   YGP   +    +RQQ LR +Y F C C  C
Sbjct  557   ATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPAC  604



>gb|AES79205.2| heat shock protein 70 (HSP70)-interacting protein, putative [Medicago 
truncatula]
Length=267

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 66/112 (59%), Gaps = 2/112 (2%)
 Frame = -3

Query  2309  SAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMG  2130
             S A+E K+ GN+ F  G Y +AL  Y  AL++AP   +  E  + ++ + NRA    K+G
Sbjct  93    SEANEAKVEGNKLFVDGKYEEALSQYEHALQVAPDMPSSVE--IRSICHANRAVCFMKLG  150

Query  2129  LIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
                  +++C +AL +   Y KA  RRG+A+  L +FE+AI D+K  L+++ S
Sbjct  151   KYENTIKECTKALELNPAYVKALVRRGEAHEKLEHFEEAIADMKKILEIDPS  202



>ref|XP_005834996.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Guillardia theta 
CCMP2712]
 gb|EKX48016.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Guillardia theta 
CCMP2712]
Length=543

 Score = 76.3 bits (186),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 83/160 (52%), Gaps = 12/160 (8%)
 Frame = -3

Query  2372  QFHQVVKELTDPEMALCGKDHSAASEV-KLRGNQCFSGGDYPKALHFYTQALRLAPTNSN  2196
             Q+   V E+T P   L  KD  AA+E  K +GN  F   D  KAL+ Y +A +L      
Sbjct  347   QYVVNVNEVT-PTYQLQLKDKLAAAEKRKEQGNVFFKSEDLEKALNKYDKAFKLVQYEQG  405

Query  2195  DTE-----KNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASL  2031
             + +     KNL +  + N+A+ L K G + EC+ +C ++L I  T  KA FRRGKA  + 
Sbjct  406   EGDEAEAVKNLKSTCHTNKAAVLEKQGKLDECIAECTKSLDIKPTNVKALFRRGKAYCTQ  465

Query  2030  GNFEDAIQDLKVSLKMEVSLSGKRQIEDELRIILDQHKLK  1911
                EDA +DLK +L ++      +Q     +++LDQ   K
Sbjct  466   NRLEDATKDLKQALTVDPENKAAKQ-----QLLLDQKDKK  500



>ref|XP_003400603.1| PREDICTED: SET and MYND domain-containing protein 4-like [Bombus 
terrestris]
Length=631

 Score = 76.6 bits (187),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 73/262 (28%), Positives = 122/262 (47%), Gaps = 32/262 (12%)
 Frame = -3

Query  2324  CG--KDHSAASEVKLRGNQCFSGG---DYP--KALHFYTQALRLAPTNSNDTEKNLSAML  2166
             CG  KD   + +++ +GN+ F      +Y    AL  YT+++  AP  S        A+ 
Sbjct  52    CGDIKDAKESEKLREQGNKLFVSTPLKNYTCVDALKLYTKSIAYAPYPSEQL-----ALA  106

Query  2165  YVNRASALHKMGLIVECLQDCDRALAIFSTY-----AKAWFRRGKANASLGN--FEDAIQ  2007
             Y NR++ L K+     C+QD DRALA+  TY     AK   R+ +   +LG+   EDAI+
Sbjct  107   YANRSAVLIKLHKYELCIQDIDRALAL--TYPNNLRAKLCVRKVECLNALGHPRMEDAIK  164

Query  2006  DLKVSL-KMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQC  1830
             + +  L KM      ++++ ++L     +H L    L K N  +       +     + C
Sbjct  165   EAQYWLEKMSSDDINRKKLSEKLNNT--KHNLASQKLKKQNTIKQPPLPKIKTRNIEVPC  222

Query  1829  VSLPTK-------GRGMVSRADIPIGSLVHKEDPYAAIILKNCRETNCHFCFNELPMHAV  1671
              S           GR +V+   I  G ++  E PY+ I+  +   T+C  C  E+    +
Sbjct  223   ASDAVTIKYNEEYGRHIVATHKIRPGEVIAVEKPYSLILTPDNIHTHCSNCL-EVSWANI  281

Query  1670  PCESCSIPLYCSSQCQLVSGGK  1605
             PCE C+  +YCS +C+++   K
Sbjct  282   PCEHCTYAMYCSEECKIMEWKK  303



>ref|XP_003417026.1| PREDICTED: SET and MYND domain-containing protein 4 [Loxodonta 
africana]
Length=800

 Score = 77.0 bits (188),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 85/322 (26%), Positives = 142/322 (44%), Gaps = 55/322 (17%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             +L+P ++R  IS + T   +   CSSL +     P+   V+K L+     L GKD +A+ 
Sbjct  17    ALLPTSIRDTISTAGTLSDVFLHCSSLFQ-----PEDEMVLKRLS--RGYLVGKDPNASL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               K  GN+ F   DY  A   Y++ +  +  N+        ++ Y NR++A   +G    
Sbjct  70    FYKEEGNKKFQEKDYMGAAVLYSKGVSHSRPNTEAI-----SLCYANRSAAFFHLGQYET  124

Query  2117  CLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIED  1947
             CL+D  RA +         K   R+ +   +LG  ++A Q +     +E  L+ K  +  
Sbjct  125   CLEDIIRAQSHGYPERLQPKMMLRKAECLVTLGRLQEASQTIS---DLESKLAAKPTLAA  181

Query  1946  ELRIILDQ--HKLKHSSLYKSNRNES----------DVTMLDEPDR--ANMQCVSL---P  1818
                 +L +  H+LK     K N +E+          D+ +++E ++  +    VSL   P
Sbjct  182   SHFEVLQRNLHRLKTKVQKKENLSETFPAALTKAFKDMDLMEESEQIPSASSSVSLCTDP  241

Query  1817  TKGRGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFN  1692
              KGR +++  DI  G L+ KE  + +++                N R TN    CH C  
Sbjct  242   LKGRHLIATKDILPGELLVKEAAFVSVLNPGEMPQLHHGLESKWNTRVTNGDLHCHCCLK  301

Query  1691  ELPMHAVPCESCSIPLYCSSQC  1626
                +  VPC+ CS   YCS +C
Sbjct  302   HT-LATVPCDQCSYAKYCSQEC  322


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 56/110 (51%), Gaps = 7/110 (6%)
 Frame = -3

Query  1187  RVNSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLS  1008
             + N+ AI  ++   +K S+      +T S E +++   I+ V S+ NHSCRPN    F S
Sbjct  498   QCNAQAITTIQHTGSKESI------ITESRE-IRLATGIFPVVSLLNHSCRPNTSVSFTS  550

Query  1007  RTLYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGC  858
                 +R +  ++ G E+   YGP   +    +RQQ LR +Y F C C  C
Sbjct  551   TVATIRASQQIAKGQEILHCYGPHESRMAVAERQQKLRSQYFFECTCPAC  600



>ref|XP_006869038.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing 
protein alpha [Chrysochloris asiatica]
Length=313

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 73/148 (49%), Gaps = 9/148 (6%)
 Frame = -3

Query  2423  GLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAASEVKLRGNQCFSGGDYPKA  2244
              LP T   + E            ++L  PE     +D + A  +K  GN+     ++  A
Sbjct  53    ALPQTLPEIFEAAAASATDRDTPQDLRSPEQPPSEEDSAEAERLKTEGNEQMKVDNFEAA  112

Query  2243  LHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVECLQDCDRALAIFSTYAKA  2064
             +HFY +A+ L P N         A+ + NRA+A  K+G     +QDCDRA+ I  +Y+KA
Sbjct  113   VHFYGKAIELNPAN---------AVYFCNRAAAYSKLGNYAGAVQDCDRAICIDPSYSKA  163

Query  2063  WFRRGKANASLGNFEDAIQDLKVSLKME  1980
             + R G A +SL    +A+   K +L+++
Sbjct  164   YGRMGLALSSLNKHAEAVAYYKKALELD  191



>dbj|BAL14275.1| serine/threonine-protein phosphatase 5 [Nicotiana tabacum]
Length=485

 Score = 76.3 bits (186),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 80/184 (43%), Gaps = 32/184 (17%)
 Frame = -3

Query  2339  PEMALCGKDHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYV  2160
             P M     + S A E+K   N+ F G  Y +A+  YTQA+ L   N         A+ + 
Sbjct  2     PTMETEKSNTSRAEELKQLANEAFKGHKYSQAIDLYTQAIELNSEN---------AVYWA  52

Query  2159  NRASALHKMGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLK------  1998
             NRA A  K+      +QD  +A+ I S Y+K ++RRG A  ++G F+DA++D +      
Sbjct  53    NRAFAHTKLEEYGSAIQDATKAIEIDSKYSKGYYRRGAAYLAMGKFKDALKDFQQVKKLC  112

Query  1997  -----------------VSLKMEVSLSGKRQIEDELRIILDQHKLKHSSLYKSNRNESDV  1869
                              + LK E ++S        +   +D H ++    Y   R E DV
Sbjct  113   PNDPDATKKLKECEKAVMKLKFEEAISVPESQRRSVADFIDYHTVEVEPQYTGARIEGDV  172

Query  1868  TMLD  1857
               LD
Sbjct  173   VTLD  176



>ref|XP_005975811.1| PREDICTED: SET and MYND domain-containing protein 4 [Pantholops 
hodgsonii]
Length=802

 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 71/297 (24%), Positives = 127/297 (43%), Gaps = 53/297 (18%)
 Frame = -3

Query  1181  NSMAIVRMKSLDTKGSLDEHVNALTSSLEQVKVGQAIYLVGSMFNHSCRPNAHAYFLSRT  1002
             N+ AI  ++   +K SL        +   +V++  A++ V S+ NHSC PN    FL   
Sbjct  501   NAQAITTIQQTGSKESL-------ITDTRRVRLATALFPVVSLLNHSCSPNTSVSFLGTV  553

Query  1001  LYVRTTDSVSAGSELELSYGPQVGQWDHKDRQQILRDRYSFSCQCRGCS---QLNLSDLC  831
               +R +  + +G E+   YGP   +    +R+Q LR +Y F C C  C    Q   +   
Sbjct  554   ATIRASQLIRSGQEISHCYGPHESRMGVAERRQKLRSQYFFDCDCPSCEREKQRPSAGPG  613

Query  830   INAYRCAKPGCLGVVPDSTLASYVKQKLPHVSKQVEK-VENERISDVAHYAVHKADYHLK  654
               A+RC +  C  ++    + S      P  ++ V + +   R+ D+    V  A  HL+
Sbjct  614   QEAFRCHR--CRALLQGDDVLSCGG---PACTESVGRDLLVSRLQDLQQ-QVGAAQKHLR  667

Query  653   PGHCLNCNLYRDLEAACATISKAESSIGRLQDAIASNDVPVEVLSNALKASDILRSTLHP  474
                                        GRL+ AI       ++L      ++   S  H 
Sbjct  668   N--------------------------GRLEIAI-------QLLLGCQSDAESFLSAEHS  694

Query  473   FNKRIAEVEDNVAQAMCLVGEPQAAMDHCKASIKILEKLYDPNHIVIGNELIKLGSI  303
                 + E+ED +AQA   +G+ + +  H + S++++E  + P+ + +G+EL KL  +
Sbjct  695   V---VGEIEDALAQAYAALGDWEKSATHLQKSLQVVEVHHGPSSVEMGHELFKLAQV  748


 Score = 70.5 bits (171),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 87/319 (27%), Positives = 142/319 (45%), Gaps = 49/319 (15%)
 Frame = -3

Query  2474  SLVPKALRQEISES-TPDGLPATCSSLLEFFHRLPQFHQVVKELTDPEMALCGKDHSAAS  2298
             SL+PK+++  IS + T + L    S+LL+     P+    +K L+   +   GKD +A+ 
Sbjct  17    SLLPKSIQVTISTAETLNDLFLHSSALLQ-----PEDEMFLKRLSGGYVV--GKDPNASL  69

Query  2297  EVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVE  2118
               + +GN+ F   DY  A   Y++ +  +  NS D      ++ Y NR++AL  +G    
Sbjct  70    FYREKGNKKFQAKDYMGAAVLYSKGVSHSGPNSTDI-----SLCYANRSAALFHLGQYET  124

Query  2117  CLQDCDRALA---IFSTYAKAWFRRGKANASLGNFEDA---IQDLKVSLKMEVSLSGKR-  1959
             CL+D  RA           K   R+ +   +LG  ++A   I DL+ S   + +LS  + 
Sbjct  125   CLKDIVRAQTHGYPEGLQPKLLLRKAECLVTLGRPQEASQTITDLESSFAAKPTLSASQF  184

Query  1958  QIEDEL--RIILD-QHKLKHSSLYKSNRNES----DVTMLDEPDRANMQCVSL---PTKG  1809
             QI      R+ +  Q K     ++     ++    D+   +E        VSL   P KG
Sbjct  185   QILQRTLCRVKVKVQEKENLPEIFPEALTKTFEGVDLREENEQIPGASSSVSLHIDPLKG  244

Query  1808  RGMVSRADIPIGSLVHKEDPYAAII--------------LKNCRETN----CHFCFNELP  1683
             R +V+  DI  G L+ KED + +++                + + TN    CH C     
Sbjct  245   RFLVATKDILPGELLVKEDAFVSVLNPGEVPLRPHSLESKWDIQVTNGDLHCHRCLRHT-  303

Query  1682  MHAVPCESCSIPLYCSSQC  1626
             +  VPCE CS   YCS +C
Sbjct  304   LAPVPCEGCSYAKYCSQEC  322



>emb|CCA23670.1| Mitochondrial Protein Translocase (MPT) Family puta [Albugo laibachii 
Nc14]
 emb|CCA25331.1| Mitochondrial Protein Translocase (MPT) Family puta [Albugo laibachii 
Nc14]
Length=261

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 93/195 (48%), Gaps = 23/195 (12%)
 Frame = -3

Query  2441  SESTP-DGLPATCSSLLEFFHRLPQFHQVVKE---------------LTDPEMAL--CGK  2316
             +E+TP D L   C +L        QF Q++ E                +D + A+  C K
Sbjct  23    NENTPNDTLSTECDALQSL---EAQFRQLLMENNGKVSEHPQDAEAAESDGQSAIKECIK  79

Query  2315  DHSAASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHK  2136
             D   AS+ K  GN+ F+ G    A+  Y+ AL+ +P     +  N  A+ + NRA+ L +
Sbjct  80    DEGKASKAKEIGNKFFALGRSLDAIECYSAALQYSPIGEEHS--NEKAIYFSNRAACLAR  137

Query  2135  MGLIVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQ  1956
             +  + E + DC +A+A+   Y KA  RR +A   L   E+A++D    LK++ S S  R 
Sbjct  138   LNRVEETIDDCTQAIALSPKYIKALLRRAEAYEKLDKLEEALRDYDEVLKIDASHSTARS  197

Query  1955  IEDELRIILDQHKLK  1911
                 L+ I+D+   K
Sbjct  198   SHTRLKKIVDERAEK  212



>dbj|GAM17448.1| hypothetical protein SAMD00019534_006230 [Acytostelium subglobosum 
LB1]
Length=970

 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 129/286 (45%), Gaps = 21/286 (7%)
 Frame = -3

Query  1091  VKVGQAIYLVGSMFNHSCRPNAHAYFLSRTLYVRTTDSVSAGSELELSYGPQVGQWDHKD  912
             VK+  AI+ + S+ NHSC  N    +   +LY+++   +    E+ L YGP     D + 
Sbjct  632   VKIAYAIFPMASLLNHSCDNNTLLQYNGTSLYIKSLKDIEKKEEVTLCYGPHSFHLDLQH  691

Query  911   RQQILRDRYSFSCQCRGCSQLNLSDLCINAYRCAKPG--CLGVVPDSTLASYVKQKLPHV  738
             R + LRD Y F+C+C+ C++ +      N  +C   G  C GV+    L +    K P  
Sbjct  692   RLESLRDEYYFTCRCKACNEKSGP----NPLKCPVMGTNCPGVL----LETVNMTKQPDD  743

Query  737   SKQVEKVENERISDVAHYAVHKADYHLKPGHCLNCNLYRDLEAACATISKAESSIGRLQD  558
                 E V  E + D   +  +K  + L+P      +L+     +  +I+   ++  R+ +
Sbjct  744   DDDEEDVTYE-VYDGRTFTCNKCGFELEPD-----DLFFLTSTSLMSITMFNNA-ARILN  796

Query  557   AIASNDVPVEVLSNALKASDILRSTLHPFNKRIAEVEDNVAQAMCLVGEPQAAMDHCKAS  378
             +  SN    EV    L+A +I ++     +K+I E+ D +A+        + A+ + + S
Sbjct  797   SGQSNK---EVEDLLLRALEIRKNIYMENSKKIGEIYDTLARFYITEDNYKEAVKYAEKS  853

Query  377   I-KILEKLYDPNHIVIGNELIKLGSIQLQRGNRDAASTTKSTAEIF  243
             +  I  +L   +   +  E  KL +I +  G    A    +TAEI 
Sbjct  854   VNNIYVRLGHSHSTELARECAKLANIYINGGEPAKAIKAINTAEIL  899


 Score = 57.0 bits (136),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 99/227 (44%), Gaps = 7/227 (3%)
 Frame = -3

Query  2294  VKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVEC  2115
              K +GN+ F    Y  AL  Y +ALRL  + ++  ++ LS  +Y NR   L  +    E 
Sbjct  213   FKNKGNELFQKKQYLDALLLYNEALRLYNSETSKDQQILST-IYSNRCLCLVHLEKFEEG  271

Query  2114  LQDCDRAL----AIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIED  1947
               +  R L    A + T+ K  +RRG    SL     A +D + + ++   +S    I+ 
Sbjct  272   ASEATRGLECRSAEYLTH-KLLYRRGICYFSLKKHARAKKDFQEAHRLVSMMSDPSDIQS  330

Query  1946  ELRIILDQHKLKHSSLYKSNRNESDVTMLDEPDRANMQCVSLPTKGRGMVSRADIPIGSL  1767
                 +   +K+K      S+  ++      E D+      S    GR   +  +I   ++
Sbjct  331   IEGYLEKINKMKTLDSGDSDTADNQSAFPSEVDQRITFKYSSDNVGRMAEASENIAANTV  390

Query  1766  VHKEDPYAAIILKNCRETNCHFCFNELPMHAVPCESCSIPLYCSSQC  1626
             + +E  Y + + ++   ++CH CF E+    + C+ C+   YCS  C
Sbjct  391   LFQEKAYVSCLERSSHSSHCHNCFKEI-FAPIYCKKCNHTQYCSDTC  436



>ref|XP_011010594.1| PREDICTED: tetratricopeptide repeat protein 1-like [Populus euphratica]
Length=269

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = -3

Query  2303  ASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLI  2124
              +E KL GN+ F  G Y +AL  Y  AL++AP +   + + L ++ + NR     K+G  
Sbjct  96    GNEAKLEGNRLFGNGQYEEALLQYELALQVAPQDVPSSVE-LRSICHFNRGVCFLKLGKY  154

Query  2123  VECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
              + +++C RAL +  +Y KA  RRG+A+  L +FE+AI D+K +L+ + S
Sbjct  155   EDTIKECSRALELNPSYMKALVRRGEAHEKLEHFEEAIADMKKTLEFDPS  204



>ref|XP_011079345.1| PREDICTED: tetratricopeptide repeat protein 1 [Sesamum indicum]
Length=274

 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = -3

Query  2303  ASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLI  2124
             A++ KL GN  F  G Y +AL  Y  A+ ++P + + +E  + +M + NRA+   KMG  
Sbjct  102   ANDAKLEGNSFFKAGQYEEALTKYEFAIHISPDDPSSSE--VRSMCHANRAACFFKMGKY  159

Query  2123  VECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVS  1974
              E +++C +AL +  TY KA  RRG+A   L  +E++I D+   L+++ S
Sbjct  160   EETVKECTKALELNPTYMKALIRRGEAREKLEQYEESIADMTRILELDPS  209



>ref|XP_002175481.1| DNAJ/TPR domain-containing protein DNAJC7 family protein [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB09188.1| DNAJ/TPR domain-containing protein DNAJC7 family protein [Schizosaccharomyces 
japonicus yFS275]
Length=470

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 9/135 (7%)
 Frame = -3

Query  2294  VKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGLIVEC  2115
              K +GN  F  GDY KA   YT AL + P N     K+ +A LY+NRA+ L K+    E 
Sbjct  227   TKSQGNASFKAGDYEKAYQLYTNALEIDPEN-----KDTNAKLYMNRATVLLKLKRPEEA  281

Query  2114  LQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAIQDLKVSLKMEVSLSGKRQIEDELRI  1935
             + D D A+ + STY K +  R KA+  L ++E AI D+K +++++ + +  R   +ELR 
Sbjct  282   IVDSDAAIRLDSTYLKGYKVRAKAHEMLEDWEAAINDIKSAVEIDGTDASLR---NELRR  338

Query  1934  I-LDQHKLKHSSLYK  1893
             + L+  K K    YK
Sbjct  339   LDLELKKSKRKDHYK  353


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 50/99 (51%), Gaps = 7/99 (7%)
 Frame = -3

Query  2306  AASEVKLRGNQCFSGGDYPKALHFYTQALRLAPTNSNDTEKNLSAMLYVNRASALHKMGL  2127
             AA E K RGN+ +  G + +A+ FYT+A+   PT +        A+ Y NRA+A  +MG 
Sbjct  23    AAEEFKARGNEFYKLGSFQEAVEFYTKAIEQGPTANQ-------AIYYSNRAAAYSQMGE  75

Query  2126  IVECLQDCDRALAIFSTYAKAWFRRGKANASLGNFEDAI  2010
                 LQD  R+  +     K   R  +A  S+  + +A+
Sbjct  76    YELALQDARRSDRLAPGVPKTAHRIAQAQESISIYNEAL  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8142878191968