BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18713_g1_i1 len=3190 path=[1:0-900 902:901-2595 2597:2596-3189]

Length=3190
                                                                      Score     E

ref|XP_002512728.1|  ATP-binding cassette transporter, putative        1490   0.0     Ricinus communis
ref|XP_010254260.1|  PREDICTED: pleiotropic drug resistance prote...   1471   0.0     
ref|XP_010254257.1|  PREDICTED: pleiotropic drug resistance prote...   1469   0.0     
ref|XP_007023982.1|  Pleiotropic drug resistance 12                    1467   0.0     
ref|XP_010254258.1|  PREDICTED: pleiotropic drug resistance prote...   1466   0.0     
ref|XP_010654722.1|  PREDICTED: pleiotropic drug resistance prote...   1461   0.0     
emb|CBI36210.3|  unnamed protein product                               1460   0.0     
ref|XP_010249930.1|  PREDICTED: pleiotropic drug resistance prote...   1459   0.0     
ref|XP_002514350.1|  ATP-binding cassette transporter, putative        1456   0.0     Ricinus communis
ref|XP_010910610.1|  PREDICTED: pleiotropic drug resistance prote...   1455   0.0     
ref|XP_011020597.1|  PREDICTED: pleiotropic drug resistance prote...   1455   0.0     
ref|XP_003528365.1|  PREDICTED: pleiotropic drug resistance prote...   1451   0.0     
gb|KCW59814.1|  hypothetical protein EUGRSUZ_H02560                    1445   0.0     
gb|KCW59813.1|  hypothetical protein EUGRSUZ_H02560                    1444   0.0     
ref|XP_010023519.1|  PREDICTED: pleiotropic drug resistance prote...   1444   0.0     
emb|CDO98093.1|  unnamed protein product                               1444   0.0     
ref|XP_010249929.1|  PREDICTED: pleiotropic drug resistance prote...   1443   0.0     
ref|XP_010023520.1|  PREDICTED: pleiotropic drug resistance prote...   1443   0.0     
emb|CBI36209.3|  unnamed protein product                               1442   0.0     
ref|XP_009799503.1|  PREDICTED: pleiotropic drug resistance prote...   1442   0.0     
ref|XP_010023531.1|  PREDICTED: ABC transporter G family member 4...   1442   0.0     
ref|XP_008795450.1|  PREDICTED: pleiotropic drug resistance prote...   1441   0.0     
ref|XP_007013791.1|  Pleiotropic drug resistance 12                    1441   0.0     
ref|XP_010049001.1|  PREDICTED: pleiotropic drug resistance prote...   1441   0.0     
ref|XP_002303856.2|  hypothetical protein POPTR_0003s18140g            1441   0.0     Populus trichocarpa [western balsam poplar]
emb|CAN61934.1|  hypothetical protein VITISV_005227                    1441   0.0     Vitis vinifera
dbj|BAB92011.1|  pleiotropic drug resistance like protein              1441   0.0     Nicotiana tabacum [American tobacco]
emb|CDO98092.1|  unnamed protein product                               1439   0.0     
gb|AGT28053.1|  pleiotropic drug resistance transporter 1              1439   0.0     
gb|KDP36995.1|  hypothetical protein JCGZ_06051                        1439   0.0     
ref|XP_010023530.1|  PREDICTED: ABC transporter G family member 4...   1438   0.0     
ref|XP_010648604.1|  PREDICTED: pleiotropic drug resistance prote...   1438   0.0     
gb|AGT28054.1|  pleiotropic drug resistance transporter 2              1438   0.0     
emb|CAN80954.1|  hypothetical protein VITISV_032205                    1438   0.0     Vitis vinifera
emb|CBI36229.3|  unnamed protein product                               1437   0.0     
gb|KDP37161.1|  hypothetical protein JCGZ_06217                        1436   0.0     
ref|XP_009401806.1|  PREDICTED: pleiotropic drug resistance prote...   1435   0.0     
ref|XP_009370616.1|  PREDICTED: pleiotropic drug resistance prote...   1434   0.0     
dbj|BAO45894.1|  pleiotropic drug resistance ABC transporter           1434   0.0     
ref|XP_009401814.1|  PREDICTED: pleiotropic drug resistance prote...   1433   0.0     
ref|XP_007217658.1|  hypothetical protein PRUPE_ppa000226mg            1433   0.0     
ref|XP_008373552.1|  PREDICTED: pleiotropic drug resistance prote...   1432   0.0     
ref|XP_003546230.1|  PREDICTED: pleiotropic drug resistance prote...   1432   0.0     
ref|XP_009596530.1|  PREDICTED: pleiotropic drug resistance prote...   1432   0.0     
ref|XP_009335239.1|  PREDICTED: pleiotropic drug resistance prote...   1431   0.0     
ref|NP_001288053.1|  ABC transporter-like                              1431   0.0     
ref|XP_008373537.1|  PREDICTED: pleiotropic drug resistance prote...   1430   0.0     
dbj|BAP90384.1|  ATP binding cassette transporter                      1429   0.0     
ref|XP_010254256.1|  PREDICTED: pleiotropic drug resistance prote...   1429   0.0     
ref|XP_008373544.1|  PREDICTED: pleiotropic drug resistance prote...   1429   0.0     
gb|KCW59818.1|  hypothetical protein EUGRSUZ_H02563                    1429   0.0     
gb|KHN22481.1|  Pleiotropic drug resistance protein 1                  1429   0.0     
ref|XP_008358474.1|  PREDICTED: pleiotropic drug resistance prote...   1428   0.0     
ref|XP_008228659.1|  PREDICTED: pleiotropic drug resistance prote...   1427   0.0     
ref|XP_010654718.1|  PREDICTED: pleiotropic drug resistance prote...   1426   0.0     
ref|XP_002514351.1|  ATP-binding cassette transporter, putative        1426   0.0     Ricinus communis
ref|XP_009343426.1|  PREDICTED: pleiotropic drug resistance prote...   1426   0.0     
ref|XP_010023532.1|  PREDICTED: ABC transporter G family member 4...   1425   0.0     
ref|XP_010914974.1|  PREDICTED: pleiotropic drug resistance prote...   1425   0.0     
ref|XP_010654721.1|  PREDICTED: pleiotropic drug resistance prote...   1425   0.0     
ref|XP_010023521.1|  PREDICTED: ABC transporter G family member 4...   1425   0.0     
gb|KDO79586.1|  hypothetical protein CISIN_1g046196mg                  1425   0.0     
ref|XP_004486707.1|  PREDICTED: pleiotropic drug resistance prote...   1425   0.0     
emb|CBI36223.3|  unnamed protein product                               1424   0.0     
ref|XP_002527332.1|  ATP-binding cassette transporter, putative        1424   0.0     Ricinus communis
ref|XP_006476216.1|  PREDICTED: pleiotropic drug resistance prote...   1423   0.0     
emb|CBI36212.3|  unnamed protein product                               1423   0.0     
ref|XP_006465412.1|  PREDICTED: pleiotropic drug resistance prote...   1423   0.0     
ref|XP_006360347.1|  PREDICTED: pleiotropic drug resistance prote...   1422   0.0     
ref|XP_009335238.1|  PREDICTED: pleiotropic drug resistance prote...   1422   0.0     
ref|XP_007150694.1|  hypothetical protein PHAVU_005G173700g            1422   0.0     
ref|XP_002298123.2|  ABC transporter family protein                    1422   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010023529.1|  PREDICTED: ABC transporter G family member 4...   1421   0.0     
ref|XP_004148099.1|  PREDICTED: pleiotropic drug resistance prote...   1421   0.0     
ref|XP_010648603.1|  PREDICTED: pleiotropic drug resistance prote...   1421   0.0     
ref|XP_010023528.1|  PREDICTED: ABC transporter G family member 4...   1420   0.0     
ref|XP_010023527.1|  PREDICTED: ABC transporter G family member 4...   1420   0.0     
gb|KEH23979.1|  drug resistance transporter-like ABC domain protein    1420   0.0     
gb|KDO58233.1|  hypothetical protein CISIN_1g000541mg                  1420   0.0     
ref|XP_006427144.1|  hypothetical protein CICLE_v10024707mg            1420   0.0     
ref|XP_008459146.1|  PREDICTED: pleiotropic drug resistance prote...   1419   0.0     
gb|ACU82515.1|  pleiotropic drug resistance protein                    1419   0.0     Cucumis sativus [cucumbers]
ref|XP_004156752.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...   1419   0.0     
gb|AES81617.2|  drug resistance transporter-like ABC domain protein    1418   0.0     
ref|XP_004506879.1|  PREDICTED: pleiotropic drug resistance prote...   1418   0.0     
ref|XP_008346192.1|  PREDICTED: pleiotropic drug resistance prote...   1418   0.0     
ref|XP_010254261.1|  PREDICTED: pleiotropic drug resistance prote...   1417   0.0     
ref|XP_010023517.1|  PREDICTED: pleiotropic drug resistance prote...   1417   0.0     
ref|XP_004486706.1|  PREDICTED: pleiotropic drug resistance prote...   1417   0.0     
gb|KHN07106.1|  Pleiotropic drug resistance protein 1                  1417   0.0     
ref|XP_010023518.1|  PREDICTED: pleiotropic drug resistance prote...   1417   0.0     
ref|XP_006476215.1|  PREDICTED: pleiotropic drug resistance prote...   1417   0.0     
ref|XP_007135719.1|  hypothetical protein PHAVU_010G152500g            1417   0.0     
ref|XP_003526427.1|  PREDICTED: pleiotropic drug resistance prote...   1417   0.0     
ref|XP_008235577.1|  PREDICTED: pleiotropic drug resistance prote...   1416   0.0     
ref|XP_006465411.1|  PREDICTED: pleiotropic drug resistance prote...   1416   0.0     
ref|XP_006476214.1|  PREDICTED: pleiotropic drug resistance prote...   1416   0.0     
ref|XP_004247841.1|  PREDICTED: pleiotropic drug resistance prote...   1416   0.0     
ref|XP_003546218.1|  PREDICTED: pleiotropic drug resistance prote...   1416   0.0     
ref|XP_003597818.1|  Pleiotropic drug resistance protein               1416   0.0     
gb|AIU41654.1|  ABC transporter family protein                         1415   0.0     
ref|XP_003543663.1|  PREDICTED: pleiotropic drug resistance prote...   1415   0.0     
ref|XP_011081908.1|  PREDICTED: pleiotropic drug resistance prote...   1415   0.0     
ref|XP_010654715.1|  PREDICTED: pleiotropic drug resistance prote...   1415   0.0     
ref|XP_010254262.1|  PREDICTED: pleiotropic drug resistance prote...   1415   0.0     
ref|XP_006366078.1|  PREDICTED: pleiotropic drug resistance prote...   1415   0.0     
gb|KCW59823.1|  hypothetical protein EUGRSUZ_H02569                    1414   0.0     
gb|KHN09389.1|  Pleiotropic drug resistance protein 1                  1414   0.0     
gb|KHN44144.1|  Pleiotropic drug resistance protein 1                  1413   0.0     
gb|KHN22480.1|  Pleiotropic drug resistance protein 1                  1413   0.0     
gb|KDP36996.1|  hypothetical protein JCGZ_06052                        1413   0.0     
ref|XP_011072269.1|  PREDICTED: pleiotropic drug resistance prote...   1413   0.0     
gb|KDO58225.1|  hypothetical protein CISIN_1g000540mg                  1412   0.0     
ref|XP_006450535.1|  hypothetical protein CICLE_v10010431mg            1411   0.0     
ref|XP_009781738.1|  PREDICTED: pleiotropic drug resistance prote...   1411   0.0     
ref|XP_009589545.1|  PREDICTED: pleiotropic drug resistance prote...   1410   0.0     
gb|KEH28743.1|  drug resistance transporter-like ABC domain protein    1410   0.0     
gb|KCW53776.1|  hypothetical protein EUGRSUZ_J03025                    1410   0.0     
ref|XP_006465418.1|  PREDICTED: pleiotropic drug resistance prote...   1410   0.0     
ref|XP_004239864.1|  PREDICTED: pleiotropic drug resistance prote...   1410   0.0     
ref|XP_003597816.1|  Pleiotropic drug resistance protein               1410   0.0     
ref|XP_004245225.1|  PREDICTED: pleiotropic drug resistance prote...   1409   0.0     
emb|CBI36227.3|  unnamed protein product                               1409   0.0     
gb|AES68067.2|  drug resistance transporter-like ABC domain protein    1409   0.0     
emb|CDP04827.1|  unnamed protein product                               1408   0.0     
ref|XP_011012297.1|  PREDICTED: pleiotropic drug resistance prote...   1408   0.0     
gb|KDO58232.1|  hypothetical protein CISIN_1g047682mg                  1408   0.0     
ref|XP_011034492.1|  PREDICTED: pleiotropic drug resistance prote...   1407   0.0     
ref|XP_008445146.1|  PREDICTED: pleiotropic drug resistance prote...   1407   0.0     
ref|XP_010033906.1|  PREDICTED: pleiotropic drug resistance prote...   1407   0.0     
ref|XP_010537955.1|  PREDICTED: ABC transporter G family member 4...   1407   0.0     
ref|XP_004289998.1|  PREDICTED: pleiotropic drug resistance prote...   1407   0.0     
ref|XP_009775073.1|  PREDICTED: pleiotropic drug resistance prote...   1406   0.0     
gb|EYU21929.1|  hypothetical protein MIMGU_mgv1a023987mg               1406   0.0     
emb|CAN77690.1|  hypothetical protein VITISV_022715                    1406   0.0     Vitis vinifera
ref|XP_010654716.1|  PREDICTED: pleiotropic drug resistance prote...   1405   0.0     
gb|KCW53803.1|  hypothetical protein EUGRSUZ_J03046                    1405   0.0     
gb|KDP36998.1|  hypothetical protein JCGZ_06054                        1405   0.0     
ref|XP_002527330.1|  ATP-binding cassette transporter, putative        1405   0.0     Ricinus communis
ref|XP_004501294.1|  PREDICTED: pleiotropic drug resistance prote...   1405   0.0     
gb|KCW59811.1|  hypothetical protein EUGRSUZ_H02558                    1405   0.0     
ref|XP_006368914.1|  hypothetical protein POPTR_0001s14650g            1404   0.0     
ref|XP_009616095.1|  PREDICTED: pleiotropic drug resistance prote...   1404   0.0     
gb|AFA43815.1|  ABCG/PDR subfamily ABC transporter                     1403   0.0     
gb|AFA43816.1|  ABCG/PDR subfamily ABC protein                         1403   0.0     
gb|AES81579.2|  drug resistance transporter-like ABC domain protein    1402   0.0     
ref|XP_002297807.2|  hypothetical protein POPTR_0001s14660g            1402   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010249928.1|  PREDICTED: putative pleiotropic drug resista...   1401   0.0     
ref|XP_006576269.1|  PREDICTED: PDR-like ABC-transporter isoform X1    1401   0.0     
ref|XP_010033935.1|  PREDICTED: pleiotropic drug resistance prote...   1401   0.0     
ref|XP_004291476.1|  PREDICTED: pleiotropic drug resistance prote...   1399   0.0     
ref|XP_004138743.1|  PREDICTED: pleiotropic drug resistance prote...   1399   0.0     
ref|XP_010691233.1|  PREDICTED: pleiotropic drug resistance prote...   1399   0.0     
ref|XP_002528564.1|  ATP-binding cassette transporter, putative        1399   0.0     Ricinus communis
ref|XP_011082577.1|  PREDICTED: pleiotropic drug resistance prote...   1399   0.0     
ref|XP_009799502.1|  PREDICTED: pleiotropic drug resistance prote...   1398   0.0     
ref|XP_007137056.1|  hypothetical protein PHAVU_009G096200g            1398   0.0     
gb|KGN62906.1|  hypothetical protein Csa_2G379370                      1397   0.0     
ref|XP_003625398.1|  Pleiotropic drug resistance protein               1397   0.0     
gb|KDO58223.1|  hypothetical protein CISIN_1g000524mg                  1397   0.0     
ref|XP_011081963.1|  PREDICTED: pleiotropic drug resistance prote...   1396   0.0     
gb|KCW59822.1|  hypothetical protein EUGRSUZ_H02568                    1396   0.0     
ref|XP_006427136.1|  hypothetical protein CICLE_v10024709mg            1396   0.0     
ref|XP_007162608.1|  hypothetical protein PHAVU_001G165700g            1395   0.0     
ref|XP_009619611.1|  PREDICTED: pleiotropic drug resistance prote...   1395   0.0     
gb|KEH28744.1|  drug resistance transporter-like ABC domain protein    1395   0.0     
gb|KDP36994.1|  hypothetical protein JCGZ_06050                        1395   0.0     
ref|XP_006366077.1|  PREDICTED: pleiotropic drug resistance prote...   1395   0.0     
ref|XP_008394025.1|  PREDICTED: pleiotropic drug resistance prote...   1394   0.0     
emb|CDP04826.1|  unnamed protein product                               1394   0.0     
gb|KDO58219.1|  hypothetical protein CISIN_1g000512mg                  1392   0.0     
ref|XP_004245224.1|  PREDICTED: pleiotropic drug resistance prote...   1392   0.0     
ref|XP_011082498.1|  PREDICTED: pleiotropic drug resistance prote...   1392   0.0     
ref|XP_011020655.1|  PREDICTED: pleiotropic drug resistance prote...   1392   0.0     
ref|XP_009416092.1|  PREDICTED: pleiotropic drug resistance prote...   1392   0.0     
gb|KDO58220.1|  hypothetical protein CISIN_1g000512mg                  1392   0.0     
gb|AES81619.2|  drug resistance transporter-like ABC domain protein    1391   0.0     
ref|XP_006465417.1|  PREDICTED: pleiotropic drug resistance prote...   1391   0.0     
gb|KDP33642.1|  hypothetical protein JCGZ_07213                        1390   0.0     
ref|XP_010102805.1|  Pleiotropic drug resistance protein 1             1390   0.0     
ref|XP_002529327.1|  ATP-binding cassette transporter, putative        1390   0.0     Ricinus communis
gb|KDO58227.1|  hypothetical protein CISIN_1g000529mg                  1389   0.0     
ref|XP_010916538.1|  PREDICTED: pleiotropic drug resistance prote...   1389   0.0     
ref|XP_010654719.1|  PREDICTED: pleiotropic drug resistance prote...   1389   0.0     
ref|XP_008219880.1|  PREDICTED: putative pleiotropic drug resista...   1389   0.0     
ref|XP_006360348.1|  PREDICTED: pleiotropic drug resistance prote...   1389   0.0     
ref|XP_007200339.1|  hypothetical protein PRUPE_ppa000227mg            1389   0.0     
gb|KDO58217.1|  hypothetical protein CISIN_1g000512mg                  1389   0.0     
ref|XP_006465512.1|  PREDICTED: pleiotropic drug resistance prote...   1389   0.0     
ref|XP_010033933.1|  PREDICTED: pleiotropic drug resistance prote...   1388   0.0     
gb|KCW53777.1|  hypothetical protein EUGRSUZ_J03025                    1388   0.0     
ref|XP_002324840.1|  hypothetical protein POPTR_0018s01240g            1388   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009407444.1|  PREDICTED: pleiotropic drug resistance prote...   1387   0.0     
gb|KDO58218.1|  hypothetical protein CISIN_1g000512mg                  1387   0.0     
ref|XP_006465416.1|  PREDICTED: pleiotropic drug resistance prote...   1387   0.0     
ref|XP_006427138.1|  hypothetical protein CICLE_v10024710mg            1387   0.0     
ref|XP_010061953.1|  PREDICTED: pleiotropic drug resistance prote...   1387   0.0     
ref|XP_008392128.1|  PREDICTED: pleiotropic drug resistance prote...   1387   0.0     
gb|KDO58216.1|  hypothetical protein CISIN_1g000512mg                  1387   0.0     
gb|KDO58212.1|  hypothetical protein CISIN_1g000512mg                  1387   0.0     
gb|KCW81449.1|  hypothetical protein EUGRSUZ_C02834                    1387   0.0     
ref|XP_010061954.1|  PREDICTED: pleiotropic drug resistance prote...   1386   0.0     
gb|AES81616.2|  drug resistance transporter-like ABC domain protein    1386   0.0     
ref|XP_006427139.1|  hypothetical protein CICLE_v10024710mg            1386   0.0     
ref|XP_004148018.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...   1386   0.0     
ref|XP_010061952.1|  PREDICTED: pleiotropic drug resistance prote...   1386   0.0     
gb|KDO58226.1|  hypothetical protein CISIN_1g000529mg                  1385   0.0     
ref|XP_006427140.1|  hypothetical protein CICLE_v10024710mg            1385   0.0     
ref|XP_007023992.1|  Pleiotropic drug resistance 12 isoform 3          1385   0.0     
ref|XP_009779532.1|  PREDICTED: pleiotropic drug resistance prote...   1384   0.0     
ref|XP_009334795.1|  PREDICTED: pleiotropic drug resistance prote...   1384   0.0     
gb|KDO58213.1|  hypothetical protein CISIN_1g000512mg                  1384   0.0     
ref|XP_010049003.1|  PREDICTED: pleiotropic drug resistance prote...   1384   0.0     
ref|XP_008361068.1|  PREDICTED: pleiotropic drug resistance prote...   1384   0.0     
gb|KEH23973.1|  drug resistance transporter-like ABC domain protein    1384   0.0     
sp|Q949G3.1|PDR1_NICPL  RecName: Full=Pleiotropic drug resistance...   1384   0.0     Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002297806.2|  hypothetical protein POPTR_0001s14620g            1384   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009415905.1|  PREDICTED: pleiotropic drug resistance prote...   1384   0.0     
ref|XP_006597138.1|  PREDICTED: pleiotropic drug resistance prote...   1384   0.0     
ref|XP_003625361.1|  Pleiotropic drug resistance protein               1384   0.0     
gb|KHN08104.1|  Pleiotropic drug resistance protein 1                  1383   0.0     
gb|KGN58140.1|  hypothetical protein Csa_3G550680                      1383   0.0     
gb|KEH28742.1|  drug resistance transporter-like ABC domain protein    1383   0.0     
ref|XP_010099662.1|  Pleiotropic drug resistance protein 1             1383   0.0     
ref|XP_002304712.2|  hypothetical protein POPTR_0003s17730g            1382   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011019747.1|  PREDICTED: pleiotropic drug resistance prote...   1382   0.0     
ref|XP_010033905.1|  PREDICTED: ABC transporter G family member 4...   1382   0.0     
gb|KDO58231.1|  hypothetical protein CISIN_1g000576mg                  1381   0.0     
ref|XP_006465419.1|  PREDICTED: pleiotropic drug resistance prote...   1381   0.0     
ref|XP_007227084.1|  hypothetical protein PRUPE_ppa000234mg            1381   0.0     
ref|XP_007023990.1|  Pleiotropic drug resistance 12 isoform 1          1380   0.0     
ref|XP_010061955.1|  PREDICTED: pleiotropic drug resistance prote...   1380   0.0     
gb|AES81581.2|  drug resistance transporter-like ABC domain protein    1380   0.0     
ref|XP_010110323.1|  Pleiotropic drug resistance protein 1             1380   0.0     
ref|XP_006365806.1|  PREDICTED: pleiotropic drug resistance prote...   1380   0.0     
ref|XP_007013787.1|  Pleiotropic drug resistance 12                    1380   0.0     
ref|XP_009415904.1|  PREDICTED: pleiotropic drug resistance prote...   1379   0.0     
ref|XP_010033934.1|  PREDICTED: pleiotropic drug resistance prote...   1379   0.0     
ref|XP_003625401.1|  Pleiotropic drug resistance protein               1379   0.0     
gb|KHN22479.1|  Pleiotropic drug resistance protein 1                  1379   0.0     
ref|XP_009334794.1|  PREDICTED: pleiotropic drug resistance prote...   1378   0.0     
ref|XP_008775867.1|  PREDICTED: pleiotropic drug resistance prote...   1378   0.0     
gb|AES81585.2|  drug resistance transporter-like ABC domain protein    1378   0.0     
ref|XP_002309596.1|  hypothetical protein POPTR_0006s26460g            1378   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006441387.1|  hypothetical protein CICLE_v10018487mg            1377   0.0     
ref|XP_010654717.1|  PREDICTED: pleiotropic drug resistance prote...   1377   0.0     
ref|XP_010925283.1|  PREDICTED: putative pleiotropic drug resista...   1377   0.0     
ref|XP_010914975.1|  PREDICTED: putative pleiotropic drug resista...   1376   0.0     
ref|XP_008228623.1|  PREDICTED: pleiotropic drug resistance prote...   1376   0.0     
ref|XP_007150693.1|  hypothetical protein PHAVU_005G173600g            1376   0.0     
ref|XP_002527329.1|  ATP-binding cassette transporter, putative        1375   0.0     Ricinus communis
ref|NP_173005.1|  ABC transporter G family member 40                   1374   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AGT28055.1|  pleiotropic drug resistance transporter 3              1374   0.0     
gb|EYU29215.1|  hypothetical protein MIMGU_mgv1a018488mg               1373   0.0     
ref|XP_006466163.1|  PREDICTED: pleiotropic drug resistance prote...   1373   0.0     
ref|XP_004252847.1|  PREDICTED: pleiotropic drug resistance prote...   1373   0.0     
gb|KCW81450.1|  hypothetical protein EUGRSUZ_C02835                    1373   0.0     
ref|XP_006427145.1|  hypothetical protein CICLE_v10024697mg            1373   0.0     
ref|XP_004253003.1|  PREDICTED: pleiotropic drug resistance prote...   1372   0.0     
ref|XP_004247842.1|  PREDICTED: pleiotropic drug resistance prote...   1372   0.0     
ref|XP_008785597.1|  PREDICTED: putative pleiotropic drug resista...   1371   0.0     
ref|XP_003597819.1|  Pleiotropic drug resistance protein               1371   0.0     
ref|XP_007217092.1|  hypothetical protein PRUPE_ppa000231mg            1370   0.0     
ref|XP_004493880.1|  PREDICTED: pleiotropic drug resistance prote...   1370   0.0     
ref|XP_004239866.1|  PREDICTED: pleiotropic drug resistance prote...   1370   0.0     
ref|XP_009385804.1|  PREDICTED: putative pleiotropic drug resista...   1369   0.0     
emb|CBI36226.3|  unnamed protein product                               1369   0.0     
sp|Q8GU88.1|PDR7_ORYSJ  RecName: Full=Putative pleiotropic drug r...   1369   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010532150.1|  PREDICTED: ABC transporter G family member 4...   1368   0.0     
ref|XP_010532149.1|  PREDICTED: ABC transporter G family member 4...   1368   0.0     
emb|CDY36570.1|  BnaA06g10230D                                         1368   0.0     
emb|CBI36213.3|  unnamed protein product                               1367   0.0     
ref|XP_008377598.1|  PREDICTED: pleiotropic drug resistance prote...   1367   0.0     
ref|XP_010110325.1|  Pleiotropic drug resistance protein 1             1367   0.0     
ref|XP_006465413.1|  PREDICTED: pleiotropic drug resistance prote...   1367   0.0     
ref|XP_009148948.1|  PREDICTED: ABC transporter G family member 40     1367   0.0     
ref|XP_004239865.1|  PREDICTED: pleiotropic drug resistance prote...   1367   0.0     
ref|XP_006427133.1|  hypothetical protein CICLE_v10027224mg            1366   0.0     
ref|XP_006306599.1|  hypothetical protein CARUB_v10008103mg            1366   0.0     
ref|XP_002297805.2|  hypothetical protein POPTR_0001s14630g            1365   0.0     
gb|EEC72716.1|  hypothetical protein OsI_06321                         1365   0.0     
ref|XP_006349934.1|  PREDICTED: pleiotropic drug resistance prote...   1365   0.0     
ref|XP_007226604.1|  hypothetical protein PRUPE_ppa023430mg            1365   0.0     
ref|XP_010026664.1|  PREDICTED: pleiotropic drug resistance prote...   1364   0.0     
ref|XP_004498643.1|  PREDICTED: pleiotropic drug resistance prote...   1364   0.0     
gb|EMS67534.1|  Pleiotropic drug resistance protein 4                  1364   0.0     
sp|Q8GU89.1|PDR4_ORYSJ  RecName: Full=Pleiotropic drug resistance...   1363   0.0     
gb|KDO58224.1|  hypothetical protein CISIN_1g000524mg                  1363   0.0     
gb|EEE56535.1|  hypothetical protein OsJ_05840                         1363   0.0     
gb|EYU29216.1|  hypothetical protein MIMGU_mgv1a000208mg               1363   0.0     
ref|XP_006644354.1|  PREDICTED: pleiotropic drug resistance prote...   1363   0.0     
ref|XP_006601131.1|  PREDICTED: putative pleiotropic drug resista...   1363   0.0     
gb|EAY74922.1|  hypothetical protein OsI_02816                         1363   0.0     
ref|XP_006416897.1|  hypothetical protein EUTSA_v10006564mg            1362   0.0     
ref|XP_006427135.1|  hypothetical protein CICLE_v10024711mg            1362   0.0     
gb|KFK43809.1|  hypothetical protein AALP_AA1G175900                   1361   0.0     
ref|XP_002514347.1|  ATP-binding cassette transporter, putative        1361   0.0     
emb|CAN83563.1|  hypothetical protein VITISV_025401                    1361   0.0     
ref|XP_007162609.1|  hypothetical protein PHAVU_001G165800g            1360   0.0     
ref|XP_004969126.1|  PREDICTED: pleiotropic drug resistance prote...   1360   0.0     
ref|XP_004969127.1|  PREDICTED: pleiotropic drug resistance prote...   1360   0.0     
ref|XP_010459091.1|  PREDICTED: ABC transporter G family member 4...   1360   0.0     
ref|XP_004239867.2|  PREDICTED: pleiotropic drug resistance prote...   1360   0.0     
ref|XP_010459089.1|  PREDICTED: ABC transporter G family member 4...   1359   0.0     
ref|XP_006427142.1|  hypothetical protein CICLE_v10027401mg            1359   0.0     
gb|KHN45207.1|  Pleiotropic drug resistance protein 1                  1358   0.0     
gb|KDO58222.1|  hypothetical protein CISIN_1g000524mg                  1358   0.0     
ref|XP_003553514.1|  PREDICTED: pleiotropic drug resistance prote...   1358   0.0     
ref|XP_002892871.1|  ATPDR12/PDR12                                     1358   0.0     
emb|CDY39660.1|  BnaC05g11890D                                         1357   0.0     
ref|XP_006647060.1|  PREDICTED: putative pleiotropic drug resista...   1357   0.0     
ref|XP_004951497.1|  PREDICTED: putative pleiotropic drug resista...   1357   0.0     
ref|NP_001274820.1|  pleiotropic drug resistance protein 1-like        1356   0.0     
gb|KHN02456.1|  Pleiotropic drug resistance protein 1                  1355   0.0     
ref|XP_010648606.1|  PREDICTED: pleiotropic drug resistance prote...   1355   0.0     
ref|XP_010497221.1|  PREDICTED: ABC transporter G family member 4...   1355   0.0     
ref|XP_011072266.1|  PREDICTED: pleiotropic drug resistance prote...   1354   0.0     
gb|AES81621.2|  drug resistance transporter-like ABC domain protein    1354   0.0     
ref|XP_002304711.2|  hypothetical protein POPTR_0003s17730g            1354   0.0     
ref|XP_008656640.1|  PREDICTED: pleiotropic drug resistance prote...   1354   0.0     
ref|XP_003569331.1|  PREDICTED: pleiotropic drug resistance prote...   1354   0.0     
ref|XP_002451754.1|  hypothetical protein SORBIDRAFT_04g007270         1354   0.0     
ref|XP_006427134.1|  hypothetical protein CICLE_v10024711mg            1353   0.0     
ref|XP_004506880.1|  PREDICTED: pleiotropic drug resistance prote...   1353   0.0     
ref|XP_007162618.1|  hypothetical protein PHAVU_001G166300g            1353   0.0     
ref|XP_002451753.1|  hypothetical protein SORBIDRAFT_04g007260         1350   0.0     
ref|XP_009399772.1|  PREDICTED: putative pleiotropic drug resista...   1350   0.0     
emb|CDP04832.1|  unnamed protein product                               1350   0.0     
sp|O24367.1|TUR2_SPIPO  RecName: Full=Pleiotropic drug resistance...   1350   0.0     
dbj|BAK02890.1|  predicted protein                                     1350   0.0     
ref|XP_002458139.1|  hypothetical protein SORBIDRAFT_03g027510         1350   0.0     
ref|XP_006576968.1|  PREDICTED: pleiotropic drug resistance prote...   1348   0.0     
ref|XP_003569329.1|  PREDICTED: pleiotropic drug resistance prote...   1348   0.0     
gb|KCW59817.1|  hypothetical protein EUGRSUZ_H02562                    1347   0.0     
gb|KHN09391.1|  Pleiotropic drug resistance protein 1                  1347   0.0     
ref|XP_003625403.1|  Pleiotropic drug resistance protein               1347   0.0     
ref|XP_004969129.1|  PREDICTED: pleiotropic drug resistance prote...   1346   0.0     
ref|XP_004969128.1|  PREDICTED: pleiotropic drug resistance prote...   1346   0.0     
ref|NP_001237697.1|  PDR-like ABC-transporter                          1345   0.0     
ref|XP_002514348.1|  ATP-binding cassette transporter, putative        1345   0.0     
ref|XP_004969123.1|  PREDICTED: probable pleiotropic drug resista...   1345   0.0     
ref|XP_006604517.1|  PREDICTED: pleiotropic drug resistance prote...   1344   0.0     
ref|XP_008679861.1|  PREDICTED: putative pleiotropic drug resista...   1344   0.0     
gb|KHG17289.1|  Pleiotropic drug resistance 1                          1343   0.0     
ref|XP_006644353.1|  PREDICTED: probable pleiotropic drug resista...   1341   0.0     
ref|XP_007161247.1|  hypothetical protein PHAVU_001G054400g            1341   0.0     
ref|XP_002458137.1|  hypothetical protein SORBIDRAFT_03g027490         1340   0.0     
gb|AES58950.2|  ABC-2 and plant PDR ABC-type transporter family p...   1339   0.0     
gb|AES81623.2|  drug resistance transporter-like ABC domain protein    1339   0.0     
ref|XP_003545503.1|  PREDICTED: pleiotropic drug resistance prote...   1339   0.0     
ref|XP_008656641.1|  PREDICTED: pleiotropic drug resistance prote...   1339   0.0     
ref|XP_011072267.1|  PREDICTED: pleiotropic drug resistance prote...   1338   0.0     
ref|XP_006465421.1|  PREDICTED: pleiotropic drug resistance prote...   1338   0.0     
emb|CAN74185.1|  hypothetical protein VITISV_001190                    1338   0.0     
emb|CDM83155.1|  unnamed protein product                               1337   0.0     
gb|EYU35725.1|  hypothetical protein MIMGU_mgv1a000224mg               1337   0.0     
ref|XP_010476642.1|  PREDICTED: ABC transporter G family member 4...   1335   0.0     
ref|XP_010234020.1|  PREDICTED: putative pleiotropic drug resista...   1335   0.0     
ref|XP_007201767.1|  hypothetical protein PRUPE_ppa000267mg            1335   0.0     
ref|XP_003588699.1|  Pleiotropic drug resistance ABC transporter ...   1333   0.0     
gb|KHG28138.1|  Pleiotropic drug resistance 1                          1332   0.0     
ref|XP_006596115.1|  PREDICTED: pleiotropic drug resistance prote...   1332   0.0     
ref|XP_004969125.1|  PREDICTED: pleiotropic drug resistance prote...   1332   0.0     
ref|XP_006596116.1|  PREDICTED: pleiotropic drug resistance prote...   1332   0.0     
ref|XP_004252846.1|  PREDICTED: pleiotropic drug resistance prote...   1328   0.0     
gb|KHN12917.1|  Pleiotropic drug resistance protein 1                  1326   0.0     
ref|NP_001043539.1|  Os01g0609300                                      1326   0.0     
ref|XP_004291477.1|  PREDICTED: pleiotropic drug resistance prote...   1326   0.0     
ref|XP_002458135.1|  hypothetical protein SORBIDRAFT_03g027460         1325   0.0     
gb|AAQ02685.1|  PDR-type ABC transporter 9                             1325   0.0     
gb|AFW83220.1|  hypothetical protein ZEAMMB73_049092                   1325   0.0     
sp|A2WSH0.1|PDR3_ORYSI  RecName: Full=Pleiotropic drug resistance...   1325   0.0     
ref|XP_008461059.1|  PREDICTED: pleiotropic drug resistance prote...   1323   0.0     
ref|XP_007162620.1|  hypothetical protein PHAVU_001G166500g            1323   0.0     
ref|XP_008675479.1|  PREDICTED: pleiotropic drug resistance prote...   1322   0.0     
ref|NP_001043538.1|  Os01g0609200                                      1322   0.0     
sp|Q8GU92.1|PDR2_ORYSJ  RecName: Full=Probable pleiotropic drug r...   1321   0.0     
ref|XP_007023821.1|  Pleiotropic drug resistance 12                    1321   0.0     
ref|XP_004135831.1|  PREDICTED: pleiotropic drug resistance prote...   1319   0.0     
gb|EEE54967.1|  hypothetical protein OsJ_02559                         1318   0.0     
gb|EMT06883.1|  Pleiotropic drug resistance protein 4                  1318   0.0     
gb|KGN45317.1|  hypothetical protein Csa_7G433950                      1317   0.0     
ref|XP_006646084.1|  PREDICTED: pleiotropic drug resistance prote...   1317   0.0     
emb|CAD59567.1|  PDR-like ABC transporter                              1317   0.0     
tpg|DAA58928.1|  TPA: hypothetical protein ZEAMMB73_427923             1317   0.0     
sp|Q7PC80.1|PDR1_ORYSJ  RecName: Full=Probable pleiotropic drug r...   1317   0.0     
ref|XP_008235761.1|  PREDICTED: pleiotropic drug resistance prote...   1317   0.0     
ref|XP_003625405.1|  Pleiotropic drug resistance protein               1317   0.0     
ref|NP_001172460.1|  Os01g0609066                                      1317   0.0     
ref|XP_006427141.1|  hypothetical protein CICLE_v10027430mg            1316   0.0     
ref|XP_010670733.1|  PREDICTED: pleiotropic drug resistance prote...   1316   0.0     
ref|XP_004158765.1|  PREDICTED: pleiotropic drug resistance prote...   1316   0.0     
ref|XP_003566865.1|  PREDICTED: pleiotropic drug resistance prote...   1315   0.0     
ref|XP_002458140.1|  hypothetical protein SORBIDRAFT_03g027520         1315   0.0     
emb|CAN63107.1|  hypothetical protein VITISV_025103                    1315   0.0     
ref|XP_006427137.1|  hypothetical protein CICLE_v10024715mg            1314   0.0     
ref|XP_008447485.1|  PREDICTED: pleiotropic drug resistance prote...   1313   0.0     
ref|XP_010102803.1|  Pleiotropic drug resistance protein 1             1313   0.0     
ref|NP_001042955.1|  Os01g0342700                                      1313   0.0     
gb|KDO58228.1|  hypothetical protein CISIN_1g038815mg                  1312   0.0     
ref|XP_007162612.1|  hypothetical protein PHAVU_001G166000g            1311   0.0     
ref|XP_004493881.1|  PREDICTED: pleiotropic drug resistance prote...   1311   0.0     
ref|XP_004956368.1|  PREDICTED: pleiotropic drug resistance prote...   1310   0.0     
gb|EPS67051.1|  hypothetical protein M569_07724                        1308   0.0     
ref|NP_001043541.1|  Os01g0609900                                      1307   0.0     
ref|XP_009347962.1|  PREDICTED: pleiotropic drug resistance prote...   1306   0.0     
ref|XP_008377599.1|  PREDICTED: pleiotropic drug resistance prote...   1305   0.0     
gb|EYU21586.1|  hypothetical protein MIMGU_mgv1a000211mg               1305   0.0     
gb|EMS67193.1|  Pleiotropic drug resistance protein 4                  1305   0.0     
gb|EEE54507.1|  hypothetical protein OsJ_01646                         1304   0.0     
ref|XP_006466162.1|  PREDICTED: pleiotropic drug resistance prote...   1302   0.0     
ref|XP_006465513.1|  PREDICTED: pleiotropic drug resistance prote...   1300   0.0     
ref|XP_009619822.1|  PREDICTED: pleiotropic drug resistance prote...   1299   0.0     
dbj|BAK01114.1|  predicted protein                                     1298   0.0     
gb|KHN15512.1|  Pleiotropic drug resistance protein 1                  1296   0.0     
ref|XP_006465414.1|  PREDICTED: pleiotropic drug resistance prote...   1296   0.0     
ref|XP_007199068.1|  hypothetical protein PRUPE_ppa018716mg            1294   0.0     
ref|XP_002458133.1|  hypothetical protein SORBIDRAFT_03g027440         1292   0.0     
ref|XP_002462387.1|  hypothetical protein SORBIDRAFT_02g024840         1292   0.0     
gb|EAY74913.1|  hypothetical protein OsI_02806                         1292   0.0     
ref|XP_008219879.1|  PREDICTED: pleiotropic drug resistance prote...   1291   0.0     
ref|XP_008219877.1|  PREDICTED: pleiotropic drug resistance prote...   1291   0.0     
ref|XP_008219878.1|  PREDICTED: pleiotropic drug resistance prote...   1290   0.0     
dbj|BAD05827.1|  putative PDR-like ABC transporter                     1290   0.0     
ref|XP_006441386.1|  hypothetical protein CICLE_v10024468mg            1290   0.0     
ref|XP_007225462.1|  hypothetical protein PRUPE_ppa000256mg            1290   0.0     
ref|XP_007161249.1|  hypothetical protein PHAVU_001G054500g            1289   0.0     
ref|XP_004956611.1|  PREDICTED: pleiotropic drug resistance prote...   1289   0.0     
ref|XP_008242858.1|  PREDICTED: pleiotropic drug resistance prote...   1288   0.0     
gb|EMT16838.1|  Putative pleiotropic drug resistance protein 7         1288   0.0     
gb|EMS61936.1|  Pleiotropic drug resistance protein 4                  1285   0.0     
ref|XP_002451110.1|  hypothetical protein SORBIDRAFT_05g024240         1283   0.0     
gb|EMT16485.1|  Pleiotropic drug resistance protein 4                  1283   0.0     
dbj|BAD52527.1|  putative PDR-type ABC transporter 2                   1281   0.0     
gb|EAZ44307.1|  hypothetical protein OsJ_28928                         1278   0.0     
gb|KHG24038.1|  Pleiotropic drug resistance 1                          1278   0.0     
gb|EEC84379.1|  hypothetical protein OsI_30931                         1278   0.0     
gb|EMT16409.1|  Pleiotropic drug resistance protein 4                  1275   0.0     
emb|CBI20980.3|  unnamed protein product                               1273   0.0     
ref|XP_010238072.1|  PREDICTED: pleiotropic drug resistance prote...   1273   0.0     
ref|XP_006601130.1|  PREDICTED: pleiotropic drug resistance prote...   1272   0.0     
ref|XP_003574423.1|  PREDICTED: pleiotropic drug resistance prote...   1271   0.0     
ref|XP_007216250.1|  hypothetical protein PRUPE_ppa017081mg            1268   0.0     
dbj|BAJ99663.1|  predicted protein                                     1266   0.0     
ref|XP_008652578.1|  PREDICTED: pleiotropic drug resistance prote...   1264   0.0     
ref|XP_006652070.1|  PREDICTED: probable pleiotropic drug resista...   1264   0.0     
gb|AFW60393.1|  hypothetical protein ZEAMMB73_326542                   1264   0.0     
ref|XP_008677970.1|  PREDICTED: putative pleiotropic drug resista...   1263   0.0     
ref|XP_002458132.1|  hypothetical protein SORBIDRAFT_03g027430         1263   0.0     
ref|XP_004300718.1|  PREDICTED: pleiotropic drug resistance prote...   1263   0.0     
ref|XP_008652577.1|  PREDICTED: pleiotropic drug resistance prote...   1262   0.0     
ref|XP_004493879.1|  PREDICTED: pleiotropic drug resistance prote...   1260   0.0     
ref|XP_009364039.1|  PREDICTED: pleiotropic drug resistance prote...   1259   0.0     
ref|XP_008389930.1|  PREDICTED: pleiotropic drug resistance prote...   1258   0.0     
ref|XP_002462237.1|  hypothetical protein SORBIDRAFT_02g022270         1255   0.0     
ref|XP_007204684.1|  hypothetical protein PRUPE_ppa000258mg            1253   0.0     
ref|XP_003588698.1|  Pleiotropic drug resistance protein               1252   0.0     
ref|XP_010244003.1|  PREDICTED: pleiotropic drug resistance prote...   1249   0.0     
ref|XP_010244008.1|  PREDICTED: pleiotropic drug resistance prote...   1248   0.0     
emb|CDM86331.1|  unnamed protein product                               1248   0.0     
ref|XP_010656385.1|  PREDICTED: pleiotropic drug resistance prote...   1248   0.0     
ref|XP_004498642.1|  PREDICTED: pleiotropic drug resistance prote...   1248   0.0     
ref|XP_004498641.1|  PREDICTED: pleiotropic drug resistance prote...   1247   0.0     
ref|XP_006481824.1|  PREDICTED: ABC transporter G family member 3...   1246   0.0     
ref|XP_006430268.1|  hypothetical protein CICLE_v10010902mg            1245   0.0     
ref|XP_009780354.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...   1244   0.0     
ref|XP_006348041.1|  PREDICTED: pleiotropic drug resistance prote...   1243   0.0     
ref|XP_010242632.1|  PREDICTED: pleiotropic drug resistance prote...   1243   0.0     
ref|XP_010273226.1|  PREDICTED: pleiotropic drug resistance prote...   1242   0.0     
ref|XP_004494154.1|  PREDICTED: ABC transporter G family member 3...   1242   0.0     
ref|XP_010654053.1|  PREDICTED: pleiotropic drug resistance prote...   1241   0.0     
gb|KCW89230.1|  hypothetical protein EUGRSUZ_A01530                    1241   0.0     
gb|KCW89231.1|  hypothetical protein EUGRSUZ_A01530                    1241   0.0     
ref|XP_009364871.1|  PREDICTED: pleiotropic drug resistance prote...   1240   0.0     
ref|XP_008360420.1|  PREDICTED: pleiotropic drug resistance prote...   1239   0.0     
ref|XP_011032821.1|  PREDICTED: pleiotropic drug resistance prote...   1238   0.0     
ref|XP_008349787.1|  PREDICTED: pleiotropic drug resistance prote...   1238   0.0     
ref|XP_006829656.1|  hypothetical protein AMTR_s00122p00119310         1238   0.0     
ref|XP_011088856.1|  PREDICTED: pleiotropic drug resistance prote...   1236   0.0     
ref|XP_010049726.1|  PREDICTED: pleiotropic drug resistance prote...   1236   0.0     
gb|KCW53772.1|  hypothetical protein EUGRSUZ_J030242                   1236   0.0     
ref|XP_009348120.1|  PREDICTED: pleiotropic drug resistance prote...   1235   0.0     
ref|XP_002304176.2|  hypothetical protein POPTR_0003s05600g            1235   0.0     
gb|EEC83509.1|  hypothetical protein OsI_29079                         1235   0.0     
ref|XP_006604625.1|  PREDICTED: ABC transporter G family member 3...   1235   0.0     
gb|KCW53771.1|  hypothetical protein EUGRSUZ_J030242                   1234   0.0     
ref|XP_002972164.1|  ATP-binding cassette transporter                  1234   0.0     
ref|XP_010553381.1|  PREDICTED: ABC transporter G family member 3...   1234   0.0     
ref|XP_010553378.1|  PREDICTED: ABC transporter G family member 3...   1234   0.0     
ref|XP_010553380.1|  PREDICTED: ABC transporter G family member 3...   1234   0.0     
ref|XP_006604626.1|  PREDICTED: ABC transporter G family member 3...   1234   0.0     
ref|XP_010651721.1|  PREDICTED: pleiotropic drug resistance prote...   1233   0.0     
ref|XP_002977484.1|  ATP-binding cassette transporter                  1233   0.0     
ref|XP_002972170.1|  ATP-binding cassette transporter                  1233   0.0     
emb|CAN83834.1|  hypothetical protein VITISV_006821                    1233   0.0     
gb|KDO58221.1|  hypothetical protein CISIN_1g000512mg                  1232   0.0     
gb|EPS71654.1|  hypothetical protein M569_03105                        1231   0.0     
emb|CBH32605.1|  ABC transporter domain containing protein,expressed   1231   0.0     
ref|XP_006481825.1|  PREDICTED: ABC transporter G family member 3...   1231   0.0     
ref|XP_006430269.1|  hypothetical protein CICLE_v10010903mg            1231   0.0     



>ref|XP_002512728.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF49231.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1429

 Score =  1490 bits (3857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 722/1044 (69%), Positives = 866/1044 (83%), Gaps = 15/1044 (1%)
 Frame = -2

Query  3108  GSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             GS R   SS+W SN  +GF+KSSR   ++DDDE ALKWAA++++PT+DRLKKGL+T  +G
Sbjct  11    GSLRRGESSIWRSNAMEGFSKSSR--GDEDDDEEALKWAAIERLPTYDRLKKGLLTTSKG  68

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
             E  E+D+ N+G+ EK+ +L+RL+KV E DNE FLLKLK+R++RV I++P +EVRFEHLNV
Sbjct  69    EANEIDVKNLGFHEKRTLLDRLVKVAEEDNELFLLKLKNRIDRVGIELPMIEVRFEHLNV  128

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
               EA+VG RALP+  NF ++I+EG L++L+ LP+ KK  SIL+DVSGIIKP RMTLLLGP
Sbjct  129   ETEAHVGSRALPTFFNFSIDIVEGFLNFLHILPSGKKSLSILQDVSGIIKPKRMTLLLGP  188

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             PSSGKT+LLLALAG+LDP L+FSGRV+YNGHEMNEFVP RTAAYISQHD HI EMT RET
Sbjct  189   PSSGKTTLLLALAGKLDPKLKFSGRVTYNGHEMNEFVPQRTAAYISQHDTHIGEMTVRET  248

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAF+ARCQGVG RYEM++EL RREKA+NI+PDPDID+FMKA AT+GQ+ANV+ DYI+K+L
Sbjct  249   LAFAARCQGVGHRYEMISELLRREKASNIKPDPDIDVFMKAMATEGQEANVVTDYILKIL  308

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GLE C D +VGNE LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTT+QI+ SI
Sbjct  309   GLEVCADIMVGNEMLRGVSGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNSI  368

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             K YIHIL+GTAVI+LLQP PE Y+LFDDIIL+S+GQIVYQGP   VLEFFE +GF+CPER
Sbjct  369   KQYIHILNGTAVISLLQPPPETYNLFDDIILLSDGQIVYQGPRENVLEFFEYMGFKCPER  428

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTSRKDQ QYW  KD KPY FVT+ EF+EAFQSF +GR L  EL+TPF KS
Sbjct  429   KGVADFLQEVTSRKDQAQYWADKD-KPYSFVTVREFAEAFQSFLVGRRLEAELSTPFDKS  487

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SHPAALTTK YGV KMELLK+CFSRE+LLMKRN  ++IF++  + +MA++ MTLF+RT 
Sbjct  488   KSHPAALTTKKYGVGKMELLKACFSREILLMKRNSFVYIFKLTQLTIMAMVAMTLFLRTE  547

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M R+S     IY+ +LFF++  IMF+ L E++ TI +LP+FYKQR LLFYP WA+++P +
Sbjct  548   MHRDSVTNGGIYVGALFFSVVFIMFNGLSEISLTIAKLPVFYKQRSLLFYPPWAFSLPPW  607

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             I +IPIT ++V++WVF TYYVIG+DPN GR  K ++LL +  Q+AS LFR  A  GR+M 
Sbjct  608   ITKIPITLVQVAIWVFLTYYVIGFDPNVGRFFKQYLLLALVSQMASGLFRFIAAAGRNMI  667

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              A   GSF +L LFALGGFILSRD++KKWWIWGYWISPLMY QNAI VNEFLG SWN VL
Sbjct  668   VANTFGSFALLALFALGGFILSRDNIKKWWIWGYWISPLMYGQNAIVVNEFLGNSWNKVL  727

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
             P ++E  G+ VL+ RG F  AYWYW+GVGAL+GFT+   F +TLAL  L PL + +A IS
Sbjct  728   PDTTETLGIQVLESRGFFTHAYWYWIGVGALVGFTLLYNFFFTLALTFLGPLQKPQAVIS  787

Query  774   AESHSNEHDVSNGGSDNSV------GERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDM  613
              +S SN    ++G +   +       E + +    ++ GM+LPFEPHSI FNDI+Y VDM
Sbjct  788   EDSASN----TSGKTGEVIQLSSVRTELIVEENHQKQKGMVLPFEPHSITFNDIRYSVDM  843

Query  612   PQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEI  433
             PQEMK +G  ++RLELL+GVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG+I
Sbjct  844   PQEMKRQGATEDRLELLRGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDI  903

Query  432   TISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVM  253
              ISGF KKQ+TFARISGYCEQNDIHSPH+TVYESL++S+WLRLP EV  ETRK+FI+EVM
Sbjct  904   RISGFPKKQETFARISGYCEQNDIHSPHVTVYESLLYSSWLRLPPEVNSETRKMFIEEVM  963

Query  252   ELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM  73
             ELVELT LR+A+VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM
Sbjct  964   ELVELTPLRQALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM  1023

Query  72    RTVRNIVDTGRTIVCTIHQPSIDI  1
             RTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1024  RTVRNTVDTGRTVVCTIHQPSIDI  1047


 Score =   131 bits (329),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 124/567 (22%), Positives = 246/567 (43%), Gaps = 58/567 (10%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +LR VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G    
Sbjct  853   TEDRLELLRGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIRISGFPKK  911

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R + Y  Q+D+H P +T  E+L +S+                       +R  P+
Sbjct  912   QETFARISGYCEQNDIHSPHVTVYESLLYSSW----------------------LRLPPE  949

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
             ++          +   + ++ +++++ L      +VG   + G+S  +RKRLT    LV 
Sbjct  950   VN---------SETRKMFIEEVMELVELTPLRQALVGLPGVSGLSTEQRKRLTIAVELVA  1000

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  
Sbjct  1001  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLMKR  1059

Query  1932  G-QIVYQGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKP  1774
             G Q +Y GP    +C ++++FE +      + G   A ++ EV+S   +M   +      
Sbjct  1060  GGQEIYVGPLGRHSCQLIKYFEAIEGVPDIKDGYNPATWMLEVSSSAQEMVLGLD-----  1114

Query  1773  YRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSRE  1594
               F  I + SE ++     + L +EL+TP     S+     T+ Y  S      +C  ++
Sbjct  1115  --FAAIYKNSELYRR---NKALIEELSTP--PLGSNDLYFPTQ-YSQSFFTQCMACLWKQ  1166

Query  1593  VLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSA  1414
                  RN         +  ++AL+  T+F     +          M S++  +  +    
Sbjct  1167  HWSYWRNPPYTAVRFLFTTVIALMFGTMFWDLGSKTTKRQDLFNAMGSMYAAIVFLGIQN  1226

Query  1413  LQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
                + P +     +FY++R    Y    YA    ++ +P   ++ +V+    Y +IG++ 
Sbjct  1227  ASSVQPVVAVERTVFYRERAAGMYSPLPYAFAQVVIELPYIFLQAAVYGLIVYAMIGFEW  1286

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRS--AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRD  1063
             +  +    W L  ++  L    +    A  V  +   A +V S    +     GFI+ R 
Sbjct  1287  SAAKFF--WYLFFMYFTLLFYTYYGMMAVAVTPNQQVASIVSSAFYSIWNLFSGFIIPRP  1344

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  WW W  W  P+ Y    +  ++F
Sbjct  1345  RIPVWWRWYAWTCPVAYTLYGLVSSQF  1371



>ref|XP_010254260.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X3 [Nelumbo nucifera]
Length=1207

 Score =  1471 bits (3809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 735/1074 (68%), Positives = 870/1074 (81%), Gaps = 33/1074 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNG--TDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDR  2965
             ME +D      + RI+SSS+W N    D F +SSR     DDDE ALKWAALQK+PT++R
Sbjct  1     MESSDCNRVGSNLRIDSSSIWRNSIIDDVFQRSSRH----DDDEEALKWAALQKLPTYNR  56

Query  2964  LKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIP  2785
             ++KGL++G+ GET +VDI ++G +EKK +LERL++V E DNE FLLKLK+R++RV +DIP
Sbjct  57    IRKGLLSGVGGETKQVDIESLGLQEKKILLERLLRVAEEDNEKFLLKLKNRIDRVGLDIP  116

Query  2784  KVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGII  2608
             K+EVRFEHLNV AE YVG RALP++ NF +N+LE  L+YL+ LP+ KK  SIL DVSGII
Sbjct  117   KIEVRFEHLNVDAETYVGSRALPTIFNFSVNMLEEFLNYLHILPSRKKPLSILHDVSGII  176

Query  2607  KPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHD  2428
             KP RMTLLLGPP SGKT+LLLALAG+L P L+FSGRV+YNGHEM+EFVP RTAAYISQ+D
Sbjct  177   KPCRMTLLLGPPGSGKTTLLLALAGKLGPDLKFSGRVTYNGHEMDEFVPQRTAAYISQYD  236

Query  2427  LHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKA  2248
             LHI EMT RETLAFSARCQGVG+ YEML ELSRREK ANI+PDPDIDIFMKAAA +GQ+A
Sbjct  237   LHIGEMTVRETLAFSARCQGVGTGYEMLVELSRREKEANIKPDPDIDIFMKAAALEGQEA  296

Query  2247  NVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLD  2068
             NV+ DYI+K+LGLE C DT+VG+E  RG+SGG++KR+T GEMLVGPA  L MDEISTGLD
Sbjct  297   NVVTDYILKILGLEICADTLVGDEMFRGISGGQKKRVTTGEMLVGPARALFMDEISTGLD  356

Query  2067  SSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEF  1888
             SSTTFQIL S++  +HIL+GTA+I+LLQPAPE Y+LFDDIIL+SEGQIVYQGPC  VLEF
Sbjct  357   SSTTFQILNSLRQSVHILNGTALISLLQPAPEAYELFDDIILLSEGQIVYQGPCENVLEF  416

Query  1887  FECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNL  1708
             FE +GF+CPERKGVADFLQEVTS KDQ QYW RKD +PYRF+ + EF+EAFQSFH+G  L
Sbjct  417   FESMGFKCPERKGVADFLQEVTSWKDQEQYWARKD-EPYRFIPVKEFAEAFQSFHVGLKL  475

Query  1707  GDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMA  1528
             GDELA PF+K+ SHPAALTTK YGVSK ELLK+C SRE+LLMKRN  ++IF++  + +M 
Sbjct  476   GDELANPFEKTKSHPAALTTKKYGVSKKELLKACISRELLLMKRNSFVYIFKMTQLTIMG  535

Query  1527  LITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLF  1348
              ITMT+F+R  M R+S I   IY+ +LFFTL +IMF+   EL  TI +LP+FYKQRDLLF
Sbjct  536   FITMTMFLRVKMHRDSVIDGGIYVGALFFTLLMIMFNGYSELTLTIVKLPVFYKQRDLLF  595

Query  1347  YPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF  1168
             YP+WAYA+PT+IL+IP T IEV+VWVF TYYVIG+DPN GR  K ++LL+   Q+AS LF
Sbjct  596   YPSWAYALPTWILKIPYTFIEVAVWVFMTYYVIGFDPNAGRFFKQYLLLLCVNQMASGLF  655

Query  1167  RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVN  988
             R    VGR+M  A   G+F +LVL  LGGFILSR+DVKKWWIWGYW SPLMY QNAIAVN
Sbjct  656   RFIGAVGRNMIVANTFGAFSLLVLMVLGGFILSREDVKKWWIWGYWTSPLMYGQNAIAVN  715

Query  987   EFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             EFLG SW+ V P S+EP GV+VLK RG+FP+AYWYWLGVG L+G+     F++TLAL+ L
Sbjct  716   EFLGNSWSHVPPNSTEPLGVMVLKSRGIFPKAYWYWLGVGVLVGYMFLFNFLFTLALSYL  775

Query  807   RPLAQSRANISAES------------------HSNEHDVSNGGSDNSVGERVSDGMS---  691
              P  + +  IS ES                    N  D   G    S+   +S G +   
Sbjct  776   NPFGKPQPIISEESLNEKWTNRTGEFIKLSSRGKNSADAEEGNEMRSMPSSISPGRTDAV  835

Query  690   ----NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLT  523
                 NRK GM+LPF+P SI F++I+Y VDMPQE+K +GV ++RLELLKGVSGAFRPGVLT
Sbjct  836   NSNQNRKRGMVLPFQPLSIIFDEIRYSVDMPQELKAQGVPEDRLELLKGVSGAFRPGVLT  895

Query  522   ALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLT  343
             ALMG+SGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQ+DIHSPH+T
Sbjct  896   ALMGISGAGKTTLMDVLAGRKTGGYIEGCITISGYPKKQETFARISGYCEQDDIHSPHVT  955

Query  342   VYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLT  163
             VYE+L+FSAWLRLPSEV   TR++FI+EVMELVELTSLREA+VGLPGVNGLS  QRKRLT
Sbjct  956   VYEALLFSAWLRLPSEVKSATREMFIEEVMELVELTSLREALVGLPGVNGLSIEQRKRLT  1015

Query  162   IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1069


 Score = 91.3 bits (225),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 154/323 (48%), Gaps = 50/323 (15%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  881   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGY-IEGCITISGYPKKQETFAR  939

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E L FSA  +           L    K+A             
Sbjct  940   ISGYCEQDDIHSPHVTVYEALLFSAWLR-----------LPSEVKSAT------------  976

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                       + ++ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  977   --------REMFIEEVMELVELTSLREALVGLPGVNGLSIEQRKRLTIAVELVANPSIIF  1028

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+ + G+ +Y
Sbjct  1029  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKQGGEEIY  1087

Query  1917  QGPC---NC-VLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              G     +C ++++FE +    +  E    A ++ EVT+ + +    +        F  I
Sbjct  1088  MGQLGRHSCHLIKYFEGIPGVNKIKEGYNPATWMLEVTTTEQEAALGV-------NFTDI  1140

Query  1755  NEFSEAFQSFHIGRNLGDELATP  1687
              + SE ++     + L +EL TP
Sbjct  1141  YKNSELYRR---NKALINELNTP  1160



>ref|XP_010254257.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=1451

 Score =  1469 bits (3803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 735/1074 (68%), Positives = 871/1074 (81%), Gaps = 33/1074 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT--DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDR  2965
             ME +D      + RI+SSS+W N    D F +SSR     DDDE ALKWAALQK+PT++R
Sbjct  1     MESSDCNRVGSNLRIDSSSIWRNSIIDDVFQRSSRH----DDDEEALKWAALQKLPTYNR  56

Query  2964  LKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIP  2785
             ++KGL++G+ GET +VDI ++G +EKK +LERL++V E DNE FLLKLK+R++RV +DIP
Sbjct  57    IRKGLLSGVGGETKQVDIESLGLQEKKILLERLLRVAEEDNEKFLLKLKNRIDRVGLDIP  116

Query  2784  KVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGII  2608
             K+EVRFEHLNV AE YVG RALP++ NF +N+LE  L+YL+ LP+ KK  SIL DVSGII
Sbjct  117   KIEVRFEHLNVDAETYVGSRALPTIFNFSVNMLEEFLNYLHILPSRKKPLSILHDVSGII  176

Query  2607  KPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHD  2428
             KP RMTLLLGPP SGKT+LLLALAG+L P L+FSGRV+YNGHEM+EFVP RTAAYISQ+D
Sbjct  177   KPCRMTLLLGPPGSGKTTLLLALAGKLGPDLKFSGRVTYNGHEMDEFVPQRTAAYISQYD  236

Query  2427  LHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKA  2248
             LHI EMT RETLAFSARCQGVG+ YEML ELSRREK ANI+PDPDIDIFMKAAA +GQ+A
Sbjct  237   LHIGEMTVRETLAFSARCQGVGTGYEMLVELSRREKEANIKPDPDIDIFMKAAALEGQEA  296

Query  2247  NVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLD  2068
             NV+ DYI+K+LGLE C DT+VG+E  RG+SGG++KR+T GEMLVGPA  L MDEISTGLD
Sbjct  297   NVVTDYILKILGLEICADTLVGDEMFRGISGGQKKRVTTGEMLVGPARALFMDEISTGLD  356

Query  2067  SSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEF  1888
             SSTTFQIL S++  +HIL+GTA+I+LLQPAPE Y+LFDDIIL+SEGQIVYQGPC  VLEF
Sbjct  357   SSTTFQILNSLRQSVHILNGTALISLLQPAPEAYELFDDIILLSEGQIVYQGPCENVLEF  416

Query  1887  FECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNL  1708
             FE +GF+CPERKGVADFLQEVTS KDQ QYW RKD +PYRF+ + EF+EAFQSFH+G  L
Sbjct  417   FESMGFKCPERKGVADFLQEVTSWKDQEQYWARKD-EPYRFIPVKEFAEAFQSFHVGLKL  475

Query  1707  GDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMA  1528
             GDELA PF+K+ SHPAALTTK YGVSK ELLK+C SRE+LLMKRN  ++IF++  + +M 
Sbjct  476   GDELANPFEKTKSHPAALTTKKYGVSKKELLKACISRELLLMKRNSFVYIFKMTQLTIMG  535

Query  1527  LITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLF  1348
              ITMT+F+R  M R+S I   IY+ +LFFTL +IMF+   EL  TI +LP+FYKQRDLLF
Sbjct  536   FITMTMFLRVKMHRDSVIDGGIYVGALFFTLLMIMFNGYSELTLTIVKLPVFYKQRDLLF  595

Query  1347  YPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF  1168
             YP+WAYA+PT+IL+IP T IEV+VWVF TYYVIG+DPN GR  K ++LL+   Q+AS LF
Sbjct  596   YPSWAYALPTWILKIPYTFIEVAVWVFMTYYVIGFDPNAGRFFKQYLLLLCVNQMASGLF  655

Query  1167  RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVN  988
             R    VGR+M  A   G+F +LVL  LGGFILSR+DVKKWWIWGYW SPLMY QNAIAVN
Sbjct  656   RFIGAVGRNMIVANTFGAFSLLVLMVLGGFILSREDVKKWWIWGYWTSPLMYGQNAIAVN  715

Query  987   EFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             EFLG SW+ V P S+EP GV+VLK RG+FP+AYWYWLGVG L+G+     F++TLAL+ L
Sbjct  716   EFLGNSWSHVPPNSTEPLGVMVLKSRGIFPKAYWYWLGVGVLVGYMFLFNFLFTLALSYL  775

Query  807   RPLAQSRANISAESHS------------------NEHDVSNGGSDNSVGERVSDGMS---  691
              P  + +  IS ES +                  N  D   G    S+   +S G +   
Sbjct  776   NPFGKPQPIISEESLNEKWTNRTGEFIKLSSRGKNSADAEEGNEMRSMPSSISPGRTDAV  835

Query  690   ----NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLT  523
                 NRK GM+LPF+P SI F++I+Y VDMPQE+K +GV ++RLELLKGVSGAFRPGVLT
Sbjct  836   NSNQNRKRGMVLPFQPLSIIFDEIRYSVDMPQELKAQGVPEDRLELLKGVSGAFRPGVLT  895

Query  522   ALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLT  343
             ALMG+SGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQ+DIHSPH+T
Sbjct  896   ALMGISGAGKTTLMDVLAGRKTGGYIEGCITISGYPKKQETFARISGYCEQDDIHSPHVT  955

Query  342   VYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLT  163
             VYE+L+FSAWLRLPSEV   TR++FI+EVMELVELTSLREA+VGLPGVNGLS  QRKRLT
Sbjct  956   VYEALLFSAWLRLPSEVKSATREMFIEEVMELVELTSLREALVGLPGVNGLSIEQRKRLT  1015

Query  162   IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1069


 Score =   129 bits (325),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 124/561 (22%), Positives = 242/561 (43%), Gaps = 58/561 (10%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  881   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGY-IEGCITISGYPKKQETFAR  939

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E L FSA  +           L    K+A             
Sbjct  940   ISGYCEQDDIHSPHVTVYEALLFSAWLR-----------LPSEVKSAT------------  976

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                       + ++ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  977   --------REMFIEEVMELVELTSLREALVGLPGVNGLSIEQRKRLTIAVELVANPSIIF  1028

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+ +G + +Y
Sbjct  1029  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKQGGEEIY  1087

Query  1917  QGPC---NC-VLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              G     +C ++++FE +    +  E    A ++ EVT+ + +    +        F  I
Sbjct  1088  MGQLGRHSCHLIKYFEGIPGVNKIKEGYNPATWMLEVTTTEQEAALGVN-------FTDI  1140

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L +EL TP     S      T+ Y  S      +C  ++     R
Sbjct  1141  YKNSELYRR---NKALINELNTP--SPGSRDLYFPTR-YSQSFFTQSVACLWKQYYSYWR  1194

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R         M S++     +       + P
Sbjct  1195  NPPYTAVRLLFTTFIALMYGTIFWDLGSRRKKQQDLFNAMGSMYSAALFLGVQNCTSVQP  1254

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   ++  ++    Y +IG++    +  
Sbjct  1255  IVAIERTVFYRERAAGMYSALPYAFGQVMVEVPHIFLQTLIYGVIVYSMIGFEWTVDKFF  1314

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDDVKKWW  1045
               W L  ++  L    F     V  +  +  A +V +    +     GFI+ R  +  WW
Sbjct  1315  --WYLFFMYVTLLYFTFYGMMTVAVTPNHNIAAIVCTAFQSIWNIFSGFIVPRTRIPIWW  1372

Query  1044  IWGYWISPLMYAQNAIAVNEF  982
              W YW +P  +    + V++F
Sbjct  1373  RWYYWANPFSWTLYGLVVSQF  1393



>ref|XP_007023982.1| Pleiotropic drug resistance 12 [Theobroma cacao]
 gb|EOY26604.1| Pleiotropic drug resistance 12 [Theobroma cacao]
Length=1463

 Score =  1467 bits (3798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 719/1069 (67%), Positives = 865/1069 (81%), Gaps = 38/1069 (4%)
 Frame = -2

Query  3108  GSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             GS R  SSS+W SN  + F++SSR    D+DDE ALKWAAL+K+PT  RL+KG++T  +G
Sbjct  15    GSLRAGSSSIWRSNTVEAFSRSSR----DEDDEEALKWAALEKLPTVARLRKGILTSSQG  70

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
                E+D++++G++EK+ +LERL+KV E DNE FLLKLK+R++RV ID+P +EVRFEHLN+
Sbjct  71    GANEIDVHDLGWQEKRTLLERLVKVAEEDNEKFLLKLKNRIDRVGIDLPTIEVRFEHLNI  130

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEA+VG RALP+V NF  +I EG L+ +  L + KKH +IL DVSGIIKPGR+TLLLGP
Sbjct  131   DAEAFVGSRALPTVLNFTTSIFEGFLNEVGILSSRKKHLTILNDVSGIIKPGRLTLLLGP  190

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             PSSGKT+LLLALAG+LDP+L+ SGRV+YNGH M+EFVP RTAAYISQ+DLHI EMT RET
Sbjct  191   PSSGKTTLLLALAGKLDPALKCSGRVTYNGHGMHEFVPERTAAYISQNDLHIGEMTVRET  250

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSARCQGVG RYEMLAELSRREK ANI+PDPDID+FMKA AT+GQ+ANVI DYI+K+L
Sbjct  251   LAFSARCQGVGDRYEMLAELSRREKQANIKPDPDIDVFMKAVATEGQEANVITDYILKIL  310

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GLE C DT+VG+E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTTFQI+ S+
Sbjct  311   GLEICADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSL  370

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             K  +HIL+GTAVI+LLQPAPE YDLFDDIIL+S+G++VYQG    VL FFE +GFRCPER
Sbjct  371   KQTVHILNGTAVISLLQPAPETYDLFDDIILLSDGRVVYQGRREHVLSFFESMGFRCPER  430

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTSRKDQMQYWIR+D +PYRFVT NEF+EAFQSFH+G  LGDEL TPF+K+
Sbjct  431   KGVADFLQEVTSRKDQMQYWIRRD-QPYRFVTANEFAEAFQSFHVGMQLGDELGTPFEKT  489

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SHPAALTTK YGV   EL K+C SRE LLMKRN  ++IF+   + +MA ITMTLF+RT 
Sbjct  490   KSHPAALTTKKYGVGLKELAKACISREYLLMKRNSFVYIFKFMQITVMAFITMTLFLRTE  549

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M+R+S    QIYM +LFF +  IMF+ + E++ TI +LP+FYKQRDLLF+P+WAYA+PT+
Sbjct  550   MKRDSVEWGQIYMGALFFGMITIMFNGMSEISMTIAKLPVFYKQRDLLFFPSWAYALPTW  609

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             IL+IPIT +EV++WVF TYYVIG+DPN  RL + + +L++  Q+AS LFR  A  GR+M 
Sbjct  610   ILKIPITFVEVAIWVFLTYYVIGFDPNVERLFRQYFILVLVNQMASGLFRFIAATGRNMI  669

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              +   GSF +LVLFALGGF+LSR+D+KKWWIWGYWISP+MY QNA+ VNEFLG  WN V 
Sbjct  670   VSNTFGSFALLVLFALGGFVLSREDIKKWWIWGYWISPMMYGQNALMVNEFLGNQWNHVR  729

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
             P  +E  G+ VLK RG F + +WYW+GVGA+IGFT+   F +TLAL  L    + RA IS
Sbjct  730   PNVTESVGIEVLKARGFFQDPHWYWIGVGAMIGFTLLFNFGFTLALTYLNSFEKPRAVIS  789

Query  774   AESHSNEHD--VSNGGS----------DNSVGERVSD-------------------GMSN  688
              +S SNE +  V  GGS           ++    + D                    + N
Sbjct  790   KDSVSNEQENGVGAGGSIQLSNYESSSSHATKSEIQDDIRRSTSSKSSSMTEATVGALGN  849

Query  687   RKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGV  508
             +K GM+LPFEPHSI F+D+ Y VDMPQEMK +GV ++RL LLKGVSGAFRPGVLTALMGV
Sbjct  850   KKKGMVLPFEPHSITFDDVIYSVDMPQEMKEQGVTEDRLVLLKGVSGAFRPGVLTALMGV  909

Query  507   SGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESL  328
             SGAGKTTLMDVLAGRKTGG+I+G IT+SG+ KKQ+TFAR+SGYCEQNDIHSPH+TVYESL
Sbjct  910   SGAGKTTLMDVLAGRKTGGFIDGNITVSGYPKKQETFARVSGYCEQNDIHSPHVTVYESL  969

Query  327   IFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVEL  148
             ++SAWLRLP+EV  ETRK+FI+EVMELVEL  LR+A+VGLPGVNGLST QRKRLTIAVEL
Sbjct  970   LYSAWLRLPAEVNAETRKMFIEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVEL  1029

Query  147   VANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             VANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1030  VANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1078


 Score =   140 bits (353),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 143/624 (23%), Positives = 281/624 (45%), Gaps = 76/624 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  890   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGF-IDGNITVSGYPKKQETFAR  948

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  949   VSGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  977

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              A  + +   + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  978   PAEVNAETRKMFIEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1037

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1038  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLMKRGGQEIY  1096

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EV++   ++   +        F  I
Sbjct  1097  VGPLGHHSKHLIKYFEGIQGVSKIKDGYNPATWMLEVSTTAQELALGVD-------FADI  1149

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L  +L+ P   + S         Y    +   ++C  ++ L   R
Sbjct  1150  YKNSELYRR---NKALIQDLSKP---APSTKELYFPTQYSQPFLTQCQACLWKQHLSYWR  1203

Query  1575  NCVLHIFEVGWVVLMALITMTLF--IRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQEL  1402
             N         +  ++AL+  TLF  + T  +R   +     M S++     ++F  +Q  
Sbjct  1204  NPPYTAVRFLFTTVIALMFGTLFWDLGTKTKRQQDLTNA--MGSMY---AAVLFLGIQNA  1258

Query  1401  A---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
             A   P +     +FY++R    Y A  YAI   ++ +P   ++ +V+    Y +IG++  
Sbjct  1259  ASVQPVVAVERTVFYRERAAGMYSAMPYAIGQVLIELPYIFVQSAVYGCIVYAMIGFEWT  1318

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDD  1060
               +    W L  ++  L    F     V  +  +  A +V S    +     GFI+ R  
Sbjct  1319  AAKFF--WYLFFMYFTLLYFTFYGMMAVAVTPNHHIAAIVSSAFYGLWNLFSGFIIPRPS  1376

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKY-RGLFPEAYWY  883
             +  WW W YWI P+ +    + V++F G   +T+   S+   G  V +Y R +F   + +
Sbjct  1377  IPVWWRWYYWICPVSWTFYGLVVSQF-GDIQDTLEDGSN---GETVEQYLRNVFDFKHEF  1432

Query  882   WLGVGA--LIGFTIFSIFIYTLAL  817
              LGV A  ++GFT+    I+T+++
Sbjct  1433  -LGVVAAVILGFTVLFGGIFTVSI  1455



>ref|XP_010254258.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=1449

 Score =  1466 bits (3796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 733/1072 (68%), Positives = 870/1072 (81%), Gaps = 31/1072 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT--DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDR  2965
             ME +D      + RI+SSS+W N    D F +SSR     DDDE ALKWAALQK+PT++R
Sbjct  1     MESSDCNRVGSNLRIDSSSIWRNSIIDDVFQRSSRH----DDDEEALKWAALQKLPTYNR  56

Query  2964  LKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIP  2785
             ++KGL++G+ GET +VDI ++G +EKK +LERL++V E DNE FLLKLK+R++RV +DIP
Sbjct  57    IRKGLLSGVGGETKQVDIESLGLQEKKILLERLLRVAEEDNEKFLLKLKNRIDRVGLDIP  116

Query  2784  KVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGII  2608
             K+EVRFEHLNV AE YVG RALP++ NF +N+LE  L+YL+ LP+ KK  SIL DVSGII
Sbjct  117   KIEVRFEHLNVDAETYVGSRALPTIFNFSVNMLEEFLNYLHILPSRKKPLSILHDVSGII  176

Query  2607  KPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHD  2428
             KP RMTLLLGPP SGKT+LLLALAG+L P L+FSGRV+YNGHEM+EFVP RTAAYISQ+D
Sbjct  177   KPCRMTLLLGPPGSGKTTLLLALAGKLGPDLKFSGRVTYNGHEMDEFVPQRTAAYISQYD  236

Query  2427  LHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKA  2248
             LHI EMT RETLAFSARCQGVG+ YEML ELSRREK ANI+PDPDIDIFMKAAA +GQ+A
Sbjct  237   LHIGEMTVRETLAFSARCQGVGTGYEMLVELSRREKEANIKPDPDIDIFMKAAALEGQEA  296

Query  2247  NVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLD  2068
             NV+ DYI+K+LGLE C DT+VG+E  RG+SGG++KR+T GEMLVGPA  L MDEISTGLD
Sbjct  297   NVVTDYILKILGLEICADTLVGDEMFRGISGGQKKRVTTGEMLVGPARALFMDEISTGLD  356

Query  2067  SSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEF  1888
             SSTTFQIL S++  +HIL+GTA+I+LLQPAPE Y+LFDDIIL+SEGQIVYQGPC  VLEF
Sbjct  357   SSTTFQILNSLRQSVHILNGTALISLLQPAPEAYELFDDIILLSEGQIVYQGPCENVLEF  416

Query  1887  FECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNL  1708
             FE +GF+CPERKGVADFLQEVTS KDQ QYW RKD +PYRF+ + EF+EAFQSFH+G  L
Sbjct  417   FESMGFKCPERKGVADFLQEVTSWKDQEQYWARKD-EPYRFIPVKEFAEAFQSFHVGLKL  475

Query  1707  GDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMA  1528
             GDELA PF+K+ SHPAALTTK YGVSK ELLK+C SRE+LLMKRN  ++IF++  + +M 
Sbjct  476   GDELANPFEKTKSHPAALTTKKYGVSKKELLKACISRELLLMKRNSFVYIFKMTQLTIMG  535

Query  1527  LITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLF  1348
              ITMT+F+R  M R+S I   IY+ +LFFTL +IMF+   EL  TI +LP+FYKQRDLLF
Sbjct  536   FITMTMFLRVKMHRDSVIDGGIYVGALFFTLLMIMFNGYSELTLTIVKLPVFYKQRDLLF  595

Query  1347  YPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF  1168
             YP+WAYA+PT+IL+IP T IEV+VWVF TYYVIG+DPN GR  K ++LL+   Q+AS LF
Sbjct  596   YPSWAYALPTWILKIPYTFIEVAVWVFMTYYVIGFDPNAGRFFKQYLLLLCVNQMASGLF  655

Query  1167  RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVN  988
             R    VGR+M  A   G+F +LVL  LGGFILSR+DVKKWWIWGYW SPLMY QNAIAVN
Sbjct  656   RFIGAVGRNMIVANTFGAFSLLVLMVLGGFILSREDVKKWWIWGYWTSPLMYGQNAIAVN  715

Query  987   EFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             EFLG SW+ V P S+EP GV+VLK RG+FP+AYWYWLGVG L+G+     F++TLAL+ L
Sbjct  716   EFLGNSWSHVPPNSTEPLGVMVLKSRGIFPKAYWYWLGVGVLVGYMFLFNFLFTLALSYL  775

Query  807   RPLAQSRANISAE----------------SHSNEHDVSNGGSDNSVGERVSDGMS-----  691
              P  + +  IS E                S   ++    G    S+   +S G +     
Sbjct  776   NPFGKPQPIISEESLNEKWTNRTGEFIKLSSRGKNSAEEGNEMRSMPSSISPGRTDAVNS  835

Query  690   --NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTAL  517
               NRK GM+LPF+P SI F++I+Y VDMPQE+K +GV ++RLELLKGVSGAFRPGVLTAL
Sbjct  836   NQNRKRGMVLPFQPLSIIFDEIRYSVDMPQELKAQGVPEDRLELLKGVSGAFRPGVLTAL  895

Query  516   MGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVY  337
             MG+SGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQ+DIHSPH+TVY
Sbjct  896   MGISGAGKTTLMDVLAGRKTGGYIEGCITISGYPKKQETFARISGYCEQDDIHSPHVTVY  955

Query  336   ESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIA  157
             E+L+FSAWLRLPSEV   TR++FI+EVMELVELTSLREA+VGLPGVNGLS  QRKRLTIA
Sbjct  956   EALLFSAWLRLPSEVKSATREMFIEEVMELVELTSLREALVGLPGVNGLSIEQRKRLTIA  1015

Query  156   VELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             VELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  VELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1067


 Score =   129 bits (325),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 124/561 (22%), Positives = 242/561 (43%), Gaps = 58/561 (10%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  879   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGY-IEGCITISGYPKKQETFAR  937

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E L FSA  +           L    K+A             
Sbjct  938   ISGYCEQDDIHSPHVTVYEALLFSAWLR-----------LPSEVKSAT------------  974

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                       + ++ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  975   --------REMFIEEVMELVELTSLREALVGLPGVNGLSIEQRKRLTIAVELVANPSIIF  1026

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+ +G + +Y
Sbjct  1027  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKQGGEEIY  1085

Query  1917  QGPC---NC-VLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              G     +C ++++FE +    +  E    A ++ EVT+ + +    +        F  I
Sbjct  1086  MGQLGRHSCHLIKYFEGIPGVNKIKEGYNPATWMLEVTTTEQEAALGVN-------FTDI  1138

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L +EL TP     S      T+ Y  S      +C  ++     R
Sbjct  1139  YKNSELYRR---NKALINELNTP--SPGSRDLYFPTR-YSQSFFTQSVACLWKQYYSYWR  1192

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R         M S++     +       + P
Sbjct  1193  NPPYTAVRLLFTTFIALMYGTIFWDLGSRRKKQQDLFNAMGSMYSAALFLGVQNCTSVQP  1252

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   ++  ++    Y +IG++    +  
Sbjct  1253  IVAIERTVFYRERAAGMYSALPYAFGQVMVEVPHIFLQTLIYGVIVYSMIGFEWTVDKFF  1312

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDDVKKWW  1045
               W L  ++  L    F     V  +  +  A +V +    +     GFI+ R  +  WW
Sbjct  1313  --WYLFFMYVTLLYFTFYGMMTVAVTPNHNIAAIVCTAFQSIWNIFSGFIVPRTRIPIWW  1370

Query  1044  IWGYWISPLMYAQNAIAVNEF  982
              W YW +P  +    + V++F
Sbjct  1371  RWYYWANPFSWTLYGLVVSQF  1391



>ref|XP_010654722.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1424

 Score =  1461 bits (3782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/1048 (68%), Positives = 862/1048 (82%), Gaps = 9/1048 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             M   D+   SGS R N SS+W S+G D F++SSR    D+DDE ALKWAAL+K+PT++RL
Sbjct  1     MATADTYRASGSLRRNGSSIWRSSGADVFSRSSR----DEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++GL+ G  GE  E+DI+N+G++EKK ++ERL+KV E DNE FLLKLK+R++RV ID+P+
Sbjct  57    RRGLLMGSEGEASEIDIHNLGFQEKKNLVERLVKVAEEDNEKFLLKLKNRIDRVGIDVPE  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIK  2605
             +EVRFEHL + AEA+VG RALPS  NF  N LEG+L+ +  LP+ K+  +IL DVSGIIK
Sbjct  117   IEVRFEHLTIDAEAFVGSRALPSFHNFIFNKLEGILNAVRILPSKKRKFTILNDVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPPSSGKT+LLLALAG+LDP+L+  GRV+YNGH MNEFVP RTAAYISQHD 
Sbjct  177   PRRLTLLLGPPSSGKTTLLLALAGKLDPNLKVMGRVTYNGHGMNEFVPQRTAAYISQHDT  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG RY+MLAELSRREKAANI+PDPD+D+FMKAAAT+GQK N
Sbjct  237   HIGEMTVRETLAFSARCQGVGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKEN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY +K+LGL+ C DT+VG+E +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDS
Sbjct  297   VVTDYTLKILGLDICADTMVGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S+K  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+ QIVYQGP   VLEFF
Sbjct  357   STTFQIINSLKQTIHILNGTAVISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKG ADFLQEVTSRKDQ QYW RKD  PY FVT+ EF+EAFQSFHIGR + 
Sbjct  417   ESIGFKCPERKGEADFLQEVTSRKDQAQYWARKD-VPYSFVTVKEFAEAFQSFHIGRKVA  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELA+PF ++ SHPAALTTK YGV K ELL +  SRE LLMKRN  ++IF++  + ++A+
Sbjct  476   DELASPFDRAKSHPAALTTKKYGVRKKELLDANMSREYLLMKRNSFVYIFKLTQLAVVAV  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF+RT M +NS     IY  +LFFT+ +IMF+ + ELA TI +LP+FYKQRD LFY
Sbjct  536   IAMTLFLRTEMNKNSTEDGSIYTGALFFTVVMIMFNGMAELAMTIAKLPVFYKQRDFLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAYA+PT++L+IPIT +EV+VWVF TYYVIG+DPN  RL + ++LL++  Q+AS LFR
Sbjct  596   PAWAYALPTWVLKIPITFVEVAVWVFITYYVIGFDPNVERLFRQYLLLLLVNQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A  GR+M  A   G+F +L+L ALGGFILS D+VKKWWIWGYW SPLMYAQNAI VNE
Sbjct  656   FIAAAGRNMIVASTFGAFAVLMLMALGGFILSHDNVKKWWIWGYWSSPLMYAQNAIVVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW+  +  S+E  G+ VLK RG F +A+WYW+G GAL+GF     F YTL L  L 
Sbjct  716   FLGKSWSKNVTNSTESLGITVLKSRGFFTDAHWYWIGAGALLGFIFVFNFFYTLCLNYLN  775

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKY  625
             P  + +A I+ ES + +   +  G    + E +++G  N+K GM+LPF+PHSI F+DI+Y
Sbjct  776   PFEKPQAVITEESDNAKTATTERG--EHMVEAIAEGNHNKKKGMVLPFQPHSITFDDIRY  833

Query  624   CVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI  445
              VDMP+EMK +G  ++RLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI
Sbjct  834   SVDMPEEMKSQGALEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI  893

Query  444   EGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFI  265
             EG I+ISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLPS+V  ETRK+FI
Sbjct  894   EGNISISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSDVNSETRKMFI  953

Query  264   KEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAA  85
             +EVMELVELT LR+A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAA
Sbjct  954   EEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAA  1013

Query  84    AIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1014  AIVMRTVRNTVDTGRTVVCTIHQPSIDI  1041


 Score =   135 bits (341),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 131/591 (22%), Positives = 249/591 (42%), Gaps = 78/591 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +S +G+   +    R
Sbjct  853   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNISISGYPKKQETFAR  911

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D++    
Sbjct  912   ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLPSDVN----  945

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  946   -----SETRKMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1000

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1001  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLMKRGGQEIY  1059

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++ +FE +      + G   A ++ EVT+   +    +            
Sbjct  1060  VGPLGRHSSHLINYFEGIEGVSKIKDGYNPATWMLEVTTGAQEGTLGV------------  1107

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSK-----MELLKSCFSREV  1591
              +F+E +++  + R   D +     K  S PA  T   Y  ++          +C  ++ 
Sbjct  1108  -DFTEIYKNSDLYRRNKDLI-----KELSQPAPGTKDLYFATQYSQPFFTQFLACLWKQR  1161

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +AL+   +F     +R         M S++  +  +     
Sbjct  1162  WSYWRNPPYTAVRFLFTTFIALMFGLIFWDLGTRRTRQQDLLNAMGSMYAAVLFLGVQNA  1221

Query  1410  QELAPTIF-RLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
             Q + P I     +FY++R    Y A  YA    ++ IP    +  V+    Y +IG++  
Sbjct  1222  QSVQPVIVVERTVFYRERAAGMYSALPYAFGQALVEIPYVFAQAVVYGVIVYGMIGFEWT  1281

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSR  1066
               +    W L  +F  L    F     V  +      + S I    + L     GFI+ R
Sbjct  1282  ATKFF--WYLFFMFCTLLYFTFYGMMAVAATPNQH--IASIIAATFYTLWNLFSGFIVPR  1337

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFG  931
             + +  WW W  WI P+ +    +  ++F      L ++  TV  F  + FG
Sbjct  1338  NRIPVWWRWYCWICPVAWTLYGLVASQFGDIQSTLLENNQTVKQFLDDYFG  1388



>emb|CBI36210.3| unnamed protein product [Vitis vinifera]
Length=1642

 Score =  1460 bits (3779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/1039 (69%), Positives = 858/1039 (83%), Gaps = 12/1039 (1%)
 Frame = -2

Query  3111  SGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLR  2935
             SGS R N SS+W S+G D F++SSR    D+DDE ALKWAAL+K+PT++RL++GL+ G  
Sbjct  231   SGSLRRNGSSIWRSSGADVFSRSSR----DEDDEEALKWAALEKLPTYNRLRRGLLMGSE  286

Query  2934  GETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLN  2755
             GE  E+DI+N+G++EKK ++ERL+KV E DNE FLLKLK+R++RV ID+P++EVRFEHL 
Sbjct  287   GEASEIDIHNLGFQEKKNLVERLVKVAEEDNEKFLLKLKNRIDRVGIDVPEIEVRFEHLT  346

Query  2754  VGAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLG  2578
             + AEA+VG RALPS  NF  N LEG+L+ +  LP+ K+  +IL DVSGIIKP R+TLLLG
Sbjct  347   IDAEAFVGSRALPSFHNFIFNKLEGILNAVRILPSKKRKFTILNDVSGIIKPRRLTLLLG  406

Query  2577  PPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARE  2398
             PPSSGKT+LLLALAG+LDP+L+  GRV+YNGH MNEFVP RTAAYISQHD HI EMT RE
Sbjct  407   PPSSGKTTLLLALAGKLDPNLKVMGRVTYNGHGMNEFVPQRTAAYISQHDTHIGEMTVRE  466

Query  2397  TLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKV  2218
             TLAFSARCQGVG RY+MLAELSRREKAANI+PDPD+D+FMKAAAT+GQK NV+ DY +K+
Sbjct  467   TLAFSARCQGVGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKENVVTDYTLKI  526

Query  2217  LGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKS  2038
             LGL+ C DT+VG+E +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDSSTTFQI+ S
Sbjct  527   LGLDICADTMVGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTFQIINS  586

Query  2037  IKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPE  1858
             +K  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+ QIVYQGP   VLEFFE +GF+CPE
Sbjct  587   LKQTIHILNGTAVISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVLEFFESIGFKCPE  646

Query  1857  RKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQK  1678
             RKG ADFLQEVTSRKDQ QYW RKD  PY FVT+ EF+EAFQSFHIGR + DELA+PF +
Sbjct  647   RKGEADFLQEVTSRKDQAQYWARKD-VPYSFVTVKEFAEAFQSFHIGRKVADELASPFDR  705

Query  1677  STSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRT  1498
             + SHPAALTTK YGV K ELL +  SRE LLMKRN  ++IF++  + ++A+I MTLF+RT
Sbjct  706   AKSHPAALTTKKYGVRKKELLDANMSREYLLMKRNSFVYIFKLTQLAVVAVIAMTLFLRT  765

Query  1497  NMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPT  1318
              M +NS     IY  +LFFT+ +IMF+ + ELA TI +LP+FYKQRD LFYPAWAYA+PT
Sbjct  766   EMNKNSTEDGSIYTGALFFTVVMIMFNGMAELAMTIAKLPVFYKQRDFLFYPAWAYALPT  825

Query  1317  FILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSM  1138
             ++L+IPIT +EV+VWVF TYYVIG+DPN  RL + ++LL++  Q+AS LFR  A  GR+M
Sbjct  826   WVLKIPITFVEVAVWVFITYYVIGFDPNVERLFRQYLLLLLVNQMASGLFRFIAAAGRNM  885

Query  1137  TNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTV  958
               A   G+F +L+L ALGGFILS D+VKKWWIWGYW SPLMYAQNAI VNEFLGKSW+  
Sbjct  886   IVASTFGAFAVLMLMALGGFILSHDNVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKN  945

Query  957   LPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANI  778
             +  S+E  G+ VLK RG F +A+WYW+G GAL+GF     F YTL L  L P  + +A I
Sbjct  946   VTNSTESLGITVLKSRGFFTDAHWYWIGAGALLGFIFVFNFFYTLCLNYLNPFEKPQAVI  1005

Query  777   SAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMK  598
             + ES     D +   +   + E +++G  N+K GM+LPF+PHSI F+DI+Y VDMP+EMK
Sbjct  1006  TEES-----DNAKTATTEHMVEAIAEGNHNKKKGMVLPFQPHSITFDDIRYSVDMPEEMK  1060

Query  597   IEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGF  418
              +G  ++RLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG I+ISG+
Sbjct  1061  SQGALEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNISISGY  1120

Query  417   TKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVEL  238
              KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLPS+V  ETRK+FI+EVMELVEL
Sbjct  1121  PKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSDVNSETRKMFIEEVMELVEL  1180

Query  237   TSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN  58
             T LR+A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN
Sbjct  1181  TPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN  1240

Query  57    IVDTGRTIVCTIHQPSIDI  1
              VDTGRT+VCTIHQPSIDI
Sbjct  1241  TVDTGRTVVCTIHQPSIDI  1259


 Score =   198 bits (504),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 3/182 (2%)
 Frame = -2

Query  2349  MLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYL  2170
             MLAEL+RREKAANI+PDPDID+FMK       K +V+ D+I+K+LGL+ C D +VG+E +
Sbjct  1     MLAELARREKAANIKPDPDIDVFMKVRQKLLSKKSVVTDHIMKILGLDICADIMVGDEMI  60

Query  2169  RGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIAL  1990
             RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDSSTT+QI+ S++  IHIL+GTAVI+L
Sbjct  61    RGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTIHILNGTAVISL  120

Query  1989  LQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERKGVADF---LQEVTS  1819
             LQP  E YDLFDDIIL+S+ + +  G     +E  +   F   E K    F   L EV +
Sbjct  121   LQPPLETYDLFDDIILLSDRKTLIGGGKENEVEENDEKFFTVSEGKDEKSFYRKLNEVEN  180

Query  1818  RK  1813
              K
Sbjct  181   EK  182


 Score =   135 bits (341),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 131/591 (22%), Positives = 249/591 (42%), Gaps = 78/591 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +S +G+   +    R
Sbjct  1071  LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNISISGYPKKQETFAR  1129

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D++    
Sbjct  1130  ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLPSDVN----  1163

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  1164  -----SETRKMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1218

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1219  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLMKRGGQEIY  1277

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++ +FE +      + G   A ++ EVT+   +    +            
Sbjct  1278  VGPLGRHSSHLINYFEGIEGVSKIKDGYNPATWMLEVTTGAQEGTLGV------------  1325

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSK-----MELLKSCFSREV  1591
              +F+E +++  + R   D +     K  S PA  T   Y  ++          +C  ++ 
Sbjct  1326  -DFTEIYKNSDLYRRNKDLI-----KELSQPAPGTKDLYFATQYSQPFFTQFLACLWKQR  1379

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +AL+   +F     +R         M S++  +  +     
Sbjct  1380  WSYWRNPPYTAVRFLFTTFIALMFGLIFWDLGTRRTRQQDLLNAMGSMYAAVLFLGVQNA  1439

Query  1410  QELAPTIF-RLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
             Q + P I     +FY++R    Y A  YA    ++ IP    +  V+    Y +IG++  
Sbjct  1440  QSVQPVIVVERTVFYRERAAGMYSALPYAFGQALVEIPYVFAQAVVYGVIVYGMIGFEWT  1499

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSR  1066
               +    W L  +F  L    F     V  +      + S I    + L     GFI+ R
Sbjct  1500  ATKFF--WYLFFMFCTLLYFTFYGMMAVAATPNQH--IASIIAATFYTLWNLFSGFIVPR  1555

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFG  931
             + +  WW W  WI P+ +    +  ++F      L ++  TV  F  + FG
Sbjct  1556  NRIPVWWRWYCWICPVAWTLYGLVASQFGDIQSTLLENNQTVKQFLDDYFG  1606



>ref|XP_010249930.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nelumbo 
nucifera]
Length=1444

 Score =  1459 bits (3778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/1060 (67%), Positives = 858/1060 (81%), Gaps = 27/1060 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLR  2935
             +  S R N+S   SNG + F++SSR    +DDDE ALKWAAL+K+PT+DR++KG++TG+ 
Sbjct  8     KVSSLRRNNSVWRSNGVEVFSRSSR----EDDDEEALKWAALEKLPTYDRIRKGILTGVG  63

Query  2934  GETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLN  2755
              +  EVDI ++GY+EKK ++ERL++V E DNE FLLKLK+R+ERV ID+P +EVRFEHLN
Sbjct  64    SQPTEVDIGSLGYQEKKNLIERLVRVAEEDNEKFLLKLKNRIERVGIDLPTIEVRFEHLN  123

Query  2754  VGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLG  2578
             + A+AYVG RALP++ NF  NI EG L++L+ LP+ KK   IL DVSGIIKP RMTLLLG
Sbjct  124   INADAYVGSRALPTIFNFTANIFEGFLNFLHILPSRKKPLCILHDVSGIIKPSRMTLLLG  183

Query  2577  PPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARE  2398
             PPSSGKT+LLLALAG+LDP L+ SGRV+YNGH M+EFVP RT+AYISQHDLHI EMT RE
Sbjct  184   PPSSGKTTLLLALAGKLDPDLKVSGRVTYNGHGMDEFVPQRTSAYISQHDLHIGEMTVRE  243

Query  2397  TLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKV  2218
             TLAFSARCQGVG+RY+ML ELSRREKAANI+PDPDIDI+MKAA  +GQ+A+V+ DYI+K+
Sbjct  244   TLAFSARCQGVGARYDMLTELSRREKAANIKPDPDIDIYMKAATLEGQEASVVTDYILKI  303

Query  2217  LGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKS  2038
             LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTT+QI+ S
Sbjct  304   LGLDVCADTMVGDEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTYQIVSS  363

Query  2037  IKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPE  1858
             ++  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+GQ+VYQGP   VL+FFE +GF+CPE
Sbjct  364   LRQSIHILNGTAVISLLQPAPETYNLFDDIILLSDGQVVYQGPREHVLDFFESMGFKCPE  423

Query  1857  RKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQK  1678
             RKGVADFLQEVTS+KDQ QYW RK ++PYRFVT+ EF+EAFQSFH+G+ LGDEL+TPF K
Sbjct  424   RKGVADFLQEVTSKKDQKQYWARK-HEPYRFVTVKEFAEAFQSFHVGQKLGDELSTPFDK  482

Query  1677  STSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRT  1498
             + SHPAALTTK YGVSK EL K+  SRE+LLMKRN  ++IF++  + +MA ITMTLF+RT
Sbjct  483   TKSHPAALTTKKYGVSKKELFKASMSREILLMKRNSFVYIFKMTQLAIMAFITMTLFLRT  542

Query  1497  NMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPT  1318
              M R+      IY+ +LFF L  +MF+ L E++ TI +LP+FYKQRDLLF+PAWAY++PT
Sbjct  543   KMHRDDSTDGGIYLGALFFALITLMFNGLSEISMTIAKLPVFYKQRDLLFFPAWAYSLPT  602

Query  1317  FILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSM  1138
             +IL+IPIT IE  +WVF TYYVIG+DPN  R  + + LL++  Q+AS LFR     GR+M
Sbjct  603   WILKIPITFIEAGIWVFITYYVIGFDPNVERFFRQYFLLLLINQMASALFRFIGATGRNM  662

Query  1137  TNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTV  958
               A   G+F +L    LGGFILSR+DVK WWIWGYWISPLMY QNAI+VNEFLGK+W  V
Sbjct  663   IVANTFGAFAVLTFVVLGGFILSRNDVKNWWIWGYWISPLMYGQNAISVNEFLGKNWRHV  722

Query  957   LPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANI  778
             LP S+EP GV V+K RG FPEA+WYW+GVGA IG+      +YT+AL  L P  + +A +
Sbjct  723   LPNSTEPLGVTVIKSRGFFPEAHWYWIGVGATIGYMFLFNILYTVALHYLDPFGKPQAIL  782

Query  777   --------------SAESHSNEHDVSNGGSDNSVG-------ERVSDGMSNRKHGMILPF  661
                           S E  S+ H  S    D  +G        R+ +   NRK GM+LPF
Sbjct  783   PEGEARTGEDNELSSLEMTSSGHTTSGEQKDGIIGVASESSSARIDEVSQNRKRGMVLPF  842

Query  660   EPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  481
             +P SI F++I+Y VDMPQEMK +GV ++RLELLKGVSG+FRPGVLTALMGVSGAGKTTLM
Sbjct  843   QPLSITFDEIRYFVDMPQEMKDQGVTEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLM  902

Query  480   DVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLP  301
             DVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQNDIHSPH+TVYES+++SAWLRLP
Sbjct  903   DVLAGRKTGGYIEGSITISGYPKKQETFARISGYCEQNDIHSPHVTVYESILYSAWLRLP  962

Query  300   SEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFM  121
             S+V   TRK+FI+EVMELVEL SLR A+VGLPGVNGLST QRKRLTIAVELVANPSIIFM
Sbjct  963   SDVEPSTRKMFIEEVMELVELNSLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1022

Query  120   DEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1023  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1062


 Score =   135 bits (339),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 144/629 (23%), Positives = 266/629 (42%), Gaps = 77/629 (12%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   
Sbjct  868   TEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGSITISGYPKK  926

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R + Y  Q+D+H P +T  E++ +SA       R     E S R+          
Sbjct  927   QETFARISGYCEQNDIHSPHVTVYESILYSAWL-----RLPSDVEPSTRK----------  971

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
                             + ++ +++++ L      +VG   + G+S  +RKRLT    LV 
Sbjct  972   ----------------MFIEEVMELVELNSLRGALVGLPGVNGLSTEQRKRLTIAVELVA  1015

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  
Sbjct  1016  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKR  1074

Query  1932  G-QIVYQGP-----CNCVLEFFECLGF-RCPERKGVADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + +Y GP     C+ +  F E  G  +       A ++ EVT+         +++   
Sbjct  1075  GGEEIYVGPLGHNSCHLIKYFEEIEGVSKIKYGYNPATWMLEVTTVA-------QEETLG  1127

Query  1773  YRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSRE  1594
               F  + + SE ++     ++L  EL+TP     S      TK Y  S      +C  ++
Sbjct  1128  VSFADVYKNSELYRR---NKSLIQELSTP--PPGSKDLYFPTK-YSQSFFTQCMACLWKQ  1181

Query  1593  VLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSA  1414
                  RN         +   +AL+  T+F     +R+        M S++  +  +    
Sbjct  1182  HWSYWRNPPYIAVRFIFTTFIALLFGTIFWDLGSKRSRQQDLFNAMGSMYAAVLFLGIQN  1241

Query  1413  LQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
                + P +     +FY++R    Y A  YA    ++ IP   ++  V+    Y +IG++ 
Sbjct  1242  ASSVQPVVAVERTVFYRERAAGMYSALPYAFGQVMIEIPHIFVQAVVYGVIVYAMIGFEW  1301

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRS--AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRD  1063
                +    W L  ++  L    F    A  V  +   A +V S    +     GFI+ R 
Sbjct  1302  TAAKFF--WYLFFMYFTLLYFTFYGMMAVAVTPNHNVAAIVSSAFYGIWNLFSGFIVPRT  1359

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLVLKYRGLFP  898
              +  WW W YWI P+ +    +  ++F       ++  TV  F    FG     +R  F 
Sbjct  1360  RMPVWWRWYYWICPVAWTLYGLVASQFGDIQDKIETDQTVEEFLRSYFG-----FRHDF-  1413

Query  897   EAYWYWLGV--GALIGFTIFSIFIYTLAL  817
                   LGV    +IGFT+   FI+  ++
Sbjct  1414  ------LGVVSAVIIGFTVLFAFIFAFSI  1436



>ref|XP_002514350.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF48304.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1449

 Score =  1456 bits (3768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1070 (66%), Positives = 860/1070 (80%), Gaps = 32/1070 (3%)
 Frame = -2

Query  3129  NDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKG  2953
             N    R GS R++SS +W N T + F+KSSR    D+DDE ALKWAAL+K+PT+ R+++G
Sbjct  3     NADTPRVGSARLSSSDIWRNTTLEIFSKSSR----DEDDEEALKWAALEKLPTYLRIRRG  58

Query  2952  LMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEV  2773
             ++    G++ E+DIN++G  EK+ +LERL+K+ E DNE FLLKLKDR+++V +D+P +EV
Sbjct  59    ILIEQGGQSREIDINSLGLIEKRNLLERLVKIAEEDNEKFLLKLKDRIDKVGLDMPTIEV  118

Query  2772  RFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGR  2596
             RFEHL+V AEAYVG RALP++ NF +N+ E  L+YL+ LP+ KK  SIL DVSGIIKP R
Sbjct  119   RFEHLSVEAEAYVGSRALPTMFNFSVNMFEAFLNYLHILPSRKKPLSILNDVSGIIKPRR  178

Query  2595  MTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIP  2416
             MTLLLGPPSSGKT+LLLALAG+L   L+FSGRV+YNGH M EFVP RT+AYISQ+D+HI 
Sbjct  179   MTLLLGPPSSGKTTLLLALAGKLTKDLKFSGRVTYNGHGMEEFVPQRTSAYISQYDIHIG  238

Query  2415  EMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIV  2236
             EMT RETLAFSARCQGVGSRYEML EL+RREK ANI+PDPDIDI+MKAAA +GQ+ANV+ 
Sbjct  239   EMTVRETLAFSARCQGVGSRYEMLMELARREKEANIKPDPDIDIYMKAAALEGQEANVVT  298

Query  2235  DYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTT  2056
             DYI+K+LGLE C DT+VG+E  RG+SGG++KR+T GEMLVGPA  L MDEISTGLDS+TT
Sbjct  299   DYILKILGLELCADTLVGDEMARGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSTTT  358

Query  2055  FQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECL  1876
             FQI+ S++  +HIL GTA+IALLQPAPE ++LFDDIIL+S+GQIVYQGP   VL+FFE +
Sbjct  359   FQIVNSLRQSVHILSGTALIALLQPAPETFELFDDIILLSDGQIVYQGPRENVLDFFEYM  418

Query  1875  GFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDEL  1696
             GF+CPERKGVADFLQEVTSRKDQ QYW  KD +PY FV++NEFSEAFQSFHIGR LGDEL
Sbjct  419   GFKCPERKGVADFLQEVTSRKDQEQYWAHKD-QPYLFVSVNEFSEAFQSFHIGRKLGDEL  477

Query  1695  ATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITM  1516
             ATPF KS +HP +LTTK YGVSK EL K+C SRE LLMKRN  ++IF++  ++++  ITM
Sbjct  478   ATPFDKSKAHPDSLTTKKYGVSKKELFKACISREYLLMKRNSFVYIFKMTQLIILGFITM  537

Query  1515  TLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAW  1336
             TLF+RT M RN+     +Y+ +LFFT+T IMF+   ELA TI +LP+FYKQRDLLFYP+W
Sbjct  538   TLFLRTEMHRNTETDGGVYLGALFFTVTTIMFNGFSELAMTILKLPVFYKQRDLLFYPSW  597

Query  1335  AYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAA  1156
             AYA+PT+IL+IPIT +EV+VWV  TYYVIG+DPN  R  K +++L+I  Q+AS LFR  A
Sbjct  598   AYALPTWILKIPITFVEVAVWVVMTYYVIGFDPNIQRFFKQYLILLITNQMASALFRLTA  657

Query  1155  VVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLG  976
              +GR++  A  VG+F ML    LGGF++SRD+VKKWWIWGYW SP+MY QNAI+VNEFLG
Sbjct  658   ALGRNIIVANTVGAFAMLTALVLGGFVISRDNVKKWWIWGYWFSPMMYVQNAISVNEFLG  717

Query  975   KSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLA  796
              SWN   P S++P GV +LK RGLFPEAYWYW+G GAL G+     F++TLAL  L P  
Sbjct  718   SSWNHFPPNSTKPLGVTLLKSRGLFPEAYWYWIGFGALTGYIFLFNFLFTLALKYLDPFG  777

Query  795   QSRANISAESHSNE-------------------------HDVSNGGSDNSVGERVSDGMS  691
             + +A IS E++S +                         H V++  + ++    +S+   
Sbjct  778   KPQAIISKEAYSEKTAVRTGEFIELSSKEKNFQERGSASHRVASSRTSSARVSSLSNAFE  837

Query  690   NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMG  511
             N K GM+LPF+P SI F D++Y V MPQEMK +G+ ++RLELLKGVSGAFRPGVLTALMG
Sbjct  838   NSKRGMVLPFQPLSITFADVRYAVQMPQEMKTQGITEDRLELLKGVSGAFRPGVLTALMG  897

Query  510   VSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYES  331
             VSGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQ DIHSPH+TVYES
Sbjct  898   VSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARISGYCEQTDIHSPHVTVYES  957

Query  330   LIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVE  151
             L++SAWLRLP EV  +TR +F++EVMELVELTSLREA+VGLPGVNGLS  QRKRLT+AVE
Sbjct  958   LLYSAWLRLPPEVDSDTRNMFVEEVMELVELTSLREALVGLPGVNGLSVEQRKRLTVAVE  1017

Query  150   LVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             LVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1018  LVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1067


 Score =   146 bits (369),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 127/573 (22%), Positives = 249/573 (43%), Gaps = 70/573 (12%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   
Sbjct  873   TEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKK  931

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R + Y  Q D+H P +T  E+L +SA                       +R  P+
Sbjct  932   QETFARISGYCEQTDIHSPHVTVYESLLYSAW----------------------LRLPPE  969

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
             +D             N+ V+ +++++ L    + +VG   + G+S  +RKRLT    LV 
Sbjct  970   VD---------SDTRNMFVEEVMELVELTSLREALVGLPGVNGLSVEQRKRLTVAVELVA  1020

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  
Sbjct  1021  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKR  1079

Query  1932  G-QIVYQGP-----CNCVLEFFECLGF-RCPERKGVADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + +Y GP     C+ +  F +  G  +  +    A ++ EVT+   ++   +      
Sbjct  1080  GGEEIYVGPVGRHACHLIKYFEDIEGIPKIKDGYNPATWMLEVTTTAQEVALGVD-----  1134

Query  1773  YRFVTINEFSEAFQSFHIGRNLGDELATPFQKS------TSHPAALTTKTYGVSKMELLK  1612
               F  I + SE ++     + L  EL+ P   S      T +  + TT+           
Sbjct  1135  --FSDIYKNSELYRK---NKALIKELSRPLPGSKDLYFPTQYSKSFTTQC---------M  1180

Query  1611  SCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLT  1432
             +C  ++     RN       + +   +AL+  T+F +   +R+        M S++  + 
Sbjct  1181  ACLWKQHWSYWRNPPYTAVRLVFATFIALMFGTIFWKLGTKRSRRQDIFNAMGSMYAAVL  1240

Query  1431  VIMFSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYY  1255
              + F     + P +     +FY++R    Y A AYA    ++ +P   I+  ++    Y 
Sbjct  1241  FLGFHNSTAVQPVVAIERTVFYRERAAGMYSALAYAFGQVMIEVPYILIQTIIYGVIVYA  1300

Query  1254  VIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGG  1081
             ++G++    +    W L  ++  L    F     V  +  +  A +V S    +     G
Sbjct  1301  MVGFEWTISKFF--WYLFFMYFTLLYFTFYGMMNVAITPNHNIAAIVSSAFYAIWNIFSG  1358

Query  1080  FILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             FI+ R  +  WW W YW  P+ +    +  ++F
Sbjct  1359  FIVPRTRIPIWWRWYYWACPIAWTLYGLVASQF  1391



>ref|XP_010910610.1| PREDICTED: pleiotropic drug resistance protein 3-like [Elaeis 
guineensis]
Length=1451

 Score =  1455 bits (3766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 719/1079 (67%), Positives = 864/1079 (80%), Gaps = 40/1079 (4%)
 Frame = -2

Query  3147  VVAMEINDSRGRSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             + +ME  D   R GS R  SSS+W  G D F++SSR    D+DDE ALKWAAL+K+PT+D
Sbjct  1     MASMEAGDVY-RVGSMR-RSSSIWRRGDDIFSRSSR----DEDDEEALKWAALEKLPTYD  54

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             R+++G++T   GE+ EVDI  +G +E+  +LERL++V E DNE FLLKL+DR++RV +D+
Sbjct  55    RVRRGILTLAEGESKEVDIQKLGLQERNALLERLVRVAEEDNERFLLKLRDRIDRVGLDL  114

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVR+EHLN+ AE YVG R LP++ N  +N+LE   +Y + LP+ K+   IL DVSGI
Sbjct  115   PTIEVRYEHLNIQAETYVGNRGLPTILNSIVNVLESAANYFHILPSRKRSLPILHDVSGI  174

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKP RMTLLLGPP SGKT+LLLALAG+LD  L+ SGRV+YNGH M EFVP RTAAYISQH
Sbjct  175   IKPQRMTLLLGPPGSGKTTLLLALAGKLDSDLKVSGRVTYNGHGMEEFVPQRTAAYISQH  234

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRYEML ELSRREKAANI+PDPDID+FMKAAA DGQK
Sbjct  235   DLHIGEMTVRETLAFSARCQGVGSRYEMLTELSRREKAANIKPDPDIDVFMKAAAMDGQK  294

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ++V+ DYI+KVLGLE C DT+VG+E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGL
Sbjct  295   SSVVTDYILKVLGLEICADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGL  354

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTTFQI+ S++  IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQ+VYQGP   VLE
Sbjct  355   DSSTTFQIVNSLRQSIHILGGTAVISLLQPAPETYDLFDDIILLSDGQVVYQGPREHVLE  414

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FFE +GF+CPERKGVADFLQEVTSRKDQ QYW R  ++ YR+V + EF+EAFQSFH+G++
Sbjct  415   FFESMGFKCPERKGVADFLQEVTSRKDQQQYWARH-HENYRYVPVKEFAEAFQSFHVGQD  473

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             +G+EL+ P+ KS +HPAALTT  YGVSK ELLK+  +RE+LLMKRN  ++IF+   +++M
Sbjct  474   IGNELSIPYDKSKNHPAALTTSNYGVSKEELLKANLARELLLMKRNSFVYIFKATQLIIM  533

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             ALITMT+F+RTNM R+S     IYM +LFF +  IMF+   ELA TI +LP+F+KQRDLL
Sbjct  534   ALITMTIFLRTNMHRDSVTDGGIYMGALFFGIVTIMFNGFSELAMTILKLPVFFKQRDLL  593

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAW+Y IPT+IL+IPI+  EV VWVF+TYYVIG+DPN GRL K ++LL+   Q+AS L
Sbjct  594   FYPAWSYTIPTWILKIPISFAEVGVWVFTTYYVIGFDPNVGRLFKQYLLLLAINQMASAL  653

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR+M  A   GSF +L+L  LGGFILSR+DVKKWWIWGYWISPLMYAQNAI+ 
Sbjct  654   FRFIAALGRNMIVANTFGSFALLILLVLGGFILSREDVKKWWIWGYWISPLMYAQNAIST  713

Query  990   NEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAK  811
             NEFLGKSW+  L  S E  GVLVLK RG+FPEA WYW+G GALIG+ +    ++T+AL  
Sbjct  714   NEFLGKSWSHSLG-SKETLGVLVLKSRGVFPEAKWYWIGFGALIGYVLLFNALFTVALTY  772

Query  810   LRPLAQSRANISAES----HSN----------------EHDVSNGGSD---------NSV  718
             L+P  +++  +S E+    H+N                +H  S  G+D         NS 
Sbjct  773   LKPFGKAQPAMSEETLKEKHANLTGEVLESSSRGRNSVDHFASGNGADEMRRSNTSSNST  832

Query  717   GERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFR  538
              E V+   +  K GM+LPF P SI F+DI+Y VDMPQEMK +GV ++RLELLKGVSG+FR
Sbjct  833   NEVVNS--NQNKKGMVLPFVPLSITFDDIRYSVDMPQEMKAQGVTEDRLELLKGVSGSFR  890

Query  537   PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIH  358
             PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFAR+SGYCEQNDIH
Sbjct  891   PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARVSGYCEQNDIH  950

Query  357   SPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQ  178
             SPH+TVYESL++SAWLRLPSEV   TRK+FI+EVMELVELTSLR+A+VGLPGVNGLST Q
Sbjct  951   SPHVTVYESLVYSAWLRLPSEVDSATRKIFIEEVMELVELTSLRDALVGLPGVNGLSTEQ  1010

Query  177   RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             RKRLTIAVELVANPSII MDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1011  RKRLTIAVELVANPSIISMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1069


 Score =   134 bits (336),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 127/572 (22%), Positives = 244/572 (43%), Gaps = 68/572 (12%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   
Sbjct  875   TEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKK  933

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R + Y  Q+D+H P +T  E+L +SA  +                          
Sbjct  934   QETFARVSGYCEQNDIHSPHVTVYESLVYSAWLR--------------------------  967

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
                    +  D     + ++ +++++ L    D +VG   + G+S  +RKRLT    LV 
Sbjct  968   -----LPSEVDSATRKIFIEEVMELVELTSLRDALVGLPGVNGLSTEQRKRLTIAVELVA  1022

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  
Sbjct  1023  NPSIISMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKR  1081

Query  1932  G-QIVYQGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + +Y GP    +C ++ +FE +      + G   A ++ EVT+   +           
Sbjct  1082  GGEEIYVGPLGRHSCHLISYFEGIEGVSKIKDGYNPATWMLEVTTLAQE-----------  1130

Query  1773  YRFVTINEFSEAFQS---FHIGRNLGDELATPFQKSTS--HPAALTTKTYGVSKMELLKS  1609
                + +N FSEA+++   +   +NL  EL+TP   S+    P+  +   +      L K 
Sbjct  1131  -EILGVN-FSEAYKNSELYQRNKNLIKELSTPPPGSSDLYFPSQYSQNFFTQCMANLWKQ  1188

Query  1608  CFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTV  1429
               S       RN         +  ++AL+  T+F     +RNS       M S++  +  
Sbjct  1189  NLS-----YWRNPPYTAVRFFFTTIIALLFGTIFWDLGTKRNSQQDLFNAMGSMYAAVLF  1243

Query  1428  IMFSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYV  1252
             +       + P +     +FY++R    Y A  YA     + IP   I+  ++    Y +
Sbjct  1244  LGVQNASSVQPVVAIERTVFYRERAAGMYSALPYAFGQVAIEIPYILIQSLIYGVIVYAM  1303

Query  1251  IGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGF  1078
             I ++    +      +  ++  L    F     VG +     A +V S    +     GF
Sbjct  1304  IAFEWTAAKFFWY--MFFMYFTLLYFTFYGMMAVGLTPNQNIASIVSSAFYAIWNLFSGF  1361

Query  1077  ILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             I+ R  +  WW W YW  P+ +    +  ++F
Sbjct  1362  IIPRPRIPVWWRWYYWACPVSWTLYGLVASQF  1393



>ref|XP_011020597.1| PREDICTED: pleiotropic drug resistance protein 1-like [Populus 
euphratica]
Length=1432

 Score =  1455 bits (3766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 715/1056 (68%), Positives = 855/1056 (81%), Gaps = 16/1056 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNG-TDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D   R+ S +   SSLW+N  +D F+KSSR    D+DDE ALKWAA++++PTF+RL
Sbjct  1     MEGADDIYRACSLQRGGSSLWTNNVSDAFSKSSR----DEDDEEALKWAAIERLPTFNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+   +G   E+ I N+G  E+K +LERLI V E DNE FL KLK R+ERV ID+P 
Sbjct  57    QKGLLATSKGAN-EIYIQNLGIHERKGLLERLIDVSEEDNEKFLKKLKSRIERVGIDLPT  115

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIK  2605
             +EVRFEHLN+ AEA+ G RALPS+ NFC++  EG  +YL++ P+ KK  SIL DVSGIIK
Sbjct  116   IEVRFEHLNIKAEAHEGSRALPSMINFCVDFAEGFFNYLHIIPSKKKQVSILEDVSGIIK  175

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLALAG+LDP+L+FSGRV+YNGH MNEFVP R+AAYISQ+D 
Sbjct  176   PSRMTLLLGPPSSGKTTLLLALAGKLDPNLKFSGRVTYNGHGMNEFVPQRSAAYISQYDT  235

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             H+ EMT RETLAF+ARCQGVG RYEMLAELSRREK A+I+PDPDID+FMKA AT+GQK +
Sbjct  236   HLGEMTVRETLAFAARCQGVGHRYEMLAELSRREKEASIKPDPDIDVFMKAIATEGQKTS  295

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DYIIK+LGLE C D IVG+E +RG+SGG+RKR+T GEMLVGPA  L MDEISTGLDS
Sbjct  296   VMTDYIIKILGLEVCADIIVGSEMVRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDS  355

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S+KH IHIL+GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+FF
Sbjct  356   STTFQIVNSLKHTIHILNGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLQFF  415

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQE+TSRKDQ QYW+ KD KPY FVT+ EF+EAFQSFH+G  +G
Sbjct  416   ESMGFKCPERKGVADFLQEITSRKDQQQYWMHKD-KPYSFVTVKEFAEAFQSFHVGCRIG  474

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             D L+TPF+KS SHPAAL T+ YGV KMELLK+CFSRE LLMKRN  ++ F++  + +M++
Sbjct  475   DALSTPFEKSQSHPAALKTRKYGVGKMELLKACFSREWLLMKRNSFVYFFKLAQLTMMSI  534

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF RT M +NS     +Y  +LF++L ++MF  + E++ TI  LP+FYKQRDLLFY
Sbjct  535   IAMTLFFRTEMHKNSVSEGGVYSGALFYSLALMMFIGMPEISMTIGSLPVFYKQRDLLFY  594

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WA+++P++ILRIP+T I+ ++WV  TYYVIGYDPN GRL K ++LL+   Q+AS LFR
Sbjct  595   PSWAFSLPSWILRIPVTLIQTTIWVALTYYVIGYDPNVGRLFKQYLLLVAVSQMASALFR  654

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                 +GRSM  A   GSF +LVLFALGGF+LS  ++KKWWIWGYWISPLMY QNAI VNE
Sbjct  655   FIGGLGRSMIVANTFGSFALLVLFALGGFVLSHGEIKKWWIWGYWISPLMYGQNAIVVNE  714

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW+ VLP S EP G+ VLK RG    AYWYW+GVGAL GFTI     YTLALA L 
Sbjct  715   FLGKSWSHVLPNSVEPLGIEVLKSRGFVTNAYWYWIGVGALGGFTILFNVCYTLALAFLN  774

Query  804   PLAQSRANISAESHSNEHDVS--------NGGSDNSVGERVSDGMSNRKHGMILPFEPHS  649
             P  +S+  IS +S S +  V+        +G    +  E +S+  + ++ GMILPFEP S
Sbjct  775   PFRKSQVVISKDSESIKPGVTGGAIQLSKHGSRHQNDTEIISEANNQKQKGMILPFEPFS  834

Query  648   IAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA  469
             I F++IKY VDMPQEMK +G+ +++LELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA
Sbjct  835   ITFDEIKYSVDMPQEMKNQGILEDKLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA  894

Query  468   GRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVT  289
             GRKTGGYIEG ITISG  KKQ+TFARISGYCEQNDIHSPH+TVYESL++S WLRLP EV 
Sbjct  895   GRKTGGYIEGNITISGHPKKQETFARISGYCEQNDIHSPHVTVYESLLYSGWLRLPLEVD  954

Query  288   CETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPT  109
              ETR +FI+EVMELVEL  LR+A+VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPT
Sbjct  955   AETRNMFIEEVMELVELNPLRQALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPT  1014

Query  108   SGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  SGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1050


 Score =   120 bits (302),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 125/583 (21%), Positives = 245/583 (42%), Gaps = 77/583 (13%)
 Frame = -2

Query  2661  LPTTKKHNSILRD-------VSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSG  2503
             +P   K+  IL D       VSG  +PG +T L+G   +GKT+L+  LAG+        G
Sbjct  846   MPQEMKNQGILEDKLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEG  904

Query  2502  RVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRRE  2323
              ++ +GH   +    R + Y  Q+D+H P +T  E+L +S   +                
Sbjct  905   NITISGHPKKQETFARISGYCEQNDIHSPHVTVYESLLYSGWLR----------------  948

Query  2322  KAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERK  2143
                                 D +  N+ ++ +++++ L      +VG   + G+S  +RK
Sbjct  949   ---------------LPLEVDAETRNMFIEEVMELVELNPLRQALVGLPGVSGLSTEQRK  993

Query  2142  RLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYD  1963
             RLT    LV   +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++
Sbjct  994   RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFE  1052

Query  1962  LFDDIILISEG-QIVYQGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQM  1804
              FD++ L+  G Q +Y GP     + ++++FE +      R G   A ++ +VTS   + 
Sbjct  1053  SFDELFLMKRGGQEIYVGPLGRHSSQLIKYFEGIEGVEKIRDGYNPATWMLDVTSLGHEA  1112

Query  1803  QYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG--DELATPFQKSTSHPAALTTKTYGVS  1630
                I        F +I + SE ++     RN     EL+TP   S           Y  S
Sbjct  1113  ALGID-------FASIYKNSELYR-----RNKARIQELSTPAPGSKD---LFFPTQYSQS  1157

Query  1629  KMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSS  1450
              +    +C  ++     RN       + + + +ALI  ++F     +          M S
Sbjct  1158  FLVQCLACLWKQHWSYWRNPSYTAVRLLFTIAIALIFGSMFWNLGSKTKKKQDLFNAMGS  1217

Query  1449  LFFTLTVIMFSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVW  1273
             ++  +  +       + P +     +FY+++    Y +  YA+   ++ +P    +  V+
Sbjct  1218  MYAAIIFLGIQNSSSVQPVVAVERTVFYREKAAGMYSSMPYALAQILIELPYIFTQSVVY  1277

Query  1272  VFSTYYVIGYDPNFGRLLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSF  1111
                 Y +IG++    +           +L   F  + +V       V   +++AF    +
Sbjct  1278  GLIVYAMIGFEWTTAKFFWYLFFMFFTLLYFTFYGMMTVAATPNQHVASIVSSAF----Y  1333

Query  1110  IMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  LF+  GFI+ R  +  WW W  WI P+ +    +  +++
Sbjct  1334  SVWNLFS--GFIIPRPRIPVWWRWYAWICPVSWTLYGLISSQY  1374



>ref|XP_003528365.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine 
max]
 gb|KHN01359.1| Pleiotropic drug resistance protein 1 [Glycine soja]
Length=1426

 Score =  1451 bits (3756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 711/1050 (68%), Positives = 867/1050 (83%), Gaps = 11/1050 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D      S R NSS++W N   + F++SSR   E+D+DE ALKWAAL+K+PT++RL
Sbjct  1     MEGSDIYRARNSLRANSSTVWRNSIMEAFSRSSR--HEEDNDEEALKWAALEKLPTYNRL  58

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T  RG   E+DI  +G++E++K+L+RLI V E DNET LLKLK+R++RV IDIP 
Sbjct  59    RKGLLTTSRGVANEIDITELGFQERQKLLDRLINVAEEDNETLLLKLKERIDRVGIDIPT  118

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVR+EHLNV AEAYVG RALP+  NF  N++E   + L+ L   KKH +ILRDVSGIIK
Sbjct  119   IEVRYEHLNVEAEAYVGSRALPTFLNFVTNMVESFFTSLHILSGKKKHVTILRDVSGIIK  178

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RM LLLGPPSSGKT+LLLAL+G+LDP+L+ SGRV+YNGHEMNEFVP RTAAYISQHD+
Sbjct  179   PRRMALLLGPPSSGKTTLLLALSGKLDPTLKVSGRVNYNGHEMNEFVPQRTAAYISQHDV  238

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+RY++L+EL+RREK A I+PDPDID++MKAAAT GQ+A+
Sbjct  239   HIGEMTVRETLAFSARCQGVGTRYDLLSELARREKEAKIKPDPDIDVYMKAAATGGQEAS  298

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             ++ DY++K+LGL+ C DT++G+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  299   LVTDYVLKILGLDICADTMMGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  358

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+KS++ Y+HIL+GTAVI+LLQPAPE Y+LFDDI+LIS+GQIVYQGP   VLEFF
Sbjct  359   STTFQIVKSLRQYVHILNGTAVISLLQPAPETYELFDDIVLISDGQIVYQGPREYVLEFF  418

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTSRKDQ QYWI +D + YRFVT+ EF+EAFQSFH+GR +G
Sbjct  419   EYVGFQCPERKGVADFLQEVTSRKDQEQYWIHRD-ESYRFVTVTEFAEAFQSFHVGRRIG  477

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +ELATPF KS SHPAALTTK YGV+K ELLK+ FSRE LLMKRN  ++IF++  + ++A+
Sbjct  478   EELATPFDKSKSHPAALTTKKYGVNKKELLKANFSREYLLMKRNSFVYIFKLFQLTILAI  537

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             +TMT+F+RT M RNS     +Y  +LFF + ++MF+ L E++ TI +LPIFYKQRDLLFY
Sbjct  538   LTMTMFLRTEMHRNSLNDGGVYTGALFFAVVILMFNGLAEISMTIVKLPIFYKQRDLLFY  597

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IPIT IE +VWVF TYYVIG+DPN GRLLK +++L++  Q++S LFR
Sbjct  598   PSWAYAIPSWILKIPITFIEAAVWVFLTYYVIGFDPNVGRLLKQYLVLLLINQMSSGLFR  657

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   GSF +LVLFALGGF+LSR+D+K WWIWGYWISPLMY QNAI VNE
Sbjct  658   AIAALGRNMIVASTFGSFALLVLFALGGFVLSRNDIKNWWIWGYWISPLMYGQNAIVVNE  717

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG SWN   P S++  G+ +L+ RG F  AYWYW+G+GALIGF I    IYTLAL  L 
Sbjct  718   FLGDSWNHFTPNSNKTLGIQILESRGFFTHAYWYWIGIGALIGFMILFNIIYTLALTYLN  777

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSVGERVS--DGMSNRKHGMILPFEPHSIAFNDI  631
             P    +  I+ ES S    ++NG ++ S G  ++       +K GMILPFEP+SI F+ I
Sbjct  778   PYDTPQTTITEESESG---MTNGIAE-SAGRAIAVMSSSHKKKRGMILPFEPYSITFDQI  833

Query  630   KYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG  451
              Y VDMP EMK +GV ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG
Sbjct  834   VYSVDMPLEMKDQGVREDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG  893

Query  450   YIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKL  271
             YIEG I +SG+ K+Q+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLP+EV   TRK+
Sbjct  894   YIEGNIKVSGYPKRQETFARISGYCEQNDIHSPHVTVYESLVYSAWLRLPAEVEAYTRKM  953

Query  270   FIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDAR  91
             FI+EVMELVEL  LR ++VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDAR
Sbjct  954   FIEEVMELVELNPLRNSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDAR  1013

Query  90    AAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1014  AAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1043


 Score =   129 bits (323),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 120/573 (21%), Positives = 248/573 (43%), Gaps = 82/573 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  855   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNIKVSGYPKRQETFAR  913

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   +++ + +
Sbjct  914   ISGYCEQNDIHSPHVTVYESLVYSAW----------------------LRLPAEVEAYTR  951

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                       + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  952   ---------KMFIEEVMELVELNPLRNSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1002

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+   GQ +Y
Sbjct  1003  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1061

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EVT+   ++   +            
Sbjct  1062  VGPLGRHSSQMIKYFESIEGVGKIKDGYNPATWMLEVTTPAQELNLGV------------  1109

Query  1755  NEFSEAFQSFHIGR---NLGDELATPFQKS------TSHPAALTTKTYGVSKMELLKSCF  1603
              +F E +++  + R    L  EL  P   S      T +P +L  +           +C 
Sbjct  1110  -DFHEIYRNSGLCRRNKRLISELGNPAPGSKDLHFPTQYPQSLLVQCL---------ACL  1159

Query  1602  SREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIM  1423
              ++     RN            + A++  T+F     + +S       M S++     ++
Sbjct  1160  WKQHWSYWRNPPYTAVRFLSTTVTAVLFGTMFWDLGGKYSSRQDLFNAMGSMY---NAVL  1216

Query  1422  FSALQELA---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYY  1255
             F  +Q  A   P +     +FY++R    Y A  YA+   I+ +P   ++ + +    Y 
Sbjct  1217  FVGVQNSASVQPVVAIERTVFYRERAAGMYSALPYALAQVIIELPYVFVQATSYSVIVYA  1276

Query  1254  VIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGG  1081
             ++G++    +    W +  ++  L    F     V  +  +  A VV S    +     G
Sbjct  1277  MMGFEWTLQKFF--WYVFFMYFTLCYFTFYGMMTVAVTPNHHVASVVASAFYGIWNLFSG  1334

Query  1080  FILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             F+++R  +  WW W YW  P+ +    +  ++F
Sbjct  1335  FVIARPSIPVWWRWYYWACPVAWTIYGLVASQF  1367



>gb|KCW59814.1| hypothetical protein EUGRSUZ_H02560 [Eucalyptus grandis]
Length=1386

 Score =  1445 bits (3741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 713/1065 (67%), Positives = 854/1065 (80%), Gaps = 25/1065 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             M+  D      S R  SS+ W N     D F++SSR    D+DDE AL+WAAL+K+PTF 
Sbjct  1     MDGGDIYRAGNSLRATSSTSWRNQASMADVFSRSSR----DEDDEEALRWAALEKLPTFK  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   +VDI N+G+ ++K +LERL++V E DNE FLLKL++R++RV ID+
Sbjct  57    RLQKGILTAGGGAN-QVDIWNLGFHDRKGLLERLLRVTEEDNEGFLLKLRNRIDRVGIDV  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRFEHLNV A+A+ G RALP+  NFC +ILEG L++L+ LP+ KKH +IL+DVSGI
Sbjct  116   PTIEVRFEHLNVEADAHEGSRALPTFINFCTSILEGFLNFLHVLPSRKKHLTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH MNEFVP RTAAYISQH
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKTTGRVTYNGHVMNEFVPERTAAYISQH  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPDIDIFMKAA T GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDIDIFMKAAVTKGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV+ DYI+K+LGLE C D +VG+E LRG+SGG+RKR+T GEMLVGPA V LMDEISTGL
Sbjct  296   ANVVTDYILKILGLEICADAMVGDEMLRGISGGQRKRVTTGEMLVGPAEVFLMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+ S+K +IHIL GTAVI+LLQPAPE YDLFDDIIL+S+ QIVYQGP   VL+
Sbjct  356   DSSTTYQIVNSLKQFIHILDGTAVISLLQPAPETYDLFDDIILLSDSQIVYQGPRELVLD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FFE +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF+EAFQSFH+GR 
Sbjct  416   FFESMGFKCPMRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFAEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  ++ M
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVSQLIFM  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A ++MTLF+RT M R++     IY+ + FFT+ +IMF+ + EL+ TI +LPIFYKQRDLL
Sbjct  535   AFVSMTLFLRTKMHRDTVTDGGIYIGATFFTVMMIMFNGMAELSMTIAKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF TYYV GYDPN GRL K ++LL    Q+AS L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFITYYVTGYDPNVGRLFKQYLLLAAISQMASGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   GSF+MLVLFALGG +LSR+DVKKWWIWGYW SPLMY QNAI V
Sbjct  655   FRLTAALGRNLIVANTFGSFVMLVLFALGGVVLSREDVKKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NEFLG +WN + P SS  EP G+ VLK RG F EAYWYW+G+GAL GF I   F +++AL
Sbjct  715   NEFLGSNWNKIPPNSSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFIIVFNFGFSVAL  774

Query  816   AKLRPLAQSRA--NISAESHSNEHDVSNGGSDNSVGERVSDG-----------MSNRKHG  676
             A L P  +S +  + + E + N   +       S G  + +G            +N K G
Sbjct  775   ALLNPFGKSHSVKSDNPEGNKNVDRIEGSIQLQSRGSSLRNGSGRSSKPETAVAANTKRG  834

Query  675   MILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAG  496
             M+LPFEPHSI F++I Y VDMP+EM  +G  ++RL LLKG SG+FRPGVLTALMGVSGAG
Sbjct  835   MVLPFEPHSITFDEITYSVDMPREMTNQGAPEDRLVLLKGASGSFRPGVLTALMGVSGAG  894

Query  495   KTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSA  316
             KTTLMDVLAGRKTGGYI+G ITISG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+SA
Sbjct  895   KTTLMDVLAGRKTGGYIKGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYESLIYSA  954

Query  315   WLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANP  136
             WLRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVANP
Sbjct  955   WLRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANP  1014

Query  135   SIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1059


 Score =   117 bits (292),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 110/478 (23%), Positives = 214/478 (45%), Gaps = 66/478 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+  SG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  871   LLKGASGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IKGNITISGYPKNQDTFAR  929

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  930   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  963

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  964   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1018

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1019  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1077

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1078  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPAQELALGV------------  1125

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++   +   + L +EL+ P     S      TK Y  S    L +C  ++   
Sbjct  1126  -DFSDLYKNSDLYRRNKALIEELSIP--PPNSKDLYFPTK-YSQSTFTQLMACLWKQHWS  1181

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + V +AL+  T+F     +      +Q  M+++      ++F  +Q 
Sbjct  1182  YWRNPPYTAVRFLFTVFIALMFGTMFWDLGSKTTR---SQDLMNAMGSMYAAVIFLGVQN  1238

Query  1404  LA---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGY  1243
              A   P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+
Sbjct  1239  AASVQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYILVQAISYGIIVYAMIGF  1296



>gb|KCW59813.1| hypothetical protein EUGRSUZ_H02560 [Eucalyptus grandis]
Length=1404

 Score =  1444 bits (3739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 713/1065 (67%), Positives = 854/1065 (80%), Gaps = 25/1065 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             M+  D      S R  SS+ W N     D F++SSR    D+DDE AL+WAAL+K+PTF 
Sbjct  1     MDGGDIYRAGNSLRATSSTSWRNQASMADVFSRSSR----DEDDEEALRWAALEKLPTFK  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   +VDI N+G+ ++K +LERL++V E DNE FLLKL++R++RV ID+
Sbjct  57    RLQKGILTAGGGAN-QVDIWNLGFHDRKGLLERLLRVTEEDNEGFLLKLRNRIDRVGIDV  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRFEHLNV A+A+ G RALP+  NFC +ILEG L++L+ LP+ KKH +IL+DVSGI
Sbjct  116   PTIEVRFEHLNVEADAHEGSRALPTFINFCTSILEGFLNFLHVLPSRKKHLTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH MNEFVP RTAAYISQH
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKTTGRVTYNGHVMNEFVPERTAAYISQH  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPDIDIFMKAA T GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDIDIFMKAAVTKGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV+ DYI+K+LGLE C D +VG+E LRG+SGG+RKR+T GEMLVGPA V LMDEISTGL
Sbjct  296   ANVVTDYILKILGLEICADAMVGDEMLRGISGGQRKRVTTGEMLVGPAEVFLMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+ S+K +IHIL GTAVI+LLQPAPE YDLFDDIIL+S+ QIVYQGP   VL+
Sbjct  356   DSSTTYQIVNSLKQFIHILDGTAVISLLQPAPETYDLFDDIILLSDSQIVYQGPRELVLD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FFE +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF+EAFQSFH+GR 
Sbjct  416   FFESMGFKCPMRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFAEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  ++ M
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVSQLIFM  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A ++MTLF+RT M R++     IY+ + FFT+ +IMF+ + EL+ TI +LPIFYKQRDLL
Sbjct  535   AFVSMTLFLRTKMHRDTVTDGGIYIGATFFTVMMIMFNGMAELSMTIAKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF TYYV GYDPN GRL K ++LL    Q+AS L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFITYYVTGYDPNVGRLFKQYLLLAAISQMASGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   GSF+MLVLFALGG +LSR+DVKKWWIWGYW SPLMY QNAI V
Sbjct  655   FRLTAALGRNLIVANTFGSFVMLVLFALGGVVLSREDVKKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NEFLG +WN + P SS  EP G+ VLK RG F EAYWYW+G+GAL GF I   F +++AL
Sbjct  715   NEFLGSNWNKIPPNSSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFIIVFNFGFSVAL  774

Query  816   AKLRPLAQSRA--NISAESHSNEHDVSNGGSDNSVGERVSDG-----------MSNRKHG  676
             A L P  +S +  + + E + N   +       S G  + +G            +N K G
Sbjct  775   ALLNPFGKSHSVKSDNPEGNKNVDRIEGSIQLQSRGSSLRNGSGRSSKPETAVAANTKRG  834

Query  675   MILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAG  496
             M+LPFEPHSI F++I Y VDMP+EM  +G  ++RL LLKG SG+FRPGVLTALMGVSGAG
Sbjct  835   MVLPFEPHSITFDEITYSVDMPREMTNQGAPEDRLVLLKGASGSFRPGVLTALMGVSGAG  894

Query  495   KTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSA  316
             KTTLMDVLAGRKTGGYI+G ITISG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+SA
Sbjct  895   KTTLMDVLAGRKTGGYIKGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYESLIYSA  954

Query  315   WLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANP  136
             WLRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVANP
Sbjct  955   WLRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANP  1014

Query  135   SIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1059


 Score =   138 bits (347),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 129/569 (23%), Positives = 248/569 (44%), Gaps = 74/569 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+  SG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  871   LLKGASGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IKGNITISGYPKNQDTFAR  929

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  930   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  963

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  964   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1018

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1019  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1077

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1078  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPAQELALGV------------  1125

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++   +   + L +EL+ P     S      TK Y  S    L +C  ++   
Sbjct  1126  -DFSDLYKNSDLYRRNKALIEELSIP--PPNSKDLYFPTK-YSQSTFTQLMACLWKQHWS  1181

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + V +AL+  T+F     +      +Q  M+++      ++F  +Q 
Sbjct  1182  YWRNPPYTAVRFLFTVFIALMFGTMFWDLGSKTTR---SQDLMNAMGSMYAAVIFLGVQN  1238

Query  1404  LA---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
              A   P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+  
Sbjct  1239  AASVQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYILVQAISYGIIVYAMIGFKW  1298

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILS  1069
                +        + F     + F    ++   MT    + S I    +AL     GF++ 
Sbjct  1299  TVAKFFWY----LFFMFFTLLYFTYYGMMAVGMTPNHHIASIISFAFYALWNLFSGFVVP  1354

Query  1068  RDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             R  +  WW W YW  P+ +    + V++F
Sbjct  1355  RTRIPIWWRWYYWACPVSWTLYGLVVSQF  1383



>ref|XP_010023519.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Eucalyptus grandis]
Length=1443

 Score =  1444 bits (3738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/1066 (67%), Positives = 852/1066 (80%), Gaps = 26/1066 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             M+  D      S R  SS+ W N     D F++SSR    D+DDE AL+WAAL+K+PTF 
Sbjct  1     MDGGDIYRAGNSLRATSSTSWRNQASMADVFSRSSR----DEDDEEALRWAALEKLPTFK  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   ++DI N+G+ ++K++LERL++V E DNE FLLKL++R++RV I++
Sbjct  57    RLQKGILTAAGGAN-QIDIWNLGFHDRKRLLERLMRVTEEDNEGFLLKLRNRIDRVGINL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRFEHL V AEAY G RALP+V NFC +ILEG L++L+ LP+ KKH++IL+DVSGI
Sbjct  116   PTIEVRFEHLKVEAEAYEGSRALPTVINFCTSILEGFLNFLHVLPSRKKHSTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH MNEFVP RTAAYISQH
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKTTGRVTYNGHVMNEFVPQRTAAYISQH  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPDIDIFMKAA T GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDIDIFMKAAVTKGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV+ DYI+K+LGLE C D +VG+E LRG+SGG+RKR+T GEMLVGPA V  MDEISTGL
Sbjct  296   ANVVTDYILKILGLEICADAMVGDEMLRGISGGQRKRVTTGEMLVGPAEVFFMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+ S+K +IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+
Sbjct  356   DSSTTYQIVNSLKQFIHILDGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPHELVLD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FFE +GF+CP RK VADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF+EAFQSFH+GR 
Sbjct  416   FFESMGFKCPRRKCVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFAEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  +++M
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVTQLIIM  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A I+MTLF+R  M R++     +Y+ +LFFT+   MF+ + EL+ TI +LPIFYKQRDLL
Sbjct  535   AFISMTLFLRNKMHRDTVTDGGVYIGALFFTMMTFMFNGMAELSMTIAKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF TYYVIGYDPN GRL K ++LL+   Q+AS L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFITYYVIGYDPNVGRLFKQYLLLVAINQMASGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   GSF++L L ALGG +LSR+DVKKWWIWGYW SPLMY QNAI V
Sbjct  655   FRLIAALGRNLIVANTFGSFVLLALVALGGVVLSREDVKKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NE LG +WN + P SS  EP G+ VLK RG F EAYWYW+G+GAL GF I   F +++AL
Sbjct  715   NELLGSNWNKIPPISSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFLILFNFGFSVAL  774

Query  816   AKLRPLAQSRANISAESHSNEHDVSNGGS----DNSVGERVSDGM----------SNRKH  679
             A L P  +S    S +   N++     GS          R   GM          +N K 
Sbjct  775   ALLNPFGKSHTVKSDDPEGNKNVDRIEGSIQLQSRGSSLRTGSGMKSSKPETAVAANTKR  834

Query  678   GMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGA  499
             GM+LPFEPHSI F++I Y VDMP+EM+ +G  + RL LLKGVSG+FRPGVLTALMGVSGA
Sbjct  835   GMVLPFEPHSITFDEITYSVDMPREMENQGAPEERLVLLKGVSGSFRPGVLTALMGVSGA  894

Query  498   GKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFS  319
             GKTTLMDVLAGRKTGGYIEG ITISG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+S
Sbjct  895   GKTTLMDVLAGRKTGGYIEGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYESLIYS  954

Query  318   AWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVAN  139
             AWLRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVAN
Sbjct  955   AWLRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVAN  1014

Query  138   PSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             PSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  PSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1060


 Score =   145 bits (367),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 141/630 (22%), Positives = 273/630 (43%), Gaps = 84/630 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  872   LLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKNQDTFAR  930

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  931   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  964

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  965   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1019

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1020  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1078

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1079  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPGQELALGV------------  1126

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++   +   + L +EL+ P     S      TK Y  S    L +C  ++   
Sbjct  1127  -DFSDLYKNSDLYRRNKALIEELSIP--PPNSKDLYFPTK-YSQSTFTQLMACLWKQRWS  1182

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + +++AL+  T+F     +          M S++  +  +       
Sbjct  1183  YWRNPPYTAVRFLFTIIIALMFGTMFWDLGSKTTRSQDLMNAMGSMYAAVVFLGIQNAAS  1242

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+     
Sbjct  1243  VQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLVQAISYGIIVYAMIGFKWTVA  1302

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDD  1060
             +        + F     + F    ++   MT    + S +    +A+     GFI+ R  
Sbjct  1303  KFFWY----LFFMFFTLLYFTYYGMMALGMTPNQHIASIVSSAFYAIWNLFSGFIVPRTR  1358

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFP  898
             +  WW W YW+ P+ +    + +++F      L  + +TV  +  + FG     YR  F 
Sbjct  1359  IPIWWRWYYWVCPVSWTLYGLVISQFGDLKNRLEDTGDTVEEYMRDYFG-----YRHNFL  1413

Query  897   EAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
              A        A+IGFT+   FI+ +++  L
Sbjct  1414  GAI-----AAAMIGFTMLFAFIFAISIKIL  1438



>emb|CDO98093.1| unnamed protein product [Coffea canephora]
Length=1422

 Score =  1444 bits (3737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1048 (66%), Positives = 856/1048 (82%), Gaps = 11/1048 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             MEI  S    GS R NSS+LW N G + F++SSR    D+DDE ALKWA+L+K+PTFDRL
Sbjct  1     MEIGPSGSLRGSLRANSSALWRNTGLEVFSRSSR----DEDDEEALKWASLEKLPTFDRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+ G RGE  EVD+ N G++E+K +LERL+KV E DNE FL+KL++R++RV ID+P 
Sbjct  57    RKGLLFGSRGEVNEVDVENFGFQERKTLLERLVKVAEEDNEKFLMKLRNRIDRVGIDLPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEHL V AEAYVG  ALP+  NF  N++EG+L+ L+ LP+ KK+  ILRDVSGIIK
Sbjct  117   IEVRFEHLKVDAEAYVGSSALPTFLNFATNMIEGVLNNLHILPSRKKNIKILRDVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPP SGKT+LL+ALAG+LDP L+ SGR++YNGH MNEFVP RTAAY+SQHDL
Sbjct  177   PSRLTLLLGPPGSGKTTLLMALAGKLDPDLKSSGRITYNGHGMNEFVPQRTAAYVSQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRYEMLAELSRREKAANI+PDPDIDI+MK+AAT+GQ+A 
Sbjct  237   HIGEMTVRETLAFSARCQGVGSRYEMLAELSRREKAANIKPDPDIDIYMKSAATEGQEAT  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY++++LGLE C DT+VG+E LRG+SGG++KR+T GEMLVGP N L MDEISTGLDS
Sbjct  297   VVTDYVLRILGLEICADTLVGDEMLRGISGGQKKRVTTGEMLVGPTNALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++ Y+HI+ GTA I+LLQPAPE YDLFDDI+L+S+G IVYQGP   V+EFF
Sbjct  357   STTFQIVNSLRQYVHIMKGTAFISLLQPAPETYDLFDDIVLLSDGLIVYQGPRENVVEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             + +GFRCP+RKGVADFLQEVTS+KDQ QYW R+D +PYR++   EF+E+FQSFH+GR L 
Sbjct  417   QSMGFRCPDRKGVADFLQEVTSKKDQRQYWARRD-EPYRYIAATEFAESFQSFHVGRTLS  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +ELATPF KS SHPAALTT+TYGV+  E+ K+  +RE+LL+KRN  ++IF++  +++M L
Sbjct  476   NELATPFDKSKSHPAALTTQTYGVNNKEIFKANSARELLLIKRNSFIYIFKLSQLIIMGL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MT+F RT M R       IY+ +LFF +  +MF+ + ELA TI +LP+F+KQRD LF+
Sbjct  536   IGMTVFFRTKMPRRDVTDGGIYLGALFFVVVQVMFNGMAELAMTILKLPVFFKQRDFLFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAW+YA+PT+IL+IPIT +EV+VWV  TYYVIG+DP+  R  K +++L+   Q+AS LFR
Sbjct  596   PAWSYALPTWILKIPITFLEVAVWVVMTYYVIGFDPSPARFFKHYLILVAINQVASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                   R+M  A   G+F +++LFALGGF+LSRD VKKWW+WGYW SPLMYAQNAI VNE
Sbjct  656   FIGAASRNMIVANTFGTFALMLLFALGGFVLSRDQVKKWWLWGYWSSPLMYAQNAILVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             F GK W  ++P ++E  G  VLK +G FP++YWYW+G+GA  GF +   F YTLAL  L+
Sbjct  716   FTGKHWRQIVPNTTETLGTQVLKSKGFFPQSYWYWIGLGACGGFILLLNFFYTLALTYLQ  775

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKY  625
             PL + +A +  ES + E+   +G  D SV + +++   N++ GMILPFEPHSI F+DI+Y
Sbjct  776   PLGKPQAVLPEESENTEN---SGQRDGSV-DAITESNENQRRGMILPFEPHSITFDDIRY  831

Query  624   CVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI  445
              VDMPQ MK +G  +++L LLKG+SGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI
Sbjct  832   SVDMPQAMKDQGAVEDKLMLLKGISGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI  891

Query  444   EGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFI  265
             EG +TISG+ K Q+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLP+EV  +TR +F+
Sbjct  892   EGNVTISGYPKNQETFARISGYCEQNDIHSPHVTVYESLVYSAWLRLPAEVDAKTRMMFV  951

Query  264   KEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAA  85
              EVMELVELTSLR+ +VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAA
Sbjct  952   DEVMELVELTSLRDGLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAA  1011

Query  84    AIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  AIVMRTVRNTVDTGRTVVCTIHQPSIDI  1039


 Score =   136 bits (342),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 123/566 (22%), Positives = 248/566 (44%), Gaps = 68/566 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ +SG  +PG +T L+G   +GKT+L+  LAG+        G V+ +G+  N+    R
Sbjct  851   LLKGISGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNVTISGYPKNQETFAR  909

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  910   ISGYCEQNDIHSPHVTVYESLVYSAWLR-------------------------------L  938

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              A  D +   + VD +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  939   PAEVDAKTRMMFVDEVMELVELTSLRDGLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  998

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  999   MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLLKRGGQEIY  1057

Query  1917  QGPCNC----VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVT+   ++   +            
Sbjct  1058  VGPLGHNSIELIKYFEAIHGVSKIKDGYNPATWMLEVTASAQELMLGV------------  1105

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F+E +++   +   + L  EL +P  +  +      TK      ++ + +CF ++ + 
Sbjct  1106  -DFAEIYKNSDLYRRNKALIHELDSP--RPGTKDLYFPTKYSQAFPVQCM-ACFWKQRIS  1161

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +AL   T+F +   ++++       M S++  +  +       
Sbjct  1162  YWRNPPYTAVRFLFTSFIALSFGTIFWKLGKRKDTTQDLFNAMGSMYAAVLFLGVQNSSA  1221

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA     + I     +   +   TY +IG++    
Sbjct  1222  VQPVVAIERTVFYRERAAGMYSALPYAFAQVGIEILYILKQAVFYSVITYAMIGFEWTAS  1281

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFA----LGGFILSRDD  1060
             + L  W L +++  L    F    VV  S+T    + + +    +A      GF++ R  
Sbjct  1282  KFL--WYLFLMYFTLLYFTFYGMMVV--SVTPNHNISAVVASAFYAGWNLFSGFLIPRPR  1337

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF  982
             +  WW W YW  P+ +    + V+++
Sbjct  1338  IPIWWRWYYWGCPVAWTLYGLFVSQW  1363



>ref|XP_010249929.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nelumbo 
nucifera]
Length=1445

 Score =  1443 bits (3736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1061 (66%), Positives = 854/1061 (80%), Gaps = 28/1061 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLR  2935
             +  S R N+S   S+  + F++SSR    ++DDE ALKWAAL+K+PT+DR++KG++TG+ 
Sbjct  8     KVSSLRRNNSVWRSDAVEVFSRSSR----EEDDEEALKWAALEKLPTYDRIRKGILTGVG  63

Query  2934  GETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLN  2755
              +  EVDI N+G++EKK ++ERL++V E DNE FLLKLK+R+ERV ID+P +EVRFEHLN
Sbjct  64    SQPTEVDIGNLGFQEKKNLIERLVRVAEEDNEKFLLKLKNRIERVGIDLPTIEVRFEHLN  123

Query  2754  VGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLG  2578
             + A+AYVG RALP++ NF  NI+EG+L++L+ LP+ KK   IL+DVSGIIKP RMTLLLG
Sbjct  124   INADAYVGSRALPTIFNFTANIVEGILNFLHILPSRKKPLCILQDVSGIIKPSRMTLLLG  183

Query  2577  PPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARE  2398
             PPSSGKT+LLLALAG+LDP L+ SGRV+YNGH M+EFVP RT+AYISQHDLHI EMT RE
Sbjct  184   PPSSGKTTLLLALAGKLDPDLKVSGRVTYNGHGMDEFVPQRTSAYISQHDLHIGEMTVRE  243

Query  2397  TLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKV  2218
             TLAFSARCQGVG RY+ML ELSRREKAANI+PDPDIDI+MKAA  +GQ+ +V+ DYI+K+
Sbjct  244   TLAFSARCQGVGERYDMLTELSRREKAANIKPDPDIDIYMKAATLEGQETSVVTDYILKI  303

Query  2217  LGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKS  2038
             LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTT+QI+ S
Sbjct  304   LGLDVCADTMVGDEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTYQIVSS  363

Query  2037  IKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPE  1858
             ++  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+GQ++YQGP   VL+FFE +GF+CPE
Sbjct  364   LRQSIHILNGTAVISLLQPAPETYNLFDDIILLSDGQVIYQGPREHVLDFFESMGFKCPE  423

Query  1857  RKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQK  1678
             RKG+ADFLQEVTS+KDQ QYW RK  KPYRFVT+ EF+EAFQSFH G+ + DEL+TPF K
Sbjct  424   RKGIADFLQEVTSKKDQKQYWARK-LKPYRFVTVKEFAEAFQSFHAGQKISDELSTPFDK  482

Query  1677  STSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRT  1498
             + +H AALTTK YGVSK EL K+C SRE+LLMKRN  ++ F++  + ++A ITMTLF+RT
Sbjct  483   TKNHAAALTTKKYGVSKKELFKACLSREILLMKRNSFVYFFKMAQLAILAFITMTLFLRT  542

Query  1497  NMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPT  1318
              M ++      IYM +LFF L  +MF+ L E++ TI +LP+FYKQRDLLFYPAWAY++PT
Sbjct  543   EMHQDDSTDGGIYMGALFFALITVMFNGLSEISMTIAKLPVFYKQRDLLFYPAWAYSLPT  602

Query  1317  FILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSM  1138
             +IL+IPIT IEV +WVF TYYVIG+DPN  R  + + LL++  Q+AS LFR     GR+M
Sbjct  603   WILKIPITFIEVGIWVFITYYVIGFDPNVERFFRQYFLLLLINQMASALFRFIGATGRNM  662

Query  1137  TNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTV  958
               A   G+F +L    LGGFILSR+DVK WWIWGYWISPLMY QNAI+VNEFLGK+W  V
Sbjct  663   IVANTFGAFAVLTFVVLGGFILSRNDVKNWWIWGYWISPLMYGQNAISVNEFLGKNWRHV  722

Query  957   LPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANI  778
             LP S+EP GV V+K RG FPEA+WYW+GVGA IG+     F+YT+AL  L P  + +A +
Sbjct  723   LPNSTEPLGVTVIKSRGFFPEAHWYWIGVGASIGYMFLFNFLYTVALHYLDPFGKPQAVL  782

Query  777   ---------------SAESHSNEHDVSNGGSD-------NSVGERVSDGMSNRKHGMILP  664
                            S E  S+ H  S    D        S   R+ +   ++K GM+LP
Sbjct  783   PDEGEARTGEDNELSSLEMTSSGHTTSGEQQDGIIRVASESSSARIDEVNQHKKRGMVLP  842

Query  663   FEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTL  484
             F+P SI F++I+Y VDMPQEMK +GV ++RLELLKGVSG+FRPGVLTALMGVSGAGKTTL
Sbjct  843   FQPLSITFDEIRYFVDMPQEMKDQGVTEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTL  902

Query  483   MDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRL  304
             MDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRL
Sbjct  903   MDVLAGRKTGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRL  962

Query  303   PSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIF  124
             PS+V   TRK+FI+EVMELVEL  LR A+VGLPGVNGLST QRKR+TIAVELVANPSIIF
Sbjct  963   PSDVDSSTRKMFIEEVMELVELNPLRGALVGLPGVNGLSTEQRKRMTIAVELVANPSIIF  1022

Query  123   MDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             MDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1023  MDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1063


 Score =   135 bits (341),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 143/634 (23%), Positives = 270/634 (43%), Gaps = 87/634 (14%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   
Sbjct  869   TEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKK  927

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R + Y  Q+D+H P +T  E+L +SA                       +R   D
Sbjct  928   QETFARISGYCEQNDIHSPHVTVYESLLYSAW----------------------LRLPSD  965

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
             +D              + ++ +++++ L      +VG   + G+S  +RKR+T    LV 
Sbjct  966   VD---------SSTRKMFIEEVMELVELNPLRGALVGLPGVNGLSTEQRKRMTIAVELVA  1016

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  
Sbjct  1017  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKR  1075

Query  1932  G-QIVYQGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + +Y GP    +C ++++FE +      + G   A ++ EVT+   +           
Sbjct  1076  GGEEIYVGPLGRQSCHLIKYFEGIEGVSKIKDGYNPATWMLEVTTMAQE-----------  1124

Query  1773  YRFVTINEFSEAFQSFHIGR---NLGDELATP--FQKSTSHPAALTTKTYGVSKMELLKS  1609
                + +N F+E +++  + R   +L  EL+TP    K    P       Y  S      +
Sbjct  1125  -EILGVN-FAEVYKNSELHRRNKSLIQELSTPPPGSKDLYFPT-----MYSQSFFTQCMA  1177

Query  1608  CFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTV  1429
             C  ++     RN         +   +AL+  T+F     +R+        M S++  +  
Sbjct  1178  CLWKQHWSYWRNPPYIAVRFIFTTFIALLFGTIFWDLGSKRSRQQDLFNAMGSMYAAVLF  1237

Query  1428  IMFSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYV  1252
             +       + P +     +FY++R    Y A  YA    ++ IP   ++  V+    Y +
Sbjct  1238  LGIQNASSVQPVVAVERTVFYRERAAGMYSALPYAFGQVMIEIPHIFVQAVVYGVIVYAM  1297

Query  1251  IGYDPNFGRLLKMWVLLIIFRQLASVLFRS--AAVVGRSMTNAFVVGSFIMLVLFALGGF  1078
             IG++    +    W L  ++  L    F    A  V  +   A +V S    +     GF
Sbjct  1298  IGFEWTAAKFF--WYLFFMYFTLLYFTFYGMMAVAVTPNHNVAAIVSSAFYGIWNLFSGF  1355

Query  1077  ILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLVLKY  913
             I+ R  +  WW W YWI P+ +    +  ++F       ++  TV  F    FG     +
Sbjct  1356  IVPRTRMPVWWRWYYWICPVAWTLYGLVASQFGDIQDKIETDQTVEEFLRSYFG-----F  1410

Query  912   RGLFPEAYWYWLGV--GALIGFTIFSIFIYTLAL  817
             R  F       LGV    +IGFT+   FI+  ++
Sbjct  1411  RHDF-------LGVVSAVIIGFTVLFAFIFAFSI  1437



>ref|XP_010023520.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Eucalyptus grandis]
Length=1442

 Score =  1443 bits (3736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 711/1065 (67%), Positives = 853/1065 (80%), Gaps = 25/1065 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             M+  D      S R  SS+ W N     D F++SSR    D+DDE AL+WAAL+K+PTF 
Sbjct  1     MDGGDIYRAGNSLRATSSTSWRNQASMADVFSRSSR----DEDDEEALRWAALEKLPTFK  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   ++DI N+G+ ++K++LERL++V E DNE FLLKL++R++RV I++
Sbjct  57    RLQKGILTAAGGAN-QIDIWNLGFHDRKRLLERLMRVTEEDNEGFLLKLRNRIDRVGINL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRFEHL V AEAY G RALP+V NFC +ILEG L++L+ LP+ KKH++IL+DVSGI
Sbjct  116   PTIEVRFEHLKVEAEAYEGSRALPTVINFCTSILEGFLNFLHVLPSRKKHSTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH MNEFVP RTAAYISQH
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKTTGRVTYNGHVMNEFVPQRTAAYISQH  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPDIDIFMKAA T GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDIDIFMKAAVTKGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV+ DYI+K+LGLE C D +VG+E LRG+SGG+RKR+T GEMLVGPA V  MDEISTGL
Sbjct  296   ANVVTDYILKILGLEICADAMVGDEMLRGISGGQRKRVTTGEMLVGPAEVFFMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+ S+K +IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+
Sbjct  356   DSSTTYQIVNSLKQFIHILDGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPHELVLD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FFE +GF+CP RK VADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF+EAFQSFH+GR 
Sbjct  416   FFESMGFKCPRRKCVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFAEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  +++M
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVTQLIIM  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A I+MTLF+R  M R++     +Y+ +LFFT+   MF+ + EL+ TI +LPIFYKQRDLL
Sbjct  535   AFISMTLFLRNKMHRDTVTDGGVYIGALFFTMMTFMFNGMAELSMTIAKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF TYYVIGYDPN GRL K ++LL+   Q+AS L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFITYYVIGYDPNVGRLFKQYLLLVAINQMASGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   GSF++L L ALGG +LSR+DVKKWWIWGYW SPLMY QNAI V
Sbjct  655   FRLIAALGRNLIVANTFGSFVLLALVALGGVVLSREDVKKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NE LG +WN + P SS  EP G+ VLK RG F EAYWYW+G+GAL GF I   F +++AL
Sbjct  715   NELLGSNWNKIPPISSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFLILFNFGFSVAL  774

Query  816   AKLRPLAQSRANISAESHSNEH--------DVSNGGSDNSVGERVSDG-----MSNRKHG  676
             A L P  +S    S +   N++         + + GS    G   S        +N K G
Sbjct  775   ALLNPFGKSHTVKSDDPEGNKNVDRIEGSIQLQSRGSSLRTGSGRSSKPETAVAANTKRG  834

Query  675   MILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAG  496
             M+LPFEPHSI F++I Y VDMP+EM+ +G  + RL LLKGVSG+FRPGVLTALMGVSGAG
Sbjct  835   MVLPFEPHSITFDEITYSVDMPREMENQGAPEERLVLLKGVSGSFRPGVLTALMGVSGAG  894

Query  495   KTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSA  316
             KTTLMDVLAGRKTGGYIEG ITISG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+SA
Sbjct  895   KTTLMDVLAGRKTGGYIEGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYESLIYSA  954

Query  315   WLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANP  136
             WLRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVANP
Sbjct  955   WLRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANP  1014

Query  135   SIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1059


 Score =   145 bits (367),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 141/630 (22%), Positives = 273/630 (43%), Gaps = 84/630 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  871   LLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKNQDTFAR  929

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  930   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  963

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  964   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1018

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1019  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1077

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1078  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPGQELALGV------------  1125

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++   +   + L +EL+ P     S      TK Y  S    L +C  ++   
Sbjct  1126  -DFSDLYKNSDLYRRNKALIEELSIP--PPNSKDLYFPTK-YSQSTFTQLMACLWKQRWS  1181

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + +++AL+  T+F     +          M S++  +  +       
Sbjct  1182  YWRNPPYTAVRFLFTIIIALMFGTMFWDLGSKTTRSQDLMNAMGSMYAAVVFLGIQNAAS  1241

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+     
Sbjct  1242  VQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLVQAISYGIIVYAMIGFKWTVA  1301

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDD  1060
             +        + F     + F    ++   MT    + S +    +A+     GFI+ R  
Sbjct  1302  KFFWY----LFFMFFTLLYFTYYGMMALGMTPNQHIASIVSSAFYAIWNLFSGFIVPRTR  1357

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFP  898
             +  WW W YW+ P+ +    + +++F      L  + +TV  +  + FG     YR  F 
Sbjct  1358  IPIWWRWYYWVCPVSWTLYGLVISQFGDLKNRLEDTGDTVEEYMRDYFG-----YRHNFL  1412

Query  897   EAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
              A        A+IGFT+   FI+ +++  L
Sbjct  1413  GAI-----AAAMIGFTMLFAFIFAISIKIL  1437



>emb|CBI36209.3| unnamed protein product [Vitis vinifera]
Length=1582

 Score =  1442 bits (3733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/1050 (68%), Positives = 854/1050 (81%), Gaps = 20/1050 (2%)
 Frame = -2

Query  3144  VAMEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             VAM   D    SGSFR N SS+W N G D F++SSR    D+DDE ALKWAAL+K+PT++
Sbjct  168   VAMATADIYRASGSFRRNGSSIWRNSGADVFSQSSR----DEDDEEALKWAALEKLPTYN  223

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KGL+ G  GE  E+DI+N+G++EKK ++ERL+K+ E DNE FLLKLK+R++RV +D+
Sbjct  224   RLRKGLLMGSEGEASEIDIHNLGFQEKKNLVERLVKIAEEDNEKFLLKLKNRIDRVGVDV  283

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P++EVRFEHL + AEA+VG RALPS  NF  N LEG+L+ ++ LP+ KK  +IL DVSGI
Sbjct  284   PEIEVRFEHLTIDAEAFVGSRALPSFHNFIFNKLEGILNAVHILPSKKKKCTILNDVSGI  343

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKP RMTLLLGPPSSGKT+LLLALAG+LDP+L+ +GRV+YNGH MNEFVP RTAAYISQH
Sbjct  344   IKPRRMTLLLGPPSSGKTTLLLALAGKLDPNLKVTGRVTYNGHSMNEFVPQRTAAYISQH  403

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             D HI EMT RETLAFSARCQGVG RY+MLAELSRREKAANI+PDPD+D    AAAT+GQK
Sbjct  404   DTHIGEMTVRETLAFSARCQGVGDRYDMLAELSRREKAANIKPDPDLD----AAATEGQK  459

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
              NV+ DY +K+LGL+ C DT+VG+E +RG+SGG+RKR    EMLVGP+  L MDEISTGL
Sbjct  460   ENVVTDYTLKILGLDICADTMVGDEMIRGISGGQRKR----EMLVGPSKALFMDEISTGL  515

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+ S+K  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+ QIVYQGP   VLE
Sbjct  516   DSSTTYQIVNSLKQTIHILNGTAVISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVLE  575

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FFE +GF+CP RKGVADFLQEVTSRKDQ QYW RK+ +PY FVT+ EF+EAFQSFHIGR 
Sbjct  576   FFESMGFKCPARKGVADFLQEVTSRKDQAQYWARKE-EPYSFVTVKEFAEAFQSFHIGRK  634

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             + DELA+PF K+ SHPAALTTK YGV K  LL +  SRE LLMKRN  ++IF++  + +M
Sbjct  635   VADELASPFDKAKSHPAALTTKKYGVRKKVLLDANMSREYLLMKRNSFVYIFKLTQLAVM  694

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A+I MTLF+RT M +NS     IY  +LFFT+ +IMF+ + ELA  I +LP+FYKQRDLL
Sbjct  695   AVIAMTLFLRTEMHKNSTDDGSIYTGALFFTVVMIMFNGMAELAMAIAKLPVFYKQRDLL  754

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P+++L+IPIT +EV+VWVF TYYVIG+DPN  RL + ++LL++  Q+AS L
Sbjct  755   FYPAWAYALPSWVLKIPITFVEVAVWVFITYYVIGFDPNVERLFRQYLLLLLVNQMASGL  814

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A  GR+M  A   G+F +L+L A GGFILS D+VKKWWIWGYW SPLMYAQNAI V
Sbjct  815   FRFIAAAGRNMIVANTFGAFALLMLLASGGFILSHDNVKKWWIWGYWSSPLMYAQNAIVV  874

Query  990   NEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAK  811
             NEFLGKSW+  +  S+E  GV VLK RG   +A+WYW+G GAL+GF     F YTL L  
Sbjct  875   NEFLGKSWSKNVTDSTESLGVTVLKSRGFSTDAHWYWIGAGALLGFIFVFNFFYTLCLNY  934

Query  810   LRPLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDI  631
             L P    +A I+ ES     D +   +   + E +++   N+K GM+LPF+PHSI F+DI
Sbjct  935   LNPFENHQAVITEES-----DNAKTATTEEMVEAIAEAKHNKKKGMVLPFQPHSITFDDI  989

Query  630   KYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG  451
             +Y VDMP+EMK +G  ++RLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG
Sbjct  990   RYSVDMPEEMKSQGALEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG  1049

Query  450   YIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKL  271
             YIEG+ITISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLPS+V  ETRK+
Sbjct  1050  YIEGKITISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSDVNSETRKM  1109

Query  270   FIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDAR  91
             FI+EVMELVELT LR+A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDAR
Sbjct  1110  FIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDAR  1169

Query  90    AAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1170  AAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1199


 Score =   133 bits (334),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 124/570 (22%), Positives = 247/570 (43%), Gaps = 76/570 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G+++ +G+   +    R
Sbjct  1011  LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGKITISGYPKKQETFAR  1069

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D++    
Sbjct  1070  ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLPSDVN----  1103

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  1104  -----SETRKMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1158

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1159  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLMKRGGQEIY  1217

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++ +FE +      + G   A ++ EVT+   ++   +R D         
Sbjct  1218  VGPLGRHSSHLINYFERIEGVSKIKDGYNPATWMLEVTTSAQEVI--LRVD---------  1266

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSK-----MELLKSCFSREV  1591
               F+E +++  + R   D +     K  S PA  T   Y  ++          +C  ++ 
Sbjct  1267  --FTEIYKNSDLYRRNKDLI-----KELSQPAPGTKDLYFATQYSQPFFTQFLACLWKQR  1319

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +AL+  T+F     +R         M S++  +  +     
Sbjct  1320  WSYWRNPPYTAVRFLFTTFIALMFGTMFWDLGTKRTRQQDLFNAMGSMYAAVLFLGIQNA  1379

Query  1410  QELAPTIF-RLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
             Q + P +     +FY++R    Y A  YA    ++ IP    +   +    Y +IG++  
Sbjct  1380  QSVQPVVVVERTVFYRERAAGMYSALPYAFGQALVEIPYVFAQAVAYGVIVYAMIGFEWT  1439

Query  1233  FGRLLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFIL  1072
               +           +L   F  + +V    AA   + + +      + +  LF+  GFI+
Sbjct  1440  AAKFFWYLFFMFFTLLYFTFYGMMAV----AATPNQHIASIVAAAFYGIWNLFS--GFIV  1493

Query  1071  SRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              R+ +  WW W YWI P+ +    +  ++F
Sbjct  1494  PRNRIPVWWRWYYWICPVAWTLYGLVTSQF  1523



>ref|XP_009799503.1| PREDICTED: pleiotropic drug resistance protein 1 [Nicotiana sylvestris]
 sp|Q76CU2.1|PDR1_TOBAC RecName: Full=Pleiotropic drug resistance protein 1; AltName: 
Full=NtPDR1 [Nicotiana tabacum]
 dbj|BAD07483.1| PDR-type ABC transporter 1 [Nicotiana tabacum]
Length=1434

 Score =  1442 bits (3733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/1044 (67%), Positives = 864/1044 (83%), Gaps = 10/1044 (1%)
 Frame = -2

Query  3120  RGRS-GSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLM  2947
             RG + GS R NS+S+W +NG + F++SSR    D+DDE ALKWAAL+K+PTFDRL+KGL+
Sbjct  15    RGSTRGSLRANSNSIWRNNGVEIFSRSSR----DEDDEEALKWAALEKLPTFDRLRKGLL  70

Query  2946  TGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRF  2767
              G +G   EVDIN++G++E+K +LERL+KV + DNE FLLKLK+R++RV ID+P +EVR+
Sbjct  71    FGSQGAAAEVDINDLGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRY  130

Query  2766  EHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKKHN-SILRDVSGIIKPGRMT  2590
             EHLN+ A+AYVG R+LP+  NF  N +E LL+ L++ +++K   +IL+D+SGIIKP RMT
Sbjct  131   EHLNIDADAYVGSRSLPTFMNFMTNFVETLLNSLHILSSRKRQLTILKDISGIIKPCRMT  190

Query  2589  LLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEM  2410
             LLLGPPSSGKT+LLLALAG+LDP+L+ +G+VSYNGHE++EFVP RTAAYISQHDLHI EM
Sbjct  191   LLLGPPSSGKTTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEM  250

Query  2409  TARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDY  2230
             T RETL FSARCQGVGSR+EMLAELSRREKAANI+PD DIDI+MKAAAT+GQ+ANV+ DY
Sbjct  251   TVRETLEFSARCQGVGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDY  310

Query  2229  IIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQ  2050
             ++K+LGL+ C DT+VG++ +RG+SGG++KR+T GEMLVGP+  L MDEISTGLDSSTT+ 
Sbjct  311   VLKILGLDICADTMVGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYS  370

Query  2049  ILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGF  1870
             I+ S++  + IL GTAVI+LLQPAPE Y+LFDDIIL+S+G IVYQGP + VLEFFE +GF
Sbjct  371   IVNSLRQSVQILKGTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGF  430

Query  1869  RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELAT  1690
             +CP+RKGVADFLQEVTS+KDQ QYW  K N+PYRF+T  EF+EA+QSFH+GR LGDELAT
Sbjct  431   KCPQRKGVADFLQEVTSKKDQQQYW-SKRNEPYRFITSKEFAEAYQSFHVGRKLGDELAT  489

Query  1689  PFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTL  1510
             PF K+  HPAALT + YG+ K ELLK C  RE+LLMKRN  +++F+   + +MALITMTL
Sbjct  490   PFDKTKCHPAALTNEKYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTL  549

Query  1509  FIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAY  1330
             F RT M R++     IY  +LFF + +IMF+ + ELA TIF+LP+FYKQRDLLF+P+WAY
Sbjct  550   FFRTEMPRDTTDDGGIYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAY  609

Query  1329  AIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVV  1150
             AIP++IL+IP+T +EV +WV  TYYVIG+DPN  R LK ++LLI+  Q+AS +FR    V
Sbjct  610   AIPSWILKIPVTLVEVGLWVILTYYVIGFDPNITRFLKQFLLLIVVNQMASGMFRFIGAV  669

Query  1149  GRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKS  970
             GR+M  A   GSF +L+ FALGGF+LSRDDVK WWIWGYWISP+MY+ N+I VNEF GK 
Sbjct  670   GRTMGVASTFGSFALLLQFALGGFVLSRDDVKSWWIWGYWISPMMYSVNSILVNEFDGKK  729

Query  969   WNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQS  790
             WN ++P  +E  G  V+K RG FPEAYWYW+GVGAL+GFT+   F Y+LALA L P  + 
Sbjct  730   WNHIVPGGNETLGSTVVKSRGFFPEAYWYWIGVGALVGFTVVFNFCYSLALAYLNPFDKP  789

Query  789   RANISAESHSNEH-DVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDM  613
             +A +  +  + E+ +VS+  +    G+ +S+  +N+K GM+LPFEPHSI F+D+ Y VDM
Sbjct  790   QAVLPEDGENAENGEVSSQITSTDGGDSISESQNNKK-GMVLPFEPHSITFDDVVYSVDM  848

Query  612   PQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEI  433
             PQEMK +G  ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+GEI
Sbjct  849   PQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGEI  908

Query  432   TISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVM  253
              ISG+ KKQ+TFARISGYCEQNDIHSP++TVYESL++SAWLRLP +V  +TRK+F+ EVM
Sbjct  909   KISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVDEKTRKMFVDEVM  968

Query  252   ELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM  73
             ELVEL  LR A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM
Sbjct  969   ELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM  1028

Query  72    RTVRNIVDTGRTIVCTIHQPSIDI  1
             RTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1029  RTVRNTVDTGRTVVCTIHQPSIDI  1052


 Score =   142 bits (358),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 130/564 (23%), Positives = 239/564 (42%), Gaps = 64/564 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  864   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGEIKISGYPKKQETFAR  922

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+D    
Sbjct  923   ISGYCEQNDIHSPYVTVYESLVYSAW----------------------LRLPQDVD----  956

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + VD +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  957   -----EKTRKMFVDEVMELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1011

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1012  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1070

Query  1917  QGP-----CNCVLEFFECLGF-RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     C+ +  F    G  +  E    A ++ EVT+   +M   I            
Sbjct  1071  VGPLGRHSCHLIKYFESNPGVAKIKEGYNPATWMLEVTASAQEMMLGI------------  1118

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F+E +++   +   + L  EL  P  +  S      T+ Y  S      +C  ++   
Sbjct  1119  -DFTEVYKNSDLYRRNKALISELGVP--RPGSKDLHFETQ-YSQSFWTQCVACLWKQHWS  1174

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +ALI  T+F     + +        M S++  +  +       
Sbjct  1175  YWRNPAYTAVRFIFTTFIALIFGTMFWDLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASS  1234

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA     + IP   ++   +    Y +IG++ + G
Sbjct  1235  VQPVVAIERTVFYRERAAGMYSAIPYAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVG  1294

Query  1227  RLLKMWVLLIIFRQLASVLFRS--AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVK  1054
             +    W L I+F  L    F       V  +   A +V +F   V     GFI+ R  + 
Sbjct  1295  KFF--WYLFIMFFTLLYFTFYGMMGVAVTPNQNVASIVAAFFYGVWNLFSGFIIPRPRMP  1352

Query  1053  KWWIWGYWISPLMYAQNAIAVNEF  982
              WW W YW +P+ +    +  ++F
Sbjct  1353  VWWRWYYWANPVAWTLYGLVASQF  1376



>ref|XP_010023531.1| PREDICTED: ABC transporter G family member 40-like isoform X2 
[Eucalyptus grandis]
Length=1441

 Score =  1442 bits (3732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/1064 (67%), Positives = 856/1064 (80%), Gaps = 24/1064 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             M+  D+     S R  SS+ W N     D F++SSR    D+DDE AL+WAAL+K+PTF+
Sbjct  1     MDGGDTYRAGNSLRATSSTTWRNHASMVDVFSRSSR----DEDDEEALRWAALEKLPTFE  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG+MT   G   ++DI N+G+ ++K++LERL++V E DNE FLLKL++R++RV ID+
Sbjct  57    RLQKGIMTAGGGAN-QIDIWNLGFHDRKRLLERLVRVIEEDNEGFLLKLRNRIDRVGIDL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRFEHL V AEA+ G RALP+V NFC +ILEG L++L+ LP+ KKH +IL+DVSGI
Sbjct  116   PTIEVRFEHLKVEAEAHEGSRALPTVINFCTSILEGFLNFLHVLPSRKKHLTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH MNEFVP RTAAYISQH
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKMTGRVTYNGHVMNEFVPQRTAAYISQH  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY+ML ELSRREKAANI+PDPDIDIFMKAA T+GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYDMLLELSRREKAANIKPDPDIDIFMKAAVTEGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV+ DYI+K+LGLE C D +VG+E LRG+SGG+RKR+T GEMLVGPA V LMDEISTGL
Sbjct  296   ANVVTDYILKILGLEICADVMVGDEMLRGISGGQRKRVTTGEMLVGPAEVFLMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+  +K +IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+
Sbjct  356   DSSTTYQIVNFLKQFIHILDGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FFE +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF EAFQSFH+GR 
Sbjct  416   FFESMGFKCPRRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFVEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  +++M
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVTQLIIM  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A I+MTLF+RT M R++     +Y+ +LFFT+  IMF+ + E++ TI +LPIFYKQRDLL
Sbjct  535   AFISMTLFLRTKMHRDTVTDGGVYIGALFFTVITIMFNGMAEISMTIAKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF+TYYVIGYDPN GRL K ++LL+   Q++S L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFTTYYVIGYDPNVGRLFKQYLLLVAINQMSSGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   G+F++L L A+GG +LSR+DV KWWIWGYW SPLMY QNAI V
Sbjct  655   FRLIAALGRNLIVANTFGTFVLLALVAMGGVVLSREDVNKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NE LG +WN + P SS  EP G+ VLK RG F EAYWYW+G+GAL GF I   F +++AL
Sbjct  715   NELLGSNWNKIPPNSSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFIILFNFGFSVAL  774

Query  816   AKLRPLAQSRANISAESHSNEHDVSNGGSD--NSVGERVSDGMS----------NRKHGM  673
             A L P  +S    S +   N++     GS    S G R S  ++          N K GM
Sbjct  775   ALLNPFGKSHTVKSDDPEGNKNVDRIEGSIQLQSRGSRRSSKLTPPWPETAVAANTKRGM  834

Query  672   ILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGK  493
             +LPFEPHSI F++I Y VDMP+EM  +G  ++RL LLKG SG+FRPGVLTALMGVSGAGK
Sbjct  835   VLPFEPHSITFDEITYSVDMPREMTNQGAPEDRLVLLKGASGSFRPGVLTALMGVSGAGK  894

Query  492   TTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAW  313
             TTLMDVLAGRKTGGYI+G ITISG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+SAW
Sbjct  895   TTLMDVLAGRKTGGYIKGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYESLIYSAW  954

Query  312   LRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPS  133
             LRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVANPS
Sbjct  955   LRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPS  1014

Query  132   IIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  IIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1058


 Score =   146 bits (369),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 144/634 (23%), Positives = 275/634 (43%), Gaps = 92/634 (15%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+  SG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  870   LLKGASGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IKGNITISGYPKNQDTFAR  928

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  929   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  962

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  963   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1017

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1018  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1076

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1077  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPAQELALGV------------  1124

Query  1755  NEFSEAFQS---FHIGRNLGDELAT--PFQKSTSHPAALTTKTYGVSKMELLKSCFSREV  1591
              +FS+ +++   +   + L +EL+   P  K    P       Y  S    L +C  ++ 
Sbjct  1125  -DFSDLYKNSDLYRRNKALIEELSISPPNSKDLYFPTK-----YSQSTFTQLMACLWKQH  1178

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         + + +AL+  T+F     +          M S++  L  + F   
Sbjct  1179  WSYWRNPPYTAVRFLFTISIALMFGTMFWDLGSKTTRSQDLFNAMGSMYAALVFLGFQNA  1238

Query  1410  QELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
               + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+   
Sbjct  1239  SSVQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLVQAISYGIIVYAMIGFKWT  1298

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSR  1066
               +        + F+    + F    ++   MT    + S + L  +AL     GF++ R
Sbjct  1299  VAKFFWY----LFFKFFTLLYFTYYGMMAVGMTPNHHIASIVSLAFYALWNLFSGFVVPR  1354

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGL  904
               +  WW W YW+ P+ +    + V++F      L  + +TV  +  + FG     YR  
Sbjct  1355  TKIPIWWRWFYWVCPVSWTLYGLVVSQFGDLTNTLEDTGDTVEEYMRDYFG-----YRHD  1409

Query  903   FPEAYWYWLGVGA--LIGFTIFSIFIYTLALAKL  808
             F       LGV A  +IGFT+   F++ +++  L
Sbjct  1410  F-------LGVIAAMVIGFTMLFAFVFAISIKIL  1436



>ref|XP_008795450.1| PREDICTED: pleiotropic drug resistance protein 3-like [Phoenix 
dactylifera]
Length=1450

 Score =  1441 bits (3731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 707/1075 (66%), Positives = 857/1075 (80%), Gaps = 36/1075 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLK  2959
             ME+ D  G  GS R  SSS+W  G + F++SS     D+DDE ALKWAAL+K+PT+DR++
Sbjct  1     MEVGDVYG-VGSMR-RSSSVWRRGDEIFSRSSW----DEDDEEALKWAALEKLPTYDRVR  54

Query  2958  KGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKV  2779
             KG++T   GE  EVDI ++G  E+K +L+RL++V E DNE FLLKL+DR++RV ID+P +
Sbjct  55    KGILTLAEGERIEVDIQSLGLRERKALLDRLVRVAEEDNERFLLKLRDRIDRVGIDLPTI  114

Query  2778  EVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKP  2602
             EVR+EHLN+ AE YVG R LP++ N  +N+LE L +Y + LP+ K+  SIL DVSG+IKP
Sbjct  115   EVRYEHLNIHAETYVGNRGLPTILNSTINVLESLANYFHILPSRKRSLSILHDVSGVIKP  174

Query  2601  GRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLH  2422
              RMTLLLGPP SGKT+LLLALAG+LD  L+ SGRV+YNGH M+EFVP RTAAYISQHDLH
Sbjct  175   QRMTLLLGPPGSGKTTLLLALAGKLDSDLKVSGRVTYNGHGMDEFVPQRTAAYISQHDLH  234

Query  2421  IPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANV  2242
             I EMT RETLAFSARCQGVGSRYEML ELSRREKAANI+PDPDID+FMKA A DGQ+ +V
Sbjct  235   IGEMTVRETLAFSARCQGVGSRYEMLTELSRREKAANIKPDPDIDVFMKAVAMDGQETSV  294

Query  2241  IVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSS  2062
             I DYI+KVLGLE C DT+VG+E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSS
Sbjct  295   ITDYILKVLGLEICADTMVGDEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSS  354

Query  2061  TTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFE  1882
             TTFQI+ S++  IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQ+VYQGP   VLEFFE
Sbjct  355   TTFQIVNSLRQSIHILGGTAVISLLQPAPETYDLFDDIILLSDGQVVYQGPRGHVLEFFE  414

Query  1881  CLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGD  1702
              +GF+CPERKGVADFLQEVTSRKDQ QYW+R D + YR+V + EF+EAFQSFH+G+++G+
Sbjct  415   SMGFKCPERKGVADFLQEVTSRKDQQQYWMRHD-ETYRYVPVKEFAEAFQSFHVGQDIGN  473

Query  1701  ELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALI  1522
             EL+ P+ KS SHPAALTT  YGVSK EL ++  +RE+LLMKR+  ++IF    + ++A I
Sbjct  474   ELSIPYDKSKSHPAALTTSKYGVSKKELFRANLARELLLMKRHSFVYIFRATQLTIVAFI  533

Query  1521  TMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYP  1342
              MT+F+RT M R+S     IYM +LFF +  +MF+   ELA T+ +LP+F+KQRDLLFYP
Sbjct  534   AMTIFLRTEMHRDSVTDGGIYMGALFFGIISVMFNGFSELAMTVLKLPVFFKQRDLLFYP  593

Query  1341  AWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRS  1162
             AW+YA+P +IL+IPI+ IEV VWVF+TYYVIG+DPN GRL K ++LL+   Q+A+ LFR 
Sbjct  594   AWSYALPKWILKIPISFIEVGVWVFTTYYVIGFDPNVGRLFKQYLLLLAINQMATALFRF  653

Query  1161  AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              A +GR+M  A   GSF +L+L  LGGFILSR+DVKKWWIWGYWISPLMY+QNAI+ NEF
Sbjct  654   IAALGRNMIVANTFGSFALLILLVLGGFILSREDVKKWWIWGYWISPLMYSQNAISTNEF  713

Query  981   LGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRP  802
             LG+SW+  LP S+EP GVLVLK RG+FPEA WYW+G GALIG+ +    ++T+ALA L P
Sbjct  714   LGRSWSHSLPGSTEPLGVLVLKSRGVFPEAKWYWIGFGALIGYMLLFNALFTVALAYLNP  773

Query  801   LAQSRANISAESHSNEH--------------------DVSNGGSDNSVGERVSDGMS---  691
               ++R  IS E+   +H                    D ++G S + +    S   S   
Sbjct  774   FGKARPAISEETLKEKHANLTGEVLGSSSSRGRNSVNDFTSGNSADEIRRSNSSSKSTNE  833

Query  690   -----NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVL  526
                    K GM+LPF P S+ F++I+Y VDMPQEMK +GV ++RLELLKGVSG+FRPGVL
Sbjct  834   VVHPNQNKKGMVLPFVPLSMTFDNIRYSVDMPQEMKAQGVIEDRLELLKGVSGSFRPGVL  893

Query  525   TALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHL  346
             TALMGVSGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFAR+SGYCEQNDIHSPH+
Sbjct  894   TALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARVSGYCEQNDIHSPHV  953

Query  345   TVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRL  166
             TVYESL++SAWLRL SEV   TRK+FI+EVMELVELTSLR A+VGLPGVNGLST QRKRL
Sbjct  954   TVYESLVYSAWLRLSSEVNSATRKMFIEEVMELVELTSLRGALVGLPGVNGLSTEQRKRL  1013

Query  165   TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR+ VDTGRT+VCTIHQPSIDI
Sbjct  1014  TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRSTVDTGRTVVCTIHQPSIDI  1068


 Score =   134 bits (337),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 128/570 (22%), Positives = 249/570 (44%), Gaps = 76/570 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  880   LLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  938

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +           LS    +A  +          
Sbjct  939   VSGYCEQNDIHSPHVTVYESLVYSAWLR-----------LSSEVNSATRK----------  977

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                       + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  978   ----------MFIEEVMELVELTSLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1027

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     ++++++  +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1028  MDEPTSGLDARAAAIVMRTVRSTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGEEIY  1086

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++ +FE +      + G   A ++ EVT+   +            R + +
Sbjct  1087  IGPLGRHSCHLINYFEGIEGVSKIKDGYNPATWMLEVTTLAQE------------RILGV  1134

Query  1755  NEFSEAFQS---FHIGRNLGDELATP------FQKSTSHPAALTTKTYGVSKMELLKSCF  1603
             N FSE +++   +   +NL  EL+TP       + +T +P +  T+           +  
Sbjct  1135  N-FSEVYKTSELYQRNKNLIKELSTPPPGSSDLRFATQYPQSFFTQC---------MANL  1184

Query  1602  SREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIM  1423
              ++ L   RN         +  ++AL+  T+F     +R+        M S++  +  I 
Sbjct  1185  WKQNLSYWRNPPYTAVRFFFTTIIALLFGTIFWDLGTKRDKQQDLFNAMGSMYAAVLFIG  1244

Query  1422  FSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIG  1246
                   + P +     +FY++R    Y A  YA     + IP   I+  ++    Y +IG
Sbjct  1245  VQNASSVQPVVAIERTVFYRERAAGMYSALPYAFGQVAIEIPYILIQSLIYGVLVYAMIG  1304

Query  1245  YDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFIL  1072
             ++    +      +  ++  L    F     VG +  +  A +V S   L+     GFI+
Sbjct  1305  FEWTAAKFFWY--MFFMYFTLLYFTFYGMMAVGLTPNHNIAAIVSSAFYLIWNLFSGFII  1362

Query  1071  SRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              R  +  WW W YWI P+ +    +  ++F
Sbjct  1363  PRPRIPVWWRWYYWICPVSWTLYGLVASQF  1392



>ref|XP_007013791.1| Pleiotropic drug resistance 12 [Theobroma cacao]
 gb|EOY31410.1| Pleiotropic drug resistance 12 [Theobroma cacao]
Length=1450

 Score =  1441 bits (3731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 716/1074 (67%), Positives = 865/1074 (81%), Gaps = 34/1074 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME      R  S RI SSS+W +N  + F+KSSR    ++DDE ALKWAA++K+PT+ R+
Sbjct  1     MESGTDAFRVSSARIGSSSIWMTNTMEAFSKSSR----EEDDEEALKWAAIEKLPTYLRV  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++T   G++ EVDI ++G+ E++ +LERL+K+ E DNE FLLKLK+R+ERV +D+P 
Sbjct  57    RRGILTEEEGQSREVDIKDLGFIERRNLLERLVKIAEEDNEKFLLKLKERIERVGLDMPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIK  2605
             +EVRFEHLNV AEAYVG RALP++ NF  NILEGLLSYL  LP+ KK   IL DVSGIIK
Sbjct  117   IEVRFEHLNVEAEAYVGSRALPTMFNFSANILEGLLSYLRILPSRKKPLPILNDVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RM LLLGPPSSGKT+LLLALAG+L   L+FSGRV+YNGH M EFVP RT+AYISQ+DL
Sbjct  177   PRRMALLLGPPSSGKTTLLLALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQYDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG RYEMLAELSRREK ANI+PDPDIDI+MKAAA +GQ+A+
Sbjct  237   HIGEMTVRETLAFSARCQGVGPRYEMLAELSRREKEANIKPDPDIDIYMKAAALEGQEAS  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DYI+K+LGLE C DT+VGNE +RG+SGG++KR+T GEMLVGPA  L MDEISTGLDS
Sbjct  297   VVTDYILKILGLEVCADTMVGNEMIRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STT+QI+ S++  IHIL+GTA+I+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFF
Sbjct  357   STTYQIVNSLRQSIHILNGTALISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             EC+GF+CPERKGVADFLQEVTSRKDQ QYW RKD +PY FV++ EF+EAFQSFHIG+ LG
Sbjct  417   ECIGFKCPERKGVADFLQEVTSRKDQEQYWARKD-EPYSFVSVKEFAEAFQSFHIGQKLG  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             D+LATPF KS SHPAALT + YGVSK EL+K+C SRE LLMKRN  +++F++  +++M  
Sbjct  476   DDLATPFDKSKSHPAALTKEKYGVSKKELIKACVSREYLLMKRNLFVYVFKMIQLIIMGF  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             ITMTLF+RT M R++     ++M +LFF L +IMF+   ELA TI +LPIFYKQRDLLFY
Sbjct  536   ITMTLFLRTEMHRDTMTDGVVFMGALFFILIMIMFNGFAELAMTIMKLPIFYKQRDLLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAY++P +IL+IPI+ +EV++WVF TYYVIG+DP+ GR  K +++L+   Q+AS LFR
Sbjct  596   PSWAYSLPAWILKIPISVLEVTIWVFMTYYVIGFDPDAGRFFKHYLILLCLSQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                 +GR++  A   GSF +L +  +GGFIL+RDD+KKWWIWGYWISPLMY QNAIAVNE
Sbjct  656   LMGGLGRNIIVANTCGSFALLAVLVMGGFILARDDIKKWWIWGYWISPLMYGQNAIAVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW  + P S EP GV +LK RG+FPEA+WYW+GVGALIG+     F++TL L  L 
Sbjct  716   FLGKSWRQIPPNSKEPLGVSILKSRGIFPEAHWYWIGVGALIGYCFLFNFLFTLTLKYLD  775

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSVGER--------------------------VS  703
             P  + +A IS E+ + E   S  G +  +  R                          ++
Sbjct  776   PFGKPQAIISKETLA-EKIASKTGENAELSLRGKGSSERGIESRRSASSRSLSAKVGSIN  834

Query  702   DGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLT  523
             +   NRK GM+LPFEP S++F++IKY VDMPQEMK +GV ++RLELLKGVSGAFRPGVLT
Sbjct  835   EATQNRKRGMVLPFEPLSMSFDEIKYAVDMPQEMKAQGVSEDRLELLKGVSGAFRPGVLT  894

Query  522   ALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLT  343
             ALMG+SGAGKTTLMDVLAGRKTGGY+EG I ISG+ KKQ+TFARISGYCEQ DIHSPH+T
Sbjct  895   ALMGISGAGKTTLMDVLAGRKTGGYVEGTIKISGYPKKQETFARISGYCEQTDIHSPHVT  954

Query  342   VYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLT  163
             VYESL+FSAWLRLP EV  ETR +FI+EVMELVELTSLREA+VGLPGVNGLST QRKRLT
Sbjct  955   VYESLLFSAWLRLPPEVDSETRMMFIEEVMELVELTSLREALVGLPGVNGLSTEQRKRLT  1014

Query  162   IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1068


 Score =   145 bits (366),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 126/561 (22%), Positives = 242/561 (43%), Gaps = 58/561 (10%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  880   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGY-VEGTIKISGYPKKQETFAR  938

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L FSA                       +R  P++D    
Sbjct  939   ISGYCEQTDIHSPHVTVYESLLFSAW----------------------LRLPPEVD----  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   -----SETRMMFIEEVMELVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1027

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G + +Y
Sbjct  1028  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKRGGEEIY  1086

Query  1917  QGP-----CNCVLEFFECLGF-RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     C+ +  F E  G  R  +    A ++ EVTS   +    +   N       I
Sbjct  1087  VGPLGRHSCHLIKYFEEITGIPRIKDGYNPATWMLEVTSAAQEETLGVNLTN-------I  1139

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE +      + L  EL++P     S      T+ Y  S +    +C  ++     R
Sbjct  1140  YKNSELYWR---NKALVKELSSP--APGSKDLYFLTR-YSQSLITQCMACLWKQYWSYWR  1193

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N         +  ++AL+  T+F     +R         M S++  +  I F     + P
Sbjct  1194  NPPYTAVRFLFTTVIALLFGTIFWDLGSKRTRQQDVLNAMGSMYAAVLFIGFQNSASVQP  1253

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   ++  ++    Y +IG+D    +  
Sbjct  1254  VVAVERTVFYRERAAGMYSALPYAFGQVVVELPYVLVQTVIYGVIVYAMIGFDWTAAKFF  1313

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDDVKKWW  1045
               W L  ++       F     V  +  +  A +V S  + +     GF++ R  +  WW
Sbjct  1314  --WYLFFMYFTFLYFTFYGMMTVAVTPNHNIAAIVSSAFLALWNLFSGFVIPRTRIPVWW  1371

Query  1044  IWGYWISPLMYAQNAIAVNEF  982
              W YW+ P+ +    +  +++
Sbjct  1372  RWYYWVCPISWTLYGLIASQY  1392



>ref|XP_010049001.1| PREDICTED: pleiotropic drug resistance protein 1-like [Eucalyptus 
grandis]
 gb|KCW81448.1| hypothetical protein EUGRSUZ_C02833 [Eucalyptus grandis]
Length=1466

 Score =  1441 bits (3730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 707/1068 (66%), Positives = 853/1068 (80%), Gaps = 34/1068 (3%)
 Frame = -2

Query  3117  GRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTG  2941
              R GS R++SS++W ++G + F++SSR    D+DDE ALKWAAL+K+PT+ R+++G++  
Sbjct  22    ARLGSARLSSSNIWRTSGREIFSRSSR----DEDDEEALKWAALEKLPTYLRIQRGILAE  77

Query  2940  LRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEH  2761
               G+  EVDI N+G  E++ +LERL+K  E DNE FLLKLK R++RV +DIP +EVRFEH
Sbjct  78    EEGQITEVDIWNLGLIERRNLLERLLKTAEEDNEKFLLKLKQRIDRVGLDIPTIEVRFEH  137

Query  2760  LNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLL  2584
             LNV AEA+VG RALP++ NF +NI+EG L+  + LP+ KK   IL DVSGIIKP RMTLL
Sbjct  138   LNVEAEAHVGSRALPTIFNFTVNIVEGFLNCFHILPSRKKPLPILNDVSGIIKPHRMTLL  197

Query  2583  LGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTA  2404
             LGPP  GKT+LLLALAG+LD  L+FSGRV+YNGHEM EFVP RT+AYISQHDLHI EMT 
Sbjct  198   LGPPGCGKTTLLLALAGKLDKDLKFSGRVTYNGHEMEEFVPQRTSAYISQHDLHIGEMTV  257

Query  2403  RETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYII  2224
             RETLAFSARCQGVG RY+ML ELSRREKAANI+PDPDIDIFMKAA+  GQ+ NV+ DYI+
Sbjct  258   RETLAFSARCQGVGPRYDMLTELSRREKAANIKPDPDIDIFMKAASLKGQETNVVTDYIL  317

Query  2223  KVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQIL  2044
             K+LGLE C D +VG+E +RG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTTFQI+
Sbjct  318   KILGLEICADIMVGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIV  377

Query  2043  KSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRC  1864
              S++  +HIL+GTA+I+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFF  +GFRC
Sbjct  378   NSLRQSVHILNGTALISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFGHMGFRC  437

Query  1863  PERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPF  1684
             PERKGVADFLQEVTSRKDQ QYW  KD+ PYRFVT+ EFSEAFQSFHIGR LGD+LA PF
Sbjct  438   PERKGVADFLQEVTSRKDQEQYWANKDS-PYRFVTVKEFSEAFQSFHIGRKLGDQLAMPF  496

Query  1683  QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFI  1504
              KS SHPAALTT+ YGVS+ ELL++C SRE+LLMKRN  +++F++  ++L+A ITMT+F+
Sbjct  497   DKSRSHPAALTTEKYGVSRKELLRACISRELLLMKRNSFVYVFKMCQLILVAFITMTVFL  556

Query  1503  RTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAI  1324
             RT M R++     IY  +LFFTL +IMF+   ELA TI +LP+FYKQRD LF+P W YA+
Sbjct  557   RTEMHRDTVTDGGIYFGALFFTLIIIMFNGFSELAMTIMKLPVFYKQRDFLFFPEWTYAL  616

Query  1323  PTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGR  1144
             PT+IL+IPI+ +EV+VWVF TYYVIGYDP+ GRL K ++LL+   Q+AS LFR    VGR
Sbjct  617   PTWILKIPISIVEVAVWVFMTYYVIGYDPDAGRLFKQYLLLLCLNQMASALFRFIGAVGR  676

Query  1143  SMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN  964
             +M  A   GSF +L +  LGGFI+SR D+K WWIWGYW SP+MY QNAIAVNEFLGK W 
Sbjct  677   NMIVANTFGSFGLLAIMVLGGFIISRVDIKPWWIWGYWSSPMMYGQNAIAVNEFLGKQWR  736

Query  963   TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRA  784
              +   ++EP GV VLK RG+FPEA WYW+GVGA IG+ +   F++T+AL  L P  + +A
Sbjct  737   HIPANATEPLGVSVLKSRGIFPEARWYWIGVGASIGYIVLFNFLFTVALKYLNPFGKPQA  796

Query  783   NISAES---------------------------HSNEHDVSNGGSDNSVGERVSDGMSNR  685
              +S E+                            S     +  G+ ++ G   +D   NR
Sbjct  797   VLSKETLVEKVASKHGEVIELSSRGSQRSSSKKESGHQGSAASGTLSTRGGSTNDSDPNR  856

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             K GM+LPFEP SIAF+D++Y VDMPQEMK +G+ ++RLELLKGVSGAFRPGVLTALMGVS
Sbjct  857   KRGMVLPFEPLSIAFDDVRYAVDMPQEMKAQGILEDRLELLKGVSGAFRPGVLTALMGVS  916

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRKTGGYI+G ITISG+ K+Q+TFARISGYCEQ DIHSPH+TVYESL 
Sbjct  917   GAGKTTLMDVLAGRKTGGYIDGTITISGYPKQQETFARISGYCEQTDIHSPHVTVYESLA  976

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLPSEV  ETRK+FI+EVMEL+ELT LREA+VGLPGVNGLST QRKRLTIAVELV
Sbjct  977   YSAWLRLPSEVDSETRKMFIEEVMELIELTPLREALVGLPGVNGLSTEQRKRLTIAVELV  1036

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1037  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1084


 Score =   144 bits (362),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 132/581 (23%), Positives = 248/581 (43%), Gaps = 73/581 (13%)
 Frame = -2

Query  2661  LPTTKKHNSILRD-------VSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSG  2503
             +P   K   IL D       VSG  +PG +T L+G   +GKT+L+  LAG+        G
Sbjct  880   MPQEMKAQGILEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDG  938

Query  2502  RVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRRE  2323
              ++ +G+   +    R + Y  Q D+H P +T  E+LA+SA  +                
Sbjct  939   TITISGYPKQQETFARISGYCEQTDIHSPHVTVYESLAYSAWLR----------------  982

Query  2322  KAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERK  2143
                              +  D +   + ++ +++++ L    + +VG   + G+S  +RK
Sbjct  983   ---------------LPSEVDSETRKMFIEEVMELIELTPLREALVGLPGVNGLSTEQRK  1027

Query  2142  RLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYD  1963
             RLT    LV   +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++
Sbjct  1028  RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFE  1086

Query  1962  LFDDIILISEG-QIVYQGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQM  1804
              FD++ L+  G Q +Y GP     + ++++FE +      + G   A ++ EVT+     
Sbjct  1087  AFDELFLLKRGGQEIYVGPLGQHSSHLIDYFEGISGVSKIKDGYNPATWMLEVTAAA---  1143

Query  1803  QYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATP--FQKSTSHPAALTTKTYGVS  1630
                 +++   + F  +   SE F+     + L +EL+TP    K    PA      Y  S
Sbjct  1144  ----QEEILGFNFTEVYRNSELFRR---NKTLINELSTPPPGSKDLYFPA-----QYSQS  1191

Query  1629  KMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSS  1450
                   +C  ++     RN       + +   +AL+  T+F     +R +       + S
Sbjct  1192  FFTQCMACLWKQYWSYWRNPSYTAVRLLFTTFIALMFGTIFWNLGSKRGNQQDLFNAIGS  1251

Query  1449  LFFTLTVIMFSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVW  1273
             ++     I F     + P +     +FY++R    Y A  YA    ++ IP T ++   +
Sbjct  1252  MYAACLFIGFQNSTSVQPVVAIERTVFYRERGAGMYSALPYAFAQVVIEIPYTFLQTVTY  1311

Query  1272  VFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF---RSAAVVGRSMTNAFVVGSFIML  1102
                 Y +IG+D    +    W +  +F  L    +    S AV       A    +F  +
Sbjct  1312  GVIVYSMIGFDWTASKFF--WYIFCMFFSLLYFTYYGMMSVAVTPNQHIAAITSSAFYAI  1369

Query  1101  V-LFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
               LF+  GF++ R  +  WW W YW  P+ +    +  ++F
Sbjct  1370  WNLFS--GFVVPRPRMPVWWRWYYWADPISWTLYGLVASQF  1408



>ref|XP_002303856.2| hypothetical protein POPTR_0003s18140g [Populus trichocarpa]
 gb|EEE78835.2| hypothetical protein POPTR_0003s18140g [Populus trichocarpa]
Length=1400

 Score =  1441 bits (3730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 715/1056 (68%), Positives = 850/1056 (80%), Gaps = 20/1056 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNG-TDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D   R+ S +   SSLW+N  +D F+KSSR    D+DDE ALKWAA++++PTF+RL
Sbjct  1     MEGADDIYRACSLQRGGSSLWTNNVSDAFSKSSR----DEDDEEALKWAAIERLPTFNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+   +G   E+ I N+G  E+K +LERLI V E DNE FL KLK R+ERV ID+P 
Sbjct  57    QKGLLATSKGAN-EIYIQNLGIHERKGLLERLIDVSEEDNEKFLKKLKSRIERVGIDLPT  115

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILE-GLLSYLYLPTTKKHNSILRDVSGIIK  2605
             +EVRFEHLN+ AEA+ G RALPS+ NFC++  E G          KK  SIL DVSGIIK
Sbjct  116   IEVRFEHLNIKAEAHEGSRALPSMINFCVDFAEVGFCR----SCKKKQVSILEDVSGIIK  171

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLALAG+LDP+L+FSGRV+YNGH MNEFVP R+AAYISQ+D 
Sbjct  172   PSRMTLLLGPPSSGKTTLLLALAGKLDPNLKFSGRVTYNGHGMNEFVPQRSAAYISQYDT  231

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             H+ EMT RETLAF+ARCQGVG RYEMLAELSRREK A+I+PDPDID+FMKA AT+GQK +
Sbjct  232   HLGEMTVRETLAFAARCQGVGHRYEMLAELSRREKEASIKPDPDIDVFMKAIATEGQKTS  291

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DYIIK+LGLE C D +VG+E +RG+SGG+RKR+T GEMLVGPA  L MDEISTGLDS
Sbjct  292   VMTDYIIKILGLEVCADIMVGSEMVRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDS  351

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S+KH IHIL+GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+FF
Sbjct  352   STTFQIVNSLKHTIHILNGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLQFF  411

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQE+TSRKDQ QYW+ KD +PY FVT+ EF+EAFQSFH+G  +G
Sbjct  412   ESMGFKCPERKGVADFLQEITSRKDQQQYWMHKD-EPYSFVTVKEFAEAFQSFHVGCRIG  470

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             D L+TPF+KS SHPAAL T+ YG  KMELLK+CF RE LLMKRN  ++ F++  + LM++
Sbjct  471   DALSTPFEKSQSHPAALKTRKYGTGKMELLKACFLREWLLMKRNSFVYFFKLAQLTLMSI  530

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF RT M +NS     +Y  +LF++L ++MF  + E++ TI  LP+FYKQRDLLFY
Sbjct  531   IAMTLFFRTEMHKNSVSEGGVYSGALFYSLALMMFIGMPEISMTIGSLPVFYKQRDLLFY  590

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WA+++P++ILRIP+T I+ ++WV  TYYVIGYDPN GRL K ++LL+   Q+AS LFR
Sbjct  591   PSWAFSLPSWILRIPVTLIQTTIWVALTYYVIGYDPNVGRLFKQYLLLVAVSQMASALFR  650

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                 +GRSM  A   GSF +L+LFALGGF+LS  D+KKWWIWGYWISPLMY QNAI VNE
Sbjct  651   FIGGLGRSMIVANTFGSFALLILFALGGFVLSHGDIKKWWIWGYWISPLMYGQNAIVVNE  710

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW+ VLP S EP G+ VLK RG   +AYWYW+GVGAL GFTI     YTLALA L 
Sbjct  711   FLGKSWSHVLPNSIEPLGIEVLKSRGFVTDAYWYWIGVGALGGFTILFNICYTLALAFLN  770

Query  804   PLAQSRANISAESHSNEHDV-------SNGGS-DNSVGERVSDGMSNRKHGMILPFEPHS  649
             P  +S+A IS +S S +  V       SN GS   +  E +S+  + +K GMILPFEP S
Sbjct  771   PFRKSQAVISKDSESIKPGVTGGAIQLSNHGSRHQNDTEIISEANNQKKKGMILPFEPFS  830

Query  648   IAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA  469
             I F++IKY VDMPQEMK +G+ +++LELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA
Sbjct  831   ITFDEIKYSVDMPQEMKNQGILEDKLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA  890

Query  468   GRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVT  289
             GRKTGGYIEG ITISG  KKQ+TFARISGYCEQNDIHSPH+TVYESL++S WLRLP EV 
Sbjct  891   GRKTGGYIEGNITISGHPKKQETFARISGYCEQNDIHSPHVTVYESLLYSGWLRLPPEVN  950

Query  288   CETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPT  109
              ETRK+FI+EVMELVEL  LR+A+VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPT
Sbjct  951   AETRKMFIEEVMELVELNPLRQALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPT  1010

Query  108   SGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1011  SGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1046


 Score =   104 bits (260),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 119/576 (21%), Positives = 229/576 (40%), Gaps = 91/576 (16%)
 Frame = -2

Query  2661  LPTTKKHNSILRD-------VSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSG  2503
             +P   K+  IL D       VSG  +PG +T L+G   +GKT+L+  LAG+        G
Sbjct  842   MPQEMKNQGILEDKLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEG  900

Query  2502  RVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRRE  2323
              ++ +GH   +    R + Y  Q+D+H P +T  E+L +S                    
Sbjct  901   NITISGHPKKQETFARISGYCEQNDIHSPHVTVYESLLYSGW------------------  942

Query  2322  KAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERK  2143
                 +R  P+++          +   + ++ +++++ L      +VG   + G+S  +RK
Sbjct  943   ----LRLPPEVN---------AETRKMFIEEVMELVELNPLRQALVGLPGVSGLSTEQRK  989

Query  2142  RLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYD  1963
             RLT    LV   +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++
Sbjct  990   RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFE  1048

Query  1962  LFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKD  1783
              FD+ I   E       P   +L+              V     E  S  D         
Sbjct  1049  SFDEGIEGVEKIRDGYNPATWMLD--------------VTSLGHEAASGID---------  1085

Query  1782  NKPYRFVTINEFSEAFQSFHIGRNLG--DELATPFQKSTSHPAALTTKTYGVSKMELLKS  1609
                  F +I + SE ++     RN     EL+TP   S           Y  S +    +
Sbjct  1086  -----FASIYKNSELYR-----RNKARIQELSTPAPGSKD---LFFPTQYSQSFLVQCLA  1132

Query  1608  CFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTV  1429
             C  ++     RN       + +   +ALI  ++F     +          M S++  +  
Sbjct  1133  CLWKQHWSYWRNPSYTAVRLLFTTAIALIFGSMFWNLGSKTKKKQDLFNAMGSMYAAIIF  1192

Query  1428  IMFSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYV  1252
             +       + P +     +FY+++    Y +  YA+   ++ +P    +  V+    Y +
Sbjct  1193  LGIQNSSSVQPVVAVERTVFYREKAAGMYSSMPYALAQILIELPYIFTQSMVYGLIVYAM  1252

Query  1251  IGYDPNFGRLLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFA  1090
             IG++    +           +L   F  + +V       V   +++AF    + +  LF+
Sbjct  1253  IGFEWTAAKFFWYLFFMFFTLLYFTFYGMMTVAATPNQHVASIVSSAF----YSVWNLFS  1308

Query  1089  LGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
               GFI+ R  +  WW W  WI P+ +    +  ++F
Sbjct  1309  --GFIIPRPRIPVWWRWYAWICPVSWTLYGLVSSQF  1342



>emb|CAN61934.1| hypothetical protein VITISV_005227 [Vitis vinifera]
Length=1400

 Score =  1441 bits (3730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 711/1048 (68%), Positives = 856/1048 (82%), Gaps = 14/1048 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             M   D+   SGS R N SS+W S+G D F++SSR    D+DDE ALKWAAL+K+PT++RL
Sbjct  1     MATADTYRASGSLRRNGSSIWRSSGADVFSRSSR----DEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++GL+ G  GE  E+DI+N+G++EKK ++ERL+KV E DNE FLLKLK+R++RV ID+P+
Sbjct  57    RRGLLMGSEGEASEIDIHNLGFQEKKNLVERLVKVAEEDNEKFLLKLKNRIDRVGIDVPE  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIK  2605
             +EVRFEHL + AEA+VG RALPS  NF  N LEG+L+ +  LP+ K+  +IL DVSGIIK
Sbjct  117   IEVRFEHLTIDAEAFVGSRALPSFHNFIFNKLEGILNAVRILPSKKRKFTILNDVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPPSSGKT+LLLALAG+LDP+L+  GRV+YNGH MNEFVP RTAAYISQHD 
Sbjct  177   PRRLTLLLGPPSSGKTTLLLALAGKLDPNLKVMGRVTYNGHGMNEFVPQRTAAYISQHDT  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG RY+MLAELSRREKAANI+PDPD+D+FMKAAAT+GQK N
Sbjct  237   HIGEMTVRETLAFSARCQGVGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKEN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY +K+LGL+ C DT+VG+E +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDS
Sbjct  297   VVTDYTLKILGLDICADTMVGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S+K  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+ QIVYQGP   VLEFF
Sbjct  357   STTFQIINSLKQTIHILNGTAVISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKG ADFLQEVTSRKDQ QYW RKD  PY FVT+ EF+EAFQSFHIGR + 
Sbjct  417   ESIGFKCPERKGEADFLQEVTSRKDQAQYWARKD-VPYSFVTVKEFAEAFQSFHIGRKVA  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELA+PF ++ SHPAALTTK YGV K ELL +  SRE LLMKRN  ++IF++  + ++A+
Sbjct  476   DELASPFDRAKSHPAALTTKKYGVRKKELLDANMSREYLLMKRNSFVYIFKLTQLAVVAV  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF+RT M +NS     IY  +LFFT+ +IMF+ + ELA TI +LP+FYKQRD LFY
Sbjct  536   IAMTLFLRTEMNKNSTEDGSIYTGALFFTVVMIMFNGMAELAMTIAKLPVFYKQRDFLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAYA+PT++L+IPIT +EV+VWVF TYYVIG+DPN  RL + ++LL++  Q+AS LFR
Sbjct  596   PAWAYALPTWVLKIPITFVEVAVWVFITYYVIGFDPNVERLFRQYLLLLLVNQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A  GR+M  A   G+F +L+L ALGGFILS D+VKKWWIWGYW SPLMYAQNAI VNE
Sbjct  656   FIAAAGRNMIVASTFGAFAVLMLMALGGFILSHDNVKKWWIWGYWSSPLMYAQNAIVVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW+  +  S+E  G  VLK RG F +A+WYW+G GAL+GF       YTL L  L 
Sbjct  716   FLGKSWSKNVTBSTESLGXTVLKSRGFFTDAHWYWIGAGALLGFIFVFNXFYTLCLNYLN  775

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKY  625
             P  + +A I+ ES + +   +  G    + E +++G  N+K GM+LPF+PHSI F+DI+Y
Sbjct  776   PFEKPQAVITEESDNAKTATTERG--EHMVEAIAEGNHNKKKGMVLPFQPHSITFDDIRY  833

Query  624   CVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI  445
              VDMP     EG  ++RLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI
Sbjct  834   SVDMP-----EGALEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI  888

Query  444   EGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFI  265
             EG I+ISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLPS+V  ETRK+FI
Sbjct  889   EGNISISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSDVNSETRKMFI  948

Query  264   KEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAA  85
             +EVMELVELT LR+A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAA
Sbjct  949   EEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAA  1008

Query  84    AIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1009  AIVMRTVRNTVDTGRTVVCTIHQPSIDI  1036


 Score =   114 bits (286),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 116/563 (21%), Positives = 238/563 (42%), Gaps = 81/563 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +S +G+   +    R
Sbjct  848   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNISISGYPKKQETFAR  906

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D++    
Sbjct  907   ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLPSDVN----  940

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  941   -----SETRKMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  995

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+   GQ +Y
Sbjct  996   MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLMKRGGQEIY  1054

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++ +FE +      + G   A ++ EVT+   +    +            
Sbjct  1055  VGPLGRHSSHLINYFEGIEGVSKIKDGYNPATWMLEVTTGAQEGTLGV------------  1102

Query  1755  NEFSEAFQSFHIGRNLGDELATP-FQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMK  1579
              +F+E +++  + R    E   P +++     + L T  + +  M +         L++ 
Sbjct  1103  -DFTEIYKNSDLYRT---EPTCPWYKRPLFXYSILPTLLHPIFGMLM------ETTLVIL  1152

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELA  1399
                 +H  E+      +L     F+ +  Q++    + +  +  +     + + + + + 
Sbjct  1153  AEPTIHGSEISLHNFHSLDVWVNFLGSGHQKDKATRS-VKCNGFYVCCCSLSWGSERPIG  1211

Query  1398  PTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
             P          +R    Y A  YA    ++ IP    +  V+    Y +IG++    +  
Sbjct  1212  PA---------KRAAGMYSALPYAFGQALVEIPYVFAQAVVYGVIVYGMIGFEWTATKFF  1262

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W L  +F  L    F     V  +      + S I    + L     GFI+ R+ +  
Sbjct  1263  --WYLFFMFCTLLYFTFYGMMAVAATPNQH--IASIIAATFYTLWNLFSGFIVPRNRIPV  1318

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W  WI P+ +    +  ++F
Sbjct  1319  WWRWYCWICPVAWTLYGLVASQF  1341



>dbj|BAB92011.1| pleiotropic drug resistance like protein [Nicotiana tabacum]
Length=1434

 Score =  1441 bits (3729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/1044 (67%), Positives = 863/1044 (83%), Gaps = 10/1044 (1%)
 Frame = -2

Query  3120  RGRS-GSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLM  2947
             RG + GS R NS+S+W +NG + F++SSR    D+DDE ALKWAAL+K+PTFDRL+KGL+
Sbjct  15    RGSTRGSLRANSNSIWRNNGVEIFSRSSR----DEDDEEALKWAALEKLPTFDRLRKGLL  70

Query  2946  TGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRF  2767
              G +G   EVDIN++G++E+K +LERL+KV + DNE FLLKLK+R++RV ID+P +EVR+
Sbjct  71    FGSQGAAAEVDINDLGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRY  130

Query  2766  EHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKKHN-SILRDVSGIIKPGRMT  2590
             EHLN+ A+AYVG R+LP+  NF  N +E LL+ L++ +++K   +IL+D+SGIIKP RMT
Sbjct  131   EHLNIDADAYVGSRSLPTFMNFMTNFVETLLNSLHILSSRKRQLTILKDISGIIKPCRMT  190

Query  2589  LLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEM  2410
             LLLGPPSSGKT+LLLALAG+LDP+L+ +G+VSYNGHE++EFVP RTAAYISQHDLHI EM
Sbjct  191   LLLGPPSSGKTTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEM  250

Query  2409  TARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDY  2230
             T RETL FSARCQGVGSR+EMLAELSRREKAANI+PD DIDI+MKAAAT+GQ+ANV+ DY
Sbjct  251   TVRETLEFSARCQGVGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDY  310

Query  2229  IIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQ  2050
             ++K+LGL+ C DT+VG++ +RG+SGG++KR+T GEMLVGP+  L MDEISTGLDSSTT+ 
Sbjct  311   VLKILGLDICADTMVGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYS  370

Query  2049  ILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGF  1870
             I+ S++  + IL GTAVI+LLQPAPE Y+LFDDIIL+S+G IVYQGP + VLEFFE +GF
Sbjct  371   IVNSLRQSVQILKGTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGF  430

Query  1869  RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELAT  1690
             +CP+RKGVADFLQEVTS+KDQ QYW  K N+PYRF+T  EF+EA+QSFH+GR LGDELAT
Sbjct  431   KCPQRKGVADFLQEVTSKKDQQQYW-SKRNEPYRFITSKEFAEAYQSFHVGRKLGDELAT  489

Query  1689  PFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTL  1510
             PF K+  HPAALT + YG+ K ELLK C  RE+LLMKRN  +++F+   + +MALITMTL
Sbjct  490   PFDKTKCHPAALTNEKYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTL  549

Query  1509  FIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAY  1330
             F RT M R++     IY  +LFF + +IMF+ + ELA TIF+LP+FYKQRDLLF+P+WAY
Sbjct  550   FFRTEMPRDTTDDGGIYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAY  609

Query  1329  AIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVV  1150
             AIP++IL+IP+T +EV +WV  TYYVIG+DPN  R LK ++LLI+  Q+AS +FR    V
Sbjct  610   AIPSWILKIPVTLVEVGLWVILTYYVIGFDPNITRFLKQFLLLIVVNQMASGMFRFIGAV  669

Query  1149  GRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKS  970
             GR+M  A   GSF +L+ FALGGF+LSRDDVK WWIWGYWISP+MY+ N+I VNEF GK 
Sbjct  670   GRTMGVASTFGSFALLLQFALGGFVLSRDDVKSWWIWGYWISPMMYSVNSILVNEFDGKK  729

Query  969   WNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQS  790
             WN ++P  +E  G  V+K RG FPEAYWYW+GVGAL+GFT+   F Y+LALA L P  + 
Sbjct  730   WNHIVPGGNETLGSTVVKSRGFFPEAYWYWIGVGALVGFTVVFNFCYSLALAYLNPFDKP  789

Query  789   RANISAESHSNEH-DVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDM  613
             +A +  +  + E+ +VS+       G+ +S+  +N+K GM+LPFEPHSI F+D+ Y VDM
Sbjct  790   QAVLPEDGENAENGEVSSQIPSTDGGDSISESQNNKK-GMVLPFEPHSITFDDVVYSVDM  848

Query  612   PQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEI  433
             PQEMK +G  ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+GEI
Sbjct  849   PQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGEI  908

Query  432   TISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVM  253
              ISG+ KKQ+TFARISGYCEQNDIHSP++TVYESL++SAWLRLP +V  +TRK+F+ EVM
Sbjct  909   KISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVDEKTRKMFVDEVM  968

Query  252   ELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM  73
             ELVEL  LR A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM
Sbjct  969   ELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM  1028

Query  72    RTVRNIVDTGRTIVCTIHQPSIDI  1
             RTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1029  RTVRNTVDTGRTVVCTIHQPSIDI  1052


 Score =   142 bits (358),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 130/564 (23%), Positives = 239/564 (42%), Gaps = 64/564 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  864   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGEIKISGYPKKQETFAR  922

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+D    
Sbjct  923   ISGYCEQNDIHSPYVTVYESLVYSAW----------------------LRLPQDVD----  956

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + VD +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  957   -----EKTRKMFVDEVMELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1011

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1012  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1070

Query  1917  QGP-----CNCVLEFFECLGF-RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     C+ +  F    G  +  E    A ++ EVT+   +M   I            
Sbjct  1071  VGPLGRHSCHLIKYFESNPGVAKIKEGYNPATWMLEVTASAQEMMLGI------------  1118

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F+E +++   +   + L  EL  P  +  S      T+ Y  S      +C  ++   
Sbjct  1119  -DFTEVYKNSDLYRRNKALISELGVP--RPGSKDLHFETQ-YSQSFWTQCVACLWKQHWS  1174

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +ALI  T+F     + +        M S++  +  +       
Sbjct  1175  YWRNPAYTAVRFIFTTFIALIFGTMFWDLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASS  1234

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA     + IP   ++   +    Y +IG++ + G
Sbjct  1235  VQPVVAIERTVFYRERAAGMYSAIPYAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVG  1294

Query  1227  RLLKMWVLLIIFRQLASVLFRS--AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVK  1054
             +    W L I+F  L    F       V  +   A +V +F   V     GFI+ R  + 
Sbjct  1295  KFF--WYLFIMFFTLLYFTFYGMMGVAVTPNQNVASIVAAFFYGVWNLFSGFIIPRPRMP  1352

Query  1053  KWWIWGYWISPLMYAQNAIAVNEF  982
              WW W YW +P+ +    +  ++F
Sbjct  1353  VWWRWYYWANPVAWTLYGLVASQF  1376



>emb|CDO98092.1| unnamed protein product [Coffea canephora]
Length=1422

 Score =  1439 bits (3725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1048 (66%), Positives = 855/1048 (82%), Gaps = 11/1048 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             MEI  S    GS R NSS+LW N G + F++SSR    D+DDE ALKWA+L+K+PTFDRL
Sbjct  1     MEIGPSGSLRGSLRANSSALWRNTGLEVFSRSSR----DEDDEDALKWASLEKLPTFDRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+ G RGE  EVD+ N G++E+K ++ERLIKV E DNE FL+KL++R++RV ID+P 
Sbjct  57    RKGLLFGSRGEVNEVDVENFGFQERKTLIERLIKVAEEDNEKFLMKLRNRIDRVGIDLPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVR+EHLNV AEAYVG  ALP+  NF  N++EG+L+ L+ LP+ KK+  ILRDVSGIIK
Sbjct  117   IEVRYEHLNVEAEAYVGSSALPTFLNFATNMIEGVLNNLHILPSRKKNIKILRDVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPP SGKT+LL+ALAG+LDP L+ SGR++YNGH MNEFVP RTAAY+SQHDL
Sbjct  177   PSRLTLLLGPPGSGKTTLLMALAGKLDPDLKSSGRITYNGHGMNEFVPQRTAAYVSQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRYEMLAELSRREKAANI+PDPDIDI+MK+AAT+GQ+A 
Sbjct  237   HIGEMTVRETLAFSARCQGVGSRYEMLAELSRREKAANIKPDPDIDIYMKSAATEGQEAT  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY++++LGLE C DT+VG+E LRG+SGG++KR+T GEMLVGP N L MDEISTGLDS
Sbjct  297   VVTDYVLRILGLEICADTLVGDEMLRGISGGQKKRVTTGEMLVGPTNALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++ Y+HI+ GTA I+LLQPAPE YDLFDDI+L+S+G IVYQGP   VLEFF
Sbjct  357   STTFQIVNSLRQYVHIMKGTAFISLLQPAPETYDLFDDIVLLSDGLIVYQGPRENVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GFRCP+RKGVADFLQEVTS+KDQ QYW R+D +PYR++   EF+E+FQSFH+GR L 
Sbjct  417   ESMGFRCPDRKGVADFLQEVTSKKDQRQYWARRD-EPYRYIAATEFAESFQSFHVGRTLS  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +ELATPF KS SHPAALTT+TYGV+  E+ K+  +RE+LL+KRN  ++IF++  +++M L
Sbjct  476   NELATPFDKSKSHPAALTTQTYGVNNKEIFKANSARELLLIKRNSFIYIFKLSQLIIMGL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MT+F RT M R       IY+ +LFF +  +MF+ + ELA TI +LP+F+KQRD  F+
Sbjct  536   IGMTVFFRTKMPRRDVADGGIYLGALFFVVVQVMFNGMAELAMTILKLPVFFKQRDFRFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAW+YA+PT+IL+IPIT +EV+VWV  TY+VIG+DP+  R  K +++L+   Q+AS LFR
Sbjct  596   PAWSYALPTWILKIPITFLEVAVWVGLTYFVIGFDPSPARFFKHYLILVAINQVASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                   R+M  A   G+F +++LFALGGF+LSRD VKKWW+WGYW SPLMYAQNAI VNE
Sbjct  656   FIGAASRNMIVANTFGTFALMLLFALGGFVLSRDQVKKWWLWGYWSSPLMYAQNAILVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             F GK W  ++P ++E  G  VLK +G FP++YWYW+G+GA  GF +   F YTLAL  L+
Sbjct  716   FTGKHWRQIVPNTTETLGTQVLKSKGFFPQSYWYWIGLGACGGFILLLNFFYTLALTYLQ  775

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKY  625
             PL + +A +  ES + E+   +G  D SV + +++   N++ GMILPFEPHSI F+DI+Y
Sbjct  776   PLGKPQAVLPEESENTEN---SGQRDGSV-DAITESNENQRRGMILPFEPHSITFDDIRY  831

Query  624   CVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI  445
              VDMPQ MK +G  +++L LLKG+SGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI
Sbjct  832   SVDMPQAMKDQGAVEDKLMLLKGISGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI  891

Query  444   EGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFI  265
             EG +TISG+ K Q+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLP+EV  +TR +F+
Sbjct  892   EGNVTISGYPKNQETFARISGYCEQNDIHSPHVTVYESLVYSAWLRLPAEVDAKTRMMFV  951

Query  264   KEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAA  85
              EVMELVEL SLR+ +VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAA
Sbjct  952   DEVMELVELNSLRDGLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAA  1011

Query  84    AIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  AIVMRTVRNTVDTGRTVVCTIHQPSIDI  1039


 Score =   134 bits (337),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 122/566 (22%), Positives = 246/566 (43%), Gaps = 68/566 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ +SG  +PG +T L+G   +GKT+L+  LAG+        G V+ +G+  N+    R
Sbjct  851   LLKGISGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNVTISGYPKNQETFAR  909

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  910   ISGYCEQNDIHSPHVTVYESLVYSAWLR-------------------------------L  938

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              A  D +   + VD +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  939   PAEVDAKTRMMFVDEVMELVELNSLRDGLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  998

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  999   MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLLKRGGQEIY  1057

Query  1917  QGPCNC----VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVT+   ++             +  
Sbjct  1058  VGPLGHNSIELIKYFEAIDGVSKIKDGYNPATWMLEVTASAQEL-------------MLG  1104

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F+E +++   +   + L  EL +P  +  +      TK      ++ + +CF ++ + 
Sbjct  1105  ADFAEIYKNSDLYRRNKALIHELDSP--RPGTKDLYFPTKYSQAFPVQCM-ACFWKQRIS  1161

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +AL   T+F +   ++ +       M S++  +  +       
Sbjct  1162  YWRNPPYTAVRFLFTSFIALSFGTIFWKLGKRKETSQDLINAMGSMYAAVLFLGVQNSSA  1221

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA     + I     +   +   TY +IG++    
Sbjct  1222  VQPVVAIERTVFYRERAAGMYSALPYAFAQVGIEILYILKQAVFYSLITYAMIGFEWTAA  1281

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFA----LGGFILSRDD  1060
             +    W L  ++  L    F    VV  S+T    + + +    +A      GF++ R  
Sbjct  1282  KFF--WYLFFMYFTLLYFTFYGMMVV--SVTPNHNISAVVASAFYAGWNLFSGFLIPRPR  1337

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF  982
             +  WW W YW  P+ ++   + V+++
Sbjct  1338  IPIWWRWYYWGCPVAWSLYGLFVSQW  1363



>gb|AGT28053.1| pleiotropic drug resistance transporter 1 [Panax ginseng]
Length=1447

 Score =  1439 bits (3724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/1041 (67%), Positives = 854/1041 (82%), Gaps = 10/1041 (1%)
 Frame = -2

Query  3108  GSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             GS R  S+S+W + G D F+KSSR    D+DDE ALKWA+L+K+PTFDRL+KGL+ G +G
Sbjct  28    GSLRAGSTSIWRDQGMDVFSKSSR----DEDDEEALKWASLEKLPTFDRLRKGLLLGSQG  83

Query  2931  ETF-EVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLN  2755
               F EVD++N+G +++K +LERL++V E DNE FLLKL+DR++RV +D+P +EVRFEHL+
Sbjct  84    AGFNEVDVDNLGVQQRKNLLERLVRVAEEDNEKFLLKLRDRIDRVGVDLPTIEVRFEHLS  143

Query  2754  VGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIKPGRMTLLLG  2578
             V AEA+VG RALPS  NF ++I+EG L+  +L   TKKH +IL+DVSGI+KP RMTLLLG
Sbjct  144   VEAEAHVGSRALPSFLNFSISIVEGFLNIFHLLRNTKKHLTILQDVSGILKPCRMTLLLG  203

Query  2577  PPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARE  2398
             PPSSGKT+L+LALAG+LDP+L FSGRV+YNGH M EFVP RTAAYISQHDLHI EMT RE
Sbjct  204   PPSSGKTTLMLALAGKLDPTLRFSGRVTYNGHGMQEFVPQRTAAYISQHDLHIGEMTVRE  263

Query  2397  TLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKV  2218
             TLAFSARCQGVGSRYEMLAEL+RREK ANI+PDPD+DI+MKAAAT GQ+A+V+ DY++K+
Sbjct  264   TLAFSARCQGVGSRYEMLAELARREKDANIKPDPDVDIYMKAAATAGQEASVVTDYVLKI  323

Query  2217  LGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKS  2038
             LGL+ C DT+VG++ +RG+SGG++KR+T GEMLVGP+  L MDEISTGLDSSTTFQI+ S
Sbjct  324   LGLDICADTMVGDQMIRGISGGQKKRVTTGEMLVGPSRALFMDEISTGLDSSTTFQIVNS  383

Query  2037  IKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPE  1858
             +KH +HIL GTA+I+LLQPAPE YDLFDDIIL+S+G IVYQGP   VLEFFE +GF+CPE
Sbjct  384   LKHSVHILQGTALISLLQPAPETYDLFDDIILLSDGHIVYQGPREHVLEFFESMGFKCPE  443

Query  1857  RKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQK  1678
             RKGVADFLQEVTS+KDQ QYW+ KD +PYRF+T  EF+EA+QSFH+G  + D+LA PF K
Sbjct  444   RKGVADFLQEVTSKKDQKQYWLHKD-EPYRFITAREFAEAYQSFHVGLKMVDDLAIPFDK  502

Query  1677  STSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRT  1498
             S SHPAALTT+ YGV+K ELLK+  +REVLLMKRN  ++IF++  +  MA+ITMTLF+RT
Sbjct  503   SKSHPAALTTEKYGVNKKELLKALTAREVLLMKRNSFVYIFKLFQLTTMAVITMTLFLRT  562

Query  1497  NMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPT  1318
              + ++S     +YM +LFF + ++MF+ L ELA TI +LP+FYKQRDLLFYP+W+YA+P+
Sbjct  563   ELDQSSTTEGGLYMGALFFAVVMLMFNGLAELAMTIAKLPVFYKQRDLLFYPSWSYALPS  622

Query  1317  FILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSM  1138
             +I++IP+T +EV+VWV  TYYVIG+DPN GR  K +++L++  Q+AS LFR    +GR+M
Sbjct  623   WIIKIPVTILEVAVWVVLTYYVIGFDPNVGRFFKQYLVLLLINQMASALFRMTGALGRTM  682

Query  1137  TNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTV  958
               A   G F +L+LFALGGF+L+R+DV KWWIWGY+ SP+MY  NAIAVNEFLG  WN +
Sbjct  683   ILANTFGGFALLILFALGGFVLAREDVAKWWIWGYYSSPMMYGMNAIAVNEFLGHQWNKL  742

Query  957   LPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANI  778
                 +E  GV +LK RG FP +YWYW+G GAL+GF +     Y +AL  L PL + +A I
Sbjct  743   TTNGTETIGVALLKSRGFFPYSYWYWIGTGALVGFILLLNLGYAVALDYLNPLGKPQAII  802

Query  777   SAESHSNEHDVSNGGSD--NSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQE  604
                S S +   +   S   +S+ E   +   N+K GMILPFEPHSI F+DIKY VDMPQE
Sbjct  803   PETSDSEQAGETTELSSELSSMTESNVETNQNKKKGMILPFEPHSITFDDIKYSVDMPQE  862

Query  603   MKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITIS  424
             MK +GV +++L LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG ITIS
Sbjct  863   MKEQGVVEDKLLLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITIS  922

Query  423   GFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELV  244
             G+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPSEV   TRK+F+ EV++LV
Sbjct  923   GYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSEVDSTTRKMFVDEVLDLV  982

Query  243   ELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTV  64
             EL SL+  ++GLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTV
Sbjct  983   ELNSLKNGLIGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTV  1042

Query  63    RNIVDTGRTIVCTIHQPSIDI  1
             RN VDTGRT+VCTIHQPSIDI
Sbjct  1043  RNTVDTGRTVVCTIHQPSIDI  1063


 Score =   131 bits (330),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 131/618 (21%), Positives = 264/618 (43%), Gaps = 65/618 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  875   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  933

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  934   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  962

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +  D     + VD ++ ++ L   ++ ++G   + G+S  +RKRLT    LV   +++ 
Sbjct  963   PSEVDSTTRKMFVDEVLDLVELNSLKNGLIGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1022

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQI-VY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1023  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGLELY  1081

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      + G   A ++ EVT+   +M   I            
Sbjct  1082  AGPVGRQSCELIKYFEDIEGISKIKDGYNPATWMLEVTTSAQEMVLGI------------  1129

Query  1755  NEFSEAFQSFHIGR---NLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F+E +++ ++ R    L  EL+T   +S S      T+ Y  S +    +C  ++   
Sbjct  1130  -DFTEVYRNSNLYRRNKELIKELST--HRSGSKDLYFPTQ-YSQSFITQCVACLWKQRCS  1185

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +AL+  ++F     + +S       M S++     +       
Sbjct  1186  YWRNTSYTAVRFLFTTAIALMFGSMFWDLGSKMDSQQDLSSAMGSMYAACLFLGVQNASS  1245

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA    ++ +P    + SV+    Y +IG++    
Sbjct  1246  VQPVVAVERTVFYRERAAGMYSALPYAFAQVLVEVPYVLAQASVYGLIVYAMIGFEWTAV  1305

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKW  1048
             +       +       ++       V  +   A ++ +    +     G+I+ R  +  W
Sbjct  1306  KFFWYLFFMFFTFLYFTLYGMMTVAVTPNADIAAIIAAAFYAIWNLFSGYIIPRPSMPVW  1365

Query  1047  WIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVG  868
             W W  W+ P+ Y    +  ++F G   +  L    +   V +  Y G   E    W+   
Sbjct  1366  WRWYAWVCPVAYTLYGLLASQF-GDIEDKTLVDVKKSVKVFIEDYYGF--EHGNVWIAGS  1422

Query  867   ALIGFTIFSIFIYTLALA  814
             A++GFT+  +F +T A +
Sbjct  1423  AVVGFTV--VFAFTFAFS  1438



>gb|KDP36995.1| hypothetical protein JCGZ_06051 [Jatropha curcas]
Length=1440

 Score =  1439 bits (3724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 707/1063 (67%), Positives = 860/1063 (81%), Gaps = 22/1063 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSS-SLWSNGT--DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             ME  D    S S R   S S+W N    D F++SSR    D+DDE ALKWAAL+K+PT+D
Sbjct  1     MEGGDIYRASSSLRRKGSFSMWRNNNPNDVFSRSSR----DEDDEEALKWAALEKLPTYD  56

Query  2967  RLKKG-LMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAID  2791
             RL+KG L++  +G   E+D++N+G++E+K +LERLIKV E DNE FLLKLK+R++RV I+
Sbjct  57    RLRKGILLSASKGVASEIDVDNLGFQERKLLLERLIKVAEEDNEKFLLKLKNRIDRVGIE  116

Query  2790  IPKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSG  2614
             IP +EVRFEHLNV AEAY   RALPS  NF   ILEG L+YL++ P+  +   IL+DVSG
Sbjct  117   IPTIEVRFEHLNVEAEAYSASRALPSFVNFTFGILEGFLNYLHIIPSRTRPLHILKDVSG  176

Query  2613  IIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQ  2434
             IIKP RM LLLGPPSSGKT+LLLALAG+LDP+L+FSG V+YNGH MNEF+P RTAAYISQ
Sbjct  177   IIKPSRMALLLGPPSSGKTTLLLALAGKLDPNLKFSGTVTYNGHGMNEFIPQRTAAYISQ  236

Query  2433  HDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQ  2254
             HD HI EMT RETLAFSARCQGVG+++++LAELSRREKAANI+PDPDID+FMKAAAT+GQ
Sbjct  237   HDEHIGEMTVRETLAFSARCQGVGTQHDLLAELSRREKAANIKPDPDIDVFMKAAATEGQ  296

Query  2253  KANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTG  2074
             + +VI DY +K+LGLE C DT+VG+E +RG+SGG+RKR+T GEMLVGPA  L MDEISTG
Sbjct  297   ETSVITDYFLKILGLEVCADTLVGDEMIRGISGGQRKRVTTGEMLVGPAKALFMDEISTG  356

Query  2073  LDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVL  1894
             LDSSTT+QI+ S++  IHIL+GTA+I+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL
Sbjct  357   LDSSTTYQIVNSLRQSIHILNGTALISLLQPAPETYDLFDDIILLSDGQIVYQGPREQVL  416

Query  1893  EFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGR  1714
              FFE +GF+CPERKGVADFLQEVTS+KDQ QYW R+D +PYRF+T  EFSEAFQS+ +GR
Sbjct  417   GFFEYMGFKCPERKGVADFLQEVTSKKDQQQYWARRD-QPYRFITAQEFSEAFQSYEVGR  475

Query  1713  NLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVL  1534
              +GDEL+TPF  + SHPAALTTK YGV KMELLK+C SRE LLMKRN  ++IF++  +++
Sbjct  476   KIGDELSTPFDTTKSHPAALTTKRYGVGKMELLKACISREYLLMKRNSFVYIFKLTQLII  535

Query  1533  MALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDL  1354
             MAL+TMTLF+RT M R++     IY+ +LFF   +IMF+ + ELA TI +LP+FYKQR+L
Sbjct  536   MALVTMTLFLRTKMHRDTVDDGGIYLGALFFATILIMFNGMSELAMTIAKLPVFYKQRNL  595

Query  1353  LFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASV  1174
             LFYPAWAY++PT+IL+IPIT +EV+VW+  TYYVIG+DPN GR  K +++LII  Q+AS 
Sbjct  596   LFYPAWAYSLPTWILKIPITFVEVAVWIVLTYYVIGFDPNVGRFFKQYLVLIIVNQMASG  655

Query  1173  LFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIA  994
             LFR  A  GR+M  A   GSF +L LFALGGFILS+DD+KKWWIWGYW+SPLMY QNAI 
Sbjct  656   LFRFIAATGRNMIVANTFGSFALLALFALGGFILSKDDIKKWWIWGYWVSPLMYGQNAIV  715

Query  993   VNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALA  814
             VNEFLG SW+ +   +++P G+ +L+ RG FP AYWYWLG GA +GF +   F++T+AL 
Sbjct  716   VNEFLGHSWSHIPAGTTKPLGIQLLEARGFFPHAYWYWLGFGACVGFMLLFNFLFTVALT  775

Query  813   KLRPLAQSRANISAESHSNEH--------DVSNGGSDNSVGERVSDGMSN----RKHGMI  670
              L P  + +A IS +S +NE          ++N GS +      +D  S     +K GM+
Sbjct  776   YLDPFEKPQAVISEDSETNESGNQTRGSIQLTNYGSSHKSSIDGADENSEVNHIKKKGMV  835

Query  669   LPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKT  490
             LPF PHSI F+DI Y VDMPQEMK +GV +++L LLKGVSGAFRPGVLTALMGVSGAGKT
Sbjct  836   LPFAPHSITFDDIIYSVDMPQEMKSQGVLEDKLVLLKGVSGAFRPGVLTALMGVSGAGKT  895

Query  489   TLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWL  310
             TLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ES+++SAWL
Sbjct  896   TLMDVLAGRKTGGYIEGSITISGYPKKQETFARISGYCEQNDIHSPHVTVHESIVYSAWL  955

Query  309   RLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSI  130
             RLP EV  ETR +F++EVM+LVEL  +R A+VGLPGVNGLST QRKRLTIAVELVANPSI
Sbjct  956   RLPPEVDKETRTMFVEEVMDLVELNPIRNALVGLPGVNGLSTEQRKRLTIAVELVANPSI  1015

Query  129   IFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  IFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1058


 Score =   138 bits (348),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 136/567 (24%), Positives = 245/567 (43%), Gaps = 70/567 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  870   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGSITISGYPKKQETFAR  928

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E++ +SA                       +R  P++D    
Sbjct  929   ISGYCEQNDIHSPHVTVHESIVYSAW----------------------LRLPPEVD----  962

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ ++ ++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  963   -----KETRTMFVEEVMDLVELNPIRNALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1017

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1018  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGEEIY  1076

Query  1917  QGP-----CNCVLEFFECLGFR-CPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     C+ +  F    G R   +    A ++ EVT    ++   +        F +I
Sbjct  1077  VGPLGRHSCHLIKYFEGIEGVRKITDGYNPATWMLEVTGPAQELAMDVD-------FASI  1129

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
                SE ++     + +  EL+ P   S           Y  S +    +CF ++     R
Sbjct  1130  YRNSEVYRR---NKAMIKELSVPAPGSKD---LYFPTQYATSFLTQCIACFWKQRWSYWR  1183

Query  1575  NCVLHIFEVGWVVLMALITMTLFIR-----TNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
             N         +   +AL+  TLF       T  Q        +Y ++LF  L V    A+
Sbjct  1184  NPPYTAVRFLFTTFIALMFGTLFWNLGSKSTKQQDLFNAMGSLYAATLF--LGVQNSGAV  1241

Query  1410  QELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
             Q +        +FY++R    Y A  YA+   ++ IP    +  V+   TY +IG+    
Sbjct  1242  QPVVA--IERTVFYRERAAGMYSAMPYALAQVMIEIPYIFCQAIVYGLITYAMIGFHWTV  1299

Query  1230  GRLLKMWVLLIIFRQLASVLFR---SAAVVGRSMTNAFVVGSFIMLV-LFALGGFILSRD  1063
              + L  W +  ++  L    F    + AV       A V  +F  L  LFA  GFI+ R 
Sbjct  1300  AKFL--WYMYFMYLTLLYFTFYGMMAVAVTPNHHIAAIVSSAFYGLWNLFA--GFIVPRT  1355

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  WW W YW +P+ +    I  ++F
Sbjct  1356  RIPVWWRWYYWANPIAWTLYGIIGSQF  1382



>ref|XP_010023530.1| PREDICTED: ABC transporter G family member 40-like isoform X1 
[Eucalyptus grandis]
Length=1447

 Score =  1438 bits (3723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 709/1070 (66%), Positives = 856/1070 (80%), Gaps = 30/1070 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             M+  D+     S R  SS+ W N     D F++SSR    D+DDE AL+WAAL+K+PTF+
Sbjct  1     MDGGDTYRAGNSLRATSSTTWRNHASMVDVFSRSSR----DEDDEEALRWAALEKLPTFE  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG+MT   G   ++DI N+G+ ++K++LERL++V E DNE FLLKL++R++RV ID+
Sbjct  57    RLQKGIMTAGGGAN-QIDIWNLGFHDRKRLLERLVRVIEEDNEGFLLKLRNRIDRVGIDL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRFEHL V AEA+ G RALP+V NFC +ILEG L++L+ LP+ KKH +IL+DVSGI
Sbjct  116   PTIEVRFEHLKVEAEAHEGSRALPTVINFCTSILEGFLNFLHVLPSRKKHLTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH MNEFVP RTAAYISQH
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKMTGRVTYNGHVMNEFVPQRTAAYISQH  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY+ML ELSRREKAANI+PDPDIDIFMKAA T+GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYDMLLELSRREKAANIKPDPDIDIFMKAAVTEGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV+ DYI+K+LGLE C D +VG+E LRG+SGG+RKR+T GEMLVGPA V LMDEISTGL
Sbjct  296   ANVVTDYILKILGLEICADVMVGDEMLRGISGGQRKRVTTGEMLVGPAEVFLMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+  +K +IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+
Sbjct  356   DSSTTYQIVNFLKQFIHILDGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FFE +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF EAFQSFH+GR 
Sbjct  416   FFESMGFKCPRRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFVEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  +++M
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVTQLIIM  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A I+MTLF+RT M R++     +Y+ +LFFT+  IMF+ + E++ TI +LPIFYKQRDLL
Sbjct  535   AFISMTLFLRTKMHRDTVTDGGVYIGALFFTVITIMFNGMAEISMTIAKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF+TYYVIGYDPN GRL K ++LL+   Q++S L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFTTYYVIGYDPNVGRLFKQYLLLVAINQMSSGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   G+F++L L A+GG +LSR+DV KWWIWGYW SPLMY QNAI V
Sbjct  655   FRLIAALGRNLIVANTFGTFVLLALVAMGGVVLSREDVNKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NE LG +WN + P SS  EP G+ VLK RG F EAYWYW+G+GAL GF I   F +++AL
Sbjct  715   NELLGSNWNKIPPNSSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFIILFNFGFSVAL  774

Query  816   AKLRPLAQSRANISAESHSNEHDVSNGGSD--NSVGERVSDG----------------MS  691
             A L P  +S    S +   N++     GS    S G  + +G                 +
Sbjct  775   ALLNPFGKSHTVKSDDPEGNKNVDRIEGSIQLQSRGSSLRNGSGRSSKLTPPWPETAVAA  834

Query  690   NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMG  511
             N K GM+LPFEPHSI F++I Y VDMP+EM  +G  ++RL LLKG SG+FRPGVLTALMG
Sbjct  835   NTKRGMVLPFEPHSITFDEITYSVDMPREMTNQGAPEDRLVLLKGASGSFRPGVLTALMG  894

Query  510   VSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYES  331
             VSGAGKTTLMDVLAGRKTGGYI+G ITISG+ K Q TFARISGYCEQNDIHSPH+TVYES
Sbjct  895   VSGAGKTTLMDVLAGRKTGGYIKGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYES  954

Query  330   LIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVE  151
             LI+SAWLRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVE
Sbjct  955   LIYSAWLRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVE  1014

Query  150   LVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             LVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  LVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1064


 Score =   146 bits (369),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 144/634 (23%), Positives = 275/634 (43%), Gaps = 92/634 (15%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+  SG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  876   LLKGASGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IKGNITISGYPKNQDTFAR  934

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  935   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  968

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  969   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1023

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1024  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1082

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1083  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPAQELALGV------------  1130

Query  1755  NEFSEAFQS---FHIGRNLGDELAT--PFQKSTSHPAALTTKTYGVSKMELLKSCFSREV  1591
              +FS+ +++   +   + L +EL+   P  K    P       Y  S    L +C  ++ 
Sbjct  1131  -DFSDLYKNSDLYRRNKALIEELSISPPNSKDLYFPTK-----YSQSTFTQLMACLWKQH  1184

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         + + +AL+  T+F     +          M S++  L  + F   
Sbjct  1185  WSYWRNPPYTAVRFLFTISIALMFGTMFWDLGSKTTRSQDLFNAMGSMYAALVFLGFQNA  1244

Query  1410  QELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
               + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+   
Sbjct  1245  SSVQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLVQAISYGIIVYAMIGFKWT  1304

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSR  1066
               +        + F+    + F    ++   MT    + S + L  +AL     GF++ R
Sbjct  1305  VAKFFWY----LFFKFFTLLYFTYYGMMAVGMTPNHHIASIVSLAFYALWNLFSGFVVPR  1360

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGL  904
               +  WW W YW+ P+ +    + V++F      L  + +TV  +  + FG     YR  
Sbjct  1361  TKIPIWWRWFYWVCPVSWTLYGLVVSQFGDLTNTLEDTGDTVEEYMRDYFG-----YRHD  1415

Query  903   FPEAYWYWLGVGA--LIGFTIFSIFIYTLALAKL  808
             F       LGV A  +IGFT+   F++ +++  L
Sbjct  1416  F-------LGVIAAMVIGFTMLFAFVFAISIKIL  1442



>ref|XP_010648604.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Vitis vinifera]
 emb|CBI20978.3| unnamed protein product [Vitis vinifera]
Length=1436

 Score =  1438 bits (3723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/1060 (67%), Positives = 858/1060 (81%), Gaps = 20/1060 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D   R  S R++SS++W N G + F++SSR    D+DDE ALKWAA++K+PT+ R+
Sbjct  1     MESSDVY-RVNSARLSSSNIWRNSGMEVFSRSSR----DEDDEEALKWAAIEKLPTYLRI  55

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++    G+  E+DI ++G  EKK +LERL+K+ E DNE FLLKLK+R++RV +DIP 
Sbjct  56    RRGILAEEEGKAREIDITSLGLIEKKNLLERLVKIAEEDNEKFLLKLKERIDRVGLDIPT  115

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEH+ V AEAY+G RALP++ NF  N+LEG L+YL+ LP+ KK   IL DVSGIIK
Sbjct  116   IEVRFEHITVDAEAYIGGRALPTIINFSANMLEGFLNYLHILPSRKKPLPILHDVSGIIK  175

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             PGRMTLLLGPPSSGKT+LLL LAG+L   L+ SGRVSYNGH M+EFVP R++AYISQ+DL
Sbjct  176   PGRMTLLLGPPSSGKTTLLLTLAGKLGSDLKLSGRVSYNGHGMDEFVPQRSSAYISQYDL  235

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+ Y+MLAELSRREK ANI+PDPDIDI+MKAAA  GQ  +
Sbjct  236   HIGEMTVRETLAFSARCQGVGTGYDMLAELSRREKVANIKPDPDIDIYMKAAALKGQGGS  295

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             +I DYI+K+LGLE C DTIVG+E +RG+SGG+++RLT GEMLVGPA  L MDEISTGLDS
Sbjct  296   LITDYILKILGLEVCADTIVGDEMVRGISGGQKRRLTTGEMLVGPAKALFMDEISTGLDS  355

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ SI+  IHIL GTA+I+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFF
Sbjct  356   STTFQIVNSIRQSIHILKGTAIISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFF  415

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTS+KDQ QYW  +  +PY FVT+ EFSEAFQSFH+GR LG
Sbjct  416   EHMGFKCPERKGVADFLQEVTSKKDQEQYWAHR-GEPYSFVTVTEFSEAFQSFHVGRRLG  474

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELA PF K+ +H AALTTK YGVSK ELLK+C SRE+LLMKRN  ++IF++  ++L+A 
Sbjct  475   DELAIPFDKAKAHTAALTTKKYGVSKKELLKACISRELLLMKRNSFVYIFKMSQLILLAF  534

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF+RT+M R +     I++ S+FFTL +IMF+   ELA TI +LP+FYKQRDLLFY
Sbjct  535   IMMTLFLRTDMPRKTIADGWIFLGSMFFTLMMIMFNGFSELALTIMKLPVFYKQRDLLFY  594

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAY++PT+IL+IPIT +EV++WVF TYYV+G+DPN  R  + ++LL+   Q+AS L R
Sbjct  595   PSWAYSLPTWILKIPITLVEVAIWVFMTYYVVGFDPNIERFFRQYLLLLCVNQMASGLLR  654

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A +GR++  A   GSF +L +  +GGF+LS+DDVK WW+WGYWISP+MY QNAIAVNE
Sbjct  655   LMAALGRNIIVANTFGSFALLAVLVMGGFVLSKDDVKPWWMWGYWISPMMYGQNAIAVNE  714

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW  V   ++EP GVLVLK RG+FPEAYWYWLGVGALIG+     F++T+ALA L 
Sbjct  715   FLGKSWRHVPENATEPLGVLVLKSRGIFPEAYWYWLGVGALIGYVFLFNFLFTVALAYLN  774

Query  804   PLAQSRANISAESHSNEH---------DVSNGGSDNSVGERV---SDGMSNRKHGMILPF  661
             P  + +  +S E+ + +          D    GS  S+  RV   ++   NRK GMILPF
Sbjct  775   PYGKHQTVLSEETLTEQSSRGTSCTGGDKIRSGSSRSLSARVGSFNNADQNRKRGMILPF  834

Query  660   EPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  481
             EP SI F++I+Y VDMPQEMK +G+ +NRLELLKGVSG+FRPGVLTALMGVSGAGKTTLM
Sbjct  835   EPLSITFDEIRYAVDMPQEMKSQGIPENRLELLKGVSGSFRPGVLTALMGVSGAGKTTLM  894

Query  480   DVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLP  301
             DVLAGRKTGGYI+G I ISG+ K QKTFARISGYCEQ DIHSPH+TVYESL++SAWLRLP
Sbjct  895   DVLAGRKTGGYIDGSIKISGYPKNQKTFARISGYCEQTDIHSPHVTVYESLLYSAWLRLP  954

Query  300   SEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFM  121
              EV   TRK+FI+EVMELVEL SLR+A+VGLPGV+GLST QRKRLT+AVELVANPSIIFM
Sbjct  955   PEVDSATRKMFIEEVMELVELNSLRQALVGLPGVDGLSTEQRKRLTVAVELVANPSIIFM  1014

Query  120   DEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1054


 Score =   140 bits (354),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 128/561 (23%), Positives = 242/561 (43%), Gaps = 58/561 (10%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+  N+    R
Sbjct  866   LLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPKNQKTFAR  924

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P++D    
Sbjct  925   ISGYCEQTDIHSPHVTVYESLLYSAW----------------------LRLPPEVD----  958

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +AT      + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  959   -SATR----KMFIEEVMELVELNSLRQALVGLPGVDGLSTEQRKRLTVAVELVANPSIIF  1013

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+  G + +Y
Sbjct  1014  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLKRGGEEIY  1072

Query  1917  QGPCNC----VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVTS   +    I        F  +
Sbjct  1073  AGPLGHHSAHLIKYFEGIDGVSKIKDGYNPATWMLEVTSAAQEAALGIN-------FTDV  1125

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L  EL+TP     S      T+ Y  S     K+C  ++     R
Sbjct  1126  YKNSELYRR---NKALIKELSTP--PPGSKDLYFPTQ-YSQSFFAQCKTCLWKQHWSYWR  1179

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R         M S++  +  I       + P
Sbjct  1180  NPSYTAVRLLFTTFIALMFGTIFWDLGSRRQRKQDLFNAMGSMYCAVLFIGAQNATSVQP  1239

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY+++    Y A  YA    ++ +P   I+  ++    Y +IG+D    +  
Sbjct  1240  VVAIERTVFYREKAAGMYSALPYAFGQVMIELPYILIQTIIYGVIVYAMIGFDWTMTKFF  1299

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDDVKKWW  1045
               W +  ++       F     V  S  +  A ++ S    +     GFI+ R  +  WW
Sbjct  1300  --WYIFFMYFTFLYFTFYGMMAVAVSPNHNIAAIISSAFYAIWNLFSGFIVPRTRIPVWW  1357

Query  1044  IWGYWISPLMYAQNAIAVNEF  982
              W YW  P+ +    +  ++F
Sbjct  1358  RWYYWCCPISWTLYGLIGSQF  1378



>gb|AGT28054.1| pleiotropic drug resistance transporter 2 [Panax ginseng]
Length=1445

 Score =  1438 bits (3722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/1047 (67%), Positives = 856/1047 (82%), Gaps = 21/1047 (2%)
 Frame = -2

Query  3105  SFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRGE  2929
             S R +SSS+W SNG + F+KS+R    D+DDE ALKWA+L+K+PTFDRL+KGL+ G +G 
Sbjct  24    SLRASSSSVWRSNGMEVFSKSAR----DEDDEEALKWASLEKLPTFDRLRKGLLLGSQGA  79

Query  2928  -TFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
                EVDI+++G +E+KK+LERL+ V E DNE FLLKL+DR++RV ID+P +EVRF+HL +
Sbjct  80    GASEVDIDDLGIQERKKLLERLVNVAEEDNERFLLKLRDRVDRVGIDLPLIEVRFDHLTI  139

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEA+VG RALPS  NF ++I+EGLL  L  LP  K+  +IL DVSGI++P RMTLLLGP
Sbjct  140   EAEAHVGSRALPSFLNFNISIVEGLLDTLRLLPNRKQRLTILEDVSGILRPCRMTLLLGP  199

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             PSSGKT+LLLALAG+LDP+L+FSGRV+YNGHEM EFVP RTAAYISQHDLHI EMT RET
Sbjct  200   PSSGKTTLLLALAGKLDPTLKFSGRVTYNGHEMTEFVPQRTAAYISQHDLHIGEMTVRET  259

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSARCQGVGSRYEMLAELSRREK ANI+PDPD+DI+MKAAAT+GQ+ANV+ DY++K+L
Sbjct  260   LAFSARCQGVGSRYEMLAELSRREKDANIKPDPDVDIYMKAAATEGQEANVVTDYVLKIL  319

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GL+ C DT+VG++ +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDSSTT+QI+K++
Sbjct  320   GLDVCADTMVGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVKAL  379

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             +H +HIL GTA+I+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+FFE +GF+CPER
Sbjct  380   RHSVHILQGTALISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLQFFESMGFKCPER  439

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTS+KDQ QYW+RKD +PYRF+T  EFSEAFQSFH+G  LG +LATP+ K 
Sbjct  440   KGVADFLQEVTSKKDQKQYWLRKD-EPYRFITATEFSEAFQSFHVGLRLGGDLATPYDKG  498

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SHPAALTT  YGVSK ELLK+  +RE+LLMKRN  ++IF++  + +M+++TM LF+RT 
Sbjct  499   RSHPAALTTDKYGVSKTELLKAVTAREILLMKRNSFVYIFKLFQLTVMSIVTMALFLRTE  558

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             +  N+     IYM +LFF + ++MF+ L ELA TI +LPIFYKQRDLLFYP W+YA+P++
Sbjct  559   LNHNTTTDGGIYMGALFFAVVMLMFNGLAELAMTIAKLPIFYKQRDLLFYPTWSYALPSW  618

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             I++IPIT +EV+VWV  TYYVIG+DPN GR +K +++L++  Q+AS LFR  A +GR+M 
Sbjct  619   IIKIPITFLEVAVWVVLTYYVIGFDPNVGRFVKQYIVLLLINQMASALFRLMAALGRNMI  678

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              AF  G F +LVLFALGGF+L+RDDV KWW+WGY+ SP+MY  NAIAVNEFLG  W+ + 
Sbjct  679   LAFTFGGFALLVLFALGGFVLARDDVAKWWLWGYYSSPMMYGMNAIAVNEFLGHQWSKLT  738

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
                +E  GV +L+ RG FP AYWYW+GVGAL+GF +   F  T+AL  L PL + +A I 
Sbjct  739   ANGNETIGVAILRSRGFFPYAYWYWIGVGALVGFVLILNFAVTVALNYLDPLGKPQAVIP  798

Query  774   AESHSNE---------HDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYC  622
              +  + E               GS     E   +   N+K GMILPFEPHSI F+++KY 
Sbjct  799   EKGDTAEPIELSSRGSSSKGKAGSQ----EINVEANPNKKRGMILPFEPHSITFDEVKYS  854

Query  621   VDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIE  442
             VDMPQEMK + V +++L LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIE
Sbjct  855   VDMPQEMKDQSVVEDKLLLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIE  914

Query  441   GEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIK  262
             G ITISGF KKQ+TFARISGYCEQNDIHSPH+TVYESLI+SAWLRLPSEV   TRK+F+ 
Sbjct  915   GNITISGFPKKQETFARISGYCEQNDIHSPHVTVYESLIYSAWLRLPSEVDSVTRKMFVD  974

Query  261   EVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAA  82
             EV+ELVEL +L++ +VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAA
Sbjct  975   EVLELVELNTLKDGLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAA  1034

Query  81    IVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1035  IVMRTVRNTVDTGRTVVCTIHQPSIDI  1061


 Score =   124 bits (312),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 139/639 (22%), Positives = 271/639 (42%), Gaps = 82/639 (13%)
 Frame = -2

Query  2661  LPTTKKHNSILRD-------VSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSG  2503
             +P   K  S++ D       VSG  +PG +T L+G   +GKT+L+  LAG+        G
Sbjct  857   MPQEMKDQSVVEDKLLLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEG  915

Query  2502  RVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRRE  2323
              ++ +G    +    R + Y  Q+D+H P +T  E+L +SA                   
Sbjct  916   NITISGFPKKQETFARISGYCEQNDIHSPHVTVYESLIYSAW------------------  957

Query  2322  KAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERK  2143
                 +R   ++D   +          + VD +++++ L   +D +VG   + G+S  +RK
Sbjct  958   ----LRLPSEVDSVTR---------KMFVDEVLELVELNTLKDGLVGLPGVNGLSTEQRK  1004

Query  2142  RLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYD  1963
             RLT    LV   +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++
Sbjct  1005  RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFE  1063

Query  1962  LFDDIILISEG-QIVYQGPC----NCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQM  1804
              FD++ L+  G Q +Y GP     + ++ +FE +      + G   A ++ EVT+   +M
Sbjct  1064  AFDELFLMKRGGQELYVGPVGRHSSQLINYFEDIDGISKIKDGYNPATWMLEVTTSAQEM  1123

Query  1803  QYWIRKDNKPYRFVTINEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGV  1633
                +             +F+E +++   +   + L  EL+TP   +        +  Y  
Sbjct  1124  VLGV-------------DFTEVYRNSDLYRRNKALIRELSTPRPGTKD---IYFSSQYSQ  1167

Query  1632  SKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLF------IRTNMQRNSPIG  1471
             S +    +C  ++     RN         +   +AL+  ++F      +RT     +  G
Sbjct  1168  SFLTQCLACLWKQRCSYWRNTSYTAVRFLFATAIALMLGSMFWDLGSKMRTQQDLFNATG  1227

Query  1470  AQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITC  1291
             + +Y + LF  L V   S++Q +        +FY++R    Y A  YA    ++ +P   
Sbjct  1228  S-MYAACLF--LGVQNASSVQPVVDV--ERTVFYRERAAGMYSALPYAFAQVLVEVPYIF  1282

Query  1290  IEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSF  1111
              + +V+    Y +IG+D    + +             ++       V  +   A ++ + 
Sbjct  1283  TQAAVYGVIVYAMIGFDWTVVKFIWYIFFTFFTLLYFTLFGMMTVAVTPNADIAAIIAAA  1342

Query  1110  IMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFG  931
                +     GFI+ R  +  WW W  W+ P+ +    +  ++F G   +  L  +     
Sbjct  1343  FFALWNVFSGFIIPRPKMPVWWRWYSWVCPVAWTLYGMIASQF-GDIDDKTLVDAKVNVK  1401

Query  930   VLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALA  814
               V  Y G   E    W+   A+ GFT+  +F +T A +
Sbjct  1402  KFVEDYFGF--EHGNVWVAGTAVAGFTV--VFAFTFAFS  1436



>emb|CAN80954.1| hypothetical protein VITISV_032205 [Vitis vinifera]
Length=1441

 Score =  1438 bits (3722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/1051 (67%), Positives = 860/1051 (82%), Gaps = 14/1051 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D   R  S R++SS++W N G + F++SSR    D+DDE ALKWAA++K+PT+ R+
Sbjct  1     MESSDVY-RVNSARLSSSNIWRNSGMEVFSRSSR----DEDDEEALKWAAIEKLPTYLRI  55

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++    G+  E+DI ++G  EKK +LERL+K+ E DNE FLLKLK+R++RV +DIP 
Sbjct  56    RRGILAEEEGKAREIDITSLGLIEKKNLLERLVKIAEEDNEKFLLKLKERIDRVGLDIPT  115

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEH+ V AEAY+G RALP++ NF  N+LEG L+YL+ LP+ KK   IL DVSGIIK
Sbjct  116   IEVRFEHITVDAEAYIGGRALPTIINFSANMLEGFLNYLHILPSRKKPLPILHDVSGIIK  175

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             PGRMTLLLGPPSSGKT+LLL LAG+L   L+ SGRVSYNGH M+EFVP R++AYISQ+DL
Sbjct  176   PGRMTLLLGPPSSGKTTLLLTLAGKLGSDLKLSGRVSYNGHGMDEFVPQRSSAYISQYDL  235

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+ Y+MLAELSRREK ANI+PDPDIDI+MKAAA  GQ  +
Sbjct  236   HIGEMTVRETLAFSARCQGVGTGYDMLAELSRREKVANIKPDPDIDIYMKAAALKGQGGS  295

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             +I DYI+K+LGLE C DTIVG+E +RG+SGG+++RLT GEMLVGPA  L MDEISTGLDS
Sbjct  296   LITDYILKILGLEXCADTIVGDEMVRGISGGQKRRLTTGEMLVGPAKALFMDEISTGLDS  355

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ SI+  IHIL GTA+I+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFF
Sbjct  356   STTFQIVNSIRQSIHILKGTAIISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFF  415

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTS+KDQ QYW  +  +PY FVT+ EFSEAFQSFH+GR LG
Sbjct  416   EHMGFKCPERKGVADFLQEVTSKKDQEQYWAHR-GEPYSFVTVTEFSEAFQSFHVGRRLG  474

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELA PF K+ +H AALTTK YGVSK ELLK+C SRE+LLMKRN  ++IF++  ++L+A 
Sbjct  475   DELAIPFDKAKAHTAALTTKKYGVSKXELLKACISRELLLMKRNSFVYIFKMSQLILLAF  534

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF+RT+M R +     I++ S+FFTL +IMF+   ELA TI +LP+FYKQRDLLFY
Sbjct  535   IMMTLFLRTDMPRKTIADGWIFLGSMFFTLMMIMFNGFSELALTIMKLPVFYKQRDLLFY  594

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAY++PT+IL+IPIT +EV++WVF TYYV+G+DPN  R  + ++LL+   Q+AS L R
Sbjct  595   PSWAYSLPTWILKIPITLVEVAIWVFMTYYVVGFDPNIERFFRQYLLLLCVNQMASGLLR  654

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A +GR++  A   GSF +L +  +GGF+LS+DDVK WW+WGYWISP+MY QNAIAVNE
Sbjct  655   LMAALGRNIIVANTFGSFALLAVLVMGGFVLSKDDVKPWWMWGYWISPMMYGQNAIAVNE  714

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW  V   ++EP GVLVLK RG+FPEAYWYWLGVGALIG+     F++T+ALA L 
Sbjct  715   FLGKSWRHVPENATEPLGVLVLKSRGIFPEAYWYWLGVGALIGYVFLFNFLFTVALAYLN  774

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMS---NRKHGMILPFEPHSIAFND  634
             P  + +  +S E+ + +   S+ G+ ++ G+++  G S   + + GMILPFEP SI F++
Sbjct  775   PYGKHQTVLSEETLTEQ---SSRGTSSTGGDKIRSGSSRSLSARRGMILPFEPLSIXFDE  831

Query  633   IKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG  454
             I+Y VDMPQEMK +G+ +NRLELLKGVSG+FRPGVLTALMGVSGAGKTTLMDVLAGRKTG
Sbjct  832   IRYAVDMPQEMKAQGIPENRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTG  891

Query  453   GYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRK  274
             GYI+G I ISG+ K QKTFARISGYCEQ DIHSPH+TVYESL++SAWLRLP EV   TRK
Sbjct  892   GYIDGSIKISGYPKNQKTFARISGYCEQTDIHSPHVTVYESLLYSAWLRLPPEVDSATRK  951

Query  273   LFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDA  94
             +FI+EVMELVEL SLR+A+VGLPGV+GLST QRKRLT+AVELVANPSIIFMDEPTSGLDA
Sbjct  952   MFIEEVMELVELNSLRQALVGLPGVDGLSTEQRKRLTVAVELVANPSIIFMDEPTSGLDA  1011

Query  93    RAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             RAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1042


 Score =   133 bits (334),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 128/578 (22%), Positives = 243/578 (42%), Gaps = 75/578 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+  N+    R
Sbjct  854   LLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPKNQKTFAR  912

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P++D    
Sbjct  913   ISGYCEQTDIHSPHVTVYESLLYSAW----------------------LRLPPEVD----  946

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +AT      + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  947   -SATR----KMFIEEVMELVELNSLRQALVGLPGVDGLSTEQRKRLTVAVELVANPSIIF  1001

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+  G + +Y
Sbjct  1002  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLKRGGEEIY  1060

Query  1917  QGPCNC----VLEFFECLGFRCPERK----------GV---------ADFLQEVTSRKDQ  1807
              GP       ++++FE       + +          GV         A ++ EVTS   +
Sbjct  1061  AGPLGHHSAHLIKYFEVRSINTRDSRSSPYLPLGIDGVSKIKDGYNPATWMLEVTSAAQE  1120

Query  1806  MQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSK  1627
                 I        F  + + SE ++     + L  EL+TP     S      T+ Y  S 
Sbjct  1121  AALGIN-------FTDVYKNSELYRR---NKALIKELSTP--PPGSKDLYFPTQ-YSQSF  1167

Query  1626  MELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSL  1447
                 K+C  ++     RN       + +   +A++  T+F     +R         M S+
Sbjct  1168  FAQCKTCLWKQHWSYWRNPSYTAVRLLFTTFIAVMFGTIFWDLGSRRQRQQDLFNAMGSM  1227

Query  1446  FFTLTVIMFSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWV  1270
             +  +  I       + P +     +FY+++    Y A  YA    ++ +P   I+  ++ 
Sbjct  1228  YCAVLFIGAQNATSVQPVVAIERTVFYREKAAGMYSALPYAFGQVMIELPYILIQTIIYG  1287

Query  1269  FSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVL  1096
                Y +IG+D    +    W +  ++       F     V  S  +  A ++ S    + 
Sbjct  1288  VIVYAMIGFDWTMTKFF--WYIFFMYFTFLYFTFYGMMAVAVSPNHNIAAIISSAFYAIW  1345

Query  1095  FALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
                 GFI+ R  +  WW W YW  P+ +    +  ++F
Sbjct  1346  NLFSGFIVPRTRIPVWWRWYYWCCPISWTLYGLIGSQF  1383



>emb|CBI36229.3| unnamed protein product [Vitis vinifera]
Length=3142

 Score =  1437 bits (3721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/1064 (67%), Positives = 855/1064 (80%), Gaps = 32/1064 (3%)
 Frame = -2

Query  3111  SGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             +GS R N S   S+G D F++SSR    D+DDE ALKWAAL+K+PT++RL+KGL+ G +G
Sbjct  10    AGSLRRNGSMWRSSGADVFSRSSR----DEDDEEALKWAALEKLPTYNRLRKGLLMGSQG  65

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
                EVD++N+GY+EK+ ++ERL+K+ E DNE FLL+L++R+ERV I IP++EVRFEHL +
Sbjct  66    AASEVDVDNLGYQEKQSLMERLVKIAEEDNEKFLLRLRNRIERVGITIPEIEVRFEHLTI  125

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEA++G RALPS  NF  N +E  L+ L  LP+ ++  +IL DVSGIIKP RMTLLLGP
Sbjct  126   DAEAFIGSRALPSFHNFMFNKIEDALTGLRILPSRRRKFTILHDVSGIIKPQRMTLLLGP  185

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             PSSGKT+LLLAL+G+LDP+L+ +GRV+YNGH M+EFVP RTAAYISQHD HI EMT RET
Sbjct  186   PSSGKTTLLLALSGKLDPTLKVTGRVTYNGHGMDEFVPQRTAAYISQHDTHIGEMTVRET  245

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSARCQGVG RY+MLAELSRREKAANI+PDPD+D+FMKAAAT+GQK NV+ DY +K+L
Sbjct  246   LAFSARCQGVGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKENVVTDYTLKIL  305

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GL+ C DT+VG+E +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDSSTTFQI+  +
Sbjct  306   GLDICADTMVGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTFQIVNCL  365

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             K  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+G+I+YQGP   VLEFFE  GFRCPER
Sbjct  366   KQTIHILNGTAVISLLQPAPETYNLFDDIILLSDGRIIYQGPREDVLEFFESTGFRCPER  425

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTS+KDQ QYW RK+ +PYRFVT+ EF+EAFQSFH GR +GDELA+P+ K+
Sbjct  426   KGVADFLQEVTSKKDQQQYWARKE-EPYRFVTVKEFAEAFQSFHTGRKVGDELASPYDKT  484

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SHPAALTTK YGV+K ELL +  SRE LLMKRN  +++F++  + +MA+ITMTLF+RT 
Sbjct  485   KSHPAALTTKKYGVNKKELLDANMSREYLLMKRNSFVYVFKLTQLAIMAVITMTLFLRTE  544

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M +NS     IY  +LFFT+ +IMF+ + ELA  I +LP+FYKQRDLLFYPAWAYA+PT+
Sbjct  545   MHKNSVDDGNIYTGALFFTVVMIMFNGMAELAMAIAKLPVFYKQRDLLFYPAWAYALPTW  604

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             IL+IPIT IEV VWVF TYYVIG+DPN  RL + ++LL++  Q+AS LFR  A  GR+M 
Sbjct  605   ILKIPITFIEVGVWVFMTYYVIGFDPNVERLFRQYLLLLLVNQMASGLFRLIASAGRNMI  664

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              +   G+F++L+L ALGGFILS DDVKKWWIWGYW SPLMYAQNAI VNEFLG SW   +
Sbjct  665   VSNTFGAFVLLMLLALGGFILSHDDVKKWWIWGYWCSPLMYAQNAIVVNEFLGHSWKKNV  724

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
               S+E  GV VL  RG F EAYWYW+G GAL GF +   F YTL L  L P  + +A I 
Sbjct  725   TGSTESLGVTVLNNRGFFTEAYWYWIGAGALFGFILLFNFGYTLCLNFLNPFDKPQAVIV  784

Query  774   AESHSNEH------DVSNGGSDNSV----GERVSDGMS----------------NRKHGM  673
              ES + E          N   D +     GE +   +S                N+K GM
Sbjct  785   EESDNAETGGQIELSQRNSSIDQAASTERGEEIGRSISSTSSAVREEAVAGANHNKKKGM  844

Query  672   ILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGK  493
             +LPF+P+SI F+DI+Y VDMP+EMK +GV +++LELLKGVSGAFRPGVLTALMGVSGAGK
Sbjct  845   VLPFQPYSITFDDIRYSVDMPEEMKSQGVVEDKLELLKGVSGAFRPGVLTALMGVSGAGK  904

Query  492   TTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAW  313
             TTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAW
Sbjct  905   TTLMDVLAGRKTGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAW  964

Query  312   LRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPS  133
             LRLPS+V  ETR++FI+EVMELVELT LR+A+VGLPGV+GLST QRKRLTIAVELVANPS
Sbjct  965   LRLPSDVKSETRQMFIEEVMELVELTPLRDALVGLPGVSGLSTEQRKRLTIAVELVANPS  1024

Query  132   IIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1025  IIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1068


 Score =  1412 bits (3654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/1068 (66%), Positives = 858/1068 (80%), Gaps = 35/1068 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             R G + ++SSS+W N G + F++SSR    D+DDE ALKWAAL+K+PT++R++KGL+ G 
Sbjct  1697  RKGFWVLDSSSIWRNSGEEVFSRSSR----DEDDEEALKWAALEKLPTYNRMRKGLLMGS  1752

Query  2937  RGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHL  2758
              GE  EVDI+N+G++EKK ++ERL+K+ E DNE FLLKL++R++RV ID+P++EVRFEHL
Sbjct  1753  AGEASEVDIHNLGFQEKKNLVERLVKIAEEDNEKFLLKLRNRIDRVGIDLPEIEVRFEHL  1812

Query  2757  NVGAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLL  2581
              + AEA+VG RALPS      N +E +L+ L  LP+ KK  +IL DVSGIIKP RMTLLL
Sbjct  1813  TIDAEAHVGSRALPSFIYSAFNQIEDILNTLRILPSRKKKLTILHDVSGIIKPRRMTLLL  1872

Query  2580  GPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTAR  2401
             GPPSSGKT+LLLAL+G+LD SL+ +G+V+YNGH MNEFVP RTA YISQHD HI EMT R
Sbjct  1873  GPPSSGKTTLLLALSGKLDSSLKVTGKVTYNGHGMNEFVPQRTATYISQHDTHIGEMTVR  1932

Query  2400  ETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIK  2221
             ETLAFSARCQGVG RY+MLAELSRREKAANI+PDPDID+FMKA AT+GQK NVI DY +K
Sbjct  1933  ETLAFSARCQGVGDRYDMLAELSRREKAANIKPDPDIDVFMKAVATEGQKENVITDYTLK  1992

Query  2220  VLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILK  2041
             +LGLE C DT+VG++ +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDSSTT+QI+ 
Sbjct  1993  ILGLEVCADTLVGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVN  2052

Query  2040  SIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCP  1861
             S++  IHIL+GTA+I+LLQPAPE YDLFDDIIL+S+ QIVYQGP   VL+FFE +GFRCP
Sbjct  2053  SLRQTIHILNGTALISLLQPAPETYDLFDDIILLSDSQIVYQGPREDVLDFFESMGFRCP  2112

Query  1860  ERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQ  1681
             ERKGVADFLQEVTSRKDQ QYW RKD +PY FVT+ EF+EAFQSFHIGR LG ELATPF 
Sbjct  2113  ERKGVADFLQEVTSRKDQQQYWARKD-EPYSFVTVKEFAEAFQSFHIGRKLGHELATPFD  2171

Query  1680  KSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIR  1501
             K+ SHPAAL T+ YGV K ELL +C SRE LLMKRN  ++IF++  +++MA I+MT+F+R
Sbjct  2172  KTKSHPAALKTEKYGVRKKELLDACISREYLLMKRNSFVYIFKLTQLIIMAAISMTIFLR  2231

Query  1500  TNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIP  1321
             T M +NS     IY  +LFFT+ +IMF+ + ELA TI +LP+FYKQR LLFYPAWAYA+P
Sbjct  2232  TEMHKNSTDDGSIYTGALFFTVVMIMFNGMSELAMTIAKLPVFYKQRGLLFYPAWAYALP  2291

Query  1320  TFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRS  1141
             ++IL+IPIT +EV+VWVF +YYVIG+DPN GRL K ++LL++  Q+AS LFR  A  GR+
Sbjct  2292  SWILKIPITFVEVAVWVFMSYYVIGFDPNVGRLFKQYLLLVLVNQMASALFRFIAAAGRN  2351

Query  1140  MTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN-  964
             M  A   GSF +L+LFALGGF+LSR++VKKWWIWGYW SPLMYAQNAI VNEFLGKSW+ 
Sbjct  2352  MIVANTFGSFSLLLLFALGGFVLSRENVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSK  2411

Query  963   TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRA  784
                  S+E  GV VLK RG F EAYWYW+G GAL+GF +   F YT+AL  L    + +A
Sbjct  2412  NSSTDSTESLGVAVLKSRGFFTEAYWYWIGAGALLGFILVFNFCYTVALTYLNAFEKPQA  2471

Query  783   NISAESHSNE-------HDVSNGGSDNSV--------------------GERVSDGMSNR  685
              I+ ES +++            G  D +                      E +++   N 
Sbjct  2472  VITEESENSKTGGKIELSSHRRGSIDQTASTERRDEIGRSISSTSSSVRAEAIAEARRNN  2531

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             K GM+LPF+P SI F+DI+Y VDMP+EMK +GV ++RLELLKGVSGAFRPGVLTALMGVS
Sbjct  2532  KKGMVLPFQPLSITFDDIRYSVDMPEEMKSQGVLEDRLELLKGVSGAFRPGVLTALMGVS  2591

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRKTGGYIEG I ISG+ KKQ+TFARISGYCEQNDIHSPH+T++ESL+
Sbjct  2592  GAGKTTLMDVLAGRKTGGYIEGNINISGYPKKQETFARISGYCEQNDIHSPHVTIHESLL  2651

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLP++V  +TRK+FI+EVMELVELT L++++VGLPGVNGLST QRKRLTIAVELV
Sbjct  2652  YSAWLRLPADVDSKTRKMFIEEVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELV  2711

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  2712  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  2759


 Score =   139 bits (349),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 136/628 (22%), Positives = 268/628 (43%), Gaps = 86/628 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  2571  LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNINISGYPKKQETFAR  2629

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+D    
Sbjct  2630  ISGYCEQNDIHSPHVTIHESLLYSAW----------------------LRLPADVD----  2663

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L   +D++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  2664  -----SKTRKMFIEEVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  2718

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  2719  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGQEIY  2777

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++F+ +      + G   A ++ EVTS   +             F+  
Sbjct  2778  VGPLGRHSSHLIKYFQGIEGVSKIKDGYNPATWMLEVTSSAQE-------------FLLG  2824

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              +F+E +++  + R   D +    Q +           Y  S      +C  ++     R
Sbjct  2825  VDFTEIYKNSDLYRRNKDLIKELSQPAPGSKDLYFPTQYSQSFFTQCMACLWKQRRSYWR  2884

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N         +   +ALI  T+F     +R         M S++  +  +       + P
Sbjct  2885  NPPYTAVRFFFTTFIALIFGTMFWDLGTKRKKQQDLSNAMGSMYAAVLFLGVQNSSSVQP  2944

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ IP    +  V+    Y +IG++    +  
Sbjct  2945  VVAVERTVFYRERAAGMYSAMPYAFAQALVEIPYVFAQAVVYGVIVYAMIGFEWTAAKFF  3004

Query  1218  KMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDV  1057
                      +L   F  + +V    AA   + +        + +  LF+  GFI+ R  +
Sbjct  3005  WYLFFMFFTLLYFTFYGMMAV----AATPNQHIAAIVAAAFYGLWNLFS--GFIVPRTRI  3058

Query  1056  KKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFPE  895
               WW W YW  P+ +    +  ++F         + +TV  + ++ FG         F  
Sbjct  3059  PVWWRWYYWACPVAWTLYGLVTSQFGDIQDRFEDTGDTVEQYLNDYFG---------FEH  3109

Query  894   AYWYWLGVGA--LIGFTIFSIFIYTLAL  817
              +   LGV A  ++GFT+  +FI+  A+
Sbjct  3110  DF---LGVVAAVIVGFTVLFLFIFAFAI  3134


 Score =   119 bits (298),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 122/583 (21%), Positives = 249/583 (43%), Gaps = 84/583 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  880   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  938

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+     
Sbjct  939   ISGYCEQNDIHSPHVTVYESLLYSAW----------------------LRLPSDVK----  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   -----SETRQMFIEEVMELVELTPLRDALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1027

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+   GQ +Y
Sbjct  1028  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGQEIY  1086

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++ +FE +      + G   A ++ E T+   +    +            
Sbjct  1087  VGPLGRYSCHLINYFEGIEGVSKIKDGYNPATWMLEATTAAQEATLGV------------  1134

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKME-----LLKSCFSREV  1591
              +F+E +++  + R   D +     K  S P   T   Y  ++          +C  ++ 
Sbjct  1135  -DFTEIYKNSDLYRRNKDLI-----KELSQPPPGTKDLYFRTQFSQPFFTQFLACLWKQR  1188

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +AL+  T+F     + ++       M S++     ++F  +
Sbjct  1189  WSYWRNPPYTAVRFLFTTFIALMFGTMFWDLGTKWSTQQDLFNAMGSMY---AAVLFLGI  1245

Query  1410  QELAPTIFRL----PIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGY  1243
             Q        +     +FY++R    Y   +YA    ++ IP    +  V+    Y +IG+
Sbjct  1246  QNSQSVQPVVVVERTVFYRERAAGMYSPLSYAFAQALVEIPYIFSQAVVYGLIVYAMIGF  1305

Query  1242  DPNFGRLLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGG  1081
                  +           ++   F  + +V    AA   +++ +      + +  LF+  G
Sbjct  1306  QWTAAKFFWYLFFMFFTLMYFTFYGMMAV----AATPNQNIASIVAAAFYGLWNLFS--G  1359

Query  1080  FILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF--LGKSWNTV  958
             FI+ R+ +  WW W YWI P+ +    +  ++F  + +  NTV
Sbjct  1360  FIVPRNRIPVWWRWYYWICPVSWTLYGLVTSQFGDITEELNTV  1402



>gb|KDP37161.1| hypothetical protein JCGZ_06217 [Jatropha curcas]
Length=1409

 Score =  1436 bits (3718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/1030 (69%), Positives = 857/1030 (83%), Gaps = 15/1030 (1%)
 Frame = -2

Query  3057  FAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRGETFEVDINNIGYeekkki  2878
             FA SSRR   ++DDE  LKWAA++++PT+DRL+KG++T + G   E+DI ++G +E+K +
Sbjct  2     FAPSSRR---EEDDEEDLKWAAIERLPTYDRLRKGVLTTMTGGASEIDIRSLGLQERKNL  58

Query  2877  lerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNVGAEAYVGKRALPSVTNFC  2698
             LERL++V E DNE FLLKLK+R++RV IDIP +EVRFEHL + AEAYVG RALP+  N+ 
Sbjct  59    LERLVRVAEEDNEKFLLKLKNRIDRVGIDIPTIEVRFEHLKIEAEAYVGSRALPTFFNYS  118

Query  2697  LNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDP  2521
             +NILEG+L+Y + L + KKH  IL+DVSGIIKP RMTLLLGPPSSGKT+LLLALAG+LDP
Sbjct  119   VNILEGILNYFHILSSRKKHLHILKDVSGIIKPSRMTLLLGPPSSGKTTLLLALAGKLDP  178

Query  2520  SLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLA  2341
             +L+FSGRV+YNGH+++EF+P RTAAYISQHDLHI EMT RETLAFSARCQGVG+RY++LA
Sbjct  179   TLKFSGRVTYNGHDLDEFIPQRTAAYISQHDLHIGEMTVRETLAFSARCQGVGTRYDLLA  238

Query  2340  ELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGM  2161
             ELSRREKAANI+PD DID FMKAAAT+GQ+A+VI DYI+KVLGLE C DT+VG+E LRG+
Sbjct  239   ELSRREKAANIKPDSDIDAFMKAAATEGQEASVITDYILKVLGLEACADTMVGDEMLRGI  298

Query  2160  SGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQP  1981
             SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTT+QI+ S+K Y+ IL GTA I+LLQP
Sbjct  299   SGGQRKRVTTGEMLVGPALALFMDEISTGLDSSTTYQIVNSLKQYVQILKGTAFISLLQP  358

Query  1980  APECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQ  1801
             APE YDLFDDIIL+S+G IVYQGP   VLEFFE +GFRCPERKGVADFLQEVTSRKDQMQ
Sbjct  359   APETYDLFDDIILLSDGLIVYQGPREQVLEFFEFMGFRCPERKGVADFLQEVTSRKDQMQ  418

Query  1800  YWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKME  1621
             YW  KD +PYRF+T+ EF+E F+SFH+GR LG +L+TPF+K+ SHPAALTTK YGV+K E
Sbjct  419   YWASKD-EPYRFITVKEFAETFESFHVGRRLGQDLSTPFEKAKSHPAALTTKNYGVNKKE  477

Query  1620  LLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFF  1441
             LLK+CFSRE LLMKRN  + +F+   + ++ALITMTLF+RT M RNS I   IY  +LFF
Sbjct  478   LLKACFSREFLLMKRNSFVFVFKFCQLTILALITMTLFLRTEMHRNSVIDGGIYAGALFF  537

Query  1440  TLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFST  1261
              + +++F+ + E++ TI +LP+FYKQR+L FYPAWAYA+PT+IL+IPIT IEV++ VF+T
Sbjct  538   IVILVLFNGMAEISMTIAKLPVFYKQRELRFYPAWAYALPTWILKIPITFIEVAILVFTT  597

Query  1260  YYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGG  1081
             YYVIG+DPN GRL + ++LLII  Q+AS LFR+ A  GR+MT A   GSFI+L+LF LGG
Sbjct  598   YYVIGFDPNVGRLFRQYLLLIIVNQMASGLFRTIAATGRNMTVANTFGSFILLLLFILGG  657

Query  1080  FILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLF  901
             FILSRD++KKWW+WGYWISP+MY QNAI VNEFLG SW+ V   S+E  GV VLK RG F
Sbjct  658   FILSRDNIKKWWLWGYWISPMMYGQNAIVVNEFLGHSWSHVPQNSTETLGVQVLKSRGFF  717

Query  900   PEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANISAESHSNEHD------VSN  739
              E YWYWLGVGAL+GFTI   F+YTLAL  L    + +A    E   NE D      ++N
Sbjct  718   TETYWYWLGVGALLGFTILFNFLYTLALTFLNAFDKPQAVAQKEPEDNETDRTEDIHLTN  777

Query  738   GGSDNS----VGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRL  571
              GS +S     G   S   + +K GM+LPFEPHSIAF++I Y VDMPQE+K EGV +++L
Sbjct  778   HGSSSSNQTNRGFGPSSSHNKKKKGMVLPFEPHSIAFDEITYSVDMPQEIKNEGVHEHKL  837

Query  570   ELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFAR  391
              LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG I ISG+ KKQ+TFAR
Sbjct  838   ILLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGSIKISGYPKKQETFAR  897

Query  390   ISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVG  211
             ISGYCEQNDIHSPH+TVYES++FSAWLRLP EV  ETR++F++EVMELVEL  LR+A+VG
Sbjct  898   ISGYCEQNDIHSPHITVYESVLFSAWLRLPPEVDSETREMFVEEVMELVELNPLRQALVG  957

Query  210   LPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIV  31
             LPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT++
Sbjct  958   LPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVI  1017

Query  30    CTIHQPSIDI  1
             CTIHQPSIDI
Sbjct  1018  CTIHQPSIDI  1027


 Score =   133 bits (335),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 131/584 (22%), Positives = 242/584 (41%), Gaps = 65/584 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  839   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGSIKISGYPKKQETFAR  897

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E++ FSA                       +R  P++D    
Sbjct  898   ISGYCEQNDIHSPHITVYESVLFSAW----------------------LRLPPEVD----  931

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  932   -----SETREMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  986

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T +  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  987   MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVICTIHQPSIDIFETFDELFLLKRGGQEIY  1045

Query  1917  QGP-----CNCVLEFFECLGF-RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     C  V  F    G  +  +    A ++ EVT+   ++   +        F  I
Sbjct  1046  VGPLGHHSCQLVKYFEGIEGISKIKDGNNPATWMLEVTTAAQEVALGVD-------FADI  1098

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKT-YGVSKMELLKSCFSREVLLMK  1579
              + SE ++     RN   EL     K       L   T Y  S      +C  ++ L   
Sbjct  1099  YKNSELYR-----RN--KELIKDLSKPAPGSKDLYFPTQYARSYFAQFLACLWKQHLSYW  1151

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELA  1399
              N         +   + LI  T+F     +          M S++  +  +       + 
Sbjct  1152  CNPPYTAVRFLFTTFIGLIFGTVFWNLGSKMTKQQDLFNAMGSMYAAVLFLGIQNASSVQ  1211

Query  1398  PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRL  1222
             P +     +FY++R    Y A  YA     + +P   ++ +V+    Y ++G++ N  + 
Sbjct  1212  PVVAVERTVFYRERAAGMYSALPYAFGQVAIELPYIFVQAAVYGVIVYAMLGFEWNVSKF  1271

Query  1221  LKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDDVKKW  1048
                W L  ++  L    F     V  S  +  A V+ S    +     GFI+ R  + +W
Sbjct  1272  F--WYLFFMYFTLLYFTFYGMMAVAVSPNHQIASVISSAFYAIWNLFSGFIIPRPRMPEW  1329

Query  1047  WIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFG  931
             W W  WI P+ +    +  ++F       ++  TV  F  E FG
Sbjct  1330  WKWYSWICPVAWTLYGLVASQFGDIKEKLETGETVEDFVREYFG  1373



>ref|XP_009401806.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=1456

 Score =  1435 bits (3714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 707/1076 (66%), Positives = 856/1076 (80%), Gaps = 39/1076 (4%)
 Frame = -2

Query  3141  AMEINDSRGRSGSFRINSSSLWSNGTDG-FAKSSRRLQEDDDDEAALKWAALQKVPTFDR  2965
             A E+N    + GS R NSS +W  G +  F+ SSR    ++DDE ALKWAAL+K+PTFDR
Sbjct  3     ATEVN----KIGSMRRNSS-IWRRGNESIFSASSR----EEDDEEALKWAALEKLPTFDR  53

Query  2964  LKKGLMTGLRGETF--EVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAID  2791
             L++G++    G     EVD+  +G+ E+K +LERL++V + DNE FLLKLKDR++RV ID
Sbjct  54    LRRGILALPEGSQRLQEVDVQQLGFRERKALLERLVRVTDEDNERFLLKLKDRVDRVGID  113

Query  2790  IPKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSG  2614
             +P +EVRFEHLN+ AEA+VG R LP++ N  LN LE + +YL+ LP+ K+  SIL DVSG
Sbjct  114   LPTIEVRFEHLNIQAEAHVGSRGLPTILNSALNTLESIANYLHILPSRKRPLSILHDVSG  173

Query  2613  IIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQ  2434
             IIKP RMTLLLGPP SGKT+LLLALAG+L   L+ +G+ +YNGHEMNEFVP RTAAYISQ
Sbjct  174   IIKPRRMTLLLGPPGSGKTTLLLALAGKLSSDLKATGKTTYNGHEMNEFVPQRTAAYISQ  233

Query  2433  HDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQ  2254
             HDLHI EMT RETLAFSARCQGVG+RYEML EL+RREK ANI+PDPDID+FMKAA+  GQ
Sbjct  234   HDLHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKEANIKPDPDIDVFMKAASMGGQ  293

Query  2253  KANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTG  2074
             ++N+I DY++K+LGLE C DT+VG+E LRG+SGG++KR+T GEMLVGPA  L MDEISTG
Sbjct  294   ESNLITDYVLKILGLEVCSDTMVGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTG  353

Query  2073  LDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVL  1894
             LDSSTTFQI+ S++  +HIL GTAVI+LLQPAPE Y+LFDDIIL+S+GQ+VYQGP   VL
Sbjct  354   LDSSTTFQIVNSLRQSVHILGGTAVISLLQPAPETYELFDDIILLSDGQVVYQGPRENVL  413

Query  1893  EFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGR  1714
             EFFE +GF+CPERKGVADFLQEVTSRKDQ QYW R D +PYR+V + EF++AFQSFH+GR
Sbjct  414   EFFESMGFKCPERKGVADFLQEVTSRKDQQQYWTRHD-EPYRYVPVREFADAFQSFHVGR  472

Query  1713  NLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVL  1534
              +GDEL+ P+ KS SHPAALTT  YGVSK ELLK+   RE+LLMKRN  ++IF+   + +
Sbjct  473   VIGDELSVPYDKSKSHPAALTTSRYGVSKKELLKANIDRELLLMKRNSFVYIFKATQLTI  532

Query  1533  MALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDL  1354
             MALI MT+F+RTNM R+S     +YM +LFF + ++MF+   E A TI +LP+F+KQRDL
Sbjct  533   MALIAMTVFLRTNMHRDSVTEGGLYMGALFFGVVMVMFNGFSETAMTILKLPVFFKQRDL  592

Query  1353  LFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASV  1174
             LFYPAW+YAIP++IL+IPI+  EV+VWVF+TYYVIG+DPN GRL K ++LL++  Q+AS 
Sbjct  593   LFYPAWSYAIPSWILKIPISFAEVAVWVFTTYYVIGFDPNVGRLFKQYMLLLLINQMASS  652

Query  1173  LFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIA  994
             LFR    VGR+M  A   GSF +L+L  LGGFILSRD VKKWWIWGYWISPLMYAQNAI+
Sbjct  653   LFRFIGAVGRNMIVANTFGSFALLILLVLGGFILSRDQVKKWWIWGYWISPLMYAQNAIS  712

Query  993   VNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALA  814
             VNEFLG SW   LP SSEP GV VLK RG+FPEA WYW+G GALIG+      ++++AL 
Sbjct  713   VNEFLGHSWQHSLPNSSEPLGVSVLKSRGVFPEAKWYWIGFGALIGYIFLFNALFSVALT  772

Query  813   KLRPLAQSRANISAES----HSN----------------EHDVSNGGSDNSVGERVSDGM  694
              L+P  +S+  +S ES    H+N                +H  S  G+D    +  S G 
Sbjct  773   YLKPFGKSQPPVSEESLKEKHANLTGEVSEQSSRGRNSVDHSQSKKGADGLRRDGTSSGS  832

Query  693   SN-----RKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGV  529
              N      K GM+LPF P SI F++I+Y VDMPQEMK +GV ++RLELLKG+SG+FRPGV
Sbjct  833   MNVAIDQNKKGMVLPFTPLSITFDNIRYSVDMPQEMKDQGVVEDRLELLKGISGSFRPGV  892

Query  528   LTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPH  349
             LTALMGVSGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFAR+SGYCEQNDIHSPH
Sbjct  893   LTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARVSGYCEQNDIHSPH  952

Query  348   LTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKR  169
             +TVYESL++SAWLRLP+EV   TRK+F+ EVMELVELT LR+A+VGLPGVNGLST QRKR
Sbjct  953   VTVYESLVYSAWLRLPAEVNSATRKMFVDEVMELVELTPLRDALVGLPGVNGLSTEQRKR  1012

Query  168   LTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             LTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1013  LTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1068


 Score =   140 bits (354),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 127/563 (23%), Positives = 248/563 (44%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ +SG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  880   LLKGISGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  938

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  939   VSGYCEQNDIHSPHVTVYESLVYSAWLR-------------------------------L  967

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              A  +     + VD +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  968   PAEVNSATRKMFVDEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1027

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1028  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGEEIY  1086

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++ +FE +      + G   A ++ EV+S+        ++D     F  I
Sbjct  1087  VGPLGHNSCHLINYFEGINGVSKIKDGYNPATWMLEVSSQA-------QEDILGVNFSEI  1139

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE +Q     ++L  EL+TP   S+          Y  S +    +C  ++ L   R
Sbjct  1140  YKNSELYQR---NKDLIKELSTPPPGSSD---LYFPTQYSQSILVQCMACLWKQHLSYWR  1193

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N         + +++AL+  T+F     +R++       M S++  +  I       + P
Sbjct  1194  NPPYTAVRFFFTLIIALLFGTIFWDLGTKRDTKQDLLNAMGSMYAAVLFIGVQNSSSVQP  1253

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA     + IP   ++  ++    Y +IG++    +  
Sbjct  1254  VVAIERTVFYRERAAGMYSAVPYAFGQVAIEIPYILVQALLYGVIVYAMIGFEWTAAKFF  1313

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
                 +  ++  L    F     VG  +T  + + S +    +A+     GFI+ R  +  
Sbjct  1314  WY--MFFMYFTLLYFTFYGMMAVG--LTPNYNIASIVSAAFYAIWNLFSGFIIPRPRIPV  1369

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W YWI P+ +    +  ++F
Sbjct  1370  WWRWYYWICPVAWTLYGLVASQF  1392



>ref|XP_009370616.1| PREDICTED: pleiotropic drug resistance protein 1-like [Pyrus 
x bretschneideri]
Length=1437

 Score =  1434 bits (3713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/1062 (66%), Positives = 857/1062 (81%), Gaps = 23/1062 (2%)
 Frame = -2

Query  3138  MEINDSRGRSG-SFRINS----SSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVP  2977
             MEI+ +  ++G SF  NS    SS W   G++ F+ SS      +DDE ALKWAALQ++P
Sbjct  1     MEISCNLEKAGHSFTRNSFTRNSSFWIDKGSEVFSTSS----HGEDDEEALKWAALQRLP  56

Query  2976  TFDRLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVA  2797
             TF RL KGL++  +G   EVD++N+  +++K ++ERL+ V E D+E FLL+LK R++RV 
Sbjct  57    TFQRLNKGLLSTPQGHANEVDLSNLEVKDRKILIERLVGVAEEDHENFLLRLKSRIDRVG  116

Query  2796  IDIPKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDV  2620
             IDIPK+EVRF++L + AEAY G RALP+V N+C+N++EGLL+ L+ LP+ KKH SIL+DV
Sbjct  117   IDIPKIEVRFQNLKIAAEAYAGSRALPTVFNYCVNMVEGLLNSLHILPSKKKHLSILKDV  176

Query  2619  SGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYI  2440
             SGII+P RMTLLLGPPSSGKT+LLLALAG+LD  L+FSGRV+YNGH M+EFVP RTAAYI
Sbjct  177   SGIIRPCRMTLLLGPPSSGKTTLLLALAGELDQDLQFSGRVTYNGHGMHEFVPQRTAAYI  236

Query  2439  SQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATD  2260
             SQHD+H+ E+T  ETL FSARCQGVG+RYE + ELSRREK  NI+PD DIDI+MKA A++
Sbjct  237   SQHDVHMGELTVGETLNFSARCQGVGARYETIVELSRREKEENIKPDADIDIYMKAVASE  296

Query  2259  GQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEIS  2080
              Q+A V+ DYI+K+LGL+ C DT+VG+  +RG+SGG++KR+T GEMLVGPA  L MDEIS
Sbjct  297   SQRAQVVTDYILKILGLDVCADTLVGDNLIRGISGGQKKRVTTGEMLVGPAKALFMDEIS  356

Query  2079  TGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNC  1900
             TGLDSSTT+QI+ SIK Y+HIL GTA I+LLQPAPE Y+LFDDI+L+S+G IVYQGP   
Sbjct  357   TGLDSSTTYQIVNSIKQYVHILKGTAFISLLQPAPETYELFDDIVLLSDGHIVYQGPREH  416

Query  1899  VLEFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHI  1720
             VLEFFE +GFRCPERKGVADFLQEVTSRKDQ QYW  +D +PYRF+T+ EF EAFQSFH+
Sbjct  417   VLEFFESMGFRCPERKGVADFLQEVTSRKDQEQYWASRD-EPYRFITVEEFVEAFQSFHV  475

Query  1719  GRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWV  1540
             GR L DELATPF K+ SHPAALTTK YGVS+ ELLK+CF+RE LLMKRN  ++IF++  +
Sbjct  476   GRKLTDELATPFDKAKSHPAALTTKKYGVSRTELLKACFAREFLLMKRNSFVYIFKLAQL  535

Query  1539  VLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQR  1360
              +MA+ITMTLF+RT M  +S     +Y  +LFF+L  +MF+ L +L+ T+ RLP+FYKQR
Sbjct  536   SIMAMITMTLFLRTEMHHDSVNDGVVYAGALFFSLVAVMFNGLADLSMTVTRLPVFYKQR  595

Query  1359  DLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLA  1180
             +LLF+P WAYA+PT+IL+IPITCIEV VWVF+TYYVIGYDPN GRL K + LL++  Q+A
Sbjct  596   NLLFFPPWAYALPTWILKIPITCIEVVVWVFTTYYVIGYDPNVGRLFKQYFLLLLINQMA  655

Query  1179  SVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNA  1000
             S LFR    VGR+MT A   GSF +LVLFALGGF+LSR+D+KKWWIWGYWISPLMY QNA
Sbjct  656   SGLFRFIGGVGRTMTIANTFGSFALLVLFALGGFVLSREDIKKWWIWGYWISPLMYGQNA  715

Query  999   IAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFT-IFSIFIYTL  823
             I VNEFLGKSW  VLP S+EP GV VLK RG F E YWYW+GVG L G+  IF+IF +TL
Sbjct  716   IVVNEFLGKSWRHVLPNSTEPLGVAVLKSRGFFTEPYWYWIGVGVLAGYMLIFNIF-FTL  774

Query  822   ALAKLRPLAQSRANISAESHSNEHDVSNGGSDNS--------VGERVSDGMSNRKHGMIL  667
             AL  L+P+ + +A +  E  ++   +S    D S          E  +D   N+K GM+L
Sbjct  775   ALTYLKPIGKPQA-VKLEDPTSTPQISRENRDGSNSSRSSSVTKEATNDTNGNKKRGMVL  833

Query  666   PFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTT  487
             PFEPHSI F+DI Y VDMPQEMK +GV +++L LL+ VSGAFRPGVLTALMGVSGAGKTT
Sbjct  834   PFEPHSITFDDITYSVDMPQEMKNQGVPEDKLVLLRQVSGAFRPGVLTALMGVSGAGKTT  893

Query  486   LMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLR  307
             LMDVLAGRKTGGYIEG ITISG+ KKQ++FARISGYCEQNDIHSPH+TVYESL++SAWLR
Sbjct  894   LMDVLAGRKTGGYIEGNITISGYPKKQESFARISGYCEQNDIHSPHVTVYESLMYSAWLR  953

Query  306   LPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSII  127
             L SE+  ETRK+F++EVM LVEL  LR+A+VGLP  +GLST QRKRLTIAVELVANPSII
Sbjct  954   LSSEINPETRKMFVEEVMGLVELNPLRQALVGLPSASGLSTEQRKRLTIAVELVANPSII  1013

Query  126   FMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             FMDEPTSGLDARAAAIVMR VRN VDTGRT+VCTIHQPSIDI
Sbjct  1014  FMDEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDI  1055


 Score =   145 bits (366),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 138/574 (24%), Positives = 253/574 (44%), Gaps = 84/574 (15%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +LR VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  867   LLRQVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQESFAR  925

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                 ++ I P         
Sbjct  926   ISGYCEQNDIHSPHVTVYESLMYSAWLR----------------LSSEINP---------  960

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ ++ ++ L      +VG     G+S  +RKRLT    LV   +++ 
Sbjct  961   ------ETRKMFVEEVMGLVELNPLRQALVGLPSASGLSTEQRKRLTIAVELVANPSIIF  1014

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+ +G Q +Y
Sbjct  1015  MDEPTSGLDARAAAIVMRAVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLKKGGQEIY  1073

Query  1917  QGP-----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVT  1759
              GP     CN ++++FE +      R G   A ++ EVTS   +M   I           
Sbjct  1074  AGPLGRHSCN-LIKYFEGIDNVSKIRDGYNPATWMLEVTSSAKEMAMEI-----------  1121

Query  1758  INEFSEAFQSFHIGRN---LGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFSRE  1594
               +F+E +++  + R    L  EL+TP    K    P       Y    +    +C  ++
Sbjct  1122  --DFAEVYKNSELYRRNKALIKELSTPAPGSKDLHFPTQ-----YSQPFLTQCIACLWKQ  1174

Query  1593  VLLMKRNCVLHIFEVGWVVLMALITMTLFI----RTNMQRN--SPIGAQIYMSSLFFTLT  1432
                  RN       + +   +AL+  T+F     +T  Q++  + IG+ +Y + LF  L 
Sbjct  1175  HWSYWRNPQYTAIRLIYTTFVALMFGTMFWNLGSKTKKQKDLFNAIGS-MYAAVLF--LG  1231

Query  1431  VIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYV  1252
             +   + +Q +        +FY++R    Y A AYA     + IP   ++   +    Y  
Sbjct  1232  IKNSTTVQPVVDV--ERTVFYRERAAGMYSALAYAFAQVTIEIPYVFVQALFYSVIVYAT  1289

Query  1251  IGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN----AFVVGSFIMLVLFALG  1084
             IG+D    + L  W L  ++     + F    ++G ++T     A +  S    +     
Sbjct  1290  IGFDWTVAKFL--WYLFFMY--FTFLYFTYYGMMGVALTPNQHIAAISSSAFYAIWNLFS  1345

Query  1083  GFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             GFI+ R  +  WW W YW  P+ +    +A ++F
Sbjct  1346  GFIIPRTRIPVWWRWYYWACPMAWTLYGLATSQF  1379



>dbj|BAO45894.1| pleiotropic drug resistance ABC transporter [Acacia mangium]
Length=1433

 Score =  1434 bits (3713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1041 (67%), Positives = 856/1041 (82%), Gaps = 10/1041 (1%)
 Frame = -2

Query  3108  GSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
              S R  SS+ W S+G + F++SSR    ++DDE ALKWAAL+K+PT++RLKKGL+T   G
Sbjct  15    ASMRAGSSTAWRSSGVEMFSRSSR----EEDDEEALKWAALEKLPTYNRLKKGLLTASHG  70

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
                EVDI+++G++EKKK+L+RLIK  E DNE FLLKL++R++RV IDIP +EVR+EHLN+
Sbjct  71    VANEVDISDLGFQEKKKLLDRLIKDTEEDNEKFLLKLRERIDRVGIDIPTIEVRYEHLNI  130

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEAYVG RALP+  NF  NI E  LS+L+ L + K+H +IL+DVSGI+KP RMTLLLGP
Sbjct  131   EAEAYVGGRALPTFINFVTNIAENFLSFLHILSSRKRHVTILKDVSGIVKPRRMTLLLGP  190

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             PSSGKT+LLLAL+G+LDPSL+ SGRV+YNGHEM EFVP RTAAYISQHD+HI EMT RET
Sbjct  191   PSSGKTTLLLALSGKLDPSLKTSGRVTYNGHEMKEFVPQRTAAYISQHDVHIGEMTVRET  250

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSAR QGVGSRY++LAELSRREK  NI+PDPDID++MKAAAT+GQ+ NV+ DY +KVL
Sbjct  251   LAFSARFQGVGSRYDLLAELSRREKEENIKPDPDIDVYMKAAATEGQEENVVTDYALKVL  310

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTT+QI+ S+
Sbjct  311   GLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQIVNSL  370

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             +  +HI++GTAVI+LLQPAPE Y+LFDDIILISEGQIVYQGP   VL+FFE +GFRCPER
Sbjct  371   RQLVHIMNGTAVISLLQPAPETYELFDDIILISEGQIVYQGPREYVLDFFESMGFRCPER  430

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTSRKDQ QYW+R+D +PY FVT  +F+EAFQSFH+GR +GDEL  PF KS
Sbjct  431   KGVADFLQEVTSRKDQEQYWVRRD-EPYSFVTDAQFAEAFQSFHVGRRIGDELGVPFDKS  489

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              +HPAALTTK +GV+K ELLK+ F+RE LLMKRN  ++IF++  +++MA I+MTLF RTN
Sbjct  490   KNHPAALTTKKFGVNKKELLKANFAREYLLMKRNSFVYIFKLTQLIIMAFISMTLFFRTN  549

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M R++     +Y  +LFFTL + MF+ + E++ TI +LP+FYKQRDLLFYP+WAYAIP++
Sbjct  550   MHRDTVTDGGVYTGALFFTLMMTMFNGMAEISMTIAKLPVFYKQRDLLFYPSWAYAIPSW  609

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             IL+IPIT +EV+VW F TYYVIG+DPN GRL K ++LL++  Q+AS LFRS A +GR+M 
Sbjct  610   ILKIPITFLEVAVWTFLTYYVIGFDPNVGRLFKQYLLLLLISQMASGLFRSIAALGRNMI  669

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              A   GSF +L+L  LGGF+L++DD+K WWIWGYWISPLMY QNAIAVNEFLG SWN   
Sbjct  670   VANTFGSFALLILITLGGFVLAKDDIKGWWIWGYWISPLMYGQNAIAVNEFLGHSWNHRA  729

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
               SSE  G+ VLK RG F +AYWYW+G+ AL GFT+    +++LAL+ L P  + +A I+
Sbjct  730   NDSSETLGIQVLKSRGFFTKAYWYWIGLAALAGFTLLFNVVFSLALSFLNPFEKPQATIN  789

Query  774   AESHSNEHDVSNGGSD---NSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQE  604
              E   +  +    G +    +  +  +D    RK GM+LPFEPHSI F++I Y VDMPQE
Sbjct  790   EEPEESTSNRRAQGVELPRIASSQNGADSSHGRKRGMVLPFEPHSITFDEIVYSVDMPQE  849

Query  603   MKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITIS  424
             MK +GV ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G I IS
Sbjct  850   MKDQGVLEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGSIKIS  909

Query  423   GFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELV  244
             G+ KKQ+TFAR+SGYCEQNDIHSPH+TVYESL++SAWLRLP EV  +TR++FI+EVMELV
Sbjct  910   GYPKKQETFARVSGYCEQNDIHSPHVTVYESLVYSAWLRLPQEVDSKTREMFIEEVMELV  969

Query  243   ELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTV  64
             EL  LR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTV
Sbjct  970   ELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTV  1029

Query  63    RNIVDTGRTIVCTIHQPSIDI  1
             RN VDTGRT+VCTIHQPSIDI
Sbjct  1030  RNTVDTGRTVVCTIHQPSIDI  1050


 Score =   122 bits (307),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 120/562 (21%), Positives = 240/562 (43%), Gaps = 60/562 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  862   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPKKQETFAR  920

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  921   VSGYCEQNDIHSPHVTVYESLVYSAWLR-------------------------------L  949

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                 D +   + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  950   PQEVDSKTREMFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1009

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1010  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1068

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EVT+   ++   +        F  I
Sbjct  1069  VGPLGRHSSHLIKYFESIDGVSKIKDGYNPATWMLEVTTSAQEVALGVN-------FTDI  1121

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + S+ ++     + L +EL  P     S      T+ Y  S M    +C  ++     R
Sbjct  1122  YKNSDLYRR---NKQLIEELGKP--APGSQDLYFPTQ-YSQSFMVQCLACLWKQHWSYWR  1175

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE---  1405
             N         +   +ALI  T+F     + +        M S++   T ++F  +Q    
Sbjct  1176  NPPYTAVRFLFTTFIALIFGTMFWNLGTKTSRRQDLFNAMGSMY---TAVLFLGVQNSSS  1232

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA+   ++ IP   ++   +    Y +IG+D    
Sbjct  1233  VQPVVAVERTVFYRERAAGMYSALPYALAQVLIEIPYVFVQSVTYGIIVYAMIGFDWTAE  1292

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKW  1048
             +       +       +     A  V  +   A +V +    +     GF++ R  +  W
Sbjct  1293  KFFWYLFFMFFTLMYFTYYGMMAVAVTPNHHVAAIVAAAFYGIWNLFSGFVVPRPAMPVW  1352

Query  1047  WIWGYWISPLMYAQNAIAVNEF  982
             W W YW  P+ ++   +  ++F
Sbjct  1353  WRWYYWACPVAWSLYGLLASQF  1374



>ref|XP_009401814.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=1455

 Score =  1433 bits (3709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 709/1075 (66%), Positives = 857/1075 (80%), Gaps = 38/1075 (4%)
 Frame = -2

Query  3141  AMEINDSRGRSGSFRINSSSLWSNGTDG-FAKSSRRLQEDDDDEAALKWAALQKVPTFDR  2965
             A E+N    + GS R NSS +W  G +  F+ SSR    ++DDE ALKWAAL+K+PTFDR
Sbjct  3     ATEVN----KIGSMRRNSS-IWRRGNESIFSASSR----EEDDEEALKWAALEKLPTFDR  53

Query  2964  LKKGLMTGLRGETF--EVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAID  2791
             L++G++    G     EVD+  +G+ E+K +LERL++V + DNE FLLKLKDR++RV ID
Sbjct  54    LRRGILALPEGSQRLQEVDVQQLGFRERKALLERLVRVTDEDNERFLLKLKDRVDRVGID  113

Query  2790  IPKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSG  2614
             +P +EVRFEHLN+ AEA+VG R LP++ N  LN LE + +YL+ LP+ K+  SIL DVSG
Sbjct  114   LPTIEVRFEHLNIQAEAHVGSRGLPTILNSALNTLESIANYLHILPSRKRPLSILHDVSG  173

Query  2613  IIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQ  2434
             IIKP RMTLLLGPP SGKT+LLLALAG+L   L+ +G+ +YNGHEMNEFVP RTAAYISQ
Sbjct  174   IIKPRRMTLLLGPPGSGKTTLLLALAGKLSSDLKATGKTTYNGHEMNEFVPQRTAAYISQ  233

Query  2433  HDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQ  2254
             HDLHI EMT RETLAFSARCQGVG+RYEML EL+RREK ANI+PDPDID+FMKAA+  GQ
Sbjct  234   HDLHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKEANIKPDPDIDVFMKAASMGGQ  293

Query  2253  KANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTG  2074
             ++N+I DY++K+LGLE C DT+VG+E LRG+SGG++KR+T GEMLVGPA  L MDEISTG
Sbjct  294   ESNLITDYVLKILGLEVCSDTMVGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTG  353

Query  2073  LDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVL  1894
             LDSSTTFQI+ S++  +HIL GTAVI+LLQPAPE Y+LFDDIIL+S+GQ+VYQGP   VL
Sbjct  354   LDSSTTFQIVNSLRQSVHILGGTAVISLLQPAPETYELFDDIILLSDGQVVYQGPRENVL  413

Query  1893  EFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGR  1714
             EFFE +GF+CPERKGVADFLQEVTSRKDQ QYW R D +PYR+V + EF++AFQSFH+GR
Sbjct  414   EFFESMGFKCPERKGVADFLQEVTSRKDQQQYWTRHD-EPYRYVPVREFADAFQSFHVGR  472

Query  1713  NLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVL  1534
              +GDEL+ P+ KS SHPAALTT  YGVSK ELLK+   RE+LLMKRN  ++IF+   + +
Sbjct  473   VIGDELSVPYDKSKSHPAALTTSRYGVSKKELLKANIDRELLLMKRNSFVYIFKATQLTI  532

Query  1533  MALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDL  1354
             MALI MT+F+RTNM R+S     +YM +LFF + ++MF+   E A TI +LP+F+KQRDL
Sbjct  533   MALIAMTVFLRTNMHRDSVTEGGLYMGALFFGVVMVMFNGFSETAMTILKLPVFFKQRDL  592

Query  1353  LFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASV  1174
             LFYPAW+YAIP++IL+IPI+  EV+VWVF+TYYVIG+DPN GRL K ++LL++  Q+AS 
Sbjct  593   LFYPAWSYAIPSWILKIPISFAEVAVWVFTTYYVIGFDPNVGRLFKQYMLLLLINQMASS  652

Query  1173  LFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIA  994
             LFR    VGR+M  A   GSF +L+L  LGGFILSRD VKKWWIWGYWISPLMYAQNAI+
Sbjct  653   LFRFIGAVGRNMIVANTFGSFALLILLVLGGFILSRDQVKKWWIWGYWISPLMYAQNAIS  712

Query  993   VNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALA  814
             VNEFLG SW   LP SSEP GV VLK RG+FPEA WYW+G GALIG+      ++++AL 
Sbjct  713   VNEFLGHSWQHSLPNSSEPLGVSVLKSRGVFPEAKWYWIGFGALIGYIFLFNALFSVALT  772

Query  813   KLRPLAQSRANISAESHSNEH-----DVSNGGS--DNSVGERVS--------DGMSN---  688
              L+P  +S+  +S ES   +H     +VS   S   NSV    S        DG S+   
Sbjct  773   YLKPFGKSQPPVSEESLKEKHANLTGEVSEQSSRGRNSVDHSQSKSADGLRRDGTSSGSM  832

Query  687   ------RKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVL  526
                    K GM+LPF P SI F++I+Y VDMPQEMK +GV ++RLELLKG+SG+FRPGVL
Sbjct  833   NVAIDQNKKGMVLPFTPLSITFDNIRYSVDMPQEMKDQGVVEDRLELLKGISGSFRPGVL  892

Query  525   TALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHL  346
             TALMGVSGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFAR+SGYCEQNDIHSPH+
Sbjct  893   TALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARVSGYCEQNDIHSPHV  952

Query  345   TVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRL  166
             TVYESL++SAWLRLP+EV   TRK+F+ EVMELVELT LR+A+VGLPGVNGLST QRKRL
Sbjct  953   TVYESLVYSAWLRLPAEVNSATRKMFVDEVMELVELTPLRDALVGLPGVNGLSTEQRKRL  1012

Query  165   TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1013  TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1067


 Score =   141 bits (355),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 127/563 (23%), Positives = 248/563 (44%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ +SG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  879   LLKGISGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  937

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  938   VSGYCEQNDIHSPHVTVYESLVYSAWLR-------------------------------L  966

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              A  +     + VD +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  967   PAEVNSATRKMFVDEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1026

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1027  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGEEIY  1085

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++ +FE +      + G   A ++ EV+S+        ++D     F  I
Sbjct  1086  VGPLGHNSCHLINYFEGINGVSKIKDGYNPATWMLEVSSQA-------QEDILGVNFSEI  1138

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE +Q     ++L  EL+TP   S+          Y  S +    +C  ++ L   R
Sbjct  1139  YKNSELYQR---NKDLIKELSTPPPGSSD---LYFPTQYSQSILVQCMACLWKQHLSYWR  1192

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N         + +++AL+  T+F     +R++       M S++  +  I       + P
Sbjct  1193  NPPYTAVRFFFTLIIALLFGTIFWDLGTKRDTKQDLLNAMGSMYAAVLFIGVQNSSSVQP  1252

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA     + IP   ++  ++    Y +IG++    +  
Sbjct  1253  VVAIERTVFYRERAAGMYSAVPYAFGQVAIEIPYILVQALLYGVIVYAMIGFEWTAAKFF  1312

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
                 +  ++  L    F     VG  +T  + + S +    +A+     GFI+ R  +  
Sbjct  1313  WY--MFFMYFTLLYFTFYGMMAVG--LTPNYNIASIVSAAFYAIWNLFSGFIIPRPRIPV  1368

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W YWI P+ +    +  ++F
Sbjct  1369  WWRWYYWICPVAWTLYGLVASQF  1391



>ref|XP_007217658.1| hypothetical protein PRUPE_ppa000226mg [Prunus persica]
 gb|EMJ18857.1| hypothetical protein PRUPE_ppa000226mg [Prunus persica]
Length=1436

 Score =  1433 bits (3709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 707/1059 (67%), Positives = 862/1059 (81%), Gaps = 18/1059 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D      S ++ SS  W +NG + F++SSR    ++DDEAALKWAAL+K+PT++RL
Sbjct  1     MEGGDIYRTGNSVQLGSSMRWRNNGVEVFSRSSR----EEDDEAALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KG++T   GE  EVDI N+G++E+K+++ER +K  E DNE FLLKLK+R++RV ID+P 
Sbjct  57    RKGILTSPAGEASEVDIPNLGFQERKELIERFLKGAEEDNERFLLKLKNRIDRVGIDLPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVR+EHLNV AEAYVG RALP++ NF +NI EG+L+ L + +++K H SIL  VSGIIK
Sbjct  117   IEVRYEHLNVEAEAYVGSRALPTLFNFIINIFEGILNSLRIFSSRKTHLSILHSVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLALAG+LDP L+ SGRV+YNGHEMN+FVP +TAAYISQHDL
Sbjct  177   PSRMTLLLGPPSSGKTTLLLALAGKLDPDLKLSGRVTYNGHEMNDFVPQKTAAYISQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             H+ EMT RETLAFSARCQGVG+RY+ML+EL RRE+AANI+PDPDID+FMKA AT+GQ+ N
Sbjct  237   HVGEMTVRETLAFSARCQGVGTRYDMLSELCRREQAANIKPDPDIDVFMKAIATEGQEVN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DYI+K+LGLE C DTIVG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  297   VVTDYILKILGLEVCADTIVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ SIK YI IL+GTAVI+LLQPAPE Y+LFDDIIL+S+GQIVYQG    VLEFF
Sbjct  357   STTFQIVNSIKQYIRILNGTAVISLLQPAPETYELFDDIILLSDGQIVYQGSREHVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKG+ADFLQEVTSRKDQ QYW  KD KPYRFVT+ EF+EAFQSFH+G+ +G
Sbjct  417   ESMGFKCPERKGIADFLQEVTSRKDQEQYWACKD-KPYRFVTVKEFNEAFQSFHVGQKIG  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DEL+ PF KS +HPAALTTK YG+ K ELLK+CFSRE LL KRN  ++IF++  + +MAL
Sbjct  476   DELSIPFDKSKNHPAALTTKEYGLKKGELLKACFSREYLLAKRNAFVYIFKLIQLTVMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I+MTLF+RT M  +S     +Y  +LFF + ++MF+ + EL  TI +LP+FYKQRDL FY
Sbjct  536   ISMTLFLRTKMHHDSVNDGGVYAGALFFIVVMVMFNGMSELPMTIIKLPVFYKQRDLFFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAW YA+PT+IL+IPIT +EV++WVF+TYYVIG+DPN  RLL+ ++LLI+  Q+AS LFR
Sbjct  596   PAWTYALPTWILKIPITIVEVALWVFTTYYVIGFDPNIERLLRQYLLLILVSQMASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A   R++  A  +GSF +L++F LGGF+LSRD+++KWWIWGYWISP+MY+QNA+ VNE
Sbjct  656   LIAAACRNLVVANTLGSFALLIMFTLGGFVLSRDNIRKWWIWGYWISPMMYSQNAVVVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIF--SIFIYTLALAK  811
             FLGK+W  VLP S+E  GV VLK RG FP AYWYW+GVGA+ GF +   S +I+  +L  
Sbjct  716   FLGKNWRHVLPNSTESLGVEVLKSRGFFPHAYWYWIGVGAMAGFVLLFNSCYIHWGSLRL  775

Query  810   LRPLAQSRANISAESHSNEH---------DVSNGGSDNSVGERVSDGMSNRKHGMILPFE  658
             L         + AE     +         +V    +  +  E     + N K GM+LPFE
Sbjct  776   LNQKIPKGMKMIAEPRERAYYHAIKIAQVNVPRQSTGQNRTEVSLQTIHNTKRGMVLPFE  835

Query  657   PHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMD  478
             PHSI F++I Y VDMPQEMKI+GV +++L LLKGVSGAFRPGVLTALMGVSGAGKTTLMD
Sbjct  836   PHSITFDEIIYSVDMPQEMKIQGVMEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMD  895

Query  477   VLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPS  298
             VLAGRKTGGYIEG++ ISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ESLI+SAWLRLP 
Sbjct  896   VLAGRKTGGYIEGDVKISGYPKKQETFARISGYCEQNDIHSPHVTVHESLIYSAWLRLPP  955

Query  297   EVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMD  118
             EV  ETRK+FI+EVMELVELTSLR+A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMD
Sbjct  956   EVKSETRKMFIEEVMELVELTSLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMD  1015

Query  117   EPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             EPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1054


 Score =   137 bits (346),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 127/565 (22%), Positives = 252/565 (45%), Gaps = 66/565 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G V  +G+   +    R
Sbjct  866   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDVKISGYPKKQETFAR  924

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P++     
Sbjct  925   ISGYCEQNDIHSPHVTVHESLIYSAW----------------------LRLPPEVK----  958

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  959   -----SETRKMFIEEVMELVELTSLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1013

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1014  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGQEIY  1072

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      + G   A ++ EVT+   ++   +R D     F  +
Sbjct  1073  VGPLGRHSCHLIKYFEGIEGVSKIKDGYNPATWMLEVTTSAQELD--LRID-----FAQV  1125

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKT-YGVSKMELLKSCFSREVLLMK  1579
              + SE ++     RN   +L   F K       L   T Y  S +    +C  ++     
Sbjct  1126  YKTSELYR-----RN--KQLIKDFSKPAPTSKDLYFPTQYAQSFLIQTIACLWKQHWSYW  1178

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE--  1405
             RN +    ++ + +++AL+  T+F +   +          M S++   T ++F  +Q   
Sbjct  1179  RNPLYTAVKILFTIVIALMFGTIFWKLGSKTKRQQDLFNAMGSMY---TAVLFLGVQNAT  1235

Query  1404  -LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
              + P +     +FY+++    Y A  YA    ++ +P   ++  V+    Y +IG++   
Sbjct  1236  SVQPVVAVERTVFYREKAAGMYSALPYAFAQVLIELPYILVQAVVYGVIIYTLIGFEMTP  1295

Query  1230  GRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDDV  1057
              +    W L  ++  L    F     V  +  +  A +V S    +     GFI+ R  +
Sbjct  1296  VKFF--WYLFFMYFTLLYFTFYGMMTVAVTPNHHIASIVSSAFYAMWNLFSGFIVPRPRI  1353

Query  1056  KKWWIWGYWISPLMYAQNAIAVNEF  982
               WW W YW  P+ +    +  ++F
Sbjct  1354  PIWWRWYYWACPMAWTLYGLVASQF  1378



>ref|XP_008373552.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X3 [Malus domestica]
Length=1295

 Score =  1432 bits (3708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1053 (66%), Positives = 855/1053 (81%), Gaps = 20/1053 (2%)
 Frame = -2

Query  3114  RSGSFRINSSSL-W-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTG  2941
             R+G+ R   SSL W +NG + F++SSR     +D+E ALKWAAL+K+PT++RL+KG++T 
Sbjct  8     RAGNGRQLGSSLRWMNNGMEVFSRSSR----GEDEEVALKWAALEKLPTYNRLRKGILTM  63

Query  2940  LRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEH  2761
               GE  E+DI N+G++E+K+++ER +K  + DNE FLLKLK+R++RV I +P +EVRFE 
Sbjct  64    PGGEASEIDIPNLGFQERKELIERFLKGNDEDNERFLLKLKNRIDRVGIVLPTIEVRFEQ  123

Query  2760  LNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIKPGRMTLL  2584
             LN+ AE YVG RALP++ NFC+NI+E +L  L + +++K H SIL +VSGIIKP RMTLL
Sbjct  124   LNIEAETYVGSRALPTLFNFCVNIIEDILIGLRILSSRKTHLSILHNVSGIIKPSRMTLL  183

Query  2583  LGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTA  2404
             LGPPSSGKT+LLLALAG+LDP L+ SGRVSYNGH MNEFVP RTAAYI QHDLHI EMT 
Sbjct  184   LGPPSSGKTTLLLALAGKLDPDLKLSGRVSYNGHGMNEFVPQRTAAYIGQHDLHIGEMTV  243

Query  2403  RETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYII  2224
             RETLAFSARCQGVG+RY+ML+ELSRREK ANI+PDP ID+FMKA +T+GQ+ NV+ DYI+
Sbjct  244   RETLAFSARCQGVGTRYDMLSELSRREKEANIKPDPVIDVFMKAISTEGQEVNVVTDYIL  303

Query  2223  KVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQIL  2044
             K+LGLE C DTIVG+E LRG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTTFQI+
Sbjct  304   KILGLEVCADTIVGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQIV  363

Query  2043  KSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRC  1864
              SIK  IHIL+GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFFE +GF+C
Sbjct  364   NSIKQCIHILNGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLEFFESMGFKC  423

Query  1863  PERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPF  1684
             PERK +ADFLQEVTSRKDQ QYW+RKD +PY F+T+ EFS AFQSF +G+ LGDEL+ PF
Sbjct  424   PERKAIADFLQEVTSRKDQEQYWVRKD-EPYSFITVREFSVAFQSFLVGQKLGDELSIPF  482

Query  1683  QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFI  1504
              KS +HPAALT K YG+ K ELLK+CFSRE LL+KRN  +++F +  +++MALITMT+F+
Sbjct  483   DKSRNHPAALTIKEYGLKKGELLKACFSREYLLIKRNSFVYVFRLTQLIVMALITMTIFL  542

Query  1503  RTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAI  1324
             RT M R+S     +YM +LFF++ ++MF+ + EL+ TI +LP+ YKQRDLLF+PAWA+A+
Sbjct  543   RTKMPRDSVDDGGVYMGALFFSVVMVMFNGMAELSMTIMKLPVVYKQRDLLFFPAWAFAL  602

Query  1323  PTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGR  1144
             PT+IL+IPI  IEV VWVF TYYVIG+DPNF R  + +VLL++  Q+AS LFR  A   R
Sbjct  603   PTWILKIPIAFIEVGVWVFMTYYVIGFDPNFDRFFRQYVLLLLVNQMASALFRFLAAACR  662

Query  1143  SMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN  964
             ++  A  +GSF +L+LF LGGF+LSRDD+KKWWIWGYWISP+MYAQNAI+VNE LGKSW 
Sbjct  663   NLIVANTLGSFALLILFTLGGFVLSRDDIKKWWIWGYWISPMMYAQNAISVNELLGKSWR  722

Query  963   TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRA  784
              VLP S+   GV  LK  G+FP  YWYW+GVGA+ GF +     Y +AL  L PL + +A
Sbjct  723   HVLPNSTVALGVAALKSHGVFPHEYWYWIGVGAMAGFALLFNIFYIVALTYLNPLGKPQA  782

Query  783   NISAESHSNEHD-----------VSNGGSDNSVGE-RVSDGMSNRKHGMILPFEPHSIAF  640
               S +S SNE+D             N  S  +  E R  + + N + GM+LPFEP+SI F
Sbjct  783   VKSEDSQSNENDGRTERTSQLPRSQNSSSQQTKTESRNQEAIRNNRRGMVLPFEPYSITF  842

Query  639   NDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  460
             ++I Y VDMPQEMK +GV +++L LL GVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK
Sbjct  843   DEIIYSVDMPQEMKTQGVVEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  902

Query  459   TGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCET  280
             TGGYIEG++ ISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLPSEV  ET
Sbjct  903   TGGYIEGDVKISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSEVKAET  962

Query  279   RKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGL  100
             RKLFI+EVMEL+EL  LR+ +VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  963   RKLFIEEVMELIELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1022

Query  99    DARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1023  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1055


 Score = 95.5 bits (236),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 100/455 (22%), Positives = 199/455 (44%), Gaps = 76/455 (17%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+        G V  +G+   +    R
Sbjct  867   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDVKISGYPKKQETFAR  925

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +           L    KA              
Sbjct  926   ISGYCEQNDIHSPHVTVHESLLYSAWLR-----------LPSEVKA--------------  960

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L+     +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  961   ------ETRKLFIEEVMELIELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1014

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+   GQ +Y
Sbjct  1015  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGQEIY  1073

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      + G   A ++ E T+   ++   I        F  +
Sbjct  1074  VGPLGRHSCHLIQYFEGIEGVSKIKDGYNPATWMLEATTSAQELSLGI-------DFAQV  1126

Query  1755  NEFSEAFQSFHIGRNLGDELATP--------FQKSTSHPAALTTKTYGVSKMELLKSCFS  1600
              + SE ++     + L  E +TP        F    S P  + T            +C  
Sbjct  1127  YKNSELYRR---NKQLIKEFSTPAPPSKDLYFPTRYSQPFLVQT-----------IACLW  1172

Query  1599  REVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMF  1420
             ++     RN + +   + +  ++AL+  ++F     +          M S++   T ++F
Sbjct  1173  KQHWSYWRNPLYNAVRLLFTTIIALMLGSMFWNLGSKTRRQQDLFNAMGSMY---TAVLF  1229

Query  1419  SALQE---LAPTI-FRLPIFYKQRDLLFYPAWAYA  1327
               +Q    + P +     +FY+++    Y A  YA
Sbjct  1230  LGIQNATSVQPIVAIERTVFYREKAAGMYSALPYA  1264



>ref|XP_003546230.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine 
max]
Length=1427

 Score =  1432 bits (3708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/1052 (65%), Positives = 861/1052 (82%), Gaps = 15/1052 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D    S S R  SS++W N G + F++SSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGSDIYRASNSLRSRSSTVWRNSGVEAFSRSSR----EEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   E+D++++G +E++K+LERL+KV E DNE FLLKLK+R++RV +DIP 
Sbjct  57    RKGLLTASHGVANEIDVSDLGIQERQKLLERLVKVAEEDNERFLLKLKERIDRVGLDIPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVR+EHLN+ AEA+VG RALPS  N   N++EG  + L++ T+KK H +IL+DVSGIIK
Sbjct  117   IEVRYEHLNIEAEAFVGSRALPSFINSVTNVVEGFFNLLHVSTSKKKHVTILKDVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLAL+G+LD +L+ SGRV+YNGHE+NEFVP RTAAYISQHDL
Sbjct  177   PRRMTLLLGPPSSGKTTLLLALSGKLDKTLKVSGRVTYNGHELNEFVPQRTAAYISQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPD+D++MKA AT+GQ++N
Sbjct  237   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATEGQESN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             ++ DY +K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  297   IVTDYTLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++HY+HIL+GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FF
Sbjct  357   STTFQIVSSLRHYVHILNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GFRCPERKGVADFLQEVTS+KDQ QYW+R+D +PYRFVT+ +F+EAFQSFHIG  LG
Sbjct  417   ESMGFRCPERKGVADFLQEVTSKKDQAQYWVRRD-QPYRFVTVTQFAEAFQSFHIGGKLG  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +EL  PF ++ SHPAALTTK YG++K ELLK+ FSRE LLMKRN  +++F++  + +MAL
Sbjct  476   EELTVPFDRTKSHPAALTTKKYGINKKELLKANFSREYLLMKRNSFVYLFKLSQLFIMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             + MTLF+RT M   +   A +Y  ++FF L  +MF+ L E++ TI +LP+FYKQR+LLFY
Sbjct  536   VAMTLFLRTEMHHENMDDAGVYAGAVFFMLITVMFNGLAEISMTIAKLPVFYKQRNLLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IP+T +EV+VWVF TYYVIG+DPN GR  K +++L+I  Q+AS LFR
Sbjct  596   PSWAYAIPSWILKIPVTIVEVAVWVFLTYYVIGFDPNVGRFFKQYLVLLIVSQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   G+F ++ + ALGGFILS+ D+K WWIWGYWISPLMY QNA+ VNE
Sbjct  656   TIAALGRNMIVANTFGAFAIITVVALGGFILSKRDIKSWWIWGYWISPLMYGQNALMVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FL  SW+     ++   GV  L+ R  F ++YWYWLG+GAL+GF      ++ LAL  L 
Sbjct  716   FLSNSWHN----ATHNLGVEYLESRAFFTDSYWYWLGLGALVGFVFLFNVMFGLALEFLG  771

Query  804   PLAQSRANISAESHSNEHDVSN----GGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFN  637
             P  + +A I+ +  SNE  +++    G   +  G+ + +    +K GM+LPFEPHSI F+
Sbjct  772   PFDKPQATITEDESSNEGTLADIELPGIESSGRGDSLVESSHGKKKGMVLPFEPHSITFD  831

Query  636   DIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  457
             ++ Y VDMPQEMK +GV+++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT
Sbjct  832   EVVYSVDMPQEMKEQGVQEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  891

Query  456   GGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETR  277
             GGYI+G I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS V  +TR
Sbjct  892   GGYIDGSIKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSSVDSKTR  951

Query  276   KLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLD  97
             K+FI+EVMELVEL  +R ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  952   KMFIEEVMELVELNPVRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1011

Query  96    ARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1043


 Score =   132 bits (332),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 117/569 (21%), Positives = 247/569 (43%), Gaps = 74/569 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  855   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPKKQETFAR  913

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  914   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  942

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              ++ D +   + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  943   PSSVDSKTRKMFIEEVMELVELNPVRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1002

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1003  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1061

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EVT+   ++   +            
Sbjct  1062  VGPLGRHSSHLIKYFESIEGVSKIKDGYNPATWMLEVTATAQELSLGV------------  1109

Query  1755  NEFSEAFQS---FHIGRNLGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFSREV  1591
              +F++ +++   +   + L  EL  P    K    P       Y  S +   ++C  ++ 
Sbjct  1110  -DFTDLYKNSDLYRRNKQLIQELGQPAPGSKDLHFPT-----QYSQSFLVQCQACLWKQR  1163

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +AL+  T+F     + ++       + S++   T ++F  +
Sbjct  1164  WSYWRNPPYTAVRFFFTTFIALMFGTIFWDLGGKHSTRGDLLNAIGSMY---TAVLFLGV  1220

Query  1410  QE---LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGY  1243
             Q    + P +     +FY+++    Y A  YA    ++ +P   ++   +    Y +IG+
Sbjct  1221  QNASSVQPVVAIERTVFYREKAAGMYSALPYAFAQILVELPYVFVQAVTYGVIVYAMIGF  1280

Query  1242  DPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILS  1069
             +    +    W L  ++  L    F     VG +  +  A +V +    V     GF+++
Sbjct  1281  EWTAEKFF--WYLFFMYFTLLYYTFYGMMTVGLTPNHHIASIVAAAFYAVWNLFSGFVVT  1338

Query  1068  RDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             R  +  WW W YW  P+ +    +  ++F
Sbjct  1339  RPSIPVWWRWYYWACPVAWTIYGLVASQF  1367



>ref|XP_009596530.1| PREDICTED: pleiotropic drug resistance protein 1 [Nicotiana tomentosiformis]
Length=1435

 Score =  1432 bits (3707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/1044 (66%), Positives = 855/1044 (82%), Gaps = 9/1044 (1%)
 Frame = -2

Query  3120  RGRS-GSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLM  2947
             RG + GS R NS+S+W +NG + F++SSR    D+DDE ALKWAAL+K+PTFDRL+KGL+
Sbjct  15    RGSTRGSLRANSNSIWRNNGVEIFSRSSR----DEDDEEALKWAALEKLPTFDRLRKGLL  70

Query  2946  TGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRF  2767
              G +G   EVDIN++G++E+K +LERL+KV + DNE FLLKLK+R++RV ID+P +EVR+
Sbjct  71    FGSQGAAAEVDINDLGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRY  130

Query  2766  EHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMT  2590
             EHLN+ A+AYVG R LP+  NF  N +E LL+ L+ LP+ K+  +IL+D+SGIIKP RMT
Sbjct  131   EHLNIDADAYVGSRGLPTFMNFMTNFVETLLNSLHILPSRKRQLTILKDISGIIKPCRMT  190

Query  2589  LLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEM  2410
             LLLGPPSSGKT+LLLALAG+LDP+L+ +G+VSYNGHE++EFVP RTAAYISQHDLHI EM
Sbjct  191   LLLGPPSSGKTTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEM  250

Query  2409  TARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDY  2230
             T RETL FSARCQGVGSR+EMLAELSRREKAANI+PD DIDI+MKAAAT+GQ+ANV+ DY
Sbjct  251   TVRETLEFSARCQGVGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDY  310

Query  2229  IIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQ  2050
             ++K+LGL+ C DT+VG++ +RG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTT+ 
Sbjct  311   VLKILGLDICADTMVGDDMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTYS  370

Query  2049  ILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGF  1870
             I+ S++  + IL GTAVI+LLQPAPE Y+LFDDIIL+S+G IVYQGP + VLEFFE +GF
Sbjct  371   IVNSLRQSVQILKGTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGF  430

Query  1869  RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELAT  1690
             +CP+RKGVADFLQEVTS+KDQ QYW  K N+ YRF+T  EF+EA++SFH+GR LGDELAT
Sbjct  431   KCPQRKGVADFLQEVTSKKDQQQYW-SKRNERYRFITSKEFAEAYESFHVGRKLGDELAT  489

Query  1689  PFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTL  1510
             PF K+  HPAALT   YG+ K ELLK C  RE+LLMKRN  +++F+   + +MALITMTL
Sbjct  490   PFDKTKCHPAALTNDKYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTL  549

Query  1509  FIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAY  1330
             F RT M R++     IY  +LFF + +IMF+ + ELA TIF+LP+FYKQRDLLF+P+WAY
Sbjct  550   FFRTEMPRDTTDDGGIYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAY  609

Query  1329  AIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVV  1150
             A+P++IL+IP+T +EV +WV  TYYVIG+DPN  R LK ++LLI+  Q+AS LFR    +
Sbjct  610   ALPSWILKIPVTLVEVGLWVILTYYVIGFDPNISRFLKHFLLLIVVNQMASGLFRFIGAM  669

Query  1149  GRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKS  970
             GR+M  A   GSF +L+ FALGGF+LSRDDVK WWIWGYW SP+MY+ N+I VNEF GK 
Sbjct  670   GRTMGVASTFGSFALLLQFALGGFVLSRDDVKSWWIWGYWTSPMMYSVNSILVNEFDGKK  729

Query  969   WNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQS  790
             WN ++   +E  G  V+K RG FPEAYWYW+GVGAL+GFTI   F Y+LALA L P  + 
Sbjct  730   WNHIVSGGNETLGTTVVKSRGFFPEAYWYWIGVGALVGFTIVFNFCYSLALAFLNPFDKP  789

Query  789   RANISAESHSNEH-DVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDM  613
             +A +  +  + E+ +VS+  +    G+ +++  +N K GM+LPFEPHSI F+D+ Y VDM
Sbjct  790   QAVLPEDGENAENVEVSSQITSTDGGDSITESQNNNKKGMVLPFEPHSITFDDVVYSVDM  849

Query  612   PQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEI  433
             PQEMK +G  ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G+I
Sbjct  850   PQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGDI  909

Query  432   TISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVM  253
              ISG+ KKQ+TFARISGYCEQNDIHSP++TVYESL++SAWLRLP  V   TRK+F+ EVM
Sbjct  910   KISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQNVDETTRKMFVDEVM  969

Query  252   ELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM  73
             ELVEL  LR A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM
Sbjct  970   ELVELRPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM  1029

Query  72    RTVRNIVDTGRTIVCTIHQPSIDI  1
             R VRN VDTGRT+VCTIHQPSIDI
Sbjct  1030  RAVRNTVDTGRTVVCTIHQPSIDI  1053


 Score =   138 bits (348),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 127/564 (23%), Positives = 240/564 (43%), Gaps = 64/564 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  865   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGDIKISGYPKKQETFAR  923

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   ++D   +
Sbjct  924   ISGYCEQNDIHSPYVTVYESLVYSAW----------------------LRLPQNVDETTR  961

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                       + VD +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  962   ---------KMFVDEVMELVELRPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1012

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1013  MDEPTSGLDARAAAIVMRAVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1071

Query  1917  QGP-----CNCVLEFFECLGF-RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     C+ +  F    G  +  E    A ++ EVT+   +M   +            
Sbjct  1072  VGPLGRHSCHLIKYFESNPGVAKIKEGYNPATWMLEVTASAQEMMLGV------------  1119

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F++ +++   +   + L  EL  P  +  S      T+ Y  S      +C  ++   
Sbjct  1120  -DFTDVYKNSDLYRRNKALISELGVP--RPGSKDLHFETQ-YSQSFWTQCMACLWKQHWS  1175

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +ALI  T+F     + +        M S++  +  +       
Sbjct  1176  YWRNPAYTAVRFIFTTFIALIFGTMFWDLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASS  1235

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA     + IP   ++   +    Y +IG++ + G
Sbjct  1236  VQPVVAVERTVFYRERAAGMYSAIPYAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVG  1295

Query  1227  RLLKMWVLLIIFRQLASVLFRS--AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVK  1054
             +    W L I+F  L    F    +  V  +   A +V +F   V     GFI+ R  + 
Sbjct  1296  KFF--WYLFIMFFTLLYFTFYGMMSVAVTPNQNVASIVAAFFYGVWNLFSGFIVPRPRMP  1353

Query  1053  KWWIWGYWISPLMYAQNAIAVNEF  982
              WW W YW +P+ +    +  ++F
Sbjct  1354  VWWRWYYWANPVAWTLYGLVASQF  1377



>ref|XP_009335239.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=1433

 Score =  1431 bits (3705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/1057 (66%), Positives = 854/1057 (81%), Gaps = 17/1057 (2%)
 Frame = -2

Query  3138  MEINDSRGRSG-SFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDR  2965
             MEI+    ++G SFR + SS W  NG+  F+ SS      +DDE ALKWAALQ++PTF R
Sbjct  1     MEISCDIQKAGHSFRRSGSSFWIDNGSGVFSTSS----HGEDDEEALKWAALQRLPTFQR  56

Query  2964  LKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIP  2785
             LKKGL+   +GET E+D++N+  +E+K ++ERL+ V E D+E FLL+LK+R++RV I++P
Sbjct  57    LKKGLLATPQGETNEIDVSNLEVKERKNLIERLVGVAEEDHENFLLRLKNRIDRVGINLP  116

Query  2784  KVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGII  2608
             K+EVRF+HL + AEAY G RALP+V N+C+N++EGLL+ ++ LP+ KKH SILRDVSGII
Sbjct  117   KIEVRFQHLKIAAEAYAGSRALPTVFNYCVNLVEGLLNSVHILPSKKKHLSILRDVSGII  176

Query  2607  KPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHD  2428
             +P RMTLLLGPPSSGKT+LLLALAG+LD  L+FSGRV+YNGH M+EFVP RTAAYISQHD
Sbjct  177   RPCRMTLLLGPPSSGKTTLLLALAGELDRDLQFSGRVTYNGHGMHEFVPQRTAAYISQHD  236

Query  2427  LHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKA  2248
             +H+ E+T  ETL FSARCQGVG RYE+L ELSRREK ANI+PD DIDI+MKA A++GQ+ 
Sbjct  237   VHMGELTVGETLNFSARCQGVGDRYEILVELSRREKEANIKPDADIDIYMKAVASEGQRV  296

Query  2247  NVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLD  2068
              V+ DY +K+LGL+GC DT+VG+  +RG+SGG++KRLT GEMLVGPA  L MDEISTGLD
Sbjct  297   QVVTDYTLKILGLDGCADTLVGDNLIRGISGGQKKRLTTGEMLVGPAKALFMDEISTGLD  356

Query  2067  SSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEF  1888
             SSTT+QI+ SIK Y+HIL+GTA I+LLQPAPE Y+LFDDI+L+S+G IVYQGP   VLEF
Sbjct  357   SSTTYQIVNSIKQYVHILNGTAFISLLQPAPETYELFDDIVLLSDGHIVYQGPRENVLEF  416

Query  1887  FECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNL  1708
             FE +GFRCPERKGVADFLQEVTSRKDQ QYW  +D +PYRF+T+ EF EAFQSFH+GR L
Sbjct  417   FESMGFRCPERKGVADFLQEVTSRKDQEQYWASRD-EPYRFITVEEFVEAFQSFHVGRKL  475

Query  1707  GDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMA  1528
              DELATPF K+ SHPAALTTK YGVSK ELLK+CF+RE LLMKRN  +++F++  + ++A
Sbjct  476   RDELATPFDKAKSHPAALTTKRYGVSKTELLKACFAREFLLMKRNSFVYLFKLAQLSILA  535

Query  1527  LITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLF  1348
             +ITMTLF+RT M RNS     IY  +LFF+L  +MF+ L EL+ T+ +LP+FYKQR+LLF
Sbjct  536   MITMTLFLRTEMHRNSVDDGVIYAGALFFSLVAVMFNGLAELSMTVTKLPVFYKQRNLLF  595

Query  1347  YPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF  1168
             +P W Y +P++IL+IPITC+EV VWVF TYYVIGYDPN GRL K W+LL++  Q+AS LF
Sbjct  596   FPPWTYTLPSWILKIPITCVEVVVWVFMTYYVIGYDPNVGRLFKQWLLLLLINQMASGLF  655

Query  1167  RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVN  988
             R  A VGRSMT A   GSF +++LF+LGGF+LSR D+KKWW+WGYWISPLMY QNAI VN
Sbjct  656   RFIAGVGRSMTIASTFGSFALVMLFSLGGFVLSRVDIKKWWMWGYWISPLMYGQNAIVVN  715

Query  987   EFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             EFLGKSW  VLP S+EP GV VLK RG F E  WYW+G G L G+ +   F +TLAL  L
Sbjct  716   EFLGKSWRHVLPNSTEPLGVAVLKSRGFFTEPRWYWIGAGVLAGYMLIFNFFFTLALTYL  775

Query  807   RPLAQSRANISAESHSNEHDVSNGGSDNS--------VGERVSDGMSNRKHGMILPFEPH  652
             +P+ + +A +  E       +S    + S          E  +D   N+K GM+LPFEPH
Sbjct  776   KPIGKPQA-VKLEDPMLTPQISRENGNGSNSSRSSSITKEATNDANGNKKRGMVLPFEPH  834

Query  651   SIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVL  472
             SI F++I Y VDMPQEMK +GV +++L L++ VSGAFRPGVLTALMGVSGAGKTTLMDVL
Sbjct  835   SITFDEITYSVDMPQEMKNQGVPEDKLVLIRRVSGAFRPGVLTALMGVSGAGKTTLMDVL  894

Query  471   AGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEV  292
             AGRKTGGYIEG ITISG+ KKQ++FARISGYCEQNDIHSPH+TVYESL++SAWLRL SE+
Sbjct  895   AGRKTGGYIEGNITISGYPKKQESFARISGYCEQNDIHSPHVTVYESLMYSAWLRLSSEI  954

Query  291   TCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEP  112
               ETRK+F++EVM LVEL  LR+A+VGLPG +GLST QRKRLTIAVELVANPSIIFMDEP
Sbjct  955   DSETRKMFVEEVMGLVELNPLRQALVGLPGASGLSTEQRKRLTIAVELVANPSIIFMDEP  1014

Query  111   TSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             TSGLDARAAAIVMR VRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  TSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDI  1051


 Score =   140 bits (354),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 136/572 (24%), Positives = 256/572 (45%), Gaps = 80/572 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             ++R VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  863   LIRRVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQESFAR  921

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   +ID    
Sbjct  922   ISGYCEQNDIHSPHVTVYESLMYSAW----------------------LRLSSEID----  955

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ ++ ++ L      +VG     G+S  +RKRLT    LV   +++ 
Sbjct  956   -----SETRKMFVEEVMGLVELNPLRQALVGLPGASGLSTEQRKRLTIAVELVANPSIIF  1010

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+ +G Q +Y
Sbjct  1011  MDEPTSGLDARAAAIVMRAVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLKKGGQELY  1069

Query  1917  QGP-----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVT  1759
              GP     CN ++++FE +      R G   A ++ EVTS   ++   I           
Sbjct  1070  VGPLGRHSCN-LIKYFEGIDNVSKIRDGYNPATWMLEVTSSAKEIAMEI-----------  1117

Query  1758  INEFSEAFQSFHIGRN---LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVL  1588
               +F+E ++   + R    L  EL+ P   S S      T+ Y    +    +C  ++  
Sbjct  1118  --DFAEVYKKSELYRRNKALIAELSNP--ASGSKDLHFPTQ-YSQPFLSQCVACLWKQHW  1172

Query  1587  LMKRNCVLHIFEVGWVVLMALITMTLFI----RTNMQRN--SPIGAQIYMSSLFFTLTVI  1426
                RN       + +  ++AL+  T+F     +T  +++  + IG+ +Y + LF  L + 
Sbjct  1173  SYWRNPPYTAIRLIYTTIVALMFGTMFWNLGSKTTKEKDLFNAIGS-MYAAVLF--LGIK  1229

Query  1425  MFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIG  1246
               + +Q +        +FY++R    Y A AYA     + IP   ++  V+    Y +IG
Sbjct  1230  NSTTVQPVVDV--ERTVFYRERAAGMYSALAYAFAQVTIEIPYVFVQALVYSVIVYAMIG  1287

Query  1245  YDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN----AFVVGSFIMLVLFALGGF  1078
             ++    + L  W L  ++     + F    ++G ++T     A +  S    +     GF
Sbjct  1288  FEWTLAKFL--WYLFFMY--FTFLYFTYYGMMGVALTPNQHIAAINSSAFYAIWNVFSGF  1343

Query  1077  ILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             I+ R  +  WW W YW  P+ +    +A ++F
Sbjct  1344  IIPRTRIPIWWRWYYWACPMAWTLYGLATSQF  1375



>ref|NP_001288053.1| ABC transporter-like [Vitis vinifera]
 dbj|BAP11911.1| pleiotropic drug resistance protein [Vitis vinifera]
Length=1450

 Score =  1431 bits (3703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1064 (66%), Positives = 854/1064 (80%), Gaps = 32/1064 (3%)
 Frame = -2

Query  3111  SGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             +GS R N S   S+G D F++SSR    D+DDE ALKWAAL+K+PT++RL+KGL+ G +G
Sbjct  10    AGSLRRNGSMWRSSGADVFSRSSR----DEDDEEALKWAALEKLPTYNRLRKGLLMGSQG  65

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
                EVD++N+G++EK+ ++ERL+K+ E DNE FLL+L++R+ERV I IP++EVRFEHL +
Sbjct  66    AASEVDVDNLGFQEKQSLMERLVKIAEEDNEKFLLRLRNRIERVGITIPEIEVRFEHLTI  125

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEA++G RALPS  NF  N +E  L+ L  L + ++  +IL DVSGIIKP RMTLLLGP
Sbjct  126   DAEAFIGSRALPSFHNFMFNKIEDALTGLRILRSRRRKFTILHDVSGIIKPQRMTLLLGP  185

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             PSSGKT+LLLAL+G+LDP+L+ +GRV+YNGH M+EFVP RTAAYISQHD HI EMT RET
Sbjct  186   PSSGKTTLLLALSGKLDPTLKVTGRVTYNGHGMDEFVPQRTAAYISQHDTHIGEMTVRET  245

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSARCQGVG RY+MLAELSRREKAANI+PDPD+D+FMKAAAT+GQK NV+ DY +K+L
Sbjct  246   LAFSARCQGVGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKENVVTDYTLKIL  305

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GL+ C DT+VG+E +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDSSTTFQI+  +
Sbjct  306   GLDICADTMVGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTFQIVNCL  365

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             K  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+G+I+YQGP   VLEFFE  GFRCPER
Sbjct  366   KQTIHILNGTAVISLLQPAPETYNLFDDIILLSDGRIIYQGPREDVLEFFESTGFRCPER  425

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTS+KDQ QYW RK+ +PYRFVT+ EF+EAFQSFH GR +GDELA+P+ K+
Sbjct  426   KGVADFLQEVTSKKDQQQYWARKE-EPYRFVTVKEFAEAFQSFHTGRKVGDELASPYDKT  484

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SHPAALTTK YGV+K ELL +  SRE LLMKRN  +++F++  + +MA+ITMTLF+RT 
Sbjct  485   KSHPAALTTKKYGVNKKELLDANMSREYLLMKRNSFVYVFKLTQLAIMAVITMTLFLRTE  544

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M +NS     IY  +LFFT+ +IMF+ + ELA  I +LP+FYKQRDLLFYPAWAYA+PT+
Sbjct  545   MHKNSVDDGNIYTGALFFTVVMIMFNGMAELAMAIAKLPVFYKQRDLLFYPAWAYALPTW  604

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             IL+IPIT IEV VWVF TYYVIG+DPN  RL + ++LL++  Q+AS LFR  A  GR+M 
Sbjct  605   ILKIPITFIEVGVWVFMTYYVIGFDPNVERLFRQYLLLLLVNQMASGLFRLIASAGRNMI  664

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              +   G+F++L+L ALGGFILS DDVKKWWIWGYW SPLMYAQNAI VNEFLG SW   +
Sbjct  665   VSNTFGAFVLLMLLALGGFILSHDDVKKWWIWGYWCSPLMYAQNAIVVNEFLGHSWKKNV  724

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
               S+E  GV VL  RG F EAYWYW+G GAL GF +   F YTL L  L P  + +A I 
Sbjct  725   TGSTESLGVTVLNNRGFFTEAYWYWIGAGALFGFILLFNFGYTLCLNFLNPFDKPQAVIV  784

Query  774   AESHSNEH------DVSNGGSDNSV----GERVSDGMS----------------NRKHGM  673
              ES + E          N   D +     GE +   +S                N+K GM
Sbjct  785   EESDNAETGGQIELSQRNSSIDQAASTERGEEIGRSISSTSSAVREEAVAGANHNKKKGM  844

Query  672   ILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGK  493
             +LPF+P+SI F+DI+Y VDMP+EMK +GV +++LELLKGVSGAFRPGVLTALMGVSGAGK
Sbjct  845   VLPFQPYSITFDDIRYSVDMPEEMKSQGVVEDKLELLKGVSGAFRPGVLTALMGVSGAGK  904

Query  492   TTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAW  313
             TTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAW
Sbjct  905   TTLMDVLAGRKTGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAW  964

Query  312   LRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPS  133
             LRLPS+V  ETR++FI+EVMELVELT LR+A+VGLPGV+GLST QRKRLTIAVELVANPS
Sbjct  965   LRLPSDVKSETRQMFIEEVMELVELTPLRDALVGLPGVSGLSTEQRKRLTIAVELVANPS  1024

Query  132   IIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1025  IIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1068


 Score =   119 bits (298),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 119/573 (21%), Positives = 244/573 (43%), Gaps = 82/573 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  880   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  938

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+     
Sbjct  939   ISGYCEQNDIHSPHVTVYESLLYSAW----------------------LRLPSDVK----  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   -----SETRQMFIEEVMELVELTPLRDALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1027

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1028  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGQEIY  1086

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++ +FE +      + G   A ++ E T+   +    +            
Sbjct  1087  VGPLGRYSCHLINYFEGIEGVSKIKDGYNPATWMLEATTAAQEATLGV------------  1134

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMEL-----LKSCFSREV  1591
              +F+E +++  + R   D +     K  S P   T   Y  ++          +C  ++ 
Sbjct  1135  -DFTEIYKNSDLYRRNKDLI-----KELSQPPPGTKDLYFRTQFSQPFFTQFLACLWKQR  1188

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +AL+  T+F     + ++       M S++     ++F  +
Sbjct  1189  WSYWRNPPYTAVRFLFTTFIALMFGTMFWDLGTKWSTQQDLFNAMGSMY---AAVLFLGI  1245

Query  1410  QELAPTIFRL----PIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGY  1243
             Q        +     +FY++R    Y   +YA    ++ IP    +  V+    Y +IG+
Sbjct  1246  QNSQSVQPVVVVERTVFYRERAAGMYSPLSYAFAQALVEIPYIFSQAVVYGLIVYAMIGF  1305

Query  1242  DPNFGRLLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGG  1081
                  +           ++   F  + +V    AA   +++ +      + +  LF+  G
Sbjct  1306  QWTAAKFFWYLFFMFFTLMYFTFYGMMAV----AATPNQNIASIVAAAFYGLWNLFS--G  1359

Query  1080  FILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             FI+ R+ +  WW W YWI P+ +    +  ++F
Sbjct  1360  FIVPRNRIPVWWRWYYWICPVSWTLYGLVTSQF  1392



>ref|XP_008373537.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Malus domestica]
Length=1437

 Score =  1430 bits (3701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/1060 (66%), Positives = 854/1060 (81%), Gaps = 19/1060 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D        ++ SS  W +NG + F++SSR     +D+E ALKWAAL+K+PT++RL
Sbjct  1     MESGDIHRAGNGRQLGSSLRWMNNGMEVFSRSSR----GEDEEVALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KG++T   GE  E+DI N+G++E+K+++ER +K  + DNE FLLKLK+R++RV I +P 
Sbjct  57    RKGILTMPGGEASEIDIPNLGFQERKELIERFLKGNDEDNERFLLKLKNRIDRVGIVLPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVRFE LN+ AE YVG RALP++ NFC+NI+E +L  L + +++K H SIL +VSGIIK
Sbjct  117   IEVRFEQLNIEAETYVGSRALPTLFNFCVNIIEDILIGLRILSSRKTHLSILHNVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLALAG+LDP L+ SGRVSYNGH MNEFVP RTAAYI QHDL
Sbjct  177   PSRMTLLLGPPSSGKTTLLLALAGKLDPDLKLSGRVSYNGHGMNEFVPQRTAAYIGQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+RY+ML+ELSRREK ANI+PDP ID+FMKA +T+GQ+ N
Sbjct  237   HIGEMTVRETLAFSARCQGVGTRYDMLSELSRREKEANIKPDPVIDVFMKAISTEGQEVN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DYI+K+LGLE C DTIVG+E LRG+SGG++KR+T GEMLVGPA  L MDEISTGLDS
Sbjct  297   VVTDYILKILGLEVCADTIVGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ SIK  IHIL+GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFF
Sbjct  357   STTFQIVNSIKQCIHILNGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERK +ADFLQEVTSRKDQ QYW+RKD +PY F+T+ EFS AFQSF +G+ LG
Sbjct  417   ESMGFKCPERKAIADFLQEVTSRKDQEQYWVRKD-EPYSFITVREFSVAFQSFLVGQKLG  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DEL+ PF KS +HPAALT K YG+ K ELLK+CFSRE LL+KRN  +++F +  +++MAL
Sbjct  476   DELSIPFDKSRNHPAALTIKEYGLKKGELLKACFSREYLLIKRNSFVYVFRLTQLIVMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             ITMT+F+RT M R+S     +YM +LFF++ ++MF+ + EL+ TI +LP+ YKQRDLLF+
Sbjct  536   ITMTIFLRTKMPRDSVDDGGVYMGALFFSVVMVMFNGMAELSMTIMKLPVVYKQRDLLFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWA+A+PT+IL+IPI  IEV VWVF TYYVIG+DPNF R  + +VLL++  Q+AS LFR
Sbjct  596   PAWAFALPTWILKIPIAFIEVGVWVFMTYYVIGFDPNFDRFFRQYVLLLLVNQMASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A   R++  A  +GSF +L+LF LGGF+LSRDD+KKWWIWGYWISP+MYAQNAI+VNE
Sbjct  656   FLAAACRNLIVANTLGSFALLILFTLGGFVLSRDDIKKWWIWGYWISPMMYAQNAISVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
              LGKSW  VLP S+   GV  LK  G+FP  YWYW+GVGA+ GF +     Y +AL  L 
Sbjct  716   LLGKSWRHVLPNSTVALGVAALKSHGVFPHEYWYWIGVGAMAGFALLFNIFYIVALTYLN  775

Query  804   PLAQSRANISAESHSNEHD-----------VSNGGSDNSVGE-RVSDGMSNRKHGMILPF  661
             PL + +A  S +S SNE+D             N  S  +  E R  + + N + GM+LPF
Sbjct  776   PLGKPQAVKSEDSQSNENDGRTERTSQLPRSQNSSSQQTKTESRNQEAIRNNRRGMVLPF  835

Query  660   EPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  481
             EP+SI F++I Y VDMPQEMK +GV +++L LL GVSGAFRPGVLTALMGVSGAGKTTLM
Sbjct  836   EPYSITFDEIIYSVDMPQEMKTQGVVEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLM  895

Query  480   DVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLP  301
             DVLAGRKTGGYIEG++ ISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLP
Sbjct  896   DVLAGRKTGGYIEGDVKISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLP  955

Query  300   SEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFM  121
             SEV  ETRKLFI+EVMEL+EL  LR+ +VGLPGVNGLST QRKRLTIAVELVANPSIIFM
Sbjct  956   SEVKAETRKLFIEEVMELIELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1015

Query  120   DEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1055


 Score =   136 bits (342),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 131/574 (23%), Positives = 251/574 (44%), Gaps = 84/574 (15%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+        G V  +G+   +    R
Sbjct  867   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDVKISGYPKKQETFAR  925

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +           L    KA              
Sbjct  926   ISGYCEQNDIHSPHVTVHESLLYSAWLR-----------LPSEVKA--------------  960

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L+     +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  961   ------ETRKLFIEEVMELIELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1014

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1015  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGQEIY  1073

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      + G   A ++ E T+   ++   I        F  +
Sbjct  1074  VGPLGRHSCHLIQYFEGIEGVSKIKDGYNPATWMLEATTSAQELSLGID-------FAQV  1126

Query  1755  NEFSEAFQSFHIGRNLGDELATP--------FQKSTSHPAALTTKTYGVSKMELLKSCFS  1600
              + SE ++     + L  E +TP        F    S P  + T            +C  
Sbjct  1127  YKNSELYRR---NKQLIKEFSTPAPPSKDLYFPTRYSQPFLVQTI-----------ACLW  1172

Query  1599  REVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMF  1420
             ++     RN + +   + +  ++AL+  ++F     +          M S++   T ++F
Sbjct  1173  KQHWSYWRNPLYNAVRLLFTTIIALMLGSMFWNLGSKTRRQQDLFNAMGSMY---TAVLF  1229

Query  1419  SALQE---LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYV  1252
               +Q    + P +     +FY+++    Y A  YA    ++ +P   ++  V+   TY +
Sbjct  1230  LGIQNATSVQPIVAIERTVFYREKAAGMYSALPYAFAQVLIELPYILLQAVVYGVITYVM  1289

Query  1251  IGYDPNFGRLLKMWVLLIIFRQLASVLF---RSAAVVGRSMTNAFVVGSFIMLV-LFALG  1084
             IG+D  F +    W L  ++  L    F    + AV       A V  +F  L  LF+  
Sbjct  1290  IGFDMTFVKFF--WYLFFMYFTLLYFTFYGMMTVAVTPNHHVAAIVSSAFYALWNLFS--  1345

Query  1083  GFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             GFI+ R  +  WW W YW  P+ +    +  ++F
Sbjct  1346  GFIIPRPRIPIWWRWYYWACPVAWTLYGLIASQF  1379



>dbj|BAP90384.1| ATP binding cassette transporter [Lotus japonicus]
Length=1433

 Score =  1429 bits (3699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/1059 (65%), Positives = 854/1059 (81%), Gaps = 22/1059 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D      S R NS+S+W N T + F++SSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGGDIYRAGHSLRANSTSVWRNSTMEAFSRSSR---HEEDDEEALKWAALEKLPTYNRL  57

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+   RG   ++D++++G++E++K+L++LIKV E DNE FLLKLK+R++RV IDIP 
Sbjct  58    RKGLLATSRGAANQIDVSDLGFQERQKLLDKLIKVAEEDNEKFLLKLKERIDRVGIDIPT  117

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVR+EHLNV AEAYVG RALPS  NF  NI+E L + L++ +TKK H +IL+DVSGIIK
Sbjct  118   IEVRYEHLNVEAEAYVGSRALPSFVNFATNIVESLFTSLHILSTKKRHVTILKDVSGIIK  177

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPP SGKT+LLLA++G+LDP+L+ SGRV+YNGHE+NEFVP RTAAYISQHD+
Sbjct  178   PRRMTLLLGPPGSGKTTLLLAMSGKLDPNLKVSGRVTYNGHELNEFVPQRTAAYISQHDV  237

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY++LAELSRREK ANI+PDP +D+FMKAA T GQ+AN
Sbjct  238   HIGEMTVRETLAFSARCQGVGSRYDLLAELSRREKEANIKPDPYLDVFMKAATTGGQEAN  297

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             ++ DY++K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  298   IVTDYVLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  357

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++ Y+HIL+GTAVI+LLQPAPE ++LFDDIILIS+GQIVYQGP   VL+FF
Sbjct  358   STTFQIVSSLRQYVHILNGTAVISLLQPAPETFELFDDIILISDGQIVYQGPREFVLDFF  417

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E LGF+CPERKG ADFLQEVTS+KDQ QYW+R+D +PYRFVT+ +F+EAFQ+FH+GR  G
Sbjct  418   ETLGFKCPERKGAADFLQEVTSKKDQEQYWVRRD-EPYRFVTVTQFAEAFQAFHVGRKSG  476

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DEL  PF KS SHPAAL  K YG++K ELLK+ FSRE LLMKRN  ++IF++  +  MA+
Sbjct  477   DELGIPFDKSKSHPAALVKKQYGINKKELLKANFSREYLLMKRNSFVYIFKICQLTFMAI  536

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             +TMTLF+RT M R+S     ++  +LFF L  IMF+ + E++ +I +LPIFYKQRDLLFY
Sbjct  537   MTMTLFLRTEMHRDSLDDGSVFSGALFFALGTIMFNGMAEISMSIAKLPIFYKQRDLLFY  596

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP +IL+IP+T +EV+VWVF TYYVIG+DPN  R +K + LL++  Q+AS LFR
Sbjct  597   PSWAYAIPNWILKIPVTFVEVAVWVFLTYYVIGFDPNALRFVKQYALLLLVNQMASGLFR  656

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   GSF +L+L  LGGFILSR D+K WWIWGYW SPLMY QNAI  NE
Sbjct  657   AIAALGRNMIVANTFGSFALLMLITLGGFILSRKDIKGWWIWGYWTSPLMYGQNAIMTNE  716

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG SW+     S++  G+  L+ RG F  AYWYW+G+GAL GF      IYTLAL  L 
Sbjct  717   FLGNSWSHFTKNSNKSLGLQALESRGFFTHAYWYWIGIGALTGFMFLYNIIYTLALTFLN  776

Query  804   PLAQSRANISAESHSNEHD-----------VSNGGSDNSVGERVSDGMSNRKHGMILPFE  658
             P  +++A I+ ES  N  +            S+G +D++V     D    RK GM+LPFE
Sbjct  777   PFDKAQATINEESEDNTPNGRAPEVELPRIESSGNADSAV-----DSSHGRKRGMVLPFE  831

Query  657   PHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMD  478
             PHSIAF+D+ Y VDMPQEM+ +GV ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMD
Sbjct  832   PHSIAFDDVVYSVDMPQEMRDQGVMEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMD  891

Query  477   VLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPS  298
             VLAGRKTGG+I+G + +SG+ K Q+TFARISGYCEQNDIHSP +TVYESL++SAWLRLP+
Sbjct  892   VLAGRKTGGHIDGSVKVSGYPKNQETFARISGYCEQNDIHSPQVTVYESLLYSAWLRLPA  951

Query  297   EVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMD  118
             EV   TRK FI+EV+ELVEL  LR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMD
Sbjct  952   EVDSNTRKTFIEEVIELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMD  1011

Query  117   EPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             EPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  EPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1050


 Score =   127 bits (320),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 128/570 (22%), Positives = 244/570 (43%), Gaps = 76/570 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G V  +G+  N+    R
Sbjct  862   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGR-KTGGHIDGSVKVSGYPKNQETFAR  920

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P++T  E+L +SA  +                                
Sbjct  921   ISGYCEQNDIHSPQVTVYESLLYSAWLR-------------------------------L  949

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              A  D       ++ +I+++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  950   PAEVDSNTRKTFIEEVIELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1009

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1010  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1068

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   +              VTI
Sbjct  1069  VGPLGRHSSKLIEYFESIEGVNKIKDGYNPATWMLEVTSSAQE--------------VTI  1114

Query  1755  N-EFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVL  1588
               +F + +++   +   + L  EL  P     S+     T+ Y  S +    +C  ++  
Sbjct  1115  GVDFHQTYKNSELYRRNKQLIAELGIP--APGSNDLYFPTQ-YSQSFLVQCLACLWKQHW  1171

Query  1587  LMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQ  1408
                RN         +   +ALI  T+F     +  +    Q   ++L    T ++F  +Q
Sbjct  1172  SYWRNPPYTAVRFFFTTFIALIFGTMFWDLGGKYKN---RQDLFNALGSMYTAVLFLGIQ  1228

Query  1407  ELA---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYD  1240
               A   P +     +FY++R    Y A  YA+   I+ IP    +   +    Y ++G++
Sbjct  1229  NSASVQPVVAVERTVFYRERAAGMYSALPYALAQVIIEIPYVFAQALSYGLIVYAMMGFE  1288

Query  1239  PNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFIL  1072
                 +        + F       F    ++  ++T    V S +    +A+     GF++
Sbjct  1289  WTVEKFFWY----LFFMFFTLCYFTYYGMMTVAVTPNHHVASIVAAAFYAIWNLFSGFVV  1344

Query  1071  SRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              R  +  WW W YW  P+ +    +  ++F
Sbjct  1345  PRPRIPVWWRWYYWACPVAWTIYGMVASQF  1374



>ref|XP_010254256.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nelumbo 
nucifera]
Length=1454

 Score =  1429 bits (3699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1070 (66%), Positives = 860/1070 (80%), Gaps = 37/1070 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLR  2935
             +  S R NSS   ++  + F++SSR    ++DDE ALKWAAL+K+PT++RL+KG++ G  
Sbjct  8     KVSSLRRNSSVWRNSAVEVFSRSSR----EEDDEEALKWAALEKLPTYNRLRKGILIGAG  63

Query  2934  GETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLN  2755
              E  E+DI ++G +EKK +L+RL++V E DNE FL KLK+R++RV IDIP +EVRFEHL+
Sbjct  64    SELSEIDIGSLGIQEKKDLLDRLVRVAEEDNEKFLSKLKNRIDRVGIDIPTIEVRFEHLS  123

Query  2754  VGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIKPGRMTLLLG  2578
             + A+AYVG RALP++ NF +NI+EGLL++L+L P+ KK  SIL+DVSGIIKP RM LLLG
Sbjct  124   INADAYVGSRALPTILNFSVNIVEGLLNHLHLLPSRKKPFSILQDVSGIIKPSRMALLLG  183

Query  2577  PPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARE  2398
             PPSSGKT+LLLALAG+LDP L+ SGRV+YNGH ++EFVP RT+AYISQHDLHI EMT RE
Sbjct  184   PPSSGKTTLLLALAGKLDPDLKVSGRVTYNGHGLDEFVPQRTSAYISQHDLHIGEMTVRE  243

Query  2397  TLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKV  2218
             TLAFSARCQGVG+ YEML EL+RREKAANI+PDPDID++MKA++ +GQ+A+V+ DYI+K+
Sbjct  244   TLAFSARCQGVGTGYEMLVELARREKAANIKPDPDIDVYMKASSLEGQEASVVTDYILKI  303

Query  2217  LGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKS  2038
             LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTTFQI+ S
Sbjct  304   LGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNS  363

Query  2037  IKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPE  1858
             ++  IHIL+GTAVI+LLQPAPE YDLFDDIIL+S+G+IVYQGP   VLEFFE +GF+CPE
Sbjct  364   LRQSIHILNGTAVISLLQPAPETYDLFDDIILLSDGEIVYQGPRENVLEFFESMGFKCPE  423

Query  1857  RKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQK  1678
             RKGVADFLQEVTS+KDQ QYW RKD  PY FV+  EF+EAF SFH+G+ L +ELATPF K
Sbjct  424   RKGVADFLQEVTSKKDQKQYWARKD-VPYSFVSAKEFAEAFHSFHVGKKLEEELATPFDK  482

Query  1677  STSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRT  1498
             + SHPAAL+TK YGVSK ELLK+C SRE LLMKRN  ++IF++  + ++ALITMT+F+RT
Sbjct  483   TKSHPAALSTKKYGVSKKELLKACSSREFLLMKRNSFVYIFKMTQLTIVALITMTIFLRT  542

Query  1497  NMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPT  1318
              M R     A I+M +LFFTL +IMF+   E+A TI +LP+FYKQRDLLF+PAWAY++PT
Sbjct  543   KMHRRDDTDAGIFMGALFFTLIMIMFNGFSEMAMTIQKLPVFYKQRDLLFFPAWAYSLPT  602

Query  1317  FILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSM  1138
             +IL+IPI+ +EV+VWVF TYYVIG+DPN  RL + + LL++  Q+AS LFR    VGR+M
Sbjct  603   WILKIPISFMEVAVWVFITYYVIGFDPNVERLFRQYFLLLLVNQVASALFRFIGSVGRNM  662

Query  1137  TNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTV  958
               A   GSF +L +  LGGFILSR++VKKWWIWGYW+SPLMY QNA+AVNEFLGKSW  V
Sbjct  663   IVANTFGSFSLLAVLVLGGFILSRENVKKWWIWGYWVSPLMYGQNALAVNEFLGKSWRHV  722

Query  957   LPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANI  778
                 +E  GV  +K RG F EA WYW+GVGA+IG+     F++T+AL  L P  + +A I
Sbjct  723   PLNKTETLGVSAIKSRGFFAEARWYWIGVGAMIGYIFLFNFLFTVALTYLNPFEKPQAVI  782

Query  777   SAESHSN---------EHDVSNGGSD---NSVGER-------VSDGMS------------  691
             S E+ SN         E   S G S     + GER       VS G S            
Sbjct  783   SEETLSNKDTSRTREVEGSSSQGMSSTGRTTSGERQDEIRRSVSSGFSSVRAETIDEVNE  842

Query  690   NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMG  511
             N + GM+LPF+P SI F++I+Y VDMPQEMK +GV ++RLELLKGVSGAFRPGVLTALMG
Sbjct  843   NTRRGMVLPFQPLSITFDEIRYSVDMPQEMKNQGVTEDRLELLKGVSGAFRPGVLTALMG  902

Query  510   VSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYES  331
             VSGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQNDIHSP++TVYES
Sbjct  903   VSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPYVTVYES  962

Query  330   LIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVE  151
             L++SAWLRLP +V   TRK+F++EVMELVEL SLREA+VGLPGVNGLST QRKRLTIAVE
Sbjct  963   LLYSAWLRLPPDVDSSTRKMFVEEVMELVELNSLREALVGLPGVNGLSTEQRKRLTIAVE  1022

Query  150   LVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             LVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1023  LVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1072


 Score =   149 bits (376),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 152/634 (24%), Positives = 283/634 (45%), Gaps = 87/634 (14%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   
Sbjct  878   TEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKK  936

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R + Y  Q+D+H P +T  E+L +SA                       +R  PD
Sbjct  937   QETFARISGYCEQNDIHSPYVTVYESLLYSAW----------------------LRLPPD  974

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
             +D              + V+ +++++ L    + +VG   + G+S  +RKRLT    LV 
Sbjct  975   VD---------SSTRKMFVEEVMELVELNSLREALVGLPGVNGLSTEQRKRLTIAVELVA  1025

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  
Sbjct  1026  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKR  1084

Query  1932  G-QIVYQGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKP  1774
             G Q +Y GP    +C ++++FE +      + G   A ++ EVT+   +    +      
Sbjct  1085  GGQEIYVGPLGHHSCHLIKYFEGIEGVSKIKDGYNPATWMLEVTTTAQEEILGVD-----  1139

Query  1773  YRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSRE  1594
               F  + + SE ++     ++L +EL+TP     S      TK Y    +    +C  ++
Sbjct  1140  --FTEVYKRSELYRR---NKSLIEELSTP--SPGSKDLYFPTK-YSQPFITQCMACLWKQ  1191

Query  1593  VLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRN------SPIGAQIYMSSLFFTLT  1432
              L   RN         +   +AL+  T+F     +R       + IG+ +Y + LF  L 
Sbjct  1192  HLSYWRNPSYTAVRFLFTTFIALMFGTIFWDLGSKRGRKQDLINAIGS-MYAAVLF--LG  1248

Query  1431  VIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYV  1252
             V   SA+Q +        +FY+++    Y A  YA    ++ +P   ++ SV+    Y +
Sbjct  1249  VQNSSAVQPVVAV--ERTVFYREKAAGMYSALPYAYAQVMIELPHIFVQASVYGVIVYAM  1306

Query  1251  IGYDPNFGRLLKMWVLLIIFRQLASVLFRS--AAVVGRSMTNAFVVGSFIMLVLFALGGF  1078
             IG++    +    W +  ++  L    F    A  V  +   A +V S   L+     GF
Sbjct  1307  IGFEWTAAKFF--WHIFFMYFTLLYFTFYGMMAVAVTPNHNIAAIVSSAFYLIWNLFSGF  1364

Query  1077  ILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLVLKY  913
             I+ R  +  WW W YW  P+ +    ++V++F        +  TV  +  E FG      
Sbjct  1365  IVPRTRIPVWWRWYYWACPVAWTLYGLSVSQFGDIEDRLDTGETVESYLREYFG------  1418

Query  912   RGLFPEAYWYWLGVGA--LIGFTIFSIFIYTLAL  817
                F   +   LGV A  ++GFT+  +FI+  ++
Sbjct  1419  ---FKHDF---LGVVAAVIVGFTVLFVFIFAFSI  1446



>ref|XP_008373544.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Malus domestica]
Length=1432

 Score =  1429 bits (3699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/1060 (66%), Positives = 854/1060 (81%), Gaps = 19/1060 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D        ++ SS  W +NG + F++SSR     +D+E ALKWAAL+K+PT++RL
Sbjct  1     MESGDIHRAGNGRQLGSSLRWMNNGMEVFSRSSR----GEDEEVALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KG++T   GE  E+DI N+G++E+K+++ER +K  + DNE FLLKLK+R++RV I +P 
Sbjct  57    RKGILTMPGGEASEIDIPNLGFQERKELIERFLKGNDEDNERFLLKLKNRIDRVGIVLPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVRFE LN+ AE YVG RALP++ NFC+NI+E +L  L + +++K H SIL +VSGIIK
Sbjct  117   IEVRFEQLNIEAETYVGSRALPTLFNFCVNIIEDILIGLRILSSRKTHLSILHNVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLALAG+LDP L+ SGRVSYNGH MNEFVP RTAAYI QHDL
Sbjct  177   PSRMTLLLGPPSSGKTTLLLALAGKLDPDLKLSGRVSYNGHGMNEFVPQRTAAYIGQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+RY+ML+ELSRREK ANI+PDP ID+FMKA +T+GQ+ N
Sbjct  237   HIGEMTVRETLAFSARCQGVGTRYDMLSELSRREKEANIKPDPVIDVFMKAISTEGQEVN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DYI+K+LGLE C DTIVG+E LRG+SGG++KR+T GEMLVGPA  L MDEISTGLDS
Sbjct  297   VVTDYILKILGLEVCADTIVGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ SIK  IHIL+GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFF
Sbjct  357   STTFQIVNSIKQCIHILNGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERK +ADFLQEVTSRKDQ QYW+RKD +PY F+T+ EFS AFQSF +G+ LG
Sbjct  417   ESMGFKCPERKAIADFLQEVTSRKDQEQYWVRKD-EPYSFITVREFSVAFQSFLVGQKLG  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DEL+ PF KS +HPAALT K YG+ K ELLK+CFSRE LL+KRN  +++F +  +++MAL
Sbjct  476   DELSIPFDKSRNHPAALTIKEYGLKKGELLKACFSREYLLIKRNSFVYVFRLTQLIVMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             ITMT+F+RT M R+S     +YM +LFF++ ++MF+ + EL+ TI +LP+ YKQRDLLF+
Sbjct  536   ITMTIFLRTKMPRDSVDDGGVYMGALFFSVVMVMFNGMAELSMTIMKLPVVYKQRDLLFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWA+A+PT+IL+IPI  IEV VWVF TYYVIG+DPNF R  + +VLL++  Q+AS LFR
Sbjct  596   PAWAFALPTWILKIPIAFIEVGVWVFMTYYVIGFDPNFDRFFRQYVLLLLVNQMASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A   R++  A  +GSF +L+LF LGGF+LSRDD+KKWWIWGYWISP+MYAQNAI+VNE
Sbjct  656   FLAAACRNLIVANTLGSFALLILFTLGGFVLSRDDIKKWWIWGYWISPMMYAQNAISVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
              LGKSW  VLP S+   GV  LK  G+FP  YWYW+GVGA+ GF +     Y +AL  L 
Sbjct  716   LLGKSWRHVLPNSTVALGVAALKSHGVFPHEYWYWIGVGAMAGFALLFNIFYIVALTYLN  775

Query  804   PLAQSRANISAESHSNEHD-----------VSNGGSDNSVGE-RVSDGMSNRKHGMILPF  661
             PL + +A  S +S SNE+D             N  S  +  E R  + + N + GM+LPF
Sbjct  776   PLGKPQAVKSEDSQSNENDGRTERTSQLPRSQNSSSQQTKTESRNQEAIRNNRRGMVLPF  835

Query  660   EPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  481
             EP+SI F++I Y VDMPQEMK +GV +++L LL GVSGAFRPGVLTALMGVSGAGKTTLM
Sbjct  836   EPYSITFDEIIYSVDMPQEMKTQGVVEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLM  895

Query  480   DVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLP  301
             DVLAGRKTGGYIEG++ ISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLP
Sbjct  896   DVLAGRKTGGYIEGDVKISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLP  955

Query  300   SEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFM  121
             SEV  ETRKLFI+EVMEL+EL  LR+ +VGLPGVNGLST QRKRLTIAVELVANPSIIFM
Sbjct  956   SEVKAETRKLFIEEVMELIELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1015

Query  120   DEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1055


 Score =   130 bits (328),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 130/573 (23%), Positives = 247/573 (43%), Gaps = 87/573 (15%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+        G V  +G+   +    R
Sbjct  867   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDVKISGYPKKQETFAR  925

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +           L    KA              
Sbjct  926   ISGYCEQNDIHSPHVTVHESLLYSAWLR-----------LPSEVKA--------------  960

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L+     +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  961   ------ETRKLFIEEVMELIELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1014

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQ  1915
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+      GQ +Y 
Sbjct  1015  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDE----RGGQEIYV  1069

Query  1914  GPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTIN  1753
             GP    +C ++++FE +      + G   A ++ E T+   ++   I        F  + 
Sbjct  1070  GPLGRHSCHLIQYFEGIEGVSKIKDGYNPATWMLEATTSAQELSLGID-------FAQVY  1122

Query  1752  EFSEAFQSFHIGRNLGDELATP--------FQKSTSHPAALTTKTYGVSKMELLKSCFSR  1597
             + SE ++     + L  E +TP        F    S P  + T            +C  +
Sbjct  1123  KNSELYRR---NKQLIKEFSTPAPPSKDLYFPTRYSQPFLVQTI-----------ACLWK  1168

Query  1596  EVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFS  1417
             +     RN + +   + +  ++AL+  ++F     +          M S++   T ++F 
Sbjct  1169  QHWSYWRNPLYNAVRLLFTTIIALMLGSMFWNLGSKTRRQQDLFNAMGSMY---TAVLFL  1225

Query  1416  ALQE---LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVI  1249
              +Q    + P +     +FY+++    Y A  YA    ++ +P   ++  V+   TY +I
Sbjct  1226  GIQNATSVQPIVAIERTVFYREKAAGMYSALPYAFAQVLIELPYILLQAVVYGVITYVMI  1285

Query  1248  GYDPNFGRLLKMWVLLIIFRQLASVLF---RSAAVVGRSMTNAFVVGSFIMLV-LFALGG  1081
             G+D  F +    W L  ++  L    F    + AV       A V  +F  L  LF+  G
Sbjct  1286  GFDMTFVKFF--WYLFFMYFTLLYFTFYGMMTVAVTPNHHVAAIVSSAFYALWNLFS--G  1341

Query  1080  FILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             FI+ R  +  WW W YW  P+ +    +  ++F
Sbjct  1342  FIIPRPRIPIWWRWYYWACPVAWTLYGLIASQF  1374



>gb|KCW59818.1| hypothetical protein EUGRSUZ_H02563 [Eucalyptus grandis]
Length=1421

 Score =  1429 bits (3699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/1042 (67%), Positives = 845/1042 (81%), Gaps = 27/1042 (3%)
 Frame = -2

Query  3063  DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRGETFEVDINNIGYeekk  2884
             D F++SSR    D+DDE AL+WAAL+K+PTF+RL+KG+MT   G   ++DI N+G+ ++K
Sbjct  3     DVFSRSSR----DEDDEEALRWAALEKLPTFERLQKGIMTAGGGAN-QIDIWNLGFHDRK  57

Query  2883  kilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNVGAEAYVGKRALPSVTN  2704
             ++LERL++V E DNE FLLKL++R++RV ID+P +EVRFEHL V AEA+ G RALP+V N
Sbjct  58    RLLERLVRVIEEDNEGFLLKLRNRIDRVGIDLPTIEVRFEHLKVEAEAHEGSRALPTVIN  117

Query  2703  FCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQL  2527
             FC +ILEG L++L+ LP+ KKH +IL+DVSGIIKPGRMTLLLGPPSSGKT+LLLALAG+L
Sbjct  118   FCTSILEGFLNFLHVLPSRKKHLTILQDVSGIIKPGRMTLLLGPPSSGKTTLLLALAGKL  177

Query  2526  DPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEM  2347
             DP L+ +GRV+YNGH MNEFVP RTAAYISQHDLHI EMT RETLAFSARCQGVGSRY+M
Sbjct  178   DPELKMTGRVTYNGHVMNEFVPQRTAAYISQHDLHIGEMTVRETLAFSARCQGVGSRYDM  237

Query  2346  LAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLR  2167
             L ELSRREKAANI+PDPDIDIFMKAA T+GQ+ANV+ DYI+K+LGLE C D +VG+E LR
Sbjct  238   LLELSRREKAANIKPDPDIDIFMKAAVTEGQEANVVTDYILKILGLEICADVMVGDEMLR  297

Query  2166  GMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALL  1987
             G+SGG+RKR+T GEMLVGPA V LMDEISTGLDSSTT+QI+  +K +IHIL GTAVI+LL
Sbjct  298   GISGGQRKRVTTGEMLVGPAEVFLMDEISTGLDSSTTYQIVNFLKQFIHILDGTAVISLL  357

Query  1986  QPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQ  1807
             QPAPE YDLFDDIIL+S+GQIVYQGP   VL+FFE +GF+CP RKGVADFLQEVTSRKDQ
Sbjct  358   QPAPETYDLFDDIILLSDGQIVYQGPRELVLDFFESMGFKCPRRKGVADFLQEVTSRKDQ  417

Query  1806  MQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSK  1627
              QYW+RKD +PY FVT+ EF EAFQSFH+GR LGDEL+TPF KS +HPAALTTK +GV  
Sbjct  418   HQYWVRKD-EPYTFVTVREFVEAFQSFHVGRKLGDELSTPFDKSKNHPAALTTKRFGVGM  476

Query  1626  MELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSL  1447
              +LLK+C  RE LLMKRN  ++IF+V  +++MA I+MTLF+RT M R++     +Y+ +L
Sbjct  477   KDLLKACILREYLLMKRNSFVYIFKVTQLIIMAFISMTLFLRTKMHRDTVTDGGVYIGAL  536

Query  1446  FFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVF  1267
             FFT+  IMF+ + E++ TI +LPIFYKQRDLLFYPAWAYA+P++IL+IPIT +EV+ WVF
Sbjct  537   FFTVITIMFNGMAEISMTIAKLPIFYKQRDLLFYPAWAYALPSWILKIPITFVEVAAWVF  596

Query  1266  STYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL  1087
             +TYYVIGYDPN GRL K ++LL+   Q++S LFR  A +GR++  A   G+F++L L A+
Sbjct  597   TTYYVIGYDPNVGRLFKQYLLLVAINQMSSGLFRLIAALGRNLIVANTFGTFVLLALVAM  656

Query  1086  GGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSS--EPFGVLVLKY  913
             GG +LSR+DV KWWIWGYW SPLMY QNAI VNE LG +WN + P SS  EP G+ VLK 
Sbjct  657   GGVVLSREDVNKWWIWGYWTSPLMYGQNAIVVNELLGSNWNKIPPNSSTNEPLGIQVLKS  716

Query  912   RGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANISAESHSNEHDVSNGG  733
             RG F EAYWYW+G+GAL GF I   F +++ALA L P  +S    S +   N++     G
Sbjct  717   RGFFTEAYWYWIGLGALFGFIILFNFGFSVALALLNPFGKSHTVKSDDPEGNKNVDRIEG  776

Query  732   SD--NSVGERVSDG----------------MSNRKHGMILPFEPHSIAFNDIKYCVDMPQ  607
             S    S G  + +G                 +N K GM+LPFEPHSI F++I Y VDMP+
Sbjct  777   SIQLQSRGSSLRNGSGRSSKLTPPWPETAVAANTKRGMVLPFEPHSITFDEITYSVDMPR  836

Query  606   EMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITI  427
             EM  +G  ++RL LLKG SG+FRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G ITI
Sbjct  837   EMTNQGAPEDRLVLLKGASGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIKGNITI  896

Query  426   SGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMEL  247
             SG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+SAWLRLP  V  +TRKLF++EVMEL
Sbjct  897   SGYPKNQDTFARISGYCEQNDIHSPHVTVYESLIYSAWLRLPPGVDDQTRKLFVEEVMEL  956

Query  246   VELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRT  67
             VEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRT
Sbjct  957   VELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRT  1016

Query  66    VRNIVDTGRTIVCTIHQPSIDI  1
             VRN VDTGRT+VCTIHQPSIDI
Sbjct  1017  VRNTVDTGRTVVCTIHQPSIDI  1038


 Score =   145 bits (367),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 144/634 (23%), Positives = 275/634 (43%), Gaps = 92/634 (15%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+  SG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  850   LLKGASGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IKGNITISGYPKNQDTFAR  908

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  909   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  942

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  943   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  997

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  998   MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1056

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1057  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPAQELALGV------------  1104

Query  1755  NEFSEAFQS---FHIGRNLGDELAT--PFQKSTSHPAALTTKTYGVSKMELLKSCFSREV  1591
              +FS+ +++   +   + L +EL+   P  K    P       Y  S    L +C  ++ 
Sbjct  1105  -DFSDLYKNSDLYRRNKALIEELSISPPNSKDLYFPTK-----YSQSTFTQLMACLWKQH  1158

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         + + +AL+  T+F     +          M S++  L  + F   
Sbjct  1159  WSYWRNPPYTAVRFLFTISIALMFGTMFWDLGSKTTRSQDLFNAMGSMYAALVFLGFQNA  1218

Query  1410  QELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
               + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+   
Sbjct  1219  SSVQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLVQAISYGIIVYAMIGFKWT  1278

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSR  1066
               +        + F+    + F    ++   MT    + S + L  +AL     GF++ R
Sbjct  1279  VAKFFWY----LFFKFFTLLYFTYYGMMAVGMTPNHHIASIVSLAFYALWNLFSGFVVPR  1334

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGL  904
               +  WW W YW+ P+ +    + V++F      L  + +TV  +  + FG     YR  
Sbjct  1335  TKIPIWWRWFYWVCPVSWTLYGLVVSQFGDLTNTLEDTGDTVEEYMRDYFG-----YRHD  1389

Query  903   FPEAYWYWLGVGA--LIGFTIFSIFIYTLALAKL  808
             F       LGV A  +IGFT+   F++ +++  L
Sbjct  1390  F-------LGVIAAMVIGFTMLFAFVFAISIKIL  1416



>gb|KHN22481.1| Pleiotropic drug resistance protein 1 [Glycine soja]
Length=1427

 Score =  1429 bits (3698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/1052 (65%), Positives = 860/1052 (82%), Gaps = 15/1052 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D    S S R  SS++W N G + F++SSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGSDIYRASNSLRSRSSTVWRNSGVEAFSRSSR----EEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   E+D++++G +E++K+LERL+KV E DNE FLLKLK+R++RV +DIP 
Sbjct  57    RKGLLTASHGVANEIDVSDLGIQERQKLLERLVKVAEEDNERFLLKLKERIDRVGLDIPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVR+EHLN+ AEA+VG RALPS  N   N++EG  + L++ T+KK H +IL+DVSGIIK
Sbjct  117   IEVRYEHLNIEAEAFVGSRALPSFINSVTNVVEGFFNLLHVSTSKKKHVTILKDVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLAL+G+LD +L+ SGRV+YNGHE+NEFVP RTAAYISQHDL
Sbjct  177   PRRMTLLLGPPSSGKTTLLLALSGKLDKTLKVSGRVTYNGHELNEFVPQRTAAYISQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPD+D++MKA AT+GQ++N
Sbjct  237   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATEGQESN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             ++ DY +K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  297   IVTDYTLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++HY+HIL+GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FF
Sbjct  357   STTFQIVSSLRHYVHILNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GFRCPERKGVADFLQEVTS+KDQ QYW+R+D +PYRFVT+ +F+EAFQSFHIG  LG
Sbjct  417   ESMGFRCPERKGVADFLQEVTSKKDQAQYWVRRD-QPYRFVTVTQFAEAFQSFHIGGKLG  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +EL  PF ++ SHPAALTTK YG++K ELLK+ FSRE LLMKRN  +++F++  + +MAL
Sbjct  476   EELTVPFDRTKSHPAALTTKKYGINKKELLKANFSREYLLMKRNSFVYLFKLSQLFIMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             + MTLF+RT M   +   A +Y  ++FF L  +MF+ L E++ TI +LP+FYKQR+LLFY
Sbjct  536   VAMTLFLRTEMHHENMDDAGVYAGAVFFMLITVMFNGLAEISMTIAKLPVFYKQRNLLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IP+T +EV+VWVF TYYVIG+DPN GR  K +++L+I  Q+AS LFR
Sbjct  596   PSWAYAIPSWILKIPVTIVEVAVWVFLTYYVIGFDPNVGRFFKQYLVLLIVSQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   G+F ++ + ALGGFILS+ D+K WWIWGYWISPLMY QNA+ VNE
Sbjct  656   TIAALGRNMIVANTFGAFAIITVVALGGFILSKRDIKSWWIWGYWISPLMYGQNALMVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FL  SW+     ++   GV  L+ R  F ++YWYWLG+GAL+GF      ++ LAL  L 
Sbjct  716   FLSNSWHN----ATHNLGVEYLESRAFFTDSYWYWLGLGALVGFVFLFNVMFGLALEFLG  771

Query  804   PLAQSRANISAESHSNEHDVSN----GGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFN  637
             P  + +A I+ +  SNE  +++    G   +  G+ + +    +K GM+LPFEPHSI F+
Sbjct  772   PFDKPQATITEDESSNEGTLADIELPGIESSGRGDSLVESSHGKKKGMVLPFEPHSITFD  831

Query  636   DIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  457
             ++ Y VDMPQEMK +GV+++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT
Sbjct  832   EVVYSVDMPQEMKEQGVQEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  891

Query  456   GGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETR  277
             GGYI+G I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS V  +TR
Sbjct  892   GGYIDGSIKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSSVDSKTR  951

Query  276   KLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLD  97
             K+FI+EVMELVEL  +R ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  952   KMFIEEVMELVELNPVRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1011

Query  96    ARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ARAAAIVMRTV N VDTGRT+VCTIHQPSIDI
Sbjct  1012  ARAAAIVMRTVGNTVDTGRTVVCTIHQPSIDI  1043


 Score =   130 bits (328),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 117/569 (21%), Positives = 246/569 (43%), Gaps = 74/569 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  855   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPKKQETFAR  913

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  914   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  942

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              ++ D +   + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  943   PSSVDSKTRKMFIEEVMELVELNPVRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1002

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++ + +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1003  MDEPTSGLDARAAAIVMRTVGNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1061

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EVT+   ++   +            
Sbjct  1062  VGPLGRHSSHLIKYFESIEGVSKIKDGYNPATWMLEVTATAQELSLGV------------  1109

Query  1755  NEFSEAFQS---FHIGRNLGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFSREV  1591
              +F++ +++   +   + L  EL  P    K    P       Y  S +   ++C  ++ 
Sbjct  1110  -DFTDLYKNSDLYRRNKQLIQELGQPAPGSKDLHFPT-----QYSQSFLVQCQACLWKQR  1163

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +AL+  T+F     + ++       + S++   T ++F  +
Sbjct  1164  WSYWRNPPYTAVRFFFTTFIALMFGTIFWDLGGKHSTRGDLLNAIGSMY---TAVLFLGV  1220

Query  1410  QE---LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGY  1243
             Q    + P +     +FY+++    Y A  YA    ++ +P   ++   +    Y +IG+
Sbjct  1221  QNASSVQPVVAIERTVFYREKAAGMYSALPYAFAQILVELPYVFVQAVTYGVIVYAMIGF  1280

Query  1242  DPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILS  1069
             +    +    W L  ++  L    F     VG +  +  A +V +    V     GF+++
Sbjct  1281  EWTAEKFF--WYLFFMYFTLLYYTFYGMMTVGLTPNHHIASIVAAAFYAVWNLFSGFVVT  1338

Query  1068  RDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             R  +  WW W YW  P+ +    +  ++F
Sbjct  1339  RPSIPVWWRWYYWACPVAWTIYGLVASQF  1367



>ref|XP_008358474.1| PREDICTED: pleiotropic drug resistance protein 1-like [Malus 
domestica]
Length=1433

 Score =  1428 bits (3696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/1056 (67%), Positives = 852/1056 (81%), Gaps = 15/1056 (1%)
 Frame = -2

Query  3138  MEINDSRGRSG-SFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDR  2965
             MEI+    ++G SFR + SS W  NG+  F+ SS      +DDE ALKWAALQ++PTF R
Sbjct  1     MEISCDIQKAGHSFRRSGSSFWIDNGSGVFSTSS----HGEDDEEALKWAALQRLPTFQR  56

Query  2964  LKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIP  2785
             LKKGL+   +GET EVD++N+  +E+K ++ERL+ V E D+E FLL+LK+R++RV I+ P
Sbjct  57    LKKGLLATPQGETNEVDVSNLEVKERKNLIERLVGVAEEDHENFLLRLKNRIDRVGINXP  116

Query  2784  KVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGII  2608
             K+EVR   L +  EAY G RALP+V N+C+N++EGLL+ ++ LP+ KKH SIL+DVSGII
Sbjct  117   KIEVRXXXLKIXXEAYAGSRALPTVFNYCVNLVEGLLNSVHILPSKKKHLSILKDVSGII  176

Query  2607  KPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHD  2428
             +P RMTLLLGPPSSGKT+LLLALAG+LD  L+FSGRV+YNGH M+EFVP RTAAYISQHD
Sbjct  177   RPCRMTLLLGPPSSGKTTLLLALAGELDRDLQFSGRVTYNGHGMHEFVPQRTAAYISQHD  236

Query  2427  LHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKA  2248
             +H+ E+T  ETL FSARCQGVG+RYE+L ELSRREK ANI+PD DIDI+MKA AT+GQ+ 
Sbjct  237   VHMGELTVGETLHFSARCQGVGARYEILVELSRREKEANIKPDADIDIYMKAVATEGQRV  296

Query  2247  NVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLD  2068
              V+ DYI+K+LGLEGC DT+VG+  +RG+SGG++KRLT GEMLVGPA  L MDEISTGLD
Sbjct  297   QVVTDYILKILGLEGCADTLVGDNLIRGISGGQKKRLTTGEMLVGPAKALFMDEISTGLD  356

Query  2067  SSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEF  1888
             SSTT+QI+ SIK Y+HIL+GTA I+LLQPAPE Y+LFDDI+L+S+G IVYQGP   VLEF
Sbjct  357   SSTTYQIVNSIKQYVHILNGTAFISLLQPAPETYELFDDIVLLSDGHIVYQGPRENVLEF  416

Query  1887  FECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNL  1708
             FE +GFRCPERKGVADFLQEVTSRKDQ QYW  +D +PY F+T+ EF EAFQSFH+GR L
Sbjct  417   FESMGFRCPERKGVADFLQEVTSRKDQKQYWASRD-EPYTFITVEEFVEAFQSFHVGRKL  475

Query  1707  GDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMA  1528
              DELATPF K+ SHPAALTTK YGVSK ELLK+CF+RE LLMKRN  +++F++  + ++A
Sbjct  476   RDELATPFDKAKSHPAALTTKRYGVSKTELLKACFAREFLLMKRNSFVYLFKLAQLSILA  535

Query  1527  LITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLF  1348
             +ITMTLF+RT M RNS     IY  +LFF+L  +MF+ L EL+ T+ +LP+FYKQR+LLF
Sbjct  536   MITMTLFLRTEMHRNSVDDGVIYAGALFFSLVAVMFNGLAELSMTVTKLPVFYKQRNLLF  595

Query  1347  YPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF  1168
             +P W Y +P++IL+IPITC+EV VWVF TYYVIGYDPN GRL K W+LL++  Q+AS LF
Sbjct  596   FPPWTYTLPSWILKIPITCVEVVVWVFMTYYVIGYDPNVGRLFKQWLLLLLINQMASGLF  655

Query  1167  RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVN  988
             R  A VGRSMT A   GSF +++LF+LGGF+LSRDD+KKWW+WGYWISPLMY QNAI VN
Sbjct  656   RFIAGVGRSMTIASTFGSFALVMLFSLGGFVLSRDDIKKWWMWGYWISPLMYGQNAIVVN  715

Query  987   EFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             EFLGKSW  VLP S+EP GV VLK RG F E  WYW+G G L G+ I   F +TLAL  L
Sbjct  716   EFLGKSWRHVLPNSTEPLGVAVLKSRGFFTEPRWYWIGAGVLAGYMIIFNFXFTLALTYL  775

Query  807   RPLAQSRA-----NISAESHSNEHDVSNGGSDNS--VGERVSDGMSNRKHGMILPFEPHS  649
             +P+ + +A      IS    S E    +  S +S    E  +D   N+K GM+LPFEPHS
Sbjct  776   KPIGKPQAVKLEDPISTPQISREKGNGSNSSRSSSITKEATNDANGNKKRGMVLPFEPHS  835

Query  648   IAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA  469
             I F++I Y VDMPQEMK +GV +++L L++ VSGAFRPGVLTALMGVSGAGKTTLMDVLA
Sbjct  836   ITFDEITYSVDMPQEMKNQGVPEDKLVLIRRVSGAFRPGVLTALMGVSGAGKTTLMDVLA  895

Query  468   GRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVT  289
             GRKTGGYIEG ITISG+ KKQ++FARISGYCEQNDIHSPH+TVYESL++SAWLRL SE+ 
Sbjct  896   GRKTGGYIEGNITISGYPKKQESFARISGYCEQNDIHSPHVTVYESLMYSAWLRLSSEID  955

Query  288   CETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPT  109
              ETRK+F++EVM LVEL  LR+A+VGLPG  GLST QRKRLTIAVELVANPSIIFMDEPT
Sbjct  956   SETRKMFVEEVMGLVELNPLRQALVGLPGAXGLSTEQRKRLTIAVELVANPSIIFMDEPT  1015

Query  108   SGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SGLDARAAAIVMR VRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  SGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDI  1051


 Score =   142 bits (357),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 130/567 (23%), Positives = 246/567 (43%), Gaps = 70/567 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             ++R VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  863   LIRRVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQESFAR  921

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   +ID    
Sbjct  922   ISGYCEQNDIHSPHVTVYESLMYSAW----------------------LRLSSEID----  955

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ ++ ++ L      +VG     G+S  +RKRLT    LV   +++ 
Sbjct  956   -----SETRKMFVEEVMGLVELNPLRQALVGLPGAXGLSTEQRKRLTIAVELVANPSIIF  1010

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+ +G Q +Y
Sbjct  1011  MDEPTSGLDARAAAIVMRAVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLKKGGQELY  1069

Query  1917  QGP-----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVT  1759
              GP     CN ++++FE +      R G   A ++ EVTS   ++   I           
Sbjct  1070  VGPLGRHSCN-LIKYFEGIDNVSKIRDGYNPATWMLEVTSSAKEIAMEI-----------  1117

Query  1758  INEFSEAFQSFHIGRN---LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVL  1588
               +F+E ++   + R    L  EL+ P   S S      T+ Y    +    +C  ++  
Sbjct  1118  --DFAEVYKKSELYRRNKALIAELSNP--ASGSKDLHFPTQ-YSQPFLTQCVACLWKQHW  1172

Query  1587  LMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQ  1408
                RN       + +  ++AL+  T+F     +          + S++  +  +      
Sbjct  1173  SYWRNPPYTAIRLIYTTIVALMFGTMFWNLGSKTTKEXDLFNAIGSMYAAVLFLGIKNST  1232

Query  1407  ELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
              + P +     +FY++R    Y A AYA     + IP   ++  V+    Y +IG++   
Sbjct  1233  TVQPVVDVERTVFYRERAAGMYSALAYAFAQVTIEIPYVFVQALVYSVIVYAMIGFEWTL  1292

Query  1230  GRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN----AFVVGSFIMLVLFALGGFILSRD  1063
              + L  W L  ++     + F    ++G ++T     A +  S    +     GFI+ R 
Sbjct  1293  AKFL--WYLFFMY--FTFLYFTYYGMMGVALTPNQHIAAINSSAFYAIWNVFSGFIIPRT  1348

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  WW W YW  P+ +    +A ++F
Sbjct  1349  RIPXWWRWYYWACPMAWTLYGLATSQF  1375



>ref|XP_008228659.1| PREDICTED: pleiotropic drug resistance protein 1-like [Prunus 
mume]
Length=1427

 Score =  1427 bits (3693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/1050 (67%), Positives = 848/1050 (81%), Gaps = 9/1050 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D      S ++ SS  W +NG + F++S      D+D+E ALKWAAL+K+PT++R+
Sbjct  1     MESGDHYRAGNSLQLGSSLRWRNNGVEAFSRSLC----DEDEEEALKWAALEKLPTYNRM  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             KKG++    GE  E+DI N+G++E+K+++ R +K  E DNE FLLK+K+R++RV ID+P 
Sbjct  57    KKGILIMPAGEASEIDIPNLGFQERKELIGRFLKGSEEDNERFLLKIKNRIDRVGIDLPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVRFE+LNV AEAYVG RALP++ NF +NILEG L+ L++ +++K H SIL +VSGIIK
Sbjct  117   IEVRFENLNVEAEAYVGSRALPTLLNFIVNILEGFLNGLHILSSRKTHLSILHNVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LL ALAG+LD  L+ SGRV+YNGHEMNEF+P +TAAYISQHDL
Sbjct  177   PSRMTLLLGPPSSGKTTLLQALAGKLDLDLKLSGRVTYNGHEMNEFLPQKTAAYISQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+RY+MLAELSRREKAANI+PDPDID+FMKA AT+GQ+ N
Sbjct  237   HIGEMTVRETLAFSARCQGVGTRYDMLAELSRREKAANIKPDPDIDVFMKAIATEGQEVN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DYI+K+LGLE C DT VGN+ LRG+SGG+RKR+T GEMLVGPA VL MDEISTGLDS
Sbjct  297   VVTDYILKILGLEVCADTKVGNDMLRGISGGQRKRVTTGEMLVGPAKVLFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ SIK YIHIL+GTAVI LLQPAPE Y+LFDDIIL+S+GQIVY+GP   VLEFF
Sbjct  357   STTFQIVNSIKQYIHILNGTAVITLLQPAPETYELFDDIILLSDGQIVYEGPLEHVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKG+ADFLQEVTS KDQ QYW  KD +PY FVT+ EFSEAFQSFH+G+ L 
Sbjct  417   ESMGFKCPERKGIADFLQEVTSSKDQEQYWACKD-EPYSFVTVKEFSEAFQSFHVGQKLR  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DEL+ PF K  +HPAALTTK YG+   EL+K CFSRE LL+KRN  ++IF++  + LMAL
Sbjct  476   DELSIPFDKRKNHPAALTTKEYGLKMGELVKVCFSREYLLIKRNSFVYIFKLAQLTLMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             ITMTLF+RT M R S     +YM +LF  +  IMF+ + ELA TI +LPIFYKQRDL FY
Sbjct  536   ITMTLFLRTEMPRGSVDDGGVYMGALFSIVVRIMFNGMPELAMTILKLPIFYKQRDLFFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAYA+PT+IL+IP+T +E++VWVF TYYVIG+DPN  R L+ ++LL++  Q+AS LFR
Sbjct  596   PAWAYALPTWILKIPMTFVEIAVWVFITYYVIGFDPNIERFLRQYLLLLLVNQMASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A + R++  A  VGSF +L L  LGGF+LSRDDVKKWW+WGYWISP+MYAQNAIAVNE
Sbjct  656   LIAAMCRNLIVANTVGSFSLLTLSTLGGFVLSRDDVKKWWVWGYWISPMMYAQNAIAVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
              LG+SW  VLP S+   G+ VLK RG FP A WYW+GVGA+ GF +     Y +AL+KL 
Sbjct  716   LLGESWRHVLPNSTVSLGIEVLKSRGFFPHACWYWIGVGAMTGFVLLFNICYIVALSKLN  775

Query  804   P--LAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDI  631
                L +  + +    +S+         D S  E   + + N + GM+LPFE HSI FN+I
Sbjct  776   RMYLIERTSQLPRSQNSSSQRTKTDSKDESAKEIAVESVRNGRRGMVLPFEQHSITFNEI  835

Query  630   KYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG  451
              Y VDMPQEMKI+GV +++L LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG
Sbjct  836   TYSVDMPQEMKIQGVLEDKLMLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGG  895

Query  450   YIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKL  271
             YIEG+I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLP EV  ETRK+
Sbjct  896   YIEGDIKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPPEVESETRKM  955

Query  270   FIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDAR  91
             FI+EVMELVELT LR+A+VGLPGV+GLST QRKRLTI VELVANPSIIFMDEPTSGLDAR
Sbjct  956   FIEEVMELVELTRLRQALVGLPGVSGLSTEQRKRLTIGVELVANPSIIFMDEPTSGLDAR  1015

Query  90    AAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  AAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1045


 Score =   139 bits (350),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 137/628 (22%), Positives = 280/628 (45%), Gaps = 87/628 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  857   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIKISGYPKKQETFAR  915

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P+++    
Sbjct  916   ISGYCEQNDIHSPHVTVYESLLYSAW----------------------LRLPPEVE----  949

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L      +VG   + G+S  +RKRLT G  LV   +++ 
Sbjct  950   -----SETRKMFIEEVMELVELTRLRQALVGLPGVSGLSTEQRKRLTIGVELVANPSIIF  1004

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G + ++
Sbjct  1005  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGEEIF  1063

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      + G   A ++ E+T+  +++   I            
Sbjct  1064  VGPLGHHSCHLIKYFEGIEGVSKIKDGYNPATWMLELTTSAEELALGI------------  1111

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKT-YGVSKMELLKSCFSREVLLMK  1579
              +F++ +++  + R    +L   F K       L   T Y  S +     C  ++     
Sbjct  1112  -DFAQVYKNSKLFRT-NKKLVKDFSKPAPSSKDLHFPTQYSQSFLTQSMVCLWKQHWSYW  1169

Query  1578  RNCVLHIFEVGWVVLMALITMTLF--IRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
             RN +     + +   MAL+  T+F  + + M+R   +     M S++  +  +       
Sbjct  1170  RNPLYTAVRLLFTTFMALLLGTMFWNLGSQMKRQQDLFNA--MGSMYIAVFFLGVQNATS  1227

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY+++    Y A AYA+   ++ +P   ++  V+    Y +IG++    
Sbjct  1228  VQPVVAIERTVFYREKAAGMYSALAYALAQVLIELPYILVQTVVYGVIIYKMIGFELTLV  1287

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRS----MTNAFVVGSFIMLVLFALGGFILSRDD  1060
             +    W L  ++  L    F    +V  S    + +     S+ +  LF+  GFI+ R  
Sbjct  1288  KFF--WYLFFMYFTLLYFTFSGMMIVAVSPNHHIASIVTYASYGLWNLFS--GFIVPRPR  1343

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLVLKYRGLFPE  895
             +  WW W YW  P+ +    +  ++F        +  TV  F  + FG     +R  F  
Sbjct  1344  IPIWWRWYYWACPVAWTLYGLVASQFGDLNDTIDNGQTVKQFLGDYFG-----FRHDF--  1396

Query  894   AYWYWLGVGAL--IGFTIFSIFIYTLAL  817
                  +GV A   +GFT+   FI+++++
Sbjct  1397  -----VGVVAAGHVGFTVLFGFIFSVSV  1419



>ref|XP_010654718.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1459

 Score =  1426 bits (3692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/1077 (66%), Positives = 854/1077 (79%), Gaps = 37/1077 (3%)
 Frame = -2

Query  3135  EINDSRGR--SGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDR  2965
             EI  + GR  SGSFR NSSS+W N G + F++SSR    D+DDE ALKWAAL+K+PT++R
Sbjct  5     EIYTASGRRASGSFRKNSSSIWRNSGAEVFSRSSR----DEDDEEALKWAALEKLPTYNR  60

Query  2964  LKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIP  2785
             L+KGL+ G  GE  EVDI+N+G +E+K ++ERL+K+ E DNE FLLKLK+RM+RV ID+P
Sbjct  61    LRKGLLIGSEGEASEVDIHNLGPQERKNLVERLVKIAEEDNEKFLLKLKNRMDRVGIDLP  120

Query  2784  KVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGII  2608
             ++EVRFEHL + AEA+VG RALPS  N   N +E +L+ L  LP+ KK  +IL DVSGII
Sbjct  121   EIEVRFEHLTIDAEAHVGSRALPSFINSVFNQIEDILNTLRILPSRKKKFTILHDVSGII  180

Query  2607  KPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHD  2428
             KPGRMTLLLGPPSSGKT+LLLAL+G+LD SL+ +GRV+YNGH MNEFVP RTAAYISQ D
Sbjct  181   KPGRMTLLLGPPSSGKTTLLLALSGKLDSSLKVTGRVTYNGHGMNEFVPQRTAAYISQLD  240

Query  2427  LHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKA  2248
              HI EMT RETLAFSARCQGVG RY+ML ELSRREKAANI+PDPDID+FMKAAA +GQK 
Sbjct  241   THIGEMTVRETLAFSARCQGVGDRYDMLVELSRREKAANIKPDPDIDVFMKAAAAEGQKE  300

Query  2247  NVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLD  2068
             NVI DY +K+LGLE C DT+VG+E +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLD
Sbjct  301   NVITDYTLKILGLEICADTMVGDEMVRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLD  360

Query  2067  SSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEF  1888
             SSTT+QI+ S++  +HIL+GTA+I+LLQPAPE YDLFDDIIL+S+ +I+YQGP   VL F
Sbjct  361   SSTTYQIVNSLRQTVHILNGTALISLLQPAPETYDLFDDIILLSDSRIIYQGPREDVLNF  420

Query  1887  FECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNL  1708
             FE +GFRCPERKGVADFLQEVTSRKDQ QYW  KD +PY FVT  EF+EAFQSFH GR L
Sbjct  421   FESMGFRCPERKGVADFLQEVTSRKDQEQYWAHKD-EPYSFVTAKEFAEAFQSFHFGRKL  479

Query  1707  GDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMA  1528
             GDELATPF K+ SHPAAL T+ YGV K ELL +C SRE LLMKRN  ++IF++  + ++A
Sbjct  480   GDELATPFDKTKSHPAALKTEKYGVRKKELLDACISREYLLMKRNSFVYIFKLTQLTIVA  539

Query  1527  LITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLF  1348
             +I MT+F+RT M +N+     IY  +LFFT+ ++MF+ + ELA TI +LP+FYKQR LLF
Sbjct  540   MIAMTIFLRTEMHKNTTEDGNIYTGALFFTVMMVMFNGMSELAMTILKLPVFYKQRGLLF  599

Query  1347  YPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF  1168
             YPAWAYA+P++ L+IPIT +EV VWVF TYYVIG+DPN GRL + ++LL++  Q AS LF
Sbjct  600   YPAWAYALPSWFLKIPITFVEVGVWVFITYYVIGFDPNVGRLFRQYLLLLLLNQTASSLF  659

Query  1167  RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVN  988
             R  A   RSM  A   GSF +++ FALGG +LSR++VKKWWIWGYW SP+MYAQNAI VN
Sbjct  660   RFIAAACRSMIVANTFGSFALVLPFALGGIVLSRENVKKWWIWGYWSSPMMYAQNAILVN  719

Query  987   EFLGKSWN-TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAK  811
             EFLGKSW+      S+E  GV VLK RG F EA+WYW+G GAL+GF     F YT+AL  
Sbjct  720   EFLGKSWSKNASTNSTESLGVAVLKARGFFTEAHWYWIGAGALLGFIFVFNFCYTVALTY  779

Query  810   LRPLAQSRANISAESHSNEHD---------------VSNGGSDNSVG------------E  712
             L P  + +A I+ ES + + +                ++  S   +G            E
Sbjct  780   LNPFEKPQAVITVESDNAKTEGKIELSSHRKGSIDQTASTESGEEIGRSISSVSSSVRAE  839

Query  711   RVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPG  532
              +++   N K GM+LPF+P SI F+DI+Y VDMP+EMK +GV ++RLELLKGVSGAFRPG
Sbjct  840   AIAEARRNNKKGMVLPFQPLSITFDDIRYSVDMPEEMKSQGVPEDRLELLKGVSGAFRPG  899

Query  531   VLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSP  352
             VLTALMGVSGAGKTTLMDVLAGRKTGGYIEG I+ISG+ KKQ+TFARISGYCEQNDIHSP
Sbjct  900   VLTALMGVSGAGKTTLMDVLAGRKTGGYIEGSISISGYPKKQETFARISGYCEQNDIHSP  959

Query  351   HLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRK  172
             H+TV+ESL++SAWLRLP  V  ETRK+FI+EVMELVELT LR A+VGLPGVNGLST QRK
Sbjct  960   HVTVHESLLYSAWLRLPPNVDAETRKMFIEEVMELVELTPLRGALVGLPGVNGLSTEQRK  1019

Query  171   RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1020  RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1076


 Score =   150 bits (380),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 149/625 (24%), Positives = 276/625 (44%), Gaps = 80/625 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +S +G+   +    R
Sbjct  888   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGSISISGYPKKQETFAR  946

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P++D    
Sbjct  947   ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLPPNVD----  980

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  981   -----AETRKMFIEEVMELVELTPLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1035

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G Q +Y
Sbjct  1036  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKRGGQEIY  1094

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EVT+   ++   +        F  I
Sbjct  1095  MGPLGRHSSHLIKYFEGIEGVSKIKDGYNPATWMLEVTASAQELILGVD-------FTEI  1147

Query  1755  NEFSEAFQSFHIGRNLGDELA--TPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLM  1582
              E S+ ++     ++L  EL+  TP  K    P       Y  S      +C  ++ L  
Sbjct  1148  YEKSDLYRR---NKDLIKELSQPTPGSKDLYFPT-----QYSQSFFTQCMACLWKQRLSY  1199

Query  1581  KRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQEL  1402
              RN         +   +AL+  T+F     +R         M S++  +  + F   Q +
Sbjct  1200  WRNPPYTAVRFFFTTFVALMFGTMFWDLGTKRTRQQDISNAMGSMYAAVLFLGFQNGQSV  1259

Query  1401  APTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGR  1225
              P +     +FY++R    Y A  YA    ++ IP    +  V+    Y +IG++    +
Sbjct  1260  QPVVAVERTVFYRERAAGMYSAMPYAFAQALVEIPYVFSQAVVYGVIVYAMIGFEWTAAK  1319

Query  1224  LLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLV-LFALGGFILSR  1066
                        +L   F  + +V     A        A V  SF  L  LF+  GFI+ R
Sbjct  1320  FFWYLFFMFFSLLYFTFYGMMAV-----AATPNQHIAAIVASSFYTLWNLFS--GFIVPR  1372

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYW  886
             + +  WW W YW  P+ ++   +  ++F G   +T+L  +     V V +Y   +     
Sbjct  1373  NRIPVWWRWYYWACPVAWSLYGLVTSQF-GDIEDTLLDSN-----VTVKQYLDDYFGFKH  1426

Query  885   YWLGVGA--LIGFTIFSIFIYTLAL  817
              +LGV A  ++GFT+  +FI+  A+
Sbjct  1427  DFLGVVAVVIVGFTVLFLFIFAFAI  1451



>ref|XP_002514351.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF48305.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1438

 Score =  1426 bits (3692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/1061 (67%), Positives = 857/1061 (81%), Gaps = 35/1061 (3%)
 Frame = -2

Query  3123  SRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLM  2947
             S GR+GSFR      W+N T + F+KSS      +DDE ALKWAAL+K+PT+ R+K+G++
Sbjct  11    SSGRTGSFRS-----WTNNTMEAFSKSS----HAEDDEEALKWAALEKLPTYLRIKRGIL  61

Query  2946  TGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRF  2767
                  +  E+D+NN+G  E++K++ERL+K+ E DNE FLLKL++R+ERV +D+P +EVRF
Sbjct  62    -----DEKEIDVNNLGLIERRKLVERLVKIAEDDNEKFLLKLRNRIERVGLDMPTIEVRF  116

Query  2766  EHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMT  2590
             EHLNV AEAY+G R LP++ NF +N+LEG L+YL+ LP+ KK   IL DVSGIIKP RMT
Sbjct  117   EHLNVEAEAYIGSRGLPTIFNFSINLLEGFLNYLHILPSRKKPLPILNDVSGIIKPRRMT  176

Query  2589  LLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEM  2410
             LLLGPPSSGKT+LLLALAG+L   L+FSGRV+YNGH M EFVP RT+AYISQ+DLHI EM
Sbjct  177   LLLGPPSSGKTTLLLALAGKLGKDLQFSGRVTYNGHGMEEFVPQRTSAYISQYDLHIGEM  236

Query  2409  TARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDY  2230
             T RETLAFSARCQGVG R EML ELSRREKAANI+PDPDIDI+MKAAA +GQ+ NV+ DY
Sbjct  237   TVRETLAFSARCQGVGPRLEMLEELSRREKAANIKPDPDIDIYMKAAALEGQETNVVTDY  296

Query  2229  IIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQ  2050
             IIK+LGLE C DT+VG+E +RG+SGG++KRLT GEMLVGPA  L MDEISTGLDSSTTFQ
Sbjct  297   IIKILGLEACADTVVGDEMIRGISGGQKKRLTTGEMLVGPARALFMDEISTGLDSSTTFQ  356

Query  2049  ILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGF  1870
             I+ S++  IHIL GTA+I+LLQPAPE +DLFDD+IL+SEGQIVYQGP   VLEFFE  GF
Sbjct  357   IVNSLRQSIHILGGTALISLLQPAPETFDLFDDVILLSEGQIVYQGPRQNVLEFFEYTGF  416

Query  1869  RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELAT  1690
             +CPERKG ADFLQEVTSRKDQ QYW RKD +PY FV++ EF+E FQSFHIG+ LGDELAT
Sbjct  417   KCPERKGPADFLQEVTSRKDQEQYWARKD-EPYSFVSVKEFAETFQSFHIGQKLGDELAT  475

Query  1689  PFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTL  1510
             PF KS  HP ALTTK YG+SK ELLK+C SRE+LLMKRN   +IF++  +++MA++T+T+
Sbjct  476   PFDKSKCHPTALTTKKYGLSKKELLKACISRELLLMKRNSFFYIFKMTQIIIMAVLTITV  535

Query  1509  FIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAY  1330
             F+RT M+R++P  A IY+ +LFFT+  +MF+   ELA TI +LP+FYKQRDLLFYP+WAY
Sbjct  536   FLRTEMRRDTPTDAAIYLGALFFTVVTLMFNGFTELALTIMKLPVFYKQRDLLFYPSWAY  595

Query  1329  AIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVV  1150
             A+PT+I++IPIT +EV++WV  TYYVIG+DPN  R LK ++LL+   Q+AS LFR  A +
Sbjct  596   ALPTWIVKIPITFVEVAIWVVLTYYVIGFDPNIRRFLKQYLLLLCTNQMASGLFRLMAAL  655

Query  1149  GRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKS  970
             GR +  A  VGSF +L +  LGGFILSRD+VK WW+WGYWISPLMY QNAI+VNEFLG +
Sbjct  656   GRDIIVANTVGSFALLAILVLGGFILSRDEVKSWWLWGYWISPLMYVQNAISVNEFLGNT  715

Query  969   WNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQS  790
             W  V P S+EP GV  LK  G+FPEA+WYW+GVGALIGF +    +YTLAL  L P  + 
Sbjct  716   WRHVPPLSTEPLGVSFLKSHGIFPEAHWYWIGVGALIGFVVLFNVLYTLALKYLEPFGKP  775

Query  789   RANIS----AESHSN------EHDVSNGGSDNSVGERV--------SDGMSNRKHGMILP  664
             +  IS    AE HSN      E   S   S  ++  ++        +D   NR+ GM+LP
Sbjct  776   QVIISKEALAEKHSNRSAESFELFTSGKSSLGNISSKIVSSSLNNFTDANPNRRRGMVLP  835

Query  663   FEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTL  484
             F+P S+AFN+I+Y VDMPQEMK +G+ D+RLELLKG+SGAF+PGVLT+LMGVSGAGKTTL
Sbjct  836   FQPLSMAFNEIRYAVDMPQEMKAQGIPDDRLELLKGISGAFKPGVLTSLMGVSGAGKTTL  895

Query  483   MDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRL  304
             MDVLAGRKTGGYIEG I+ISG+ KKQ+TFARISGYCEQ DIHSPH+T+YESL++SAWLRL
Sbjct  896   MDVLAGRKTGGYIEGHISISGYPKKQETFARISGYCEQTDIHSPHVTLYESLLYSAWLRL  955

Query  303   PSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIF  124
             P EV    RK+FI+EVMELVEL SLREA+VGLPGVNGLST QRKRLTIAVELVANPSIIF
Sbjct  956   PPEVDSYKRKMFIEEVMELVELNSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1015

Query  123   MDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             MDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  MDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1056


 Score =   139 bits (351),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 127/559 (23%), Positives = 241/559 (43%), Gaps = 54/559 (10%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ +SG  KPG +T L+G   +GKT+L+  LAG+        G +S +G+   +    R
Sbjct  868   LLKGISGAFKPGVLTSLMGVSGAGKTTLMDVLAGRKTGGY-IEGHISISGYPKKQETFAR  926

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P++D +  
Sbjct  927   ISGYCEQTDIHSPHVTLYESLLYSAW----------------------LRLPPEVDSY--  962

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                    K  + ++ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  963   -------KRKMFIEEVMELVELNSLREALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1015

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++IL+  G + VY
Sbjct  1016  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELILLKRGGEEVY  1074

Query  1917  QGPCNC----VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP  C    ++++FE +      + G   + ++ E+TS   +    I        F  I
Sbjct  1075  VGPIGCHSCRLIKYFEDIKGVPKIKDGYNPSTWMLEITSAAQEAVLGIN-------FADI  1127

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L  EL+TP  +  S      T+ Y    +    +C  ++     R
Sbjct  1128  YKNSELYRK---NKALIKELSTP--QPGSKDLYFPTQ-YSQPFLTQCMACLWKQHWSYWR  1181

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N      ++ +  ++AL+  T+F     +R         + S++  L  I       + P
Sbjct  1182  NPPYTAVKLLFTTVIALMFGTIFWDLGCKRRRQQDIFNAIGSMYVALLFIGIQNAASVQP  1241

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   I+  ++    Y +IG D    +  
Sbjct  1242  VVAIERTVFYRERAAGMYSALPYAFGQVMIEVPYAFIQTIIYGVIVYAMIGLDWTVRKFF  1301

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIW  1039
                  +       S        V  +   A VV S    +     GFI+ +  +  WW W
Sbjct  1302  WYMFFMYFTFLYFSFYGMMTTAVTPNHNIAAVVASAFYAIWNLFSGFIIPQPRIPVWWRW  1361

Query  1038  GYWISPLMYAQNAIAVNEF  982
              YW  P+ +    +  ++F
Sbjct  1362  YYWCCPVAWTMYGLVASQF  1380



>ref|XP_009343426.1| PREDICTED: pleiotropic drug resistance protein 1-like [Pyrus 
x bretschneideri]
Length=1437

 Score =  1426 bits (3691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1060 (66%), Positives = 853/1060 (80%), Gaps = 19/1060 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D        ++ SS  W +NG + F+ SSR     +DDE ALKWAAL+K+PT++RL
Sbjct  1     MESGDIHRAGNGRQLGSSLRWRNNGMEVFSSSSR----GEDDEVALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KG++T   GE  E+DI N+G++E+K+++ER +K  + DNE FLLKLK+R++RV I +P 
Sbjct  57    RKGILTMPGGEASEIDIPNLGFQERKELIERFLKGNDEDNERFLLKLKNRIDRVGIVLPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVRFE LNV AE YVG RALP++ NFC+NI+EG+L+ L + +++K H SIL +VSGIIK
Sbjct  117   IEVRFEQLNVEAETYVGGRALPTLFNFCVNIIEGILNGLRILSSRKTHLSILHNVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLALAG+LDP L+ SGRVSYNGH MNEFVP RTAAYI QHDL
Sbjct  177   PSRMTLLLGPPSSGKTTLLLALAGKLDPDLKLSGRVSYNGHGMNEFVPQRTAAYIGQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSAR QGVG+RY+ML+ELSRREK ANI PDP ID+FMKA +T+GQ+ N
Sbjct  237   HIGEMTVRETLAFSARFQGVGTRYDMLSELSRREKEANINPDPVIDVFMKAISTEGQEVN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DYI+K+LGLE C DTIVG+E LRG+SGG++KR+T GEMLVGPA  L MDEISTGLDS
Sbjct  297   VVTDYILKILGLEVCADTIVGDEMLRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ SIK  IHIL+GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFF
Sbjct  357   STTFQIVNSIKQCIHILNGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CP+RK +ADFLQEVTSRKDQ QYW+RK+ +PY F+T+ EFS AFQSF +G+ LG
Sbjct  417   ESMGFKCPKRKAIADFLQEVTSRKDQEQYWVRKE-EPYSFITVKEFSVAFQSFLLGQKLG  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DEL+ PF KS +HPAALT K YG+ K ELLK+CFSRE LL+KRN  ++IF +  +++MAL
Sbjct  476   DELSIPFDKSRNHPAALTIKEYGLKKGELLKACFSREYLLIKRNSFVYIFRLTQLIVMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             ITMT+F+RT M  +S     +YM +LFF++ ++MF+ + EL+ TI +LP+FYKQRDLLF+
Sbjct  536   ITMTIFLRTKMPHDSVDDGGVYMGALFFSVVMVMFNGMAELSMTIMKLPVFYKQRDLLFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWA+A+PT+IL+IPI  IEV VWVF TYYVIG+DPN  R  + +VLL++  Q+AS LFR
Sbjct  596   PAWAFALPTWILKIPIAIIEVGVWVFMTYYVIGFDPNVDRFFRQYVLLLLVNQMASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A V R++  A  +GSF +L+LF LGGF+LSRDD+KKWWIWGYWISP+MYAQNAI+VNE
Sbjct  656   FLAAVCRNLVVANTLGSFALLILFTLGGFVLSRDDIKKWWIWGYWISPMMYAQNAISVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
              LG SW  VLP S+   GV  LK  G+FP  YWYW+GVGA+ GF +     Y +AL  L 
Sbjct  716   LLGNSWRHVLPNSTVALGVAALKSHGVFPHEYWYWIGVGAMAGFALLFNIFYIVALTYLN  775

Query  804   PLAQSRANISAESHSNEHD-----------VSNGGSDNSVGE-RVSDGMSNRKHGMILPF  661
             PL + +A  S +S SNE+D             N  S  ++ E R  + + N + GM+LPF
Sbjct  776   PLGKPQAVKSEDSQSNENDGRTERTSQLPRSQNSSSQQTMPESRNQEAICNNRRGMVLPF  835

Query  660   EPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  481
             EP+SI F++I Y VDMPQEMK +GV +++L LLKGVSGAFRPGVLTALMGVSGAGKTTLM
Sbjct  836   EPYSITFDEIIYSVDMPQEMKTQGVLEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLM  895

Query  480   DVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLP  301
             DVLAGRKTGGYIEG++ ISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLP
Sbjct  896   DVLAGRKTGGYIEGDVKISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLP  955

Query  300   SEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFM  121
              EV  ETRKLFI+EVMELVEL  LR+ +VGLPGVNGLST QRKRLTIAVELVANPSIIFM
Sbjct  956   PEVKAETRKLFIEEVMELVELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1015

Query  120   DEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1055


 Score =   137 bits (344),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 127/566 (22%), Positives = 253/566 (45%), Gaps = 68/566 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G V  +G+   +    R
Sbjct  867   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDVKISGYPKKQETFAR  925

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P++     
Sbjct  926   ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLPPEVK----  959

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L+     +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  960   -----AETRKLFIEEVMELVELKPLRQVLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1014

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1015  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGQEIY  1073

Query  1917  QGPC---NC-VLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +    +  +    A ++ E T+   ++   I        F  +
Sbjct  1074  VGPLGGHSCHLIQYFEGIEGVSKIKDSYNPATWMLEATTSAQELSLGID-------FAQV  1126

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L  E +TP   S S      T+ Y    +    +C  ++     R
Sbjct  1127  YKNSELYRR---NKQLIKEFSTP--ASPSKDLYFPTR-YSQPFLVQTIACLWKQHWSYWR  1180

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE---  1405
             N + +   + +  ++AL+  ++F     +          M S++   T ++F  +Q    
Sbjct  1181  NPLYNAVRLLFTTIIALMLGSMFWNLGSKTRRQQDLFNAMGSMY---TAVLFLGVQNATS  1237

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY+++    Y A  YA    ++ +P   ++  V+   TY +IG+D    
Sbjct  1238  VQPIVAIERTVFYREKAAGMYSALPYAFAQVLIELPYILLQAVVYGVITYVMIGFDMTLV  1297

Query  1227  RLLKMWVLLIIFRQLASVLF---RSAAVVGRSMTNAFVVGSFIMLV-LFALGGFILSRDD  1060
             +    W +  ++  L    F    + AV       A V  +F  L  LF+  GFI+ R  
Sbjct  1298  KFF--WYIFFMYFTLLYFTFYGMMTVAVTPNHHVAAIVSSAFYALWNLFS--GFIIPRPR  1353

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF  982
             +  WW W YW  P+ +    +  ++F
Sbjct  1354  IPIWWRWYYWACPVAWTLYGLIASQF  1379



>ref|XP_010023532.1| PREDICTED: ABC transporter G family member 40-like [Eucalyptus 
grandis]
Length=1438

 Score =  1425 bits (3690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 702/1064 (66%), Positives = 852/1064 (80%), Gaps = 24/1064 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             M+  D      S R  SS+ W N     D F++SSR    D+DDE AL+WAAL+K+PTF+
Sbjct  1     MDGGDIYRAGNSLRATSSTTWRNHASIADVFSRSSR----DEDDEEALRWAALEKLPTFE  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   ++DI N+G+ ++K++LERL++V E DNE FLLKL++R++RV ID+
Sbjct  57    RLQKGILTAGGGAN-QIDIWNLGFHDRKRLLERLVRVTEEDNEGFLLKLRNRIDRVGIDL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRFEHL V AEA+ G RALP+V NFC +ILEG L++L+ LP+ KKH +IL+DVSGI
Sbjct  116   PTIEVRFEHLKVEAEAHEGSRALPTVINFCTSILEGFLNFLHILPSRKKHLTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH MNEFVP RTAAYISQ 
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKTTGRVTYNGHVMNEFVPQRTAAYISQQ  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAA+I+PDPD+DIFMKAA  +GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAASIKPDPDVDIFMKAAVIEGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV++DYI+K+LGLE C D +VG+E LRG+SGG+RKR+TAGEMLVGP  V LMDEISTGL
Sbjct  296   ANVVIDYILKILGLEICADAMVGDEMLRGISGGQRKRVTAGEMLVGPVEVFLMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+  +K +IHIL GTA+I+LLQPAPE YDLFDDIIL+S+GQIVYQGP   +L+
Sbjct  356   DSSTTYQIVNFLKQFIHILDGTAIISLLQPAPETYDLFDDIILLSDGQIVYQGPRELILD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FF+ +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF EAFQSFH+GR 
Sbjct  416   FFKSMGFKCPRRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFVEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  ++++
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVSQLIIL  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A I++TLF+RT M R++     +Y+ +LFFT+  IMF+ + E++ TI +LPIFYKQRDLL
Sbjct  535   AFISVTLFLRTKMHRDTVTDGGVYIGALFFTVITIMFNGMSEISMTIAKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF TYYV GYDPN GRL K ++LL+   Q+AS L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFITYYVTGYDPNVGRLFKHYLLLVAINQMASGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   GSF++L L ALGG +LSR+DVKKWWIWGYW SPLMY QNAI V
Sbjct  655   FRLIAALGRNLIVANTFGSFVLLALVALGGVVLSREDVKKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NE LG +WN + P SS  EP G+ VLK RG F EAYWYW+G+GAL GF +   F +++AL
Sbjct  715   NELLGSNWNKIPPNSSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFIVLFNFGFSVAL  774

Query  816   AKLRPLAQSRANISAESHSNEHDVSNGGSDNSV--GERVSDG----------MSNRKHGM  673
             A L P  +S    S +   N++     GS      G R S             +N K GM
Sbjct  775   ALLNPFGKSHTVKSDDPEGNKNVDRIEGSIQLQFRGSRRSSKPTPAWPETAVAANTKRGM  834

Query  672   ILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGK  493
             +LPFEPHSI F++I Y VDMP+EM  +G  ++RL LLKG SG+FRPGVLTALMGVSGAGK
Sbjct  835   VLPFEPHSITFDEITYSVDMPREMTNQGAPEDRLVLLKGASGSFRPGVLTALMGVSGAGK  894

Query  492   TTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAW  313
             TTLMDVLAGRKTGGYIEG ITISG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+SAW
Sbjct  895   TTLMDVLAGRKTGGYIEGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYESLIYSAW  954

Query  312   LRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPS  133
             LRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVANPS
Sbjct  955   LRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPS  1014

Query  132   IIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  IIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1058


 Score =   140 bits (352),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 141/638 (22%), Positives = 276/638 (43%), Gaps = 100/638 (16%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+  SG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  870   LLKGASGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKNQDTFAR  928

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  929   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  962

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  963   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1017

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1018  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1076

Query  1917  QGP----CNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQ--YWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +              Q V+  KD      W+ +   P + +T+
Sbjct  1077  VGPLGRHSSHLIEYFEGI--------------QGVSKIKDGYNPATWMLEVTSPAQELTL  1122

Query  1755  N-EFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVL  1588
               +FS+ +++   +   + L +EL+ P     +      TK Y  S    L +C  ++  
Sbjct  1123  GVDFSDLYKNSDLYRRNKALIEELSIP--PPNAKDLYFPTK-YSQSTFTQLMACLWKQHW  1179

Query  1587  LMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQ  1408
                RN         + + +AL+  T+F     +          M S++  +  +      
Sbjct  1180  SYWRNPPYTAVRFLFTISIALMFGTMFWDLGSKTTRSQDLLNAMGSMYAAIFFLGMQNAS  1239

Query  1407  ELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
              + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+    
Sbjct  1240  SVQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLVQAISYGIIVYAMIGFK---  1296

Query  1230  GRLLKMWVLL-----IIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGF  1078
                   W ++     + F     + F    ++   MT    + S +    +A+     GF
Sbjct  1297  ------WTVVKFFWYLFFMFFTLLYFTYYGMMAVGMTPNHHIASIVSFAFYAIWNLFSGF  1350

Query  1077  ILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLK  916
             ++ R  +  WW W YW+ P+ +    + V++F      L  +  TV  +  + FG     
Sbjct  1351  VVPRTRIPIWWRWFYWVCPVSWTLYGLVVSQFGNLTNRLEDTGETVEEYMRDYFG-----  1405

Query  915   YRGLFPEAYWYWLGVGA--LIGFTIFSIFIYTLALAKL  808
             YR  F       LG+ A  +IGFT+  +F++ +++  L
Sbjct  1406  YRHGF-------LGMIAAVMIGFTMLFVFVFAISIKIL  1436



>ref|XP_010914974.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Elaeis guineensis]
Length=1455

 Score =  1425 bits (3689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1066 (65%), Positives = 850/1066 (80%), Gaps = 33/1066 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLR  2935
             R GS R  S+S+W+ G D F++SSR    ++DDE ALKWA+L+K+PT++RL+KG++T   
Sbjct  13    RMGSIRTGSASIWTRGDDVFSRSSR----EEDDEEALKWASLEKLPTYNRLRKGILTITE  68

Query  2934  GETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLN  2755
             G+  EVDI N+ Y+E+K ++ERL++V E DNE FLLKL++R+++V ID+P +EVR+EHLN
Sbjct  69    GQPREVDIENLSYQERKNLIERLVRVAEEDNEKFLLKLRNRIDQVGIDLPTIEVRYEHLN  128

Query  2754  VGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIKPGRMTLLLG  2578
             V A AYVG R LPS  N  +N+LEGL + L++ P+ K+   IL DVSGIIKP RMTLLLG
Sbjct  129   VEARAYVGNRGLPSFINATVNVLEGLANLLHIVPSRKRPLEILHDVSGIIKPRRMTLLLG  188

Query  2577  PPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARE  2398
             PP SGKT+LLLALAG+L+  L+ SG V+YNGH M++FVP RTAAYISQHDLHI +MT RE
Sbjct  189   PPGSGKTTLLLALAGKLESDLKASGTVTYNGHGMDDFVPQRTAAYISQHDLHIGQMTVRE  248

Query  2397  TLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKV  2218
             TL+FSARCQGVG+RY+MLAEL+RREK ANI+PDPDID+FMKAAA   Q+ NV+ DYI+K+
Sbjct  249   TLSFSARCQGVGTRYDMLAELARREKQANIKPDPDIDVFMKAAAMGNQETNVVTDYILKI  308

Query  2217  LGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKS  2038
             LGLE C DT+VG+E LRG+SGG+RKR+T GEM+VGPA  L MDEISTGLDSSTTFQI+ S
Sbjct  309   LGLEVCADTMVGDEMLRGISGGQRKRVTTGEMIVGPARALFMDEISTGLDSSTTFQIVNS  368

Query  2037  IKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPE  1858
              +  IHIL GTAVI+LLQPAPE YDLFDDIIL+S+G +VYQGP   VLEFFE +GFRCPE
Sbjct  369   FRQSIHILAGTAVISLLQPAPETYDLFDDIILLSDGHVVYQGPREHVLEFFESMGFRCPE  428

Query  1857  RKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQK  1678
             RKGVADFLQEVTSRKDQ QYW+R D +PYRFV + EF+EAFQSFH+G+ LG EL+ PF K
Sbjct  429   RKGVADFLQEVTSRKDQQQYWMRHD-EPYRFVPVREFAEAFQSFHVGQKLGHELSVPFDK  487

Query  1677  STSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRT  1498
             S+SHPAAL +  YG S  ELLK+   RE+LLMKRN  ++ F    ++ MA I+MTLF+RT
Sbjct  488   SSSHPAALASSKYGASSKELLKANIWRELLLMKRNSFVYGFRAFQLMFMATISMTLFLRT  547

Query  1497  NMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPT  1318
             NM R++     +Y+ +LFF++ +IMF+   ELA  I +LP+F+KQRD LFYPAW YA+P+
Sbjct  548   NMHRDNTSDGGLYLGALFFSMIMIMFNGFSELALAIAKLPVFFKQRDYLFYPAWTYALPS  607

Query  1317  FILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSM  1138
             +I++IPIT +EV VWVF TYYVIG+DPN GRL K ++LL++  Q+AS LFR  A +GR+M
Sbjct  608   WIIKIPITFVEVGVWVFLTYYVIGFDPNVGRLFKQYMLLLLVNQMASGLFRFIAALGRNM  667

Query  1137  TNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTV  958
               A   GSF +LVL  LGGFILSR+DVKKWWIWGYWISP+MY+QNA+A NEFLG SW+ +
Sbjct  668   IIANTFGSFSLLVLVVLGGFILSREDVKKWWIWGYWISPMMYSQNALATNEFLGHSWSRI  727

Query  957   LPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANI  778
             LP  +EP GV VLK RG F EA WYW+GVGAL+G+TI   F++T+AL  ++P  +++  +
Sbjct  728   LPNHTEPLGVEVLKSRGFFHEAKWYWIGVGALVGYTILFNFLFTVALTYIKPFGKAQPAV  787

Query  777   SAES------------------------HSNEHDVSNGGSDNSVGERVSDGMSN---RKH  679
             S E+                         S     +NG  +      ++DG++N   +K 
Sbjct  788   SEEALNEKYSNITGEMKSSSPAERSASRDSTSKKTANGSRNIEASSSMTDGVANPNQKKK  847

Query  678   GMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGA  499
             GM+LPF P  I F+DI+Y VDMPQEMK +GVE +RLELLKGVSG+FRPGVLTALMGVSGA
Sbjct  848   GMVLPFTPLCITFDDIRYSVDMPQEMKAQGVEGDRLELLKGVSGSFRPGVLTALMGVSGA  907

Query  498   GKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFS  319
             GKTTLMDVLAGRKTGGYI+G ITISG+ K Q+TFARISGYCEQNDIHSPH+TVYESL++S
Sbjct  908   GKTTLMDVLAGRKTGGYIDGSITISGYPKNQETFARISGYCEQNDIHSPHVTVYESLVYS  967

Query  318   AWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVAN  139
             AWLRLP+EV   TRK+F++EVMELVELTSLREA+VGLPGV+GLST QRKRLTIAVELVAN
Sbjct  968   AWLRLPAEVDSATRKMFVEEVMELVELTSLREALVGLPGVSGLSTEQRKRLTIAVELVAN  1027

Query  138   PSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             PSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1028  PSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1073


 Score =   133 bits (334),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 121/564 (21%), Positives = 246/564 (44%), Gaps = 64/564 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  885   LLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSITISGYPKNQETFAR  943

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  944   ISGYCEQNDIHSPHVTVYESLVYSAWLR-------------------------------L  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              A  D     + V+ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   PAEVDSATRKMFVEEVMELVELTSLREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1032

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1033  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLLKRGGEEIY  1091

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      + G   A ++ EVT++  +    +            
Sbjct  1092  VGPLGRHSCHLIDYFEQIEGVSKIKDGYNPATWMLEVTTQAQEQILGV------------  1139

Query  1755  NEFSEAFQSFHIGRN---LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FSE +++  + R    L  EL+ P     S      T+ Y    +    +C  ++ L 
Sbjct  1140  -DFSEVYKNSELYRRNKALIKELSMP--PPGSSDLHFPTQ-YAQPFLTQCLACLWKQRLS  1195

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +A++  T+F     + ++       M S++  +  I  S    
Sbjct  1196  YWRNPPYTAVRFFFTTAIAVMFGTIFWDLGTKTSNEQDLFNAMGSMYAAVLFIGVSNGTS  1255

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA    ++ +P   ++  V+    Y +I ++    
Sbjct  1256  VQPVVSIERTVFYRERAAGMYSALPYAFGQVLIELPYVLVQALVYGVIVYAMIAFEWTAA  1315

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRS--MTNAFVVGSFIMLVLFALGGFILSRDDVK  1054
             +    W +  ++  L    F     VG +  +  A ++ +  + +     GFI+ R  + 
Sbjct  1316  KFF--WYIFFMYFTLLYFTFYGMMTVGMTPNINIAAIISAGFVGLWNLFSGFIIPRPSMP  1373

Query  1053  KWWIWGYWISPLMYAQNAIAVNEF  982
              WW W +W SP+ +    +  ++F
Sbjct  1374  VWWRWYFWASPVAWTLYGLVTSQF  1397



>ref|XP_010654721.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1424

 Score =  1425 bits (3689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/1049 (68%), Positives = 861/1049 (82%), Gaps = 11/1049 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             M   D    SGS R N SS+W S+G D F++SSR    D+DDE ALKWAAL+K+PT++RL
Sbjct  1     MATADIYRASGSLRRNGSSIWRSSGADIFSRSSR----DEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++GL+ G  GE  E+DI+N+G++EKK ++ERL+KV E DNE FLLKLK+R++RV ID+P+
Sbjct  57    RRGLLMGSEGEASEIDIHNLGFQEKKNLVERLVKVAEEDNEKFLLKLKNRIDRVGIDVPE  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIK  2605
             +EVRFEHL + AEA+VG RALPS  NF  + LEG+L+ +  LP+ K+  +IL DVSG IK
Sbjct  117   IEVRFEHLTIDAEAFVGSRALPSFHNFIFSKLEGILNAVRILPSKKRKFTILNDVSGTIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPPSSGKT+LLLALAG+LDP+L+  GRV+YNGH MNEFVP RTAAYISQHD 
Sbjct  177   PRRLTLLLGPPSSGKTTLLLALAGKLDPNLKVMGRVTYNGHGMNEFVPQRTAAYISQHDT  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG RY+MLAELSRREKAANI+PDPD+D+FMKAAAT+GQK N
Sbjct  237   HIGEMTVRETLAFSARCQGVGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKEN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY +K+LGL+ C DT+VG+E +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDS
Sbjct  297   VVTDYTLKILGLDICADTMVGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STT+QI+ S+K  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+ QIVYQGP   V+EFF
Sbjct  357   STTYQIINSLKQTIHILNGTAVISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVVEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CP RKGVADFLQEVTSRKDQ QYW RKD  PY FVT+ EF+EAFQSFHIGR + 
Sbjct  417   ESMGFKCPARKGVADFLQEVTSRKDQAQYWARKD-VPYSFVTVKEFAEAFQSFHIGRKVA  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELA+PF ++ SHPAALTTK YGV K ELL +  SRE LLMKRN  ++IF++  + +MA+
Sbjct  476   DELASPFDRAKSHPAALTTKKYGVRKKELLDANMSREYLLMKRNSFVYIFKLTQLAVMAV  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF+RT M +NS     IY  +LFFT+ +IMF+ + ELA  I +LP+FYKQRDLLFY
Sbjct  536   IAMTLFLRTEMHKNSTDDGNIYTGALFFTVVMIMFNGMAELAMAIAKLPVFYKQRDLLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAYA+PT++LRIPIT +EV VWVF TYYVIG+DPN  RL + ++LL++  Q+AS LFR
Sbjct  596   PAWAYALPTWVLRIPITFVEVGVWVFITYYVIGFDPNVERLFRQYLLLLLVNQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A  GR+M  A   G+F +L+L ALGGFILS D+VKKWWIWGYW SPLMYAQNAI VNE
Sbjct  656   FIAAAGRNMIVANTFGAFALLMLLALGGFILSYDNVKKWWIWGYWSSPLMYAQNAIVVNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFT-IFSIFIYTLALAKL  808
             FLGKSW+  +  S+E  GV VLK RG F +A+WYW+G GAL+GF  +F+IF YTL L  L
Sbjct  716   FLGKSWSKNVTDSTESLGVTVLKSRGFFTDAHWYWIGAGALLGFIFVFNIF-YTLCLNYL  774

Query  807   RPLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIK  628
                 + +A I+ ES + +   +  G    + E +++   N+K GM+LPF+PHSI F+DI+
Sbjct  775   NLFEKPQAVITEESDNAKTATTERGE--QMVEAIAEANHNKKKGMVLPFQPHSITFDDIR  832

Query  627   YCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY  448
             Y VDMP+EMK +G  ++RLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY
Sbjct  833   YSVDMPEEMKSQGALEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY  892

Query  447   IEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLF  268
             IEG ITISG+ KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLPS+V  ETRK+F
Sbjct  893   IEGNITISGYPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSDVNSETRKMF  952

Query  267   IKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARA  88
             I+EVMELVELT LR+A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARA
Sbjct  953   IEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARA  1012

Query  87    AAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1013  AAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1041


 Score =   133 bits (334),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 123/570 (22%), Positives = 245/570 (43%), Gaps = 76/570 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  853   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  911

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D++    
Sbjct  912   ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLPSDVN----  945

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  946   -----SETRKMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1000

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1001  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLMKRGGQEIY  1059

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++ +FE +      + G   A ++ EVT+   +    +            
Sbjct  1060  VGPLGRHSSHLINYFEGIEGVSKIKDGYNPATWMLEVTTGAQEGTLGV------------  1107

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSK-----MELLKSCFSREV  1591
              +F+E +++  + R   D +     K  S PA  T   Y  ++          +C  ++ 
Sbjct  1108  -DFTEIYKNSDLYRRNKDLI-----KELSQPAPGTKDLYFATQYSQPFFTQFLACLWKQR  1161

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +AL+  T+F     +R         M S++  +  +     
Sbjct  1162  WSYWRNPPYTAVRFLFTTFIALMFGTMFWDLGTERTRQQDLLNAMGSMYAAVLFLGVQNA  1221

Query  1410  QELAPTIF-RLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
             Q + P +     +FY++R    Y A  YA    ++ IP    +  V+    Y +IG++  
Sbjct  1222  QSVQPVVVVERTVFYRERAAGMYSALPYAFGQALVEIPYVFAQAVVYGVIVYAMIGFEWT  1281

Query  1233  FGRLLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFIL  1072
               +           +L   F  + +V    AA   + + +      + +  LF+  GFI+
Sbjct  1282  AAKFFWYLFFMFFTLLYFTFYGMMAV----AATPNQHIASIVAAAFYGLWNLFS--GFIV  1335

Query  1071  SRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              R+ +  WW W YWI P+ +    +  ++F
Sbjct  1336  PRNRIPVWWRWYYWICPVAWTLYGLVTSQF  1365



>ref|XP_010023521.1| PREDICTED: ABC transporter G family member 40-like [Eucalyptus 
grandis]
Length=1439

 Score =  1425 bits (3689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/1063 (66%), Positives = 855/1063 (80%), Gaps = 23/1063 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW---SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             ME  D    S S R  SS++    +   D F++SS     D+DDE +L+WAAL+K+PTF+
Sbjct  1     MEGGDIYRASNSLRATSSTMQMHHATTMDVFSRSSC----DEDDEESLRWAALEKLPTFE  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   E+DI N+G+ E+K+++ERL++V E DNE+FLLKL++R++RV I++
Sbjct  57    RLRKGILTAGGGAN-EIDIRNLGFHERKRLIERLVRVTEEDNESFLLKLRNRIDRVGIEL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKKHNSILRDVSGII  2608
             P +EVRFEHLNV  EA+ G RALP+V NFC +ILEG L+++++   KK+ +IL+DVSGII
Sbjct  116   PTIEVRFEHLNVEVEAHEGSRALPTVINFCTSILEGFLNFMHILPRKKYLTILQDVSGII  175

Query  2607  KPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHD  2428
             KPGRMTLLLGPP+SGKT+LLLALA +LDP LE +GRV+YNGH MNEFVP RTAAYISQH+
Sbjct  176   KPGRMTLLLGPPNSGKTTLLLALASKLDPKLETTGRVTYNGHVMNEFVPQRTAAYISQHN  235

Query  2427  LHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKA  2248
             LHI EMT RETLAFS RCQGVGSRY+ML+ELSRREKAANI+PDPDIDIFMKAAAT+GQ+A
Sbjct  236   LHIGEMTVRETLAFSTRCQGVGSRYDMLSELSRREKAANIKPDPDIDIFMKAAATEGQEA  295

Query  2247  NVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLD  2068
             NV+ DYI+K+LGLE C DT+VG+E LRG+SGGE+KR+T GEMLVGPA V  MDEISTGLD
Sbjct  296   NVVTDYILKMLGLEKCADTMVGDEMLRGISGGEQKRVTIGEMLVGPAKVFFMDEISTGLD  355

Query  2067  SSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEF  1888
             SSTT+QI+ S+K +IHIL GTAVI+LLQPAPE YDLFDDII++ +GQ+VYQGP   VL+F
Sbjct  356   SSTTYQIVNSLKKFIHILDGTAVISLLQPAPETYDLFDDIIILFDGQMVYQGPRELVLDF  415

Query  1887  FECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNL  1708
             FE +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF+EAFQSFH+GR L
Sbjct  416   FESMGFKCPRRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVQEFAEAFQSFHVGRKL  474

Query  1707  GDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMA  1528
             GDEL+TPF KS +HPAALTTK +GV   +LLK+   RE LLMKRN  ++IF+V  +++MA
Sbjct  475   GDELSTPFDKSKNHPAALTTKRFGVGMKDLLKAWILREYLLMKRNSFVYIFKVTQLIIMA  534

Query  1527  LITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLF  1348
              I+MTLF+RT M R++     +Y+ +LFFT+  IMF+ + EL+ TI +LPIFYKQRDLLF
Sbjct  535   FISMTLFLRTKMHRDTVTDGGVYIGALFFTMITIMFNGMAELSMTIAKLPIFYKQRDLLF  594

Query  1347  YPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF  1168
             YPAWAYA+PT+IL+IPIT +EV+VWVF TYYVIGYDPN GRL K ++LL+   Q+AS LF
Sbjct  595   YPAWAYALPTWILKIPITFVEVAVWVFITYYVIGYDPNVGRLFKQYLLLVAVNQMASGLF  654

Query  1167  RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVN  988
             R  A +GR++  A   GSF++  LFALGG +LSR++VKKWWIW YWISPLMY QNAI VN
Sbjct  655   RLIAALGRNLIVANTFGSFVLFALFALGGVVLSREEVKKWWIWAYWISPLMYGQNAIVVN  714

Query  987   EFLGKSWNTVLPFS--SEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALA  814
             E LG +WN + P S  +EP G+ VLK RG F EAYWYW+GVGAL GF I   F +++ALA
Sbjct  715   ELLGSNWNKIPPNSRTNEPLGIQVLKSRGFFTEAYWYWIGVGALFGFIILFNFGFSVALA  774

Query  813   KLRPLAQSRANIS--AESHSNEHDVSNGGSDNSVGERVSDG----------MSNRKHGMI  670
              L P  +S    S   E + N + +       S G R S             +NRK GM+
Sbjct  775   LLNPFGKSHTVKSDDPEGNKNVNRIEGSIQLQSQGSRRSSEPTPPWPETAVAANRKRGMV  834

Query  669   LPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKT  490
             LPF+ HSI F++I Y VDMP+EMK +G  +++L LL+GVSGAFRPGVLTALMGVSGAGKT
Sbjct  835   LPFKQHSITFDEITYSVDMPREMKNQGALEDKLVLLEGVSGAFRPGVLTALMGVSGAGKT  894

Query  489   TLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWL  310
             TLMDVLAGRKTGGYI+G ITISG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+SAWL
Sbjct  895   TLMDVLAGRKTGGYIKGNITISGYPKNQDTFARISGYCEQNDIHSPHITVYESLIYSAWL  954

Query  309   RLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSI  130
             RLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVANPSI
Sbjct  955   RLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSI  1014

Query  129   IFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  IFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1057


 Score =   146 bits (369),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 147/631 (23%), Positives = 272/631 (43%), Gaps = 87/631 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  869   LLEGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IKGNITISGYPKNQDTFAR  927

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  928   ISGYCEQNDIHSPHITVYESLIYSAW----------------------LRLPPGVD----  961

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  962   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1016

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1017  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1075

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1076  VGPLGRHSSHLIEYFEGIQGVGKIKDGYNPATWMLEVTSPTQELALGV------------  1123

Query  1755  NEFSEAFQSFHIGRN---LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++  + R    L +EL+ P            TK Y  S    L +C  ++   
Sbjct  1124  -DFSDLYKNSDLYRRNNALIEELSIP--PPNFKDLYFPTK-YSQSTFTQLMACLWKQRWS  1179

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + ++ AL+  T+F     +          M S++  L + + +A   
Sbjct  1180  YWRNPPYTAVRFLFTIVTALMFGTMFWDLGSKTTRSQDLINAMGSMYGALFLGVQNAASV  1239

Query  1404  LAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGR  1225
                      +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+     +
Sbjct  1240  QPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLVQAISYGIIVYAMIGFKWTVAK  1299

Query  1224  LLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDV  1057
                 W L  +   L    +     VG  MT    V S +    +A+     GFIL R  +
Sbjct  1300  FF--WYLFFMCFTLLYFTYYGMMAVG--MTPNHHVASIVSFAFYAIWNLFSGFILPRTRI  1355

Query  1056  KKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFPE  895
               WW W YW+ P+ +    + +++F      L  +  TV  +  + FG     YR  F  
Sbjct  1356  PIWWRWYYWLCPVSWTLYGLVISQFGDLTNRLEDTGGTVEEYMRDYFG-----YRHDF--  1408

Query  894   AYWYWLGVGA--LIGFTIFSIFIYTLALAKL  808
                  LGV A  ++GFT+   F++ +++  L
Sbjct  1409  -----LGVIAVVMVGFTMLFAFVFAISIKIL  1434



>gb|KDO79586.1| hypothetical protein CISIN_1g046196mg [Citrus sinensis]
Length=1436

 Score =  1425 bits (3688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/1057 (67%), Positives = 850/1057 (80%), Gaps = 14/1057 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             M+   +  R  S R+ SSS+W N T D FA+SSR    DDD+  AL WAA++K+PT+ R+
Sbjct  1     MDAGQASFRISSARLGSSSIWRNNTLDVFARSSREDTYDDDE--ALTWAAIEKLPTYLRV  58

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++T   G+  EVDI N+G+ E++ ++ERL+K+ E DNE FLLKLKDR+ERV +DIP 
Sbjct  59    QRGMLTEDEGQAREVDIKNLGFIERRNLIERLLKIAEEDNEKFLLKLKDRIERVGLDIPT  118

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEHLNV AEAY+G RALP+V N C N+LEG L+YL+ LP+ KK  +IL DVSGIIK
Sbjct  119   IEVRFEHLNVEAEAYIGSRALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIK  178

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPPSSGKT+LLLALAG+L   L+FSGRV+YNGH M EFVP RT+AYISQ+DL
Sbjct  179   PQRLTLLLGPPSSGKTTLLLALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDL  238

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG RYE+L ELSRREKAANI+PDPDID+ MKAA+ +GQ+ N
Sbjct  239   HIGEMTVRETLAFSARCQGVGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKN  298

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY++K+LGLE C DT+VG+E LRG+SGG+RKRLT GEMLVGPA  L MDEISTGLDS
Sbjct  299   VVTDYVLKILGLEVCADTMVGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDS  358

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STT+QI+ S++  IHIL+GTAVI+LLQPAPE Y+LFDD+IL+S+GQIVYQGP   VLEFF
Sbjct  359   STTYQIVNSLRQSIHILNGTAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFF  418

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTSRKDQ QYW  KD +PY FVT  EFSE FQSFHIG+ LG
Sbjct  419   ERMGFKCPERKGVADFLQEVTSRKDQEQYWANKD-EPYSFVTAKEFSEVFQSFHIGQKLG  477

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELATPF KS SHPAALTTK YG SK ELLK+CF+RE LLMKRN  ++ F++  +   A 
Sbjct  478   DELATPFDKSKSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSAS  537

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             + MTLF+RT M R++     IYM +LFF +  IMF+   EL+ TI +LP+FYKQRD LF+
Sbjct  538   VAMTLFLRTEMHRSTVEDGGIYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFF  597

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAY++PT+IL+IPIT IEV +WVF TYYV+G++ N  R +K + LL+   Q AS LFR
Sbjct  598   PAWAYSLPTWILKIPITFIEVGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFR  657

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                 +GR++  A   GSF  L +  LGGFILSRDDVKKWW+WGYW SP+MY QNA+AVNE
Sbjct  658   LMGALGRNIIVANTFGSFANLTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNE  717

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW  V P S+EP GV++LK RGLFP AYWYW+GVGAL+G+ +   F++T+AL  L 
Sbjct  718   FLGKSWGHVPPNSTEPLGVVILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLD  777

Query  804   PLAQSRANISAESHSNEHDVS-------NGGSDNSVGE--RVSDGMSNRKHGMILPFEPH  652
             P  + +A +S E+ + ++          + G  +S GE    ++   NRK GMILPFEPH
Sbjct  778   PFGKPQAILSEEALAKKNACKTEEPVELSSGVQSSYGEVRSFNEADQNRKRGMILPFEPH  837

Query  651   SIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVL  472
             SI F+DI+Y +DMPQEMK +G+ D+RLE LKGVSGAFRPGVLTALMGVSGAGKTTLMDVL
Sbjct  838   SITFDDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTALMGVSGAGKTTLMDVL  897

Query  471   AGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEV  292
             AGRKTGGY+ G ITISG+ K Q+TFARISGYCEQ DIHSPH+TVYESL++SAWLRLP EV
Sbjct  898   AGRKTGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEV  957

Query  291   TCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEP  112
               +TRK+F++EVMELVEL  +REA+VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEP
Sbjct  958   DSDTRKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEP  1017

Query  111   TSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             TSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1018  TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1054


 Score =   147 bits (370),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 131/563 (23%), Positives = 254/563 (45%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
              L+ VSG  +PG +T L+G   +GKT+L+  LAG+       SG ++ +G+  N+    R
Sbjct  866   FLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-VSGSITISGYPKNQETFAR  924

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P++D    
Sbjct  925   ISGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPEVD----  958

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                +D +K  + V+ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  959   ---SDTRK--MFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1013

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G + +Y
Sbjct  1014  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLMKRGGEEIY  1072

Query  1917  QGP----CNCVLEFFECLGF--RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    C+ ++++FE +    +  E    A ++ EVT+   +    I        F  +
Sbjct  1073  VGPLGRHCSQLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGIN-------FAKV  1125

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + +  EL+ P     S      T+ Y  S      +C  ++ L   R
Sbjct  1126  YKNSELYKG---NKEMIKELSIP--PPGSKNLYFQTR-YSQSFFTQCMACLWKQHLSYWR  1179

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R +       M S++  +  +       + P
Sbjct  1180  NPPYTAVRLFFTTFIALMFGTIFWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQP  1239

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   I+  ++    Y +IG+D    + L
Sbjct  1240  VVAVERTVFYRERAAGMYSALPYAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFL  1299

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W LL ++  L  + F    ++  ++T    + + I    + L     GFI+ R  +  
Sbjct  1300  --WYLLFMY--LTFLYFTLYGMMTVAVTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPI  1355

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W  WI P+ +    +  ++F
Sbjct  1356  WWRWYCWICPVSWTLYGLVASQF  1378



>ref|XP_004486707.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cicer 
arietinum]
Length=1423

 Score =  1425 bits (3688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1049 (66%), Positives = 854/1049 (81%), Gaps = 12/1049 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D    + S R  SS++W N G + F+KSSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGTDIYRATNSLRARSSTVWRNSGVEVFSKSSR----EEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   E+D+ ++ ++EK+K+LERL+KV E DNE FLLKLK+R++RV +D+P 
Sbjct  57    RKGLLTTSHGAANEIDVTDLDFQEKQKLLERLVKVAEEDNEGFLLKLKERVDRVGLDLPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIK  2605
             +EVR+EHL + AEA+VG RALPS  N   N++EGLL+ L++ P+ K+H +IL+DVSG+IK
Sbjct  117   IEVRYEHLKIDAEAFVGSRALPSFINAATNVVEGLLNVLHIVPSKKRHVAILKDVSGVIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPP SGKT+LLLAL+G+LDPSL+ SG V+YNGH +NEFVP RTAAYISQHD+
Sbjct  177   PRRMTLLLGPPGSGKTTLLLALSGKLDPSLQLSGSVTYNGHGLNEFVPQRTAAYISQHDV  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPDID++MKA AT+GQK +
Sbjct  237   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDIDVYMKAIATEGQKYS  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             +  DY++K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  297   ISTDYVLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++ Y+HI++GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FF
Sbjct  357   STTFQIVSSLRQYVHIMNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CP+RKGVADFLQEVTSRKDQ QYW+R+D +PYRFVT+ +F+EAFQSFHIGR L 
Sbjct  417   ESMGFKCPDRKGVADFLQEVTSRKDQAQYWVRRD-QPYRFVTVTQFAEAFQSFHIGRKLT  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +EL+ PF K+ SHPAALTTK YG++K ELLK+ FSRE LLMKRN  ++IF++  + +MAL
Sbjct  476   EELSVPFDKTKSHPAALTTKEYGLNKKELLKANFSREYLLMKRNSFVYIFKLTQLFIMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF RT M RN+   A +Y  +LFFTL  IMF+ + E++ TI +LP+FYKQRDLLFY
Sbjct  536   IAMTLFFRTEMHRNNQDDAGVYAGALFFTLVTIMFNGMSEISMTIAKLPVFYKQRDLLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IP+T +EV++WVF TYYVIG+DPN GR  K +++L    Q+AS LFR
Sbjct  596   PSWAYAIPSWILKIPVTMVEVALWVFLTYYVIGFDPNIGRFFKQFLILFFTSQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   GSF +L L ALGGFILSR D+K WWIWGYWISPLMY QNA+  NE
Sbjct  656   AIAALGRNMIVANTFGSFAVLTLLALGGFILSRKDIKSWWIWGYWISPLMYGQNALMANE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG +W+     ++   G L L  RG FP AYWYW+G+G L+GF      ++ +ALA L 
Sbjct  716   FLGNNWHN----ATFDLGKLYLDNRGFFPHAYWYWIGIGGLVGFVFLFNALFGVALAVLG  771

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNS-VGERVSDGMSNRKHGMILPFEPHSIAFNDIK  628
             P  + +A I+ +S     +V     ++S  G+ V++    +K GM+LPFEPHSI F+DI 
Sbjct  772   PFDKPQATITEDSEEVVEEVELPRIESSGRGDSVTESSHGKKKGMVLPFEPHSITFDDIV  831

Query  627   YCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY  448
             Y VDMP EMK +GV+++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY
Sbjct  832   YSVDMPAEMKEQGVQEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY  891

Query  447   IEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLF  268
             I+G I +SG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS V   TRK+F
Sbjct  892   IDGSIKVSGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSGVDSNTRKMF  951

Query  267   IKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARA  88
             I EVM+LVEL SLR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLDARA
Sbjct  952   IDEVMDLVELNSLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARA  1011

Query  87    AAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  AAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1040


 Score =   127 bits (319),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 120/567 (21%), Positives = 242/567 (43%), Gaps = 70/567 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  852   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKVSGYPKKQETFAR  910

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  911   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  939

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +  D     + +D ++ ++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  940   PSGVDSNTRKMFIDEVMDLVELNSLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  999

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1000  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1058

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +        G   A ++ EVT+         ++ N    F   
Sbjct  1059  VGPLGRHSTHLIKYFESIEGVSKINNGYNPATWMLEVTTTA-------QEHNLGVDFTDY  1111

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVLLMK  1579
              + S+ ++     + L  EL  P   S   H     ++++ V      ++C  ++     
Sbjct  1112  YKNSDLYRR---NKQLIQELGQPAPGSKDLHFPTQFSQSFLVQ----CQACLWKQRWSYW  1164

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE--  1405
             RN         +   +AL+  T+F     + +S    Q  ++++    T ++F  +Q   
Sbjct  1165  RNPPYTAVRFFFTTFIALMFGTIFWDLGGKHSS---RQDLLNAVGSMYTAVLFLGVQNSS  1221

Query  1404  -LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
              + P +     +FY+++    Y A  YA    ++ +P    +   +    Y +IG++   
Sbjct  1222  SVQPVVAVERTVFYREKAAGMYSALPYAFSQILVELPYVFAQAVTYGVIVYAMIGFEWTA  1281

Query  1230  GRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRD  1063
              +    W L  ++  L    F     V  ++T    V S +    +A+     GF++ R 
Sbjct  1282  EKFF--WYLFFMYFTLLYFTFYGMMAV--AVTPNHHVASIVAAAFYAIWNLFSGFVVPRP  1337

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  WW W YW  P+ +    +  ++F
Sbjct  1338  SIPIWWRWYYWACPVAWTIYGLVASQF  1364



>emb|CBI36223.3| unnamed protein product [Vitis vinifera]
Length=1707

 Score =  1424 bits (3686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 717/1096 (65%), Positives = 863/1096 (79%), Gaps = 43/1096 (4%)
 Frame = -2

Query  3174  AFYIVL---CS*VVAME---INDSRGR--SGSFRINSSSLWSN-GTDGFAKSSRRLQEDD  3022
              F++VL    S  VAME   I  + GR  SGSFR NSSS+W N G + F++SSR    D+
Sbjct  134   GFWLVLQGGSSFRVAMETAEIYTASGRRASGSFRKNSSSIWRNSGAEVFSRSSR----DE  189

Query  3021  DDEAALKWAALQKVPTFDRLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDN  2842
             DDE ALKWAAL+K+PT++RL+KGL+ G  GE  EVDI+N+G +E+K ++ERL+K+ E DN
Sbjct  190   DDEEALKWAALEKLPTYNRLRKGLLIGSEGEASEVDIHNLGPQERKNLVERLVKIAEEDN  249

Query  2841  ETFLLKLKDRMERVAIDIPKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYL-  2665
             E FLLKLK+RM+RV ID+P++EVRFEHL + AEA+VG RALPS  N   N +E +L+ L 
Sbjct  250   EKFLLKLKNRMDRVGIDLPEIEVRFEHLTIDAEAHVGSRALPSFINSVFNQIEDILNTLR  309

Query  2664  YLPTTKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNG  2485
              LP+ KK  +IL DVSGIIKPGRMTLLLGPPSSGKT+LLLAL+G+LD SL+ +GRV+YNG
Sbjct  310   ILPSRKKKFTILHDVSGIIKPGRMTLLLGPPSSGKTTLLLALSGKLDSSLKVTGRVTYNG  369

Query  2484  HEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIR  2305
             H MNEFVP RTAAYISQ D HI EMT RETLAFSARCQGVG RY+ML ELSRREKAANI+
Sbjct  370   HGMNEFVPQRTAAYISQLDTHIGEMTVRETLAFSARCQGVGDRYDMLVELSRREKAANIK  429

Query  2304  PDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGE  2125
             PDPDID+FMKAAA +GQK NVI DY +K+LGLE C DT+VG+E +RG+SGG+RKR+T GE
Sbjct  430   PDPDIDVFMKAAAAEGQKENVITDYTLKILGLEICADTMVGDEMVRGISGGQRKRVTTGE  489

Query  2124  MLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDII  1945
             MLVGP+  L MDEISTGLDSSTT+QI+ S++  +HIL+GTA+I+LLQPAPE YDLFDDII
Sbjct  490   MLVGPSKALFMDEISTGLDSSTTYQIVNSLRQTVHILNGTALISLLQPAPETYDLFDDII  549

Query  1944  LISEGQIVYQGPCNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRF  1765
             L+S+ +I+YQGP   VL FFE +GFRCPERKGVADFLQEVTSRKDQ QYW  KD +PY F
Sbjct  550   LLSDSRIIYQGPREDVLNFFESMGFRCPERKGVADFLQEVTSRKDQEQYWAHKD-EPYSF  608

Query  1764  VTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
             VT  EF+EAFQSFH GR LGDELATPF K+ SHPAAL T+ YGV K ELL +C SRE LL
Sbjct  609   VTAKEFAEAFQSFHFGRKLGDELATPFDKTKSHPAALKTEKYGVRKKELLDACISREYLL  668

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
             MKRN  ++IF++  + ++A+I MT+F+RT M +N+     IY  +LFFT+ ++MF+ + E
Sbjct  669   MKRNSFVYIFKLTQLTIVAMIAMTIFLRTEMHKNTTEDGNIYTGALFFTVMMVMFNGMSE  728

Query  1404  LAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGR  1225
             LA TI +LP+FYKQR LLFYPAWAYA+P++ L+IPIT +EV VWVF TYYVIG+DPN GR
Sbjct  729   LAMTILKLPVFYKQRGLLFYPAWAYALPSWFLKIPITFVEVGVWVFITYYVIGFDPNVGR  788

Query  1224  LLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWW  1045
             L + ++LL++  Q AS LFR  A   RSM  A   GSF +++ FALGG +LSR++VKKWW
Sbjct  789   LFRQYLLLLLLNQTASSLFRFIAAACRSMIVANTFGSFALVLPFALGGIVLSRENVKKWW  848

Query  1044  IWGYWISPLMYAQNAIAVNEFLGKSWN-TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVG  868
             IWGYW SP+MYAQNAI VNEFLGKSW+      S+E  GV VLK RG F EA+WYW+G G
Sbjct  849   IWGYWSSPMMYAQNAILVNEFLGKSWSKNASTNSTESLGVAVLKARGFFTEAHWYWIGAG  908

Query  867   ALIGFTIFSIFIYTLALAKLRPLAQSRANISAESHSNEHD---------------VSNGG  733
             AL+GF     F YT+AL  L P  + +A I+ ES + + +                ++  
Sbjct  909   ALLGFIFVFNFCYTVALTYLNPFEKPQAVITVESDNAKTEGKIELSSHRKGSIDQTASTE  968

Query  732   SDNSVG------------ERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEG  589
             S   +G            E +++   N K GM+LPF+P SI F+DI+Y VDMP+EMK +G
Sbjct  969   SGEEIGRSISSVSSSVRAEAIAEARRNNKKGMVLPFQPLSITFDDIRYSVDMPEEMKSQG  1028

Query  588   VEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKK  409
             V ++RLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG I+ISG+ KK
Sbjct  1029  VPEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGSISISGYPKK  1088

Query  408   QKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSL  229
             Q+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLP  V  ETRK+FI+EVMELVELT L
Sbjct  1089  QETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPPNVDAETRKMFIEEVMELVELTPL  1148

Query  228   REAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVD  49
             R A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VD
Sbjct  1149  RGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVD  1208

Query  48    TGRTIVCTIHQPSIDI  1
             TGRT+VCTIHQPSIDI
Sbjct  1209  TGRTVVCTIHQPSIDI  1224


 Score =   144 bits (364),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 133/568 (23%), Positives = 248/568 (44%), Gaps = 72/568 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +S +G+   +    R
Sbjct  1036  LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGSISISGYPKKQETFAR  1094

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P++D    
Sbjct  1095  ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLPPNVD----  1128

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  1129  -----AETRKMFIEEVMELVELTPLRGALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1183

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G Q +Y
Sbjct  1184  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKRGGQEIY  1242

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EVT+   ++   +        F  I
Sbjct  1243  MGPLGRHSSHLIKYFEGIEGVSKIKDGYNPATWMLEVTASAQELILGVD-------FTEI  1295

Query  1755  NEFSEAFQSFHIGRNLGDELA--TPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLM  1582
              E S+ ++     ++L  EL+  TP  K    P       Y  S      +C  ++ L  
Sbjct  1296  YEKSDLYRR---NKDLIKELSQPTPGSKDLYFPT-----QYSQSFFTQCMACLWKQRLSY  1347

Query  1581  KRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQEL  1402
              RN         +   +AL+  T+F     +R         M S++  +  + F   Q +
Sbjct  1348  WRNPPYTAVRFFFTTFVALMFGTMFWDLGTKRTRQQDISNAMGSMYAAVLFLGFQNGQSV  1407

Query  1401  APTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGR  1225
              P +     +FY++R    Y A  YA    ++ IP    +  V+    Y +IG++    +
Sbjct  1408  QPVVAVERTVFYRERAAGMYSAMPYAFAQALVEIPYVFSQAVVYGVIVYAMIGFEWTAAK  1467

Query  1224  LLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLV-LFALGGFILSR  1066
                        +L   F  + +V     A        A V  SF  L  LF+  GFI+ R
Sbjct  1468  FFWYLFFMFFSLLYFTFYGMMAV-----AATPNQHIAAIVASSFYTLWNLFS--GFIVPR  1520

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             + +  WW W YW  P+ ++   +  ++F
Sbjct  1521  NRIPVWWRWYYWACPVAWSLYGLVTSQF  1548



>ref|XP_002527332.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF35084.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1443

 Score =  1424 bits (3686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/1045 (67%), Positives = 844/1045 (81%), Gaps = 23/1045 (2%)
 Frame = -2

Query  3081  LWSNGT--DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKG-LMTGLRGETFEVDI  2911
             +W+N T  D F+ SSR    ++DDE ALKWAAL+++PT+DRL+KG L +  R    E+D+
Sbjct  21    IWTNNTIPDIFSMSSR----EEDDEEALKWAALERLPTYDRLRKGILFSASRNGANEIDV  76

Query  2910  NNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNVGAEAYVG  2731
              ++G+ E+K +LERL++V E DNE FLLKLK+R++RV I++P +EVRFE+LN+ AEA+VG
Sbjct  77    GSLGFHERKLLLERLLRVVEEDNEEFLLKLKNRIDRVGIELPTIEVRFENLNIEAEAFVG  136

Query  2730  KRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTS  2554
              RALP+  NF +N+ EG L+ L+ LP+ KK  +IL+DVSG+IKP RMTLLLGPPSSGKT+
Sbjct  137   SRALPTFVNFSINLFEGFLNSLHILPSRKKQLTILKDVSGVIKPSRMTLLLGPPSSGKTT  196

Query  2553  LLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARC  2374
             LLLALAG+LDP+L+FSG V+YNGH MNEF+P  TAAYISQHDLHI EMT RETL+FS RC
Sbjct  197   LLLALAGKLDPNLKFSGNVTYNGHGMNEFIPQSTAAYISQHDLHIGEMTVRETLSFSVRC  256

Query  2373  QGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCED  2194
             QGVG+R +ML ELSRREKAANI+PDPDID+FMKA AT+GQ+ NV+ DY++K+LGLE C D
Sbjct  257   QGVGTRNDMLVELSRREKAANIKPDPDIDVFMKAVATEGQETNVVTDYVLKILGLEVCAD  316

Query  2193  TIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHIL  2014
             T+VG+E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTT+QI+ S+K  IHIL
Sbjct  317   TLVGDEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSLKQTIHIL  376

Query  2013  HGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERKGVADFL  1834
              GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFFE +GF+CPERKGVADFL
Sbjct  377   DGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPREHVLEFFEYMGFKCPERKGVADFL  436

Query  1833  QEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAAL  1654
             QEVTS+ DQ QYW++KD +PY FVT+ EFSEAFQS+ +G+ +G EL+TPF KS SHPAAL
Sbjct  437   QEVTSKNDQKQYWVQKD-QPYSFVTVQEFSEAFQSYDVGQIIGQELSTPFDKSKSHPAAL  495

Query  1653  TTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPI  1474
               + YGV KMELLK+CF+RE LLMKRN  ++IF++  +V+MA+I+MTLF+RT M R    
Sbjct  496   AARKYGVDKMELLKACFAREYLLMKRNSFVYIFKLTQLVVMAIISMTLFLRTEMHREDLT  555

Query  1473  GAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPIT  1294
              A +Y+ +LFF+L  IMF+ + EL+ TI +LP+FYKQRDL FYP WAYA+PT+IL+IPIT
Sbjct  556   DAGVYLGALFFSLIAIMFNGMSELSMTIAKLPVFYKQRDLQFYPPWAYALPTWILKIPIT  615

Query  1293  CIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGS  1114
               EV VWVF TYYVIG+DPN  RL K + LL+I  Q+AS LFR  A VGR+M  A   GS
Sbjct  616   FFEVGVWVFITYYVIGFDPNVERLFKQYFLLLIVNQMASGLFRFIAAVGRNMIVANTFGS  675

Query  1113  FIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLP--FSSE  940
             F +L +FALGG +LSRDD+KKWW WGYWISP+MY QNA+  NEFLG+SWN V     S++
Sbjct  676   FALLTVFALGGIVLSRDDIKKWWTWGYWISPMMYGQNALVANEFLGESWNHVPANSTSTD  735

Query  939   PFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANISAESHS  760
               GV  +K RG FP AYWYW+G+GAL GFTI     +TLAL  L P  +  A IS E   
Sbjct  736   SLGVQFIKSRGFFPHAYWYWIGIGALTGFTILFNLCFTLALTHLNPYEKPHAVISDEPER  795

Query  759   NEH-----DVSNGGS------DNSVGERVSD-GMSNRKHGMILPFEPHSIAFNDIKYCVD  616
             ++       +S  GS      +N VG R++D    N+K GM+LPFEPHSI FND+ Y VD
Sbjct  796   SDRTGGAIQLSQNGSSHRTITENGVGIRMTDEANQNKKKGMVLPFEPHSITFNDVMYSVD  855

Query  615   MPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGE  436
             MPQEMK +G+ D++L LLKGVSGAF+PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG+
Sbjct  856   MPQEMKSQGIADDKLVLLKGVSGAFKPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGD  915

Query  435   ITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEV  256
             I ISG+ KKQ TFARISGYCEQNDIHSPH+TVYESLI+SAWLRL  EV  ETRK+F+ EV
Sbjct  916   IRISGYPKKQDTFARISGYCEQNDIHSPHVTVYESLIYSAWLRLAPEVDPETRKMFVNEV  975

Query  255   MELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIV  76
             MELVEL  LR+A+VGLPGVNGLST QRKRLTI+VELVANPSIIFMDEPTSGLDARAAAIV
Sbjct  976   MELVELNPLRQALVGLPGVNGLSTEQRKRLTISVELVANPSIIFMDEPTSGLDARAAAIV  1035

Query  75    MRTVRNIVDTGRTIVCTIHQPSIDI  1
             MRTVRN VDTGRT+VCTIHQPSID+
Sbjct  1036  MRTVRNTVDTGRTVVCTIHQPSIDL  1060


 Score =   137 bits (344),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 139/620 (22%), Positives = 268/620 (43%), Gaps = 70/620 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  KPG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  872   LLKGVSGAFKPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIRISGYPKKQDTFAR  930

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P++D    
Sbjct  931   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLAPEVD----  964

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  965   -----PETRKMFVNEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTISVELVANPSIIF  1019

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1020  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDLFEAFDELFLMKRGGEEIY  1078

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      + G   A ++ EVTS   ++   +        F TI
Sbjct  1079  VGPLGRHSCHMIDYFEVIEGASKVKDGYNPATWMLEVTSSAQELSLGVD-------FATI  1131

Query  1755  NEFSEAFQSFHIGRNLGDELAT--PFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLM  1582
              + SE ++     + +  EL+T  P  K    P       Y  S +    +C  ++ L  
Sbjct  1132  YKNSELYRR---NKAIIKELSTSVPGSKDLYFPTQ-----YSQSFLTQCIACLWKQRLSY  1183

Query  1581  KRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQEL  1402
              RN         +   +AL+  T+F     +  +         S++  +  +       +
Sbjct  1184  WRNPPYTAVRFLFTTFIALMFGTMFWDLGSKTRTQQDIFNSAGSMYAAVVFLGTQNAASV  1243

Query  1401  APTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGR  1225
              P +     +FY++R    Y A  YA    ++ IP    +  V+   TY +IG++    +
Sbjct  1244  QPVVAIERTVFYRERAAGMYSALPYAYAQVLVEIPYIFAQAVVYGLLTYSMIGFEWTAAK  1303

Query  1224  LLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDDVKK  1051
                 W +  ++  L    +     V  +  +  A VV S    +     GFI+ R  +  
Sbjct  1304  FF--WYIFFMYFTLMYFTYYGMMAVAVTPNHHIASVVSSAFYGIWNLFSGFIVPRTRMPV  1361

Query  1050  WWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGV  871
             WW W YW+ P+ +    +  ++F            S+     V +Y G+  +    +LGV
Sbjct  1362  WWRWYYWVCPVSWTLYGLIGSQF--SDIKDAFEGGSQTVEDFVREYYGIRHD----FLGV  1415

Query  870   GA--LIGFTIFSIFIYTLAL  817
              A  ++G T+   FI+ +++
Sbjct  1416  VAAVIVGTTVLFAFIFAVSI  1435



>ref|XP_006476216.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X4 [Citrus sinensis]
Length=1446

 Score =  1423 bits (3684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1067 (66%), Positives = 851/1067 (80%), Gaps = 24/1067 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             M+   +  R  S R+ SSS+W N T D FA+SSR    DDD+  AL WAA++K+PT+ R+
Sbjct  1     MDAGQASFRISSARLGSSSIWRNNTLDVFARSSREDTYDDDE--ALTWAAIEKLPTYLRV  58

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++T   G+  EVDI N+G+ E++ ++ERL+K+ E DNE FLLKLKDR+ERV +DIP 
Sbjct  59    QRGMLTEDEGQAREVDIKNLGFIERRNLIERLLKIAEEDNEKFLLKLKDRIERVGLDIPT  118

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEHLNV AEAY+G RALP+V N C N+LEG L+YL+ LP+ KK  +IL DVSGIIK
Sbjct  119   IEVRFEHLNVEAEAYIGSRALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIK  178

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPPSSGKT+LLLALAG+L   L+FSGRV+YNGH M EFVP RT+AYISQ+DL
Sbjct  179   PQRLTLLLGPPSSGKTTLLLALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDL  238

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG RYE+L ELSRREKAANI+PDPDID+ MKAA+ +GQ+ N
Sbjct  239   HIGEMTVRETLAFSARCQGVGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKN  298

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY++K+LGLE C DT+VG+E LRG+SGG+RKRLT GEMLVGPA  L MDEISTGLDS
Sbjct  299   VVTDYVLKILGLEVCADTMVGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDS  358

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STT+QI+ S++  IHIL+GTAVI+LLQPAPE Y+LFDD+IL+S+GQIVYQGP   VLEFF
Sbjct  359   STTYQIVNSLRQSIHILNGTAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFF  418

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTSRKDQ QYW  KD +PY FVT  EFSE FQSFHIG+ LG
Sbjct  419   ERMGFKCPERKGVADFLQEVTSRKDQEQYWANKD-EPYSFVTAKEFSEVFQSFHIGQKLG  477

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELATPF KS SHPAALTTK YG SK ELLK+CF+RE LLMKRN  ++ F++  +   A 
Sbjct  478   DELATPFDKSKSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSAS  537

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             + MTLF+RT M R++     IYM +LFF +  IMF+   EL+ TI +LP+FYKQRD LF+
Sbjct  538   VAMTLFLRTEMHRSTVEDGGIYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFF  597

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAY++PT+IL+IPIT IEV +WVF TYYV+G++ N  R +K + LL+   Q AS LFR
Sbjct  598   PAWAYSLPTWILKIPITFIEVGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFR  657

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                 +GR++  A   GSF  L +  LGGFILSRDDVKKWW+WGYW SP+MY QNA+AVNE
Sbjct  658   LMGALGRNIIVANTFGSFANLTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNE  717

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW  V P S+EP GV++LK RGLFP AYWYW+GVGAL+G+ +   F++T+AL  L 
Sbjct  718   FLGKSWGHVPPNSTEPLGVVILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLD  777

Query  804   PLAQSRANISAESHSNEHDVS-------NGGSDNSVGERVS------------DGMSNRK  682
             P  + +A +S E+ + ++          + G  +S GE VS            +   NRK
Sbjct  778   PFGKPQAILSEEALAKKNACKTEEPVELSSGVQSSYGENVSFRTLSARVRSFNEADQNRK  837

Query  681   HGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSG  502
              GMILPFEPHSI F+DI+Y +DMPQEMK +G+ D+RLE LKGVSGAFRPGVLTALMGVSG
Sbjct  838   RGMILPFEPHSITFDDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTALMGVSG  897

Query  501   AGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIF  322
             AGKTTLMDVLAGRKTGGY+ G ITISG+ K Q+TFARISGYCEQ DIHSPH+TVYESL++
Sbjct  898   AGKTTLMDVLAGRKTGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTVYESLVY  957

Query  321   SAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVA  142
             SAWLRLP EV  +TRK+F++EVMELVEL  +REA+VGLPGV+GLST QRKRLTIAVELVA
Sbjct  958   SAWLRLPPEVDSDTRKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVA  1017

Query  141   NPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             NPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1018  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1064


 Score =   146 bits (369),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 131/563 (23%), Positives = 254/563 (45%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
              L+ VSG  +PG +T L+G   +GKT+L+  LAG+       SG ++ +G+  N+    R
Sbjct  876   FLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-VSGSITISGYPKNQETFAR  934

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P++D    
Sbjct  935   ISGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPEVD----  968

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                +D +K  + V+ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  969   ---SDTRK--MFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1023

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G + +Y
Sbjct  1024  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLMKRGGEEIY  1082

Query  1917  QGP----CNCVLEFFECLGF--RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    C+ ++++FE +    +  E    A ++ EVT+   +    I        F  +
Sbjct  1083  VGPLGRHCSQLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGIN-------FAKV  1135

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + +  EL+ P     S      T+ Y  S      +C  ++ L   R
Sbjct  1136  YKNSELYKG---NKEMIKELSIP--PPGSKNLYFQTR-YSQSFFTQCMACLWKQHLSYWR  1189

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R +       M S++  +  +       + P
Sbjct  1190  NPPYTAVRLFFTTFIALMFGTIFWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQP  1249

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   I+  ++    Y +IG+D    + L
Sbjct  1250  VVAVERTVFYRERAAGMYSALPYAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFL  1309

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W LL ++  L  + F    ++  ++T    + + I    + L     GFI+ R  +  
Sbjct  1310  --WYLLFMY--LTFLYFTLYGMMTVAVTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPI  1365

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W  WI P+ +    +  ++F
Sbjct  1366  WWRWYCWICPVSWTLYGLVASQF  1388



>emb|CBI36212.3| unnamed protein product [Vitis vinifera]
Length=1770

 Score =  1423 bits (3683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/1040 (68%), Positives = 859/1040 (83%), Gaps = 11/1040 (1%)
 Frame = -2

Query  3111  SGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLR  2935
             SGS R N SS+W S+G D F++SSR    D+DDE ALKWAAL+K+PT++RL++GL+ G  
Sbjct  356   SGSLRRNGSSIWRSSGADIFSRSSR----DEDDEEALKWAALEKLPTYNRLRRGLLMGSE  411

Query  2934  GETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLN  2755
             GE  E+DI+N+G++EKK ++ERL+KV E DNE FLLKLK+R++RV ID+P++EVRFEHL 
Sbjct  412   GEASEIDIHNLGFQEKKNLVERLVKVAEEDNEKFLLKLKNRIDRVGIDVPEIEVRFEHLT  471

Query  2754  VGAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLG  2578
             + AEA+VG RALPS  NF  + LEG+L+ +  LP+ K+  +IL DVSG IKP R+TLLLG
Sbjct  472   IDAEAFVGSRALPSFHNFIFSKLEGILNAVRILPSKKRKFTILNDVSGTIKPRRLTLLLG  531

Query  2577  PPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARE  2398
             PPSSGKT+LLLALAG+LDP+L+  GRV+YNGH MNEFVP RTAAYISQHD HI EMT RE
Sbjct  532   PPSSGKTTLLLALAGKLDPNLKVMGRVTYNGHGMNEFVPQRTAAYISQHDTHIGEMTVRE  591

Query  2397  TLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKV  2218
             TLAFSARCQGVG RY+MLAELSRREKAANI+PDPD+D+FMKAAAT+GQK NV+ DY +K+
Sbjct  592   TLAFSARCQGVGDRYDMLAELSRREKAANIKPDPDLDVFMKAAATEGQKENVVTDYTLKI  651

Query  2217  LGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKS  2038
             LGL+ C DT+VG+E +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDSSTT+QI+ S
Sbjct  652   LGLDICADTMVGDEMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIINS  711

Query  2037  IKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPE  1858
             +K  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+ QIVYQGP   V+EFFE +GF+CP 
Sbjct  712   LKQTIHILNGTAVISLLQPAPETYNLFDDIILLSDSQIVYQGPREDVVEFFESMGFKCPA  771

Query  1857  RKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQK  1678
             RKGVADFLQEVTSRKDQ QYW RKD  PY FVT+ EF+EAFQSFHIGR + DELA+PF +
Sbjct  772   RKGVADFLQEVTSRKDQAQYWARKD-VPYSFVTVKEFAEAFQSFHIGRKVADELASPFDR  830

Query  1677  STSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRT  1498
             + SHPAALTTK YGV K ELL +  SRE LLMKRN  ++IF++  + +MA+I MTLF+RT
Sbjct  831   AKSHPAALTTKKYGVRKKELLDANMSREYLLMKRNSFVYIFKLTQLAVMAVIAMTLFLRT  890

Query  1497  NMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPT  1318
              M +NS     IY  +LFFT+ +IMF+ + ELA  I +LP+FYKQRDLLFYPAWAYA+PT
Sbjct  891   EMHKNSTDDGNIYTGALFFTVVMIMFNGMAELAMAIAKLPVFYKQRDLLFYPAWAYALPT  950

Query  1317  FILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSM  1138
             ++LRIPIT +EV VWVF TYYVIG+DPN  RL + ++LL++  Q+AS LFR  A  GR+M
Sbjct  951   WVLRIPITFVEVGVWVFITYYVIGFDPNVERLFRQYLLLLLVNQMASGLFRFIAAAGRNM  1010

Query  1137  TNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTV  958
               A   G+F +L+L ALGGFILS D+VKKWWIWGYW SPLMYAQNAI VNEFLGKSW+  
Sbjct  1011  IVANTFGAFALLMLLALGGFILSYDNVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKN  1070

Query  957   LPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFT-IFSIFIYTLALAKLRPLAQSRAN  781
             +  S+E  GV VLK RG F +A+WYW+G GAL+GF  +F+IF YTL L  L    + +A 
Sbjct  1071  VTDSTESLGVTVLKSRGFFTDAHWYWIGAGALLGFIFVFNIF-YTLCLNYLNLFEKPQAV  1129

Query  780   ISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEM  601
             I+ ES + +   +  G    + E +++   N+K GM+LPF+PHSI F+DI+Y VDMP+EM
Sbjct  1130  ITEESDNAKTATTERGE--QMVEAIAEANHNKKKGMVLPFQPHSITFDDIRYSVDMPEEM  1187

Query  600   KIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISG  421
             K +G  ++RLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG ITISG
Sbjct  1188  KSQGALEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISG  1247

Query  420   FTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVE  241
             + KKQ+TFARISGYCEQNDIHSPH+TV+ESL++SAWLRLPS+V  ETRK+FI+EVMELVE
Sbjct  1248  YPKKQETFARISGYCEQNDIHSPHVTVHESLLYSAWLRLPSDVNSETRKMFIEEVMELVE  1307

Query  240   LTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR  61
             LT LR+A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR
Sbjct  1308  LTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR  1367

Query  60    NIVDTGRTIVCTIHQPSIDI  1
             N VDTGRT+VCTIHQPSIDI
Sbjct  1368  NTVDTGRTVVCTIHQPSIDI  1387


 Score =   133 bits (335),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 123/570 (22%), Positives = 245/570 (43%), Gaps = 76/570 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  1199  LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  1257

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D++    
Sbjct  1258  ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLPSDVN----  1291

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  1292  -----SETRKMFIEEVMELVELTPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1346

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1347  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLMKRGGQEIY  1405

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++ +FE +      + G   A ++ EVT+   +    +            
Sbjct  1406  VGPLGRHSSHLINYFEGIEGVSKIKDGYNPATWMLEVTTGAQEGTLGV------------  1453

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSK-----MELLKSCFSREV  1591
              +F+E +++  + R   D +     K  S PA  T   Y  ++          +C  ++ 
Sbjct  1454  -DFTEIYKNSDLYRRNKDLI-----KELSQPAPGTKDLYFATQYSQPFFTQFLACLWKQR  1507

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +AL+  T+F     +R         M S++  +  +     
Sbjct  1508  WSYWRNPPYTAVRFLFTTFIALMFGTMFWDLGTERTRQQDLLNAMGSMYAAVLFLGVQNA  1567

Query  1410  QELAPTIF-RLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
             Q + P +     +FY++R    Y A  YA    ++ IP    +  V+    Y +IG++  
Sbjct  1568  QSVQPVVVVERTVFYRERAAGMYSALPYAFGQALVEIPYVFAQAVVYGVIVYAMIGFEWT  1627

Query  1233  FGRLLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFIL  1072
               +           +L   F  + +V    AA   + + +      + +  LF+  GFI+
Sbjct  1628  AAKFFWYLFFMFFTLLYFTFYGMMAV----AATPNQHIASIVAAAFYGLWNLFS--GFIV  1681

Query  1071  SRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              R+ +  WW W YWI P+ +    +  ++F
Sbjct  1682  PRNRIPVWWRWYYWICPVAWTLYGLVTSQF  1711



>ref|XP_006465412.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus 
sinensis]
Length=1454

 Score =  1423 bits (3683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 702/1079 (65%), Positives = 858/1079 (80%), Gaps = 41/1079 (4%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDG-FAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D    S S R  SS  W N + G F+++SR    D+DDE AL WAAL+K+PT++RL
Sbjct  1     MEASDIYRASQSLRRTSS--WRNNSAGAFSRTSR----DEDDEEALIWAALEKLPTYNRL  54

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             KKG++T   G   EVD++ +G  E+++++++L+KV + DNE  LLKLK+R++RV I +P+
Sbjct  55    KKGILTASTGAANEVDVHKLGLLERQRLIDKLVKVADVDNEQLLLKLKNRVDRVGISLPE  114

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEHLNV AEAYVG RALP+  NFC N++EG L+ L+ LP+ KK  +IL+DV+GI+K
Sbjct  115   IEVRFEHLNVEAEAYVGGRALPTFFNFCANLIEGFLNSLHILPSRKKKFTILKDVNGIVK  174

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPP+SGKT+LLLALAG+LDPSL+ SGRV+YNGH M+EFVP RTAAYISQHD+
Sbjct  175   PSRLTLLLGPPASGKTTLLLALAGKLDPSLKLSGRVTYNGHNMDEFVPQRTAAYISQHDV  234

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML ELSRREK ANI+PDPDID+FMKA AT+GQ+A+
Sbjct  235   HIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKDANIKPDPDIDVFMKALATEGQEAS  294

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY+IKVLGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPA VL MDEISTGLDS
Sbjct  295   VVTDYVIKVLGLDVCADTMVGDEMLRGISGGQRKRVTTGEMLVGPALVLFMDEISTGLDS  354

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++  IHIL+GTAVI+LLQPAPE YDLFDDIILISEGQIVYQGP   VLEFF
Sbjct  355   STTFQIVTSLRQIIHILNGTAVISLLQPAPETYDLFDDIILISEGQIVYQGPREHVLEFF  414

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             + +GF CP+RKGVADFLQEVTS+KDQ QYW+RK+ +PYRFVT+ EFS+AFQ FH+G+ LG
Sbjct  415   KSMGFECPKRKGVADFLQEVTSKKDQQQYWVRKE-EPYRFVTVKEFSDAFQEFHVGQKLG  473

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             D L TPF KS SHPAALTTK+YG++K ELLK+C SRE+LLMKRN  ++IF++  + +  +
Sbjct  474   DGLGTPFDKSKSHPAALTTKSYGINKKELLKACISRELLLMKRNSFVYIFKLIQLTITGV  533

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I+MTLF RT M R+S     IY+ +LFFT+ +I F+ + EL+ +I +LP+FYKQRDL FY
Sbjct  534   ISMTLFFRTKMHRDSVTNGGIYVGALFFTIIMITFNGMAELSMSIAKLPVFYKQRDLRFY  593

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAY +PT+IL++PI  +EV+VWV   YYVIG+DPN GR  K ++LL++  Q++S LFR
Sbjct  594   PAWAYGLPTWILKVPIAFVEVAVWVILNYYVIGFDPNIGRAFKQYLLLVLVNQMSSGLFR  653

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A  GRSM  A   GSF MLVLFALGGF+LSR+D+KKWW W YW SPLMYAQN +AVNE
Sbjct  654   LMAATGRSMVVANTFGSFAMLVLFALGGFVLSREDIKKWWKWAYWCSPLMYAQNGLAVNE  713

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG SW  VLP S+EP GV VLK RG F +AYWYWLG+  L G  +   F + LAL+ L 
Sbjct  714   FLGNSWQKVLPNSTEPLGVEVLKSRGFFTDAYWYWLGMAGLAGSILLFNFGFILALSFLN  773

Query  804   PLAQSRANISAESHSNEHDVSNGGS-------------------------DNSVGERVS-  703
             P   S+A IS ES SNE D   GG+                          NS  + +S 
Sbjct  774   PFG-SQAVISEESQSNECDNRTGGTLQLSTCGSSSSHLTQSDESRDNIRRRNSTSQSLSL  832

Query  702   ---DGMSN--RKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFR  538
                D  +N  ++ GM+LPFEP S+ F D+ Y VDMPQEMK++GV D++L LL GVSGAFR
Sbjct  833   TEEDIAANQPKRSGMVLPFEPLSLTFEDVVYSVDMPQEMKLQGVLDDKLVLLNGVSGAFR  892

Query  537   PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIH  358
             PGVLTALMGVSGAGKTTLMDVLAGRKTGGYI G I ISG+ KKQ+TFARISGYCEQNDIH
Sbjct  893   PGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNIKISGYPKKQETFARISGYCEQNDIH  952

Query  357   SPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQ  178
             SP++TVYESL++SAWLRLP +V  ETR++F++E+MELVEL  LR+++VGLPGV+GLST Q
Sbjct  953   SPNVTVYESLLYSAWLRLPPDVDSETRRMFLEEIMELVELNPLRQSLVGLPGVSGLSTEQ  1012

Query  177   RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1013  RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1071


 Score =   135 bits (340),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 136/620 (22%), Positives = 272/620 (44%), Gaps = 70/620 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+       +G +  +G+   +    R
Sbjct  883   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-ITGNIKISGYPKKQETFAR  941

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  PD+D    
Sbjct  942   ISGYCEQNDIHSPNVTVYESLLYSAW----------------------LRLPPDVD----  975

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ I++++ L     ++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  976   -----SETRRMFLEEIMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1030

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQI-VY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G   +Y
Sbjct  1031  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGYEIY  1089

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++ +FE +      + G   A ++ EV+S   ++   +        F  I
Sbjct  1090  VGPLGRHSSHLISYFEAIPGVNKIKDGYNPATWMLEVSSSSQELALGVD-------FTDI  1142

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L +EL+ P     S      T+ Y  S      +C  ++     R
Sbjct  1143  YKGSELYRR---NKALIEELSKP--APGSRDLYFPTQ-YSQSFFTQCMACLWKQHWSYWR  1196

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N         +   +AL+  +LF     + +        M S++  +  +       + P
Sbjct  1197  NPPYTAVRFLFTTAIALMFGSLFWDLGTKTSKRQDLFNAMGSMYTAVQFLGVQNSSSVQP  1256

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY+++    Y + AYA    ++ IP   ++  V+    Y +IG++    + +
Sbjct  1257  VVAVERAVFYREKAAGMYSSMAYAFAQVLIEIPHVFVQAVVYGVIVYAMIGFEWTAVKFI  1316

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W +  +F     +LF    ++  +MT    + + + +  + +     GFI+ R  +  
Sbjct  1317  --WYIFFMFWSF--LLFTFYGMMCVAMTPNLHIATVVSIAFYGIWNVFSGFIIPRTRIPI  1372

Query  1050  WWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGV  871
             WW W YW +P+ +    +  ++F G   +T L  S E     +  Y G   +    +LGV
Sbjct  1373  WWRWYYWANPIAWTLYGLVASQF-GDIDDTRLE-SGETVKQFLRSYFGFKHD----FLGV  1426

Query  870   GAL--IGFTIFSIFIYTLAL  817
              A   + FT+  +F++ L +
Sbjct  1427  IAAVHVAFTVLFVFVFALGI  1446



>ref|XP_006360347.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum 
tuberosum]
Length=1440

 Score =  1422 bits (3682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/1047 (66%), Positives = 854/1047 (82%), Gaps = 9/1047 (1%)
 Frame = -2

Query  3132  INDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKK  2956
             I+ SR  S S R NS+S+W N G + F++S+R    D+DDE ALKWAAL+K+PTFDRL+K
Sbjct  18    ISGSRRGSVSLRANSNSIWRNTGVEIFSRSAR----DEDDEEALKWAALEKLPTFDRLRK  73

Query  2955  GLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVE  2776
             GL+ G +G   E+DIN+IGY+E+K +LERL++V E DNE FLLKLK+R++RV ID+P +E
Sbjct  74    GLLFGSQGAAAEIDINDIGYQERKNLLERLVRVAEEDNEKFLLKLKNRIDRVGIDLPTIE  133

Query  2775  VRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPG  2599
             VR+E+LN+ A+AYVG R LP+V NF  N +E LL+ L+ LP++K+  +IL+D+SGIIKP 
Sbjct  134   VRYENLNIEADAYVGSRGLPTVINFMTNFIETLLNTLHILPSSKRQITILKDISGIIKPC  193

Query  2598  RMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHI  2419
             RMTLLLGPPSSGKT+LLLALAG+LD SL+ +G+VSYNGHE++EFVP RTAAYISQHDLHI
Sbjct  194   RMTLLLGPPSSGKTTLLLALAGKLDSSLKVTGKVSYNGHELHEFVPQRTAAYISQHDLHI  253

Query  2418  PEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVI  2239
              EMT RETL FSARCQGVGSRYEMLAELSRREKAANI+PDPDIDI+MKA+AT+GQ+ANV+
Sbjct  254   GEMTVRETLEFSARCQGVGSRYEMLAELSRREKAANIKPDPDIDIYMKASATEGQEANVV  313

Query  2238  VDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSST  2059
              DY++K+LGL+ C DT+VG+E LRG+SGG++KR+T GEMLVGP+  L MDEISTGLDSST
Sbjct  314   TDYVLKILGLDICADTMVGDEMLRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSST  373

Query  2058  TFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFEC  1879
             T+ I+ S++  + IL GTAVI+LLQPAPE Y+LFDDIILIS+G IVYQGP + VLEFFE 
Sbjct  374   TYSIVNSLRQSVQILKGTAVISLLQPAPETYNLFDDIILISDGYIVYQGPRDDVLEFFES  433

Query  1878  LGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDE  1699
             +GF+CPERKGVADFLQEVTS+KDQ QYW R+ N+ YRF++  EFS+AFQSFH+GR LGDE
Sbjct  434   MGFKCPERKGVADFLQEVTSKKDQPQYWSRR-NEHYRFISSKEFSDAFQSFHVGRKLGDE  492

Query  1698  LATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALIT  1519
             LA PF ++  HPAALT + YG+ K ELLK C  RE LLMKRN  +++F+   + +MAL+T
Sbjct  493   LAIPFDRTKCHPAALTNEKYGIGKKELLKVCTEREYLLMKRNSFVYVFKFVQLTIMALMT  552

Query  1518  MTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPA  1339
             MTLF RT M R++     IY  +LFF + +IMF+ + E+A TIF+LP+FYKQRDLLF+P+
Sbjct  553   MTLFFRTEMPRDTVDDGGIYAGALFFVVVMIMFNGMSEMAMTIFKLPVFYKQRDLLFFPS  612

Query  1338  WAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSA  1159
             WAYAIP++IL+IP+T +EV +WV  TYYVIG+DPN  R LK ++LL++  Q+AS LFR  
Sbjct  613   WAYAIPSWILKIPVTLVEVGLWVILTYYVIGFDPNITRFLKQFLLLVLVNQMASGLFRFM  672

Query  1158  AVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFL  979
               VGR+M  A   G+F +L+ FAL GF+LSR+DVK WWIWGYWISPLMY+ N+I VNEF 
Sbjct  673   GAVGRTMGVASTFGAFALLLQFALCGFVLSREDVKGWWIWGYWISPLMYSVNSILVNEFD  732

Query  978   GKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPL  799
             G  W  + P  +EP GV V+K RG F +AYWYW+G  AL GFTI   F Y+LALA L+P 
Sbjct  733   GNKWKHIAPNGTEPLGVAVVKSRGFFADAYWYWIGFAALFGFTIVFNFFYSLALAYLKPY  792

Query  798   AQSRANISAESHSNEH-DVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYC  622
              +S+     +S + E+   ++  +    G+ VS G S +K GM+LPFEPHSI F+D+ Y 
Sbjct  793   GKSQTVRPEDSENAENGQAASQMASTDGGDIVSAGQSKKK-GMVLPFEPHSITFDDVVYS  851

Query  621   VDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIE  442
             VDMPQEMK +G  ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+
Sbjct  852   VDMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYID  911

Query  441   GEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIK  262
             G+I ISG+ KKQ+TFARISGYCEQNDIHSP++TVYESL++SAWLRLP +V  + RK+F+ 
Sbjct  912   GDIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPKDVDEKIRKMFVD  971

Query  261   EVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAA  82
             EVMELVEL  LR A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAA
Sbjct  972   EVMELVELEPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAA  1031

Query  81    IVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1032  IVMRTVRNTVDTGRTVVCTIHQPSIDI  1058


 Score =   143 bits (361),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 127/564 (23%), Positives = 249/564 (44%), Gaps = 64/564 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  870   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGDIKISGYPKKQETFAR  928

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+D  ++
Sbjct  929   ISGYCEQNDIHSPYVTVYESLVYSAW----------------------LRLPKDVDEKIR  966

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                       + VD +++++ LE     +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  967   ---------KMFVDEVMELVELEPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1017

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1018  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1076

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      ++G   A ++ EVT+   +M   +            
Sbjct  1077  VGPLGRHSCHLIKYFESIPGVAKIKEGYNPATWMLEVTASAQEMMLGV------------  1124

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F++ +++   +   + L  EL+ P  +  S      T+ Y  S      +C  ++   
Sbjct  1125  -DFTDLYKNSDLYRRNKALITELSVP--RPGSKDLYFETQ-YSQSLWIQCMACLWKQNWS  1180

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + + +AL+  T+F     + +        M S++  +  +       
Sbjct  1181  YWRNPAYTAVRFIFTMFIALVFGTMFWDIGTKVSQSQDLFNAMGSMYAAVLFLGVQNASS  1240

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA     + IP   ++  V+    Y +IG++   G
Sbjct  1241  VQPVVDVERTVFYRERAAGMYSAIPYAFGQVFIEIPYVFVQAIVYGIIVYAMIGFEWETG  1300

Query  1227  RLLKMWVLLIIFRQLASVLFRS--AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVK  1054
             ++   W L I++  L    F    +  V  +   A +V +F   +     GFI+ R  + 
Sbjct  1301  KVF--WYLFIMYTTLLYFTFYGMMSVAVTPNQNVASIVAAFFYAIWNLFSGFIVPRPRMP  1358

Query  1053  KWWIWGYWISPLMYAQNAIAVNEF  982
              WW W YW  P+ +    +  ++F
Sbjct  1359  IWWRWYYWCCPVAWTLYGLVASQF  1382



>ref|XP_009335238.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=1467

 Score =  1422 bits (3681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/1090 (65%), Positives = 858/1090 (79%), Gaps = 49/1090 (4%)
 Frame = -2

Query  3138  MEINDSRGRSG-SFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDR  2965
             MEI+    ++G SFR + SS W  NG+  F+ SS      +DDE ALKWAALQ++PTF R
Sbjct  1     MEISCDIQKAGHSFRRSGSSFWIDNGSGVFSTSS----HGEDDEEALKWAALQRLPTFQR  56

Query  2964  LKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIP  2785
             LKKGL+   +GET E+D++N+  +E+K ++ERL+ V E D+E FLL+LK+R++RV I++P
Sbjct  57    LKKGLLATPQGETNEIDVSNLEVKERKNLIERLVGVAEEDHENFLLRLKNRIDRVGINLP  116

Query  2784  KVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGII  2608
             K+EVRF+HL + AEAY G RALP+V N+C+N++EGLL+ ++ LP+ KKH SILRDVSGII
Sbjct  117   KIEVRFQHLKIAAEAYAGSRALPTVFNYCVNLVEGLLNSVHILPSKKKHLSILRDVSGII  176

Query  2607  KPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHD  2428
             +P RMTLLLGPPSSGKT+LLLALAG+LD  L+FSGRV+YNGH M+EFVP RTAAYISQHD
Sbjct  177   RPCRMTLLLGPPSSGKTTLLLALAGELDRDLQFSGRVTYNGHGMHEFVPQRTAAYISQHD  236

Query  2427  LHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKA  2248
             +H+ E+T  ETL FSARCQGVG RYE+L ELSRREK ANI+PD DIDI+MKA A++GQ+ 
Sbjct  237   VHMGELTVGETLNFSARCQGVGDRYEILVELSRREKEANIKPDADIDIYMKAVASEGQRV  296

Query  2247  NVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLD  2068
              V+ DY +K+LGL+GC DT+VG+  +RG+SGG++KRLT GEMLVGPA  L MDEISTGLD
Sbjct  297   QVVTDYTLKILGLDGCADTLVGDNLIRGISGGQKKRLTTGEMLVGPAKALFMDEISTGLD  356

Query  2067  SSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEF  1888
             SSTT+QI+ SIK Y+HIL+GTA I+LLQPAPE Y+LFDDI+L+S+G IVYQGP   VLEF
Sbjct  357   SSTTYQIVNSIKQYVHILNGTAFISLLQPAPETYELFDDIVLLSDGHIVYQGPRENVLEF  416

Query  1887  FECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNL  1708
             FE +GFRCPERKGVADFLQEVTSRKDQ QYW  +D +PYRF+T+ EF EAFQSFH+GR L
Sbjct  417   FESMGFRCPERKGVADFLQEVTSRKDQEQYWASRD-EPYRFITVEEFVEAFQSFHVGRKL  475

Query  1707  GDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMA  1528
              DELATPF K+ SHPAALTTK YGVSK ELLK+CF+RE LLMKRN  +++F++  + ++A
Sbjct  476   RDELATPFDKAKSHPAALTTKRYGVSKTELLKACFAREFLLMKRNSFVYLFKLAQLSILA  535

Query  1527  LITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLF  1348
             +ITMTLF+RT M RNS     IY  +LFF+L  +MF+ L EL+ T+ +LP+FYKQR+LLF
Sbjct  536   MITMTLFLRTEMHRNSVDDGVIYAGALFFSLVAVMFNGLAELSMTVTKLPVFYKQRNLLF  595

Query  1347  YPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF  1168
             +P W Y +P++IL+IPITC+EV VWVF TYYVIGYDPN GRL K W+LL++  Q+AS LF
Sbjct  596   FPPWTYTLPSWILKIPITCVEVVVWVFMTYYVIGYDPNVGRLFKQWLLLLLINQMASGLF  655

Query  1167  RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVN  988
             R  A VGRSMT A   GSF +++LF+LGGF+LSR D+KKWW+WGYWISPLMY QNAI VN
Sbjct  656   RFIAGVGRSMTIASTFGSFALVMLFSLGGFVLSRVDIKKWWMWGYWISPLMYGQNAIVVN  715

Query  987   EFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             EFLGKSW  VLP S+EP GV VLK RG F E  WYW+G G L G+ +   F +TLAL  L
Sbjct  716   EFLGKSWRHVLPNSTEPLGVAVLKSRGFFTEPRWYWIGAGVLAGYMLIFNFFFTLALTYL  775

Query  807   RPLAQ---------------SRANIS-------AESHSNEHDVSN--------GGSDNS-  721
             +P+ +               SR NIS           S  H   +        G ++N  
Sbjct  776   KPIGKPQAVKLEDPMLTPQISRGNISYIRGCRFCVQLSIRHKFFDLFDKTKFCGCTENGN  835

Query  720   ----------VGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRL  571
                         E  +D   N+K GM+LPFEPHSI F++I Y VDMPQEMK +GV +++L
Sbjct  836   GSNSSRSSSITKEATNDANGNKKRGMVLPFEPHSITFDEITYSVDMPQEMKNQGVPEDKL  895

Query  570   ELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFAR  391
              L++ VSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ++FAR
Sbjct  896   VLIRRVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQESFAR  955

Query  390   ISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVG  211
             ISGYCEQNDIHSPH+TVYESL++SAWLRL SE+  ETRK+F++EVM LVEL  LR+A+VG
Sbjct  956   ISGYCEQNDIHSPHVTVYESLMYSAWLRLSSEIDSETRKMFVEEVMGLVELNPLRQALVG  1015

Query  210   LPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIV  31
             LPG +GLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMR VRN VDTGRT+V
Sbjct  1016  LPGASGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTVV  1075

Query  30    CTIHQPSIDI  1
             CTIHQPSIDI
Sbjct  1076  CTIHQPSIDI  1085


 Score =   140 bits (354),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 136/572 (24%), Positives = 256/572 (45%), Gaps = 80/572 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             ++R VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  897   LIRRVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQESFAR  955

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   +ID    
Sbjct  956   ISGYCEQNDIHSPHVTVYESLMYSAW----------------------LRLSSEID----  989

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ ++ ++ L      +VG     G+S  +RKRLT    LV   +++ 
Sbjct  990   -----SETRKMFVEEVMGLVELNPLRQALVGLPGASGLSTEQRKRLTIAVELVANPSIIF  1044

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+ + GQ +Y
Sbjct  1045  MDEPTSGLDARAAAIVMRAVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLKKGGQELY  1103

Query  1917  QGP-----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVT  1759
              GP     CN ++++FE +      R G   A ++ EVTS   ++   I           
Sbjct  1104  VGPLGRHSCN-LIKYFEGIDNVSKIRDGYNPATWMLEVTSSAKEIAMEI-----------  1151

Query  1758  INEFSEAFQSFHIGRN---LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVL  1588
               +F+E ++   + R    L  EL+ P   S S      T+ Y    +    +C  ++  
Sbjct  1152  --DFAEVYKKSELYRRNKALIAELSNP--ASGSKDLHFPTQ-YSQPFLSQCVACLWKQHW  1206

Query  1587  LMKRNCVLHIFEVGWVVLMALITMTLFI----RTNMQRN--SPIGAQIYMSSLFFTLTVI  1426
                RN       + +  ++AL+  T+F     +T  +++  + IG+ +Y + LF  L + 
Sbjct  1207  SYWRNPPYTAIRLIYTTIVALMFGTMFWNLGSKTTKEKDLFNAIGS-MYAAVLF--LGIK  1263

Query  1425  MFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIG  1246
               + +Q +        +FY++R    Y A AYA     + IP   ++  V+    Y +IG
Sbjct  1264  NSTTVQPVVDV--ERTVFYRERAAGMYSALAYAFAQVTIEIPYVFVQALVYSVIVYAMIG  1321

Query  1245  YDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN----AFVVGSFIMLVLFALGGF  1078
             ++    + L  W L  ++     + F    ++G ++T     A +  S    +     GF
Sbjct  1322  FEWTLAKFL--WYLFFMY--FTFLYFTYYGMMGVALTPNQHIAAINSSAFYAIWNVFSGF  1377

Query  1077  ILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             I+ R  +  WW W YW  P+ +    +A ++F
Sbjct  1378  IIPRTRIPIWWRWYYWACPMAWTLYGLATSQF  1409



>ref|XP_007150694.1| hypothetical protein PHAVU_005G173700g [Phaseolus vulgaris]
 gb|ESW22688.1| hypothetical protein PHAVU_005G173700g [Phaseolus vulgaris]
Length=1425

 Score =  1422 bits (3681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/1054 (66%), Positives = 857/1054 (81%), Gaps = 21/1054 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D    S S R  SS++W +N  + F++SSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGSDIYRASNSMRARSSTVWRNNSVEVFSRSSR----EEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   E+D+ ++GY+E+ K+LERL+KV E DNE+FLLKLKDR++RV +DIP 
Sbjct  57    RKGLLTASHGAANEIDVADLGYQERHKLLERLVKVAEEDNESFLLKLKDRIDRVGLDIPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVR+EHL + AEA+VG RALPS  N   N++EG L++L+ LP+ KKH +IL+DVSG+IK
Sbjct  117   IEVRYEHLKIEAEAFVGGRALPSFINSATNVIEGFLNFLHILPSRKKHVTILKDVSGVIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLAL+G+LD SL+ SG+V+YNGHE+NEFVP RTAAYISQHD+
Sbjct  177   PRRMTLLLGPPSSGKTTLLLALSGKLDKSLQVSGKVTYNGHELNEFVPQRTAAYISQHDV  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPD+D++MKA AT GQ+++
Sbjct  237   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATAGQESS  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             ++ DY +K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  297   IVTDYTMKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+  ++ Y+HIL+GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FF
Sbjct  357   STTFQIVSCLRQYVHILNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GFRCPERKG ADFLQEVTS+KDQ QYW+R+D +PYRFVT+ +F+EAFQSFHIGR LG
Sbjct  417   ESMGFRCPERKGAADFLQEVTSKKDQAQYWVRRD-QPYRFVTVTQFAEAFQSFHIGRKLG  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
              ELA  F K+ SHPAALTTK +G++K ELLK+ FSRE LLMKRN  ++IF++  + +MAL
Sbjct  476   QELAVSFDKTKSHPAALTTKKFGINKKELLKANFSREYLLMKRNSFVYIFKLCQLFIMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I +TLF RT M  +S  GA +Y  ++FFT+  +MF+ + E++ TI +LP+FYKQRDLLF+
Sbjct  536   IALTLFFRTEMDHDSLDGAGVYAGAIFFTIITVMFNGMAEISMTIAKLPVFYKQRDLLFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IP+T  EV++WVF TYYVIGYDPN GRL K +++L++  Q+AS LFR
Sbjct  596   PSWAYAIPSWILKIPVTIAEVALWVFLTYYVIGYDPNVGRLFKQYLILLLISQMASSLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   GSF +L L  LGGFILS+ D+KKWWIWG+WISPLMY QNA+  NE
Sbjct  656   AIAALGRNMIVANTFGSFSVLTLLTLGGFILSKRDIKKWWIWGFWISPLMYGQNALMTNE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG SW+      +   G+  L  R  F +AYWYWLG+GAL+GF +F   ++  AL  L 
Sbjct  716   FLGNSWHN----DTHNLGLDYLDSRAFFKDAYWYWLGLGALVGFVLFFNVVFGFALDFLG  771

Query  804   PLAQSRANISAE-SHSN-----EHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIA  643
             P  + +A I+ E +H       E      G D SV E  S G   +K GM+LPFEPHSI 
Sbjct  772   PFDKPQAVIAEEPTHEGSPAEVELPRIETGKDGSVVES-SHG---KKKGMVLPFEPHSIT  827

Query  642   FNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGR  463
             F+++ Y VDMPQEMK +GV++++L LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGR
Sbjct  828   FDEVVYSVDMPQEMKEQGVQEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGR  887

Query  462   KTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCE  283
             KTGGYIEG I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS V  +
Sbjct  888   KTGGYIEGNIKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSSVDSK  947

Query  282   TRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSG  103
             TRK+FI+EVMELVEL  LR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSG
Sbjct  948   TRKMFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  1007

Query  102   LDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             LDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1008  LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1041


 Score =   128 bits (321),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 115/571 (20%), Positives = 250/571 (44%), Gaps = 78/571 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  853   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNIKISGYPKKQETFAR  911

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  912   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  940

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              ++ D +   + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  941   PSSVDSKTRKMFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1000

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+   GQ +Y
Sbjct  1001  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1059

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EVT+   ++   +            
Sbjct  1060  VGPLGRHSSHLIKYFESIDGVSKIKDGYNPATWMLEVTTTAQELGLGV------------  1107

Query  1755  NEFSEAFQS---FHIGRNLGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFSREV  1591
              +F++ +++   +   + L  EL  P    K    P   +   +        ++C  ++ 
Sbjct  1108  -DFTDLYRNSDLYRRNKQLIQELGQPAPGSKDLYFPTQFSQNFF-----VQCQACLWKQR  1161

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
                 RN         +   +A++  T+F     +R++       + S++   T ++F  +
Sbjct  1162  WSYWRNPPYTAVRFFFTTFIAIMFGTMFWDLGGKRSTRGDLMNALGSMY---TAVLFLGV  1218

Query  1410  QE---LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGY  1243
             Q    + P +     +FY+++    Y A  YA    ++ +P    +   +    Y +IG+
Sbjct  1219  QNSSSVQPVVAVERTVFYREKAAGMYSALPYAFSQILVELPYIFTQAVTYGVIVYAMIGF  1278

Query  1242  DPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFI  1075
             +    +    W L  ++  L  + F    ++G ++T    V S +    +A+     GF+
Sbjct  1279  EWTAEKFF--WYLFFMYFTL--LYFTFYGMMGVAVTPNHHVASIVSAAFYAIWNLFSGFV  1334

Query  1074  LSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             ++R  +  WW W YW  P+ +    +  ++F
Sbjct  1335  VARPSIPIWWRWYYWACPVAWTLYGLVGSQF  1365



>ref|XP_002298123.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE82928.2| ABC transporter family protein [Populus trichocarpa]
Length=1449

 Score =  1422 bits (3680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/1064 (67%), Positives = 862/1064 (81%), Gaps = 28/1064 (3%)
 Frame = -2

Query  3120  RGRSGSFRINSSSLWSNGTDG----FAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKG  2953
             R  S   R NSS  +SN        F+ SS      DDDE ALKWAAL+K+PT+DRL+KG
Sbjct  8     RAGSSVRRGNSSGTFSNNAAADHQVFSLSS---HGQDDDEEALKWAALEKLPTYDRLRKG  64

Query  2952  LMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEV  2773
             ++T   G   EV++ N+G++E+K ++ERL+ V E DNE FLLKLK+R++RV I +P +EV
Sbjct  65    ILTTSTGAASEVEVQNLGFQERKNLVERLVNVAEEDNEKFLLKLKNRIDRVGIHVPTIEV  124

Query  2772  RFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGR  2596
             RFEHLNV AEAYVG RALP+  N+ +N+LEG+L+YL+ L + KKH  IL+DVSGIIKP R
Sbjct  125   RFEHLNVEAEAYVGSRALPTFFNYSVNMLEGVLNYLHILSSRKKHMWILKDVSGIIKPSR  184

Query  2595  MTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIP  2416
             MTLLLGPPSSGKT+LLLALAG+LD +L+FSGRV+YNGHEM+EFVP RTAAYISQHDLHI 
Sbjct  185   MTLLLGPPSSGKTTLLLALAGKLDHALKFSGRVTYNGHEMDEFVPQRTAAYISQHDLHIG  244

Query  2415  EMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIV  2236
             EMT RETLAFSARCQGVGSRY+MLAELSRREK A I+PDPDID+FMKAAAT+GQ+ +V++
Sbjct  245   EMTVRETLAFSARCQGVGSRYDMLAELSRREKEAGIKPDPDIDVFMKAAATEGQEDSVVI  304

Query  2235  DYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTT  2056
             DYI+KVLGLE C DT+VG+E LRG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTT
Sbjct  305   DYILKVLGLEVCADTLVGDEMLRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTT  364

Query  2055  FQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECL  1876
             +QI+ SIK Y+ IL GTA+I+LLQPAPE YDLFDDIIL+S+G+IVYQGP   VL FFE +
Sbjct  365   YQIVNSIKQYVQILEGTALISLLQPAPETYDLFDDIILLSDGEIVYQGPREHVLRFFEYM  424

Query  1875  GFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDEL  1696
             GF+CP RKGVADFLQEVTSRKDQMQYW R+D  PYRFVT+ EF+EAF SFH G+ LG+EL
Sbjct  425   GFKCPARKGVADFLQEVTSRKDQMQYWARRD-VPYRFVTVKEFAEAFYSFHEGKRLGNEL  483

Query  1695  ATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITM  1516
             A PF KS +HPAALTTK YGV+K EL K+ FSRE LLMKRN  ++ F+   + ++A+I M
Sbjct  484   AVPFDKSKNHPAALTTKKYGVNKRELCKASFSREFLLMKRNSFVYAFKFIQLTIVAVIAM  543

Query  1515  TLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAW  1336
             TLF+RT M R+S     IY+ ++FF + VIMF+ + E++ T+ +LP+FYKQRDLLF+PAW
Sbjct  544   TLFLRTEMHRDSVTDGGIYVGAMFFIVVVIMFNGMAEISMTLAKLPVFYKQRDLLFFPAW  603

Query  1335  AYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAA  1156
              YA+PT+IL+IPIT IEV++ VF TY+VIG+DPN GRL K +++L++  Q+AS LFR+ A
Sbjct  604   IYALPTWILKIPITFIEVAIMVFITYFVIGFDPNVGRLFKHYLVLLLTNQMASGLFRTIA  663

Query  1155  VVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLG  976
              VGR+M  A   GSF++L+LF LGGF+LSRDD+KKWWIWG+W SP+MYAQNA+ VNEFLG
Sbjct  664   AVGRNMVVANTFGSFVLLLLFVLGGFVLSRDDIKKWWIWGFWTSPMMYAQNAVVVNEFLG  723

Query  975   KSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLA  796
             KSWN VLP S+EP G+ VLK RG F EAYWYWL V AL GFT+   F+Y LALA L PL 
Sbjct  724   KSWNHVLPNSTEPLGIEVLKSRGFFTEAYWYWLAVAALFGFTLLYNFLYILALAFLNPLG  783

Query  795   Q-SRANISAESHSNE--------HDVSNG------GSDNSVGE----RVSDGMSNRKHGM  673
             +  +A IS E  SN         H ++ G       S  S+ E    + S    N++ G+
Sbjct  784   KPQQAGISEEPQSNNVGRIGEAIHLMNPGINSSLHTSAESIDEIGRSKSSRFTCNKQRGV  843

Query  672   ILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGK  493
             I+PFEPHSI F+ + Y VDMPQEMK  GV +++L LLKGVSGAFRPGVLTALMG+SGAGK
Sbjct  844   IIPFEPHSITFDKVMYSVDMPQEMKSHGVHEDKLVLLKGVSGAFRPGVLTALMGISGAGK  903

Query  492   TTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAW  313
             TT+MDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAW
Sbjct  904   TTMMDVLAGRKTGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPHITVYESLLYSAW  963

Query  312   LRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPS  133
             LRLP+EV  ETRK+F++EVMELVEL  LR+A+VGLPGV+GLST QRKRLTIAVELVANPS
Sbjct  964   LRLPTEVDIETRKMFVEEVMELVELNPLRQALVGLPGVDGLSTEQRKRLTIAVELVANPS  1023

Query  132   IIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1024  IIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1067


 Score =   135 bits (339),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 142/625 (23%), Positives = 272/625 (44%), Gaps = 81/625 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+++  LAG+        G ++ +G+   +    R
Sbjct  879   LLKGVSGAFRPGVLTALMGISGAGKTTMMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  937

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   ++DI   
Sbjct  938   ISGYCEQNDIHSPHITVYESLLYSAW----------------------LRLPTEVDI---  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   ------ETRKMFVEEVMELVELNPLRQALVGLPGVDGLSTEQRKRLTIAVELVANPSIIF  1026

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1027  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLLKRGGQEIY  1085

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      + G   A ++ EVTS  +++   +            
Sbjct  1086  VGPLGRLSCHLIKYFEGIEGVNKIKDGYNPATWMLEVTSTAEELALGV------------  1133

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F+E ++S   F   R L  +L+TP     S     +T+ Y  S      +C  ++   
Sbjct  1134  -DFAEIYRSSELFRRNRALIKDLSTP--APGSKDLYFSTQ-YSRSFFTQCLACLWKQHWS  1189

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN            ++ LI  T+F     +          M S++   T ++F  +Q 
Sbjct  1190  YWRNPPYTAIRFLSTTVIGLIFGTMFWDIGSKITKRQDLFNAMGSMY---TAVLFLGVQN  1246

Query  1404  LA---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
              A   P +     +FY++R    Y A  YA    ++ +P   ++ +V+    Y +IG+  
Sbjct  1247  AASVQPVVAVERTVFYRERAAGMYSALPYAFAQVLIELPYIFVQAAVYGVIVYSMIGFGW  1306

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRD  1063
                +    W L  ++  L    F     V  S  +  A V+ +    +     GF++ R 
Sbjct  1307  TISKFF--WYLYFMYFTLLYFTFYGMMAVAVSPNHQIASVISAAFYGIWNVFSGFVIPRS  1364

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWY  883
              +  WW W  WI P+ +    +  ++F           + E F  + L ++  F      
Sbjct  1365  RMPLWWRWYSWICPVFWTLYGLVASQFGDMKDRLETGETVEQFVTIYLDFKHDF------  1418

Query  882   WLGVGA--LIGFTIFSIFIYTLALA  814
              LGV A  ++GFT+  +F  T A++
Sbjct  1419  -LGVVAAVILGFTV--LFAITFAIS  1440



>ref|XP_010023529.1| PREDICTED: ABC transporter G family member 40-like isoform X3 
[Eucalyptus grandis]
Length=1441

 Score =  1421 bits (3679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1064 (66%), Positives = 851/1064 (80%), Gaps = 24/1064 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             ME  D    S S R  SS++  +     D F++SS     D+DDE +L+WAAL+K+PTF+
Sbjct  1     MEGGDIYRASNSLRATSSTMQKHHATTMDVFSRSSC----DEDDEESLRWAALEKLPTFE  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   E+DI N+G+ E+K+++ERL++V E DNE+FLLKL++R++RV ID+
Sbjct  57    RLRKGILTAGGGAN-EIDIRNLGFHERKRLIERLVRVTEEDNESFLLKLRNRIDRVGIDL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRF+HL V AEA+ G RALP+V NFC +ILEG L++L+ LP  KKH +IL+DVSGI
Sbjct  116   PTIEVRFDHLKVEAEAHEGSRALPTVINFCTSILEGFLNFLHVLPRRKKHLTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH +NEFVP RTAAYISQH
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKTTGRVTYNGHVVNEFVPQRTAAYISQH  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY ML++LSRREKAANI+PDPDIDIFMKA  T+GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYAMLSKLSRREKAANIKPDPDIDIFMKAVVTEGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV++DYI+K+LGLE C+D +VG+E LRG+SGG+RKR+T GEMLVGPA V LMDEISTGL
Sbjct  296   ANVVIDYILKILGLEICDDVMVGDEMLRGISGGQRKRVTTGEMLVGPAEVFLMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+  +K +IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+
Sbjct  356   DSSTTYQIVNFLKQFIHILDGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FF+ +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF EAFQSFH+GR 
Sbjct  416   FFKSMGFKCPRRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFVEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  +++M
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVSQLIIM  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A I+ TLF+RT M R+      +Y+ +LFFT+  IMF+ + E++ TI +LPIFYKQRDLL
Sbjct  535   AFISTTLFLRTKMHRDIVTDGGVYIGALFFTVITIMFNGMSEISMTIPKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF TYYV GY PN GRL K ++LL+   Q+AS L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFITYYVTGYHPNVGRLFKQYLLLVAINQMASGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   GSF++L L ALGG +LSR+DVKKWWIWGYW SPLMY QNAI V
Sbjct  655   FRLIAALGRNLIVANTFGSFVLLALVALGGVVLSREDVKKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NEFLG +WN +   SS  EP G+ VLK RG F EAYWYW+G+GAL GF I   F +++AL
Sbjct  715   NEFLGSNWNKIPTNSSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFIILFNFGFSVAL  774

Query  816   AKLRPLAQSRANISAESHSNEHDVSNGGSD--NSVGERVSDG----------MSNRKHGM  673
             A L P  +S    S +   N++     GS    S G R S             +N K GM
Sbjct  775   ALLNPFGKSHKVKSDDPEGNKNVDRIEGSIQLQSRGSRRSSKPTPPWPETAVAANTKRGM  834

Query  672   ILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGK  493
             +LPFEPHSI F+ I Y VDMP+EMK +G  + RL LLKGVSGAFRPGVLTALMG+SGAGK
Sbjct  835   VLPFEPHSITFDKITYSVDMPREMKNQGAPEERLVLLKGVSGAFRPGVLTALMGISGAGK  894

Query  492   TTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAW  313
             TTLMDVLAGRKTGGYI+G ITISG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+SAW
Sbjct  895   TTLMDVLAGRKTGGYIKGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYESLIYSAW  954

Query  312   LRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPS  133
             LRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVANPS
Sbjct  955   LRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPS  1014

Query  132   IIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             IIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  IIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1058


 Score =   143 bits (361),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 142/632 (22%), Positives = 274/632 (43%), Gaps = 88/632 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  870   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGY-IKGNITISGYPKNQDTFAR  928

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  929   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  962

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  963   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1017

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1018  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFESFDELFLMKRGGQGIY  1076

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1077  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPAQELALGV------------  1124

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++   +   + L +EL+ P     S      TK Y  S    L +C  ++   
Sbjct  1125  -DFSDLYKNSDLYRRNKALIEELSIP--PPNSKDLYFPTK-YSQSTFTQLMACLWKQHWS  1180

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + + +A++  T+F     +          M S++  L  +       
Sbjct  1181  YWRNPPYTAVRFLFTISIAIMFGTMFWDLGSKTTRSQDLFNAMGSMYAALVFLGIQNASS  1240

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+     
Sbjct  1241  VQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLMQAISYGIIVYVMIGFKWTVA  1300

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDD  1060
             +        + F     + F    ++   MT    + S +    +A+     GF++ R  
Sbjct  1301  KFFWY----LFFMFFTLLYFTYYGMMAVGMTPNHHIASIVSFAFYAIWNLFSGFVVPRTK  1356

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFP  898
             +  WW W YW+ P+ +    + V++F      L  + +TV  +  + FG     YR  F 
Sbjct  1357  IPIWWRWFYWVCPVSWTLYGLVVSQFGDLTNTLEDTGDTVEEYMRDYFG-----YRHDF-  1410

Query  897   EAYWYWLGVGA--LIGFTIFSIFIYTLALAKL  808
                   LGV A  +IGFT+   F++ +++  L
Sbjct  1411  ------LGVIAAVMIGFTMLFAFVFAVSIKIL  1436



>ref|XP_004148099.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis 
sativus]
 gb|KGN63378.1| hypothetical protein Csa_2G433930 [Cucumis sativus]
Length=1451

 Score =  1421 bits (3679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1068 (65%), Positives = 849/1068 (79%), Gaps = 36/1068 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             R  S RINSSS+W N   + F++SSR    DDDDE ALKWA+++++PT+ R+++G++  L
Sbjct  8     RVSSARINSSSIWRNSAMEVFSRSSR----DDDDEEALKWASIERLPTYLRVRRGILN-L  62

Query  2937  RGETF-EVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEH  2761
              GE+  E+D+ N+G  E++ ILERL+K+ E DNE FLLKLK+RMERV +D+P +EVRFEH
Sbjct  63    DGESAREIDVQNLGLLERRNILERLVKIAEDDNERFLLKLKNRMERVGLDLPAIEVRFEH  122

Query  2760  LNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIKPGRMTLL  2584
             L V AEA+   RALP++ NF LN+LEG LSY ++ P  KK  SIL DVSGIIKPGRMTLL
Sbjct  123   LEVEAEAHTAGRALPTMFNFSLNMLEGFLSYFHIIPNRKKQLSILHDVSGIIKPGRMTLL  182

Query  2583  LGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTA  2404
             LGPPSSGKT+LL  LAG+L   L+FSGRV+YNGH MNEFVP RT+AYISQ DLHI EMT 
Sbjct  183   LGPPSSGKTTLLKTLAGKLGKDLKFSGRVTYNGHGMNEFVPQRTSAYISQQDLHIGEMTV  242

Query  2403  RETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYII  2224
             RETL+FSARCQGVG RY+ML ELSRREKAANI+PDPD+DI MKAAA  GQ+ NV+ DY++
Sbjct  243   RETLSFSARCQGVGPRYDMLTELSRREKAANIKPDPDLDIIMKAAALGGQETNVVTDYVL  302

Query  2223  KVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQIL  2044
             K+LGLE C DT+VG+E  RG+SGG++KR+T GEMLVGP+  L MDEISTGLDSSTT+QI+
Sbjct  303   KILGLEICADTMVGDEMFRGISGGQKKRVTTGEMLVGPSRALFMDEISTGLDSSTTYQIV  362

Query  2043  KSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRC  1864
              S++ YIHIL+GTA+I+LLQPAPE Y+LFDDIILIS+GQ+VYQGP   VLEFF+ +GF C
Sbjct  363   NSMRQYIHILNGTALISLLQPAPETYELFDDIILISDGQVVYQGPRENVLEFFQHMGFTC  422

Query  1863  PERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPF  1684
             P+RKGVADFLQEVTSRKDQ QYW ++D + YRFV++ EFSEAFQSFH+G+ LGDELATPF
Sbjct  423   PQRKGVADFLQEVTSRKDQEQYWTKRD-EVYRFVSVEEFSEAFQSFHVGKKLGDELATPF  481

Query  1683  QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFI  1504
              KS SHPAALTT+ YG SK ELLK+C SRE+LLMKRN  ++IF++  ++LMA +TMTLF 
Sbjct  482   DKSKSHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLIQLILMAFVTMTLFF  541

Query  1503  RTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAI  1324
             RT M R +     +YM +LFF + +IMF+   ELA TI +LP+FYKQRD LF+P WAY+I
Sbjct  542   RTEMHRRTVDDGSVYMGALFFAIIIIMFNGFSELALTILKLPVFYKQRDFLFFPPWAYSI  601

Query  1323  PTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGR  1144
             PT+IL+IPIT +EV +WV  TYYV+G+DPN GR  K +++L+   Q+AS LFR    +GR
Sbjct  602   PTWILKIPITFVEVGIWVVMTYYVVGFDPNAGRFFKHFLMLLFVNQMASALFRLIGALGR  661

Query  1143  SMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN  964
             ++  A   GSF +L +  LGGF+L+RDDV  WWIWGYWISP+MYAQN IAVNEFLG  W 
Sbjct  662   NIIVANTFGSFALLTVLVLGGFVLARDDVHPWWIWGYWISPMMYAQNGIAVNEFLGHKWR  721

Query  963   TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRA  784
                P S+E  GVL+LK RG+FP+A WYW+GVGA IG+ +   F++T+AL  L P  + +A
Sbjct  722   HPAPNSNESLGVLILKSRGIFPQASWYWIGVGATIGYILLFNFLFTIALQYLDPFEKPQA  781

Query  783   NISAESHSN----------EHDVSNGGSDNS-----------------VGERVSDGMSNR  685
              +S E+ ++          E ++S+ G  +S                 VG    +   N+
Sbjct  782   IVSKETSTDKSVKKSQDVQELELSSKGKSSSERTENQISLSSRTSSARVGSFSEEANQNK  841

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             K GM+LPFEPHSI F++I+Y VDMPQEMK +GV ++RLELLKGVSG+FRPGVLTALMGVS
Sbjct  842   KRGMVLPFEPHSITFDEIRYAVDMPQEMKSQGVTEDRLELLKGVSGSFRPGVLTALMGVS  901

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARI+GYCEQ DIHSPH+TVYESL+
Sbjct  902   GAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLV  961

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLP +V   TRK+F++EVMEL+EL  LR+A+VGLPGV+GLST QRKRLTIAVELV
Sbjct  962   YSAWLRLPPDVDSATRKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELV  1021

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1022  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1069


 Score =   149 bits (377),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 153/626 (24%), Positives = 271/626 (43%), Gaps = 68/626 (11%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   
Sbjct  875   TEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKK  933

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R A Y  Q D+H P +T  E+L +SA                       +R  PD
Sbjct  934   QETFARIAGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPD  971

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
             +D     +AT      + V+ +++++ L    D IVG   + G+S  +RKRLT    LV 
Sbjct  972   VD-----SAT----RKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELVA  1022

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+  
Sbjct  1023  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLRR  1081

Query  1932  G-QIVYQGPC----NCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + +Y GP     + ++E+FE +      + G   A ++ E+T+   +    +      
Sbjct  1082  GGEEIYVGPVGRHSSQLIEYFESIEGVPKIKDGYNPATWMLEITTAAQETTLGVN-----  1136

Query  1773  YRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSRE  1594
               F T+ + SE ++     + L  EL+ P     S+     TK Y  S      +C  ++
Sbjct  1137  --FNTLYKDSELYRR---NKALIKELSVP--NENSNELYFPTK-YSQSFFIQCIACLWKQ  1188

Query  1593  VLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSA  1414
              L   RN         +   +AL+  T+F     +R +       M S++  +  I    
Sbjct  1189  HLSYWRNPPYSAVRFLFTTFIALMFGTIFWDLGSKRGTQQDLFNAMGSMYAAVLFIGVQN  1248

Query  1413  LQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
                + P +     +FY++R    Y A  YA    ++ +P   I+  V+    Y +IG++ 
Sbjct  1249  ATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPYIFIQTVVYGVIVYGMIGFEW  1308

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRD  1063
                +    W +  ++  L    F     V  +  +  A +V S          GFI+ R 
Sbjct  1309  TAAKFF--WYIFFMYFTLLYFTFYGMMTVAVTPNHNIAAIVSSAFYGFWNLFSGFIVPRT  1366

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLVLKYRGLFP  898
              +  WW W YWI P+ +    +  ++F        S  TV  F S  FG    KY  L  
Sbjct  1367  RIPIWWRWYYWICPVAWTLYGLVTSQFGDINDPMDSNQTVAEFVSNYFG---YKYDFLGV  1423

Query  897   EAYWYWLGVGALIGFTI-FSIFIYTL  823
              A  + +G+  L GF   FSI ++  
Sbjct  1424  VAAVH-VGITVLFGFIFAFSIKVFNF  1448



>ref|XP_010648603.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Vitis vinifera]
Length=1470

 Score =  1421 bits (3678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/1094 (64%), Positives = 858/1094 (78%), Gaps = 54/1094 (5%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D   R  S R++SS++W N G + F++SSR    D+DDE ALKWAA++K+PT+ R+
Sbjct  1     MESSDVY-RVNSARLSSSNIWRNSGMEVFSRSSR----DEDDEEALKWAAIEKLPTYLRI  55

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++    G+  E+DI ++G  EKK +LERL+K+ E DNE FLLKLK+R++RV +DIP 
Sbjct  56    RRGILAEEEGKAREIDITSLGLIEKKNLLERLVKIAEEDNEKFLLKLKERIDRVGLDIPT  115

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILE---------------------------  2683
             +EVRFEH+ V AEAY+G RALP++ NF  N+LE                           
Sbjct  116   IEVRFEHITVDAEAYIGGRALPTIINFSANMLEVIHFLDYINLCMYTLCSNLLSCKQSHA  175

Query  2682  -------GLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQL  2527
                    G L+YL+ LP+ KK   IL DVSGIIKPGRMTLLLGPPSSGKT+LLL LAG+L
Sbjct  176   MIFLSLKGFLNYLHILPSRKKPLPILHDVSGIIKPGRMTLLLGPPSSGKTTLLLTLAGKL  235

Query  2526  DPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEM  2347
                L+ SGRVSYNGH M+EFVP R++AYISQ+DLHI EMT RETLAFSARCQGVG+ Y+M
Sbjct  236   GSDLKLSGRVSYNGHGMDEFVPQRSSAYISQYDLHIGEMTVRETLAFSARCQGVGTGYDM  295

Query  2346  LAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLR  2167
             LAELSRREK ANI+PDPDIDI+MKAAA  GQ  ++I DYI+K+LGLE C DTIVG+E +R
Sbjct  296   LAELSRREKVANIKPDPDIDIYMKAAALKGQGGSLITDYILKILGLEVCADTIVGDEMVR  355

Query  2166  GMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALL  1987
             G+SGG+++RLT GEMLVGPA  L MDEISTGLDSSTTFQI+ SI+  IHIL GTA+I+LL
Sbjct  356   GISGGQKRRLTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSIRQSIHILKGTAIISLL  415

Query  1986  QPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQ  1807
             QPAPE YDLFDDIIL+S+GQIVYQGP   VLEFFE +GF+CPERKGVADFLQEVTS+KDQ
Sbjct  416   QPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEHMGFKCPERKGVADFLQEVTSKKDQ  475

Query  1806  MQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSK  1627
              QYW  +  +PY FVT+ EFSEAFQSFH+GR LGDELA PF K+ +H AALTTK YGVSK
Sbjct  476   EQYWAHR-GEPYSFVTVTEFSEAFQSFHVGRRLGDELAIPFDKAKAHTAALTTKKYGVSK  534

Query  1626  MELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSL  1447
              ELLK+C SRE+LLMKRN  ++IF++  ++L+A I MTLF+RT+M R +     I++ S+
Sbjct  535   KELLKACISRELLLMKRNSFVYIFKMSQLILLAFIMMTLFLRTDMPRKTIADGWIFLGSM  594

Query  1446  FFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVF  1267
             FFTL +IMF+   ELA TI +LP+FYKQRDLLFYP+WAY++PT+IL+IPIT +EV++WVF
Sbjct  595   FFTLMMIMFNGFSELALTIMKLPVFYKQRDLLFYPSWAYSLPTWILKIPITLVEVAIWVF  654

Query  1266  STYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL  1087
              TYYV+G+DPN  R  + ++LL+   Q+AS L R  A +GR++  A   GSF +L +  +
Sbjct  655   MTYYVVGFDPNIERFFRQYLLLLCVNQMASGLLRLMAALGRNIIVANTFGSFALLAVLVM  714

Query  1086  GGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRG  907
             GGF+LS+DDVK WW+WGYWISP+MY QNAIAVNEFLGKSW  V   ++EP GVLVLK RG
Sbjct  715   GGFVLSKDDVKPWWMWGYWISPMMYGQNAIAVNEFLGKSWRHVPENATEPLGVLVLKSRG  774

Query  906   LFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANISAESHSNEH--------  751
             +FPEAYWYWLGVGALIG+     F++T+ALA L P  + +  +S E+ + +         
Sbjct  775   IFPEAYWYWLGVGALIGYVFLFNFLFTVALAYLNPYGKHQTVLSEETLTEQSSRGTSCTG  834

Query  750   -DVSNGGSDNSVGERV---SDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVE  583
              D    GS  S+  RV   ++   NRK GMILPFEP SI F++I+Y VDMPQEMK +G+ 
Sbjct  835   GDKIRSGSSRSLSARVGSFNNADQNRKRGMILPFEPLSITFDEIRYAVDMPQEMKSQGIP  894

Query  582   DNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQK  403
             +NRLELLKGVSG+FRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G I ISG+ K QK
Sbjct  895   ENRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGSIKISGYPKNQK  954

Query  402   TFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLRE  223
             TFARISGYCEQ DIHSPH+TVYESL++SAWLRLP EV   TRK+FI+EVMELVEL SLR+
Sbjct  955   TFARISGYCEQTDIHSPHVTVYESLLYSAWLRLPPEVDSATRKMFIEEVMELVELNSLRQ  1014

Query  222   AVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTG  43
             A+VGLPGV+GLST QRKRLT+AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTG
Sbjct  1015  ALVGLPGVDGLSTEQRKRLTVAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTG  1074

Query  42    RTIVCTIHQPSIDI  1
             RT+VCTIHQPSIDI
Sbjct  1075  RTVVCTIHQPSIDI  1088


 Score =   140 bits (353),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 128/561 (23%), Positives = 242/561 (43%), Gaps = 58/561 (10%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+  N+    R
Sbjct  900   LLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPKNQKTFAR  958

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P++D    
Sbjct  959   ISGYCEQTDIHSPHVTVYESLLYSAW----------------------LRLPPEVD----  992

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +AT      + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  993   -SATR----KMFIEEVMELVELNSLRQALVGLPGVDGLSTEQRKRLTVAVELVANPSIIF  1047

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+  G + +Y
Sbjct  1048  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLKRGGEEIY  1106

Query  1917  QGPCNC----VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVTS   +    I        F  +
Sbjct  1107  AGPLGHHSAHLIKYFEGIDGVSKIKDGYNPATWMLEVTSAAQEAALGIN-------FTDV  1159

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L  EL+TP     S      T+ Y  S     K+C  ++     R
Sbjct  1160  YKNSELYRR---NKALIKELSTP--PPGSKDLYFPTQ-YSQSFFAQCKTCLWKQHWSYWR  1213

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R         M S++  +  I       + P
Sbjct  1214  NPSYTAVRLLFTTFIALMFGTIFWDLGSRRQRKQDLFNAMGSMYCAVLFIGAQNATSVQP  1273

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY+++    Y A  YA    ++ +P   I+  ++    Y +IG+D    +  
Sbjct  1274  VVAIERTVFYREKAAGMYSALPYAFGQVMIELPYILIQTIIYGVIVYAMIGFDWTMTKFF  1333

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDDVKKWW  1045
               W +  ++       F     V  S  +  A ++ S    +     GFI+ R  +  WW
Sbjct  1334  --WYIFFMYFTFLYFTFYGMMAVAVSPNHNIAAIISSAFYAIWNLFSGFIVPRTRIPVWW  1391

Query  1044  IWGYWISPLMYAQNAIAVNEF  982
              W YW  P+ +    +  ++F
Sbjct  1392  RWYYWCCPISWTLYGLIGSQF  1412



>ref|XP_010023528.1| PREDICTED: ABC transporter G family member 40-like isoform X2 
[Eucalyptus grandis]
Length=1448

 Score =  1420 bits (3676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/1071 (66%), Positives = 852/1071 (80%), Gaps = 31/1071 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             ME  D    S S R  SS++  +     D F++SS     D+DDE +L+WAAL+K+PTF+
Sbjct  1     MEGGDIYRASNSLRATSSTMQKHHATTMDVFSRSSC----DEDDEESLRWAALEKLPTFE  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   E+DI N+G+ E+K+++ERL++V E DNE+FLLKL++R++RV ID+
Sbjct  57    RLRKGILTAGGGAN-EIDIRNLGFHERKRLIERLVRVTEEDNESFLLKLRNRIDRVGIDL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRF+HL V AEA+ G RALP+V NFC +ILEG L++L+ LP  KKH +IL+DVSGI
Sbjct  116   PTIEVRFDHLKVEAEAHEGSRALPTVINFCTSILEGFLNFLHVLPRRKKHLTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH +NEFVP RTAAYISQH
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKTTGRVTYNGHVVNEFVPQRTAAYISQH  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY ML++LSRREKAANI+PDPDIDIFMKA  T+GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYAMLSKLSRREKAANIKPDPDIDIFMKAVVTEGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV++DYI+K+LGLE C+D +VG+E LRG+SGG+RKR+T GEMLVGPA V LMDEISTGL
Sbjct  296   ANVVIDYILKILGLEICDDVMVGDEMLRGISGGQRKRVTTGEMLVGPAEVFLMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+  +K +IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+
Sbjct  356   DSSTTYQIVNFLKQFIHILDGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FF+ +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF EAFQSFH+GR 
Sbjct  416   FFKSMGFKCPRRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFVEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  +++M
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVSQLIIM  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A I+ TLF+RT M R+      +Y+ +LFFT+  IMF+ + E++ TI +LPIFYKQRDLL
Sbjct  535   AFISTTLFLRTKMHRDIVTDGGVYIGALFFTVITIMFNGMSEISMTIPKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF TYYV GY PN GRL K ++LL+   Q+AS L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFITYYVTGYHPNVGRLFKQYLLLVAINQMASGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   GSF++L L ALGG +LSR+DVKKWWIWGYW SPLMY QNAI V
Sbjct  655   FRLIAALGRNLIVANTFGSFVLLALVALGGVVLSREDVKKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NEFLG +WN +   SS  EP G+ VLK RG F EAYWYW+G+GAL GF I   F +++AL
Sbjct  715   NEFLGSNWNKIPTNSSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFIILFNFGFSVAL  774

Query  816   AKLRPLAQSRANISAESHSNEHDVSNGGSD--NSVGERVSDG-----------------M  694
             A L P  +S    S +   N++     GS    S G  + +G                  
Sbjct  775   ALLNPFGKSHKVKSDDPEGNKNVDRIEGSIQLQSRGSSLRNGSGMKSSKPTPPWPETAVA  834

Query  693   SNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALM  514
             +N K GM+LPFEPHSI F+ I Y VDMP+EMK +G  + RL LLKGVSGAFRPGVLTALM
Sbjct  835   ANTKRGMVLPFEPHSITFDKITYSVDMPREMKNQGAPEERLVLLKGVSGAFRPGVLTALM  894

Query  513   GVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYE  334
             G+SGAGKTTLMDVLAGRKTGGYI+G ITISG+ K Q TFARISGYCEQNDIHSPH+TVYE
Sbjct  895   GISGAGKTTLMDVLAGRKTGGYIKGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYE  954

Query  333   SLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAV  154
             SLI+SAWLRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAV
Sbjct  955   SLIYSAWLRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAV  1014

Query  153   ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1065


 Score =   144 bits (362),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 142/632 (22%), Positives = 274/632 (43%), Gaps = 88/632 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  877   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGY-IKGNITISGYPKNQDTFAR  935

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  936   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  969

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  970   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1024

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1025  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFESFDELFLMKRGGQGIY  1083

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1084  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPAQELALGV------------  1131

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++   +   + L +EL+ P     S      TK Y  S    L +C  ++   
Sbjct  1132  -DFSDLYKNSDLYRRNKALIEELSIP--PPNSKDLYFPTK-YSQSTFTQLMACLWKQHWS  1187

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + + +A++  T+F     +          M S++  L  +       
Sbjct  1188  YWRNPPYTAVRFLFTISIAIMFGTMFWDLGSKTTRSQDLFNAMGSMYAALVFLGIQNASS  1247

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+     
Sbjct  1248  VQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLMQAISYGIIVYVMIGFKWTVA  1307

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDD  1060
             +        + F     + F    ++   MT    + S +    +A+     GF++ R  
Sbjct  1308  KFFWY----LFFMFFTLLYFTYYGMMAVGMTPNHHIASIVSFAFYAIWNLFSGFVVPRTK  1363

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFP  898
             +  WW W YW+ P+ +    + V++F      L  + +TV  +  + FG     YR  F 
Sbjct  1364  IPIWWRWFYWVCPVSWTLYGLVVSQFGDLTNTLEDTGDTVEEYMRDYFG-----YRHDF-  1417

Query  897   EAYWYWLGVGA--LIGFTIFSIFIYTLALAKL  808
                   LGV A  +IGFT+   F++ +++  L
Sbjct  1418  ------LGVIAAVMIGFTMLFAFVFAVSIKIL  1443



>ref|XP_010023527.1| PREDICTED: ABC transporter G family member 40-like isoform X1 
[Eucalyptus grandis]
Length=1447

 Score =  1420 bits (3676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/1070 (66%), Positives = 852/1070 (80%), Gaps = 30/1070 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             ME  D    S S R  SS++  +     D F++SS     D+DDE +L+WAAL+K+PTF+
Sbjct  1     MEGGDIYRASNSLRATSSTMQKHHATTMDVFSRSSC----DEDDEESLRWAALEKLPTFE  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   E+DI N+G+ E+K+++ERL++V E DNE+FLLKL++R++RV ID+
Sbjct  57    RLRKGILTAGGGAN-EIDIRNLGFHERKRLIERLVRVTEEDNESFLLKLRNRIDRVGIDL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRF+HL V AEA+ G RALP+V NFC +ILEG L++L+ LP  KKH +IL+DVSGI
Sbjct  116   PTIEVRFDHLKVEAEAHEGSRALPTVINFCTSILEGFLNFLHVLPRRKKHLTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH +NEFVP RTAAYISQH
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKTTGRVTYNGHVVNEFVPQRTAAYISQH  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY ML++LSRREKAANI+PDPDIDIFMKA  T+GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYAMLSKLSRREKAANIKPDPDIDIFMKAVVTEGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV++DYI+K+LGLE C+D +VG+E LRG+SGG+RKR+T GEMLVGPA V LMDEISTGL
Sbjct  296   ANVVIDYILKILGLEICDDVMVGDEMLRGISGGQRKRVTTGEMLVGPAEVFLMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+  +K +IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VL+
Sbjct  356   DSSTTYQIVNFLKQFIHILDGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FF+ +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF EAFQSFH+GR 
Sbjct  416   FFKSMGFKCPRRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFVEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  +++M
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVSQLIIM  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A I+ TLF+RT M R+      +Y+ +LFFT+  IMF+ + E++ TI +LPIFYKQRDLL
Sbjct  535   AFISTTLFLRTKMHRDIVTDGGVYIGALFFTVITIMFNGMSEISMTIPKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF TYYV GY PN GRL K ++LL+   Q+AS L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFITYYVTGYHPNVGRLFKQYLLLVAINQMASGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   GSF++L L ALGG +LSR+DVKKWWIWGYW SPLMY QNAI V
Sbjct  655   FRLIAALGRNLIVANTFGSFVLLALVALGGVVLSREDVKKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NEFLG +WN +   SS  EP G+ VLK RG F EAYWYW+G+GAL GF I   F +++AL
Sbjct  715   NEFLGSNWNKIPTNSSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFIILFNFGFSVAL  774

Query  816   AKLRPLAQSRANISAESHSNEHDVSNGGSD--NSVGERVSDG----------------MS  691
             A L P  +S    S +   N++     GS    S G  + +G                 +
Sbjct  775   ALLNPFGKSHKVKSDDPEGNKNVDRIEGSIQLQSRGSSLRNGSGRSSKPTPPWPETAVAA  834

Query  690   NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMG  511
             N K GM+LPFEPHSI F+ I Y VDMP+EMK +G  + RL LLKGVSGAFRPGVLTALMG
Sbjct  835   NTKRGMVLPFEPHSITFDKITYSVDMPREMKNQGAPEERLVLLKGVSGAFRPGVLTALMG  894

Query  510   VSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYES  331
             +SGAGKTTLMDVLAGRKTGGYI+G ITISG+ K Q TFARISGYCEQNDIHSPH+TVYES
Sbjct  895   ISGAGKTTLMDVLAGRKTGGYIKGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYES  954

Query  330   LIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVE  151
             LI+SAWLRLP  V  +TRKLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVE
Sbjct  955   LIYSAWLRLPPGVDDQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVE  1014

Query  150   LVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             LVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  LVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1064


 Score =   143 bits (361),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 142/632 (22%), Positives = 274/632 (43%), Gaps = 88/632 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  876   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLAGRKTGGY-IKGNITISGYPKNQDTFAR  934

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  935   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  968

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  969   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  1023

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1024  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFESFDELFLMKRGGQGIY  1082

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1083  VGPLGRHSSHLIEYFEGIQGVSKIKDGYNPATWMLEVTSPAQELALGV------------  1130

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++   +   + L +EL+ P     S      TK Y  S    L +C  ++   
Sbjct  1131  -DFSDLYKNSDLYRRNKALIEELSIP--PPNSKDLYFPTK-YSQSTFTQLMACLWKQHWS  1186

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + + +A++  T+F     +          M S++  L  +       
Sbjct  1187  YWRNPPYTAVRFLFTISIAIMFGTMFWDLGSKTTRSQDLFNAMGSMYAALVFLGIQNASS  1246

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+     
Sbjct  1247  VQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLMQAISYGIIVYVMIGFKWTVA  1306

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDD  1060
             +        + F     + F    ++   MT    + S +    +A+     GF++ R  
Sbjct  1307  KFFWY----LFFMFFTLLYFTYYGMMAVGMTPNHHIASIVSFAFYAIWNLFSGFVVPRTK  1362

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFP  898
             +  WW W YW+ P+ +    + V++F      L  + +TV  +  + FG     YR  F 
Sbjct  1363  IPIWWRWFYWVCPVSWTLYGLVVSQFGDLTNTLEDTGDTVEEYMRDYFG-----YRHDF-  1416

Query  897   EAYWYWLGVGA--LIGFTIFSIFIYTLALAKL  808
                   LGV A  +IGFT+   F++ +++  L
Sbjct  1417  ------LGVIAAVMIGFTMLFAFVFAVSIKIL  1442



>gb|KEH23979.1| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1385

 Score =  1420 bits (3676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1071 (65%), Positives = 844/1071 (79%), Gaps = 39/1071 (4%)
 Frame = -2

Query  3108  GSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRGE  2929
             GSFRI SSS+W N +D     S    ++DD+EA LKWAA+QK+PTF+RL+KGL+T L+GE
Sbjct  5     GSFRIGSSSIWRN-SDAAEIFSNSFHQEDDEEA-LKWAAIQKLPTFERLRKGLLTSLQGE  62

Query  2928  TFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNVG  2749
               E+D+ N+G +E+K +LERL+++ E DNE FLLKLKDR++RV ID+P +EVRFE LN+ 
Sbjct  63    ATEIDVENLGLQERKDLLERLVRLAEEDNEKFLLKLKDRIDRVGIDLPTIEVRFEGLNIE  122

Query  2748  AEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGPP  2572
             AEA+VG R+LP+ TNF +NI+EGLL+ L+ LP+ K+H +IL+DVSGI+KP RMTLLLGPP
Sbjct  123   AEAHVGNRSLPTFTNFMVNIVEGLLNSLHVLPSRKQHLNILKDVSGILKPSRMTLLLGPP  182

Query  2571  SSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETL  2392
             SSGKT+LLLALAG+LDP L+FSG+V+YNGHEMNEFVP RTAAY+ Q+DLHI EMT RETL
Sbjct  183   SSGKTTLLLALAGKLDPKLKFSGKVTYNGHEMNEFVPQRTAAYVDQNDLHIGEMTVRETL  242

Query  2391  AFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLG  2212
             AFSAR QGVG RY++LAELSRREK ANI PDPDID++MKA AT+GQKAN+I DY++++LG
Sbjct  243   AFSARVQGVGPRYDLLAELSRREKHANIMPDPDIDVYMKAIATEGQKANLITDYVLRILG  302

Query  2211  LEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIK  2032
             LE C DT+VGN  LRG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTTFQI+ S+K
Sbjct  303   LEICADTVVGNAMLRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSMK  362

Query  2031  HYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERK  1852
              ++HIL GTAVI+LLQP PE Y+LFDDIIL+S+  I+YQGP   VLEFFE +GF+CP+RK
Sbjct  363   QFVHILKGTAVISLLQPPPETYNLFDDIILLSDSHIIYQGPREHVLEFFESIGFKCPDRK  422

Query  1851  GVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKST  1672
             GVADFLQEVTSRKDQ QYW  KD +PYRFVT  EFSEAFQSFH+GR LGDEL T F KS 
Sbjct  423   GVADFLQEVTSRKDQEQYWEHKD-QPYRFVTAEEFSEAFQSFHVGRRLGDELGTEFDKSK  481

Query  1671  SHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNM  1492
             SHPAALTTK YGV K EL K+C SRE LLMKRN  ++IF++  + +MA+I MT+F RT M
Sbjct  482   SHPAALTTKKYGVGKWELFKACLSREYLLMKRNSFVYIFKICQICIMAMIAMTIFFRTEM  541

Query  1491  QRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFI  1312
              R+S     IY+ +LF+ + VIMF+ + E++  + RLP+FYKQR  LF+P WAYA+P +I
Sbjct  542   HRDSVTLGGIYVGALFYGVVVIMFNGMAEISMVVSRLPVFYKQRGYLFFPPWAYALPAWI  601

Query  1311  LRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN  1132
             L+IP+T +EV+VWVF TYYVIG+DP  GR  + +++L++  Q+AS LFR  A VGR MT 
Sbjct  602   LKIPLTFVEVAVWVFLTYYVIGFDPYIGRFFRQYLILVLVNQMASALFRFIAAVGRDMTV  661

Query  1131  AFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLP  952
             A   GSF + +LFA+ GF+LS+D +KKWWIWG+WISP+MY QNA+  NEFLG  W  VLP
Sbjct  662   ALTFGSFALSILFAMSGFVLSKDRIKKWWIWGFWISPMMYGQNAMVNNEFLGNKWKHVLP  721

Query  951   FSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANISA  772
              S++P GV VLK RG F E+YWYW+GVGALIG+T+   F Y LAL  L PL + +  I  
Sbjct  722   NSTDPIGVEVLKSRGYFTESYWYWIGVGALIGYTLLFNFGYILALTFLNPLGKHQTVIPD  781

Query  771   ESHSNEHDVSNGGSDNSVGERVSDGMS---------------------------------  691
             ES S+   +  G    +V + + D  S                                 
Sbjct  782   ESQSDGQ-IGGGRKRTNVLKFIKDSFSQHSNKVRNGEIRSGSTSPSTSSDRQERVAAETN  840

Query  690   -NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALM  514
              +RK GM+LPFEPHSI F+++ Y VDMPQEM+  GV +++L LLKGVSGAFRPGVLTALM
Sbjct  841   HSRKRGMVLPFEPHSITFDEVTYSVDMPQEMRNRGVVEDKLVLLKGVSGAFRPGVLTALM  900

Query  513   GVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYE  334
             GV+GAGKTTLMDVL+GRKTGGYI G ITISG+ KKQ TFARISGYCEQ DIHSPH+TVYE
Sbjct  901   GVTGAGKTTLMDVLSGRKTGGYIGGNITISGYPKKQDTFARISGYCEQTDIHSPHVTVYE  960

Query  333   SLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAV  154
             SL++SAWLRL  ++  ETRK+FI+EVMELVEL  L+ A+VGLPGV+GLST QRKRLTIAV
Sbjct  961   SLLYSAWLRLSPDINAETRKMFIEEVMELVELKPLQNAIVGLPGVSGLSTEQRKRLTIAV  1020

Query  153   ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1021  ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1071


 Score =   124 bits (310),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 116/538 (22%), Positives = 244/538 (45%), Gaps = 68/538 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  L+G+        G ++ +G+   +    R
Sbjct  883   LLKGVSGAFRPGVLTALMGVTGAGKTTLMDVLSGRKTGGY-IGGNITISGYPKKQDTFAR  941

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  PDI+    
Sbjct  942   ISGYCEQTDIHSPHVTVYESLLYSAW----------------------LRLSPDIN----  975

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L+  ++ IVG   + G+S  +RKRLT    LV   +++ 
Sbjct  976   -----AETRKMFIEEVMELVELKPLQNAIVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1030

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+ + G+ +Y
Sbjct  1031  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFESFDELLLLKQGGKEIY  1089

Query  1917  QGP----CNCVLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              G      + ++ +FE +    +  E    A ++ E+T+   ++   I            
Sbjct  1090  VGSLGHNSSNLISYFEGIHGVNKIKEGYNPATWMLEITNSSKEVDLGI------------  1137

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F+E +++   +   + L +EL+TP   ++       T  Y  S      +C  ++   
Sbjct  1138  -DFAEVYKNSDLYRRNKTLIEELSTP---ASGSKDLYFTSQYSRSFWTQCMACLWKQHWS  1193

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLF--IRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
               RN V       +   +A++  T+F  + +N+++   +     M S++  + +I     
Sbjct  1194  YWRNPVYTAIRFLYSTSVAVLLGTMFWNLGSNIEKEQDLFNA--MGSMYSAVLLIGIKNS  1251

Query  1410  QELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
               + P +     +FY++R    Y A+ YA    ++ +P   ++  V+ F  Y +IG++ +
Sbjct  1252  NAVQPVVAVERTVFYRERAAGMYSAFPYAFAQVVIELPHVFVQSVVYGFIVYAMIGFEWS  1311

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSR  1066
               ++L  W L  ++       F     V  +  N  + +V S    V     GFI+ R
Sbjct  1312  VVKVL--WYLFFMYFTFLYFTFYGMMAVAMTPNNHISTIVSSAFYSVWNLFSGFIVPR  1367



>gb|KDO58233.1| hypothetical protein CISIN_1g000541mg [Citrus sinensis]
Length=1433

 Score =  1420 bits (3676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 702/1042 (67%), Positives = 854/1042 (82%), Gaps = 6/1042 (1%)
 Frame = -2

Query  3111  SGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             S S RI S+S+W + +      S   + ++DDE ALKWAAL+K+PT++RLKKG++T  RG
Sbjct  11    SNSLRIGSTSIWRSNSATLGAFSMSSRGEEDDEEALKWAALEKLPTYNRLKKGILTSSRG  70

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
             E  EVD+ N+G +E+++I+++L+KV + DNE FLLKLK+R++RV I +P +EVRFEHLNV
Sbjct  71    EANEVDVCNLGPQERQRIIDKLVKVADVDNEEFLLKLKNRIDRVGISLPTIEVRFEHLNV  130

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEAYVG RALP+  NFC NI+EG L+ +  LP+ KKH +IL+DVSGII+PGRMTLLLGP
Sbjct  131   EAEAYVGSRALPTFFNFCANIIEGFLNSVNILPSRKKHLTILKDVSGIIRPGRMTLLLGP  190

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             P+SGKT+LLLALAG+LD SL  SGRV+YNGH+M+EFVP RTAAYISQHD HI EMT RET
Sbjct  191   PASGKTTLLLALAGKLDSSLRVSGRVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRET  250

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSARCQGVGSR+EML+ELSRREKAA I+PDPDID+FMKAAAT+GQ+A+V+ DYI+K+L
Sbjct  251   LAFSARCQGVGSRHEMLSELSRREKAAGIKPDPDIDVFMKAAATEGQEASVVTDYILKIL  310

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GL+ C DT+VG+E LRG+SGG++KR+T GEM+VGPA  L MDEISTGLDSSTTFQI+ S+
Sbjct  311   GLDVCADTMVGDEMLRGISGGQKKRVTTGEMMVGPAQALFMDEISTGLDSSTTFQIVNSL  370

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             +  IHIL GT +I+LLQPAPE YDLFDDIILIS+GQIVYQGP   VLEFF+ +GF CP+R
Sbjct  371   RQSIHILKGTTLISLLQPAPETYDLFDDIILISDGQIVYQGPREHVLEFFKFMGFECPKR  430

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTSRKDQ QYW+ K+ +PYRFVT+ EF++AFQ F++G+ +GDEL  PF K 
Sbjct  431   KGVADFLQEVTSRKDQEQYWVHKE-EPYRFVTVKEFADAFQVFYMGQKVGDELRIPFDKR  489

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SH AALTTK YGVSK ELLK+C SRE+LLMKRN  ++IF++  + +M L+ MTLF RT 
Sbjct  490   KSHRAALTTKIYGVSKKELLKACMSRELLLMKRNSFVYIFKLCQLTIMGLVAMTLFFRTK  549

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M R+S     IY  +LFF + +IMF+ + E+  TI +LPIFYKQRDL FYP+WAYA+ T+
Sbjct  550   MHRDSITDGVIYTGALFFIVLMIMFNGMAEIPMTIAKLPIFYKQRDLRFYPSWAYALSTW  609

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             IL+IPI+ IEV+VWVF TYYVIG+DPN GRL + ++LL+   Q+AS LFR  A  GR++ 
Sbjct  610   ILKIPISYIEVAVWVFLTYYVIGFDPNVGRLFRQYLLLLFLNQMASALFRLIAATGRNIV  669

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              A   GSF +L+LF LGGF+LSR+D+KKWWIW YW SPLMYAQNAI VNEFLG SW  VL
Sbjct  670   VANTFGSFALLLLFVLGGFVLSREDIKKWWIWAYWCSPLMYAQNAIVVNEFLGNSWRKVL  729

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
             P ++EP GV VLK RG F +AYWYWLG+GAL GF +   F +TLAL+ L P  +++A IS
Sbjct  730   PNTTEPLGVQVLKSRGFFTDAYWYWLGLGALAGFILLFNFGFTLALSFLNPFGKNQAVIS  789

Query  774   AESHSNEHDVSNGGSD--NSVGERVSDGMSN--RKHGMILPFEPHSIAFNDIKYCVDMPQ  607
              ES SNEHD   GG+   ++ G   ++  +N  +K GM+LPF+PHSI F++I Y VDMPQ
Sbjct  790   QESQSNEHDNRTGGTIQLSTSGRSKAEVKANHHKKRGMVLPFKPHSITFDEIAYSVDMPQ  849

Query  606   EMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITI  427
             EM   GV +++L LL GVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI G I I
Sbjct  850   EMMRPGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYISGSIMI  909

Query  426   SGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMEL  247
             SG+ KKQ+TFARISGYCEQNDIHSP++TVYESL++SAWLRLP EV   TRK+FI+EVMEL
Sbjct  910   SGYPKKQETFARISGYCEQNDIHSPNVTVYESLLYSAWLRLPLEVDSPTRKMFIEEVMEL  969

Query  246   VELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRT  67
             VEL  LR+A+VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRT
Sbjct  970   VELNPLRQALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRT  1029

Query  66    VRNIVDTGRTIVCTIHQPSIDI  1
             VRN VDTGRT+VCTIHQPSIDI
Sbjct  1030  VRNTVDTGRTVVCTIHQPSIDI  1051


 Score =   122 bits (305),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 123/567 (22%), Positives = 238/567 (42%), Gaps = 70/567 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+       SG +  +G+   +    R
Sbjct  863   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-ISGSIMISGYPKKQETFAR  921

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  922   ISGYCEQNDIHSPNVTVYESLLYSAWLR-------------------------------L  950

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                 D     + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  951   PLEVDSPTRKMFIEEVMELVELNPLRQALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1010

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ +  + FD++ L+  G Q +Y
Sbjct  1011  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIVEAFDELFLLKRGGQEIY  1069

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              G      + ++++FE +      + G   A ++ EVT+   +    I        F  I
Sbjct  1070  VGSLGRHSSHLIKYFEGIRGVSKIKDGYNPATWMLEVTAPSQETALGID-------FADI  1122

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVLLMK  1579
              + SE ++     + L  +++ P   S   H A    +++    M    +C  ++     
Sbjct  1123  YKSSELYRR---NKALIKDISKPAPGSKDLHFATQYAQSFFTQCM----ACLWKQHWSYW  1175

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELA  1399
             RN         +  ++AL   T+F     +          M S++   T ++F  +Q  A
Sbjct  1176  RNPPYSAVRFLFTTIIALAFGTMFWDMGTKTKKQQDLFNAMGSMY---TAVLFLGVQNAA  1232

Query  1398  ---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
                P +     +FY++R    Y A  YA    ++ IP   ++   +    Y +IG++   
Sbjct  1233  SVQPVVSIERTVFYRERAAGMYSALPYAFAQALIEIPYIFVQSVTYGVIVYAMIGFEWTA  1292

Query  1230  GRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRD  1063
              + L  W    +F  L  + F    ++  +MT    +   +    + L     GFI+ R 
Sbjct  1293  AKFL--WYQFFMFFTL--LYFTYYGMMAVAMTPNHHISGIVAFAFYGLWNVFSGFIIPRT  1348

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  WW W YW  P+ +    +  ++F
Sbjct  1349  RIPIWWRWYYWACPVSWTLYGLVASQF  1375



>ref|XP_006427144.1| hypothetical protein CICLE_v10024707mg [Citrus clementina]
 gb|ESR40384.1| hypothetical protein CICLE_v10024707mg [Citrus clementina]
Length=1454

 Score =  1420 bits (3676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1079 (65%), Positives = 858/1079 (80%), Gaps = 41/1079 (4%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDG-FAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D    S S R  SS  W N + G F+++SR    D+DDE AL WAAL+K+PT++RL
Sbjct  1     MEASDIYRASQSLRRTSS--WRNNSAGAFSRTSR----DEDDEEALIWAALEKLPTYNRL  54

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             KKG++T   G   EVD++ +G  E+++++++L+KV + DNE  LLKLK+R++RV I +P+
Sbjct  55    KKGILTASTGAANEVDVHKLGLLERQRLIDKLVKVADVDNEQLLLKLKNRVDRVGISLPE  114

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEHLNV AEAYVG RALP+  NFC N++EG L+ L+ LP+ KK  +IL+DV+GI+K
Sbjct  115   IEVRFEHLNVEAEAYVGGRALPTFFNFCANLIEGFLNCLHILPSRKKKFTILKDVNGIVK  174

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPP+SGKT+LLLALAG+LDPSL+ SGRV+YNGH M+EFVP RTAAYISQHD+
Sbjct  175   PSRLTLLLGPPASGKTTLLLALAGKLDPSLKLSGRVTYNGHNMDEFVPQRTAAYISQHDV  234

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML ELSRREK ANI+PDPDID+FMKA AT+GQ+A+
Sbjct  235   HIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKDANIKPDPDIDVFMKALATEGQEAS  294

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY+IKVLGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDS
Sbjct  295   VVTDYVIKVLGLDVCADTMVGDEMLRGISGGQRKRVTTGEMLVGPALALFMDEISTGLDS  354

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++  IHIL+GTAVI+LLQPAPE YDLFDDIILISEGQIV+QGP   VLEFF
Sbjct  355   STTFQIVTSLRQIIHILNGTAVISLLQPAPETYDLFDDIILISEGQIVFQGPREHVLEFF  414

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             + +GF CP+RKGVADFLQEVTS+KDQ QYW+RK+ +PYRFVT+ EFS+AFQ+FH+G+ LG
Sbjct  415   KSMGFECPKRKGVADFLQEVTSKKDQQQYWVRKE-EPYRFVTVKEFSDAFQAFHVGQKLG  473

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             D L TPF KS SHPAALTTK+YG++K ELLK+C SRE+LLMKRN  ++IF++  + +  +
Sbjct  474   DGLRTPFDKSKSHPAALTTKSYGINKKELLKACISRELLLMKRNSFVYIFKLIQLTITGV  533

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I+MTLF RT M R+S     IY+ +LFFT+ +I F+ + EL+ +I +LP+FYKQRDL FY
Sbjct  534   ISMTLFFRTKMHRDSVTNGGIYVGALFFTIIMITFNGMAELSMSIAKLPVFYKQRDLRFY  593

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAY +PT+IL++PI  +EV+VWV   YYVIG+DPN GR  K ++LL++  Q++S LFR
Sbjct  594   PAWAYGLPTWILKVPIAFVEVAVWVILNYYVIGFDPNVGRAFKQYLLLVLVNQMSSGLFR  653

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A  GRSM  A   GSF MLVLFALGGF+LSR+D+KKWW W YW SPLMYAQN +AVNE
Sbjct  654   LMAATGRSMVVANTFGSFAMLVLFALGGFVLSREDIKKWWKWAYWCSPLMYAQNGLAVNE  713

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG SW  VLP S+EP GV VLK RG F +AYWYWLG+  L G  +   F + LAL+ L 
Sbjct  714   FLGNSWQKVLPNSTEPLGVEVLKSRGFFTDAYWYWLGMAGLAGSILLFNFCFILALSFLN  773

Query  804   PLAQSRANISAESHSNEHDVSNGGS-------------------------DNSVGERVS-  703
             P   S+A IS ES SNE D   GG+                          NS  + +S 
Sbjct  774   PFG-SQAVISEESQSNECDNRTGGTLQLSTHGSSSSHLTQSDESRDNIRRRNSTSQSLSL  832

Query  702   ---DGMSN--RKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFR  538
                D  +N  ++ GM+LPFEP S+ F D+ Y VDMPQEMK++GV D++L LL GVSGAFR
Sbjct  833   TEEDIAANQPKRSGMVLPFEPLSLTFEDVVYSVDMPQEMKLQGVLDDKLVLLNGVSGAFR  892

Query  537   PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIH  358
             PGVLTALMGVSGAGKTTLMDVLAGRKTGGYI G I ISG+ KKQ+TFARISGYCEQNDIH
Sbjct  893   PGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNIKISGYPKKQETFARISGYCEQNDIH  952

Query  357   SPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQ  178
             SP++TVYESL++SAWLRLP +V  ETR++F++E+MELVEL  LR+++VGLPGV+GLST Q
Sbjct  953   SPNVTVYESLLYSAWLRLPPDVDSETRRMFLEEIMELVELNPLRQSLVGLPGVSGLSTEQ  1012

Query  177   RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1013  RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1071


 Score =   135 bits (340),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 136/620 (22%), Positives = 272/620 (44%), Gaps = 70/620 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+       +G +  +G+   +    R
Sbjct  883   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-ITGNIKISGYPKKQETFAR  941

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  PD+D    
Sbjct  942   ISGYCEQNDIHSPNVTVYESLLYSAW----------------------LRLPPDVD----  975

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ I++++ L     ++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  976   -----SETRRMFLEEIMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1030

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQI-VY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G   +Y
Sbjct  1031  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGYEIY  1089

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++ +FE +      + G   A ++ EV+S   ++   +        F  I
Sbjct  1090  VGPLGRHSSHLISYFEAIPGVNKIKDGYNPATWMLEVSSSSQELALGVD-------FTDI  1142

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L +EL+ P     S      T+ Y  S      +C  ++     R
Sbjct  1143  YKGSELYRR---NKALIEELSKP--APGSRDLYFPTQ-YSQSFFTQCMACLWKQHWSYWR  1196

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N         +   +AL+  +LF     + +        M S++  +  +       + P
Sbjct  1197  NPPYTAVRFLFTTAIALMFGSLFWDLGTKTSKRQDLFNAMGSMYTAVQFLGVQNSSSVQP  1256

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY+++    Y + AYA    ++ IP   ++  V+    Y +IG++    + +
Sbjct  1257  VVAVERAVFYREKAAGMYSSMAYAFAQVLIEIPHVFVQAVVYGVIVYAMIGFEWTAVKFI  1316

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W +  +F     +LF    ++  +MT    + + + +  + +     GFI+ R  +  
Sbjct  1317  --WYIFFMFWSF--LLFTFYGMMCVAMTPNLHIATVVSIAFYGIWNVFSGFIIPRTRIPI  1372

Query  1050  WWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGV  871
             WW W YW +P+ +    +  ++F G   +T L  S E     +  Y G   +    +LGV
Sbjct  1373  WWRWYYWANPIAWTLYGLVASQF-GDIDDTRLE-SGETVKQFLRSYFGFKHD----FLGV  1426

Query  870   GAL--IGFTIFSIFIYTLAL  817
              A   + FT+  +F++ L +
Sbjct  1427  IAAVHVAFTVLFVFVFALGI  1446



>ref|XP_008459146.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis 
melo]
Length=1451

 Score =  1419 bits (3674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1068 (65%), Positives = 847/1068 (79%), Gaps = 36/1068 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             R  S RINSSS+W N   + F++SSR    D+DDE ALKWA+++++PT+ R+++G++  L
Sbjct  8     RVSSARINSSSIWRNSAMEVFSRSSR----DEDDEEALKWASIERLPTYLRVRRGILN-L  62

Query  2937  RGETF-EVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEH  2761
              GE+  E+D+ N+G  E++ ILERL+K+ E DNE FLLKLK+RMERV +D+P +EVRFEH
Sbjct  63    DGESAREIDVQNLGLLERRNILERLVKIAEDDNERFLLKLKNRMERVGLDLPAIEVRFEH  122

Query  2760  LNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIKPGRMTLL  2584
             L V AEA+   RALP++ NF LN+ EG LSY ++ P  KK  SIL DVSGIIKPGRMTLL
Sbjct  123   LEVEAEAHTAGRALPTMFNFSLNMFEGFLSYFHIIPNRKKQLSILHDVSGIIKPGRMTLL  182

Query  2583  LGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTA  2404
             LGPPSSGKT+LL  LAG+L   L+FSGRV+YNGH MNEFVP RT+AYISQ DLHI EMT 
Sbjct  183   LGPPSSGKTTLLKTLAGKLGKDLKFSGRVTYNGHGMNEFVPQRTSAYISQQDLHIGEMTV  242

Query  2403  RETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYII  2224
             RETL+FSARCQGVG RY+ML ELSRREKAANI+PDPD+DI MKAAA  GQ+ NV+ DY++
Sbjct  243   RETLSFSARCQGVGPRYDMLTELSRREKAANIKPDPDLDIIMKAAALGGQETNVVTDYVL  302

Query  2223  KVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQIL  2044
             K+LGLE C DT+VG+E  RG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTT+QI+
Sbjct  303   KILGLEICADTMVGDEMFRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTYQIV  362

Query  2043  KSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRC  1864
              S++  IHIL+GTA+I+LLQPAPE Y+LFDDIILIS+GQ+VYQGP   VLEFF+ +GF C
Sbjct  363   NSMRQSIHILNGTALISLLQPAPETYELFDDIILISDGQVVYQGPRENVLEFFQHMGFTC  422

Query  1863  PERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPF  1684
             P+RKGVADFLQEVTSRKDQ QYW ++D + YRFV++ EFSEAFQSFH+G+ LGDELATPF
Sbjct  423   PQRKGVADFLQEVTSRKDQEQYWTKRD-EVYRFVSVEEFSEAFQSFHVGKKLGDELATPF  481

Query  1683  QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFI  1504
              KS SHPAALTT+ YG SK ELLK+C SRE+LLMKRN  ++IF++  ++LMA +TMTLF 
Sbjct  482   DKSKSHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLTQLILMAFVTMTLFF  541

Query  1503  RTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAI  1324
             RT M+R +     +YM +LFF + +IMF+   ELA TI +LP+FYKQRD LF+P WAY+I
Sbjct  542   RTEMRRRTVDDGSVYMGALFFAIIIIMFNGFSELALTILKLPVFYKQRDFLFFPPWAYSI  601

Query  1323  PTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGR  1144
             PT+IL+IPIT +EV +WV  TYYV+G+DPN GR  K ++LL+   Q+AS LFR    +GR
Sbjct  602   PTWILKIPITFVEVGIWVVMTYYVVGFDPNAGRFFKHFLLLLCVNQMASALFRLIGALGR  661

Query  1143  SMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN  964
             ++  A   GSF +L +  LGGF+L+RDDV  WWIWGYW SP+MYAQN IAVNEFLG  W 
Sbjct  662   NIIVANTFGSFALLTVLVLGGFVLARDDVHPWWIWGYWTSPMMYAQNGIAVNEFLGHKWR  721

Query  963   TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRA  784
                P S+E  GV++LK RG+FP+A WYW+GVGA IG+ +   F++T+AL  L P  + +A
Sbjct  722   HPGPNSTESLGVMILKSRGIFPQASWYWIGVGATIGYILLFNFLFTIALKYLDPFEKPQA  781

Query  783   NISAESHSN----------EHDVSNGGSDNS-----------------VGERVSDGMSNR  685
              +S E+ ++          E ++S+ G   S                 VG    +   N+
Sbjct  782   VVSKETSTDKSVKKSQDVQELELSSKGKSTSERTENQISLSSRTSSARVGSFSEEAHQNK  841

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             K GM+LPFEPHSIAF++I+Y VDMPQEMK +G+ +NRLELLKGVSG+FRPGVLTALMGVS
Sbjct  842   KRGMVLPFEPHSIAFDEIRYAVDMPQEMKSQGITENRLELLKGVSGSFRPGVLTALMGVS  901

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARI+GYCEQ DIHSPH+TVYESL+
Sbjct  902   GAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLV  961

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLP EV   TRK+F++EVMEL+EL  LR+A+VGLPGV+GLST QRKRLTIAVELV
Sbjct  962   YSAWLRLPPEVDSATRKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELV  1021

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1022  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1069


 Score =   149 bits (376),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 148/626 (24%), Positives = 267/626 (43%), Gaps = 68/626 (11%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   
Sbjct  875   TENRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKK  933

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R A Y  Q D+H P +T  E+L +SA                       +R  P+
Sbjct  934   QETFARIAGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPE  971

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
             +D     +AT      + V+ +++++ L    D IVG   + G+S  +RKRLT    LV 
Sbjct  972   VD-----SATR----KMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELVA  1022

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+  
Sbjct  1023  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLRR  1081

Query  1932  G-QIVYQGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + +Y GP     + ++E+FE +      + G   A ++ E+T+   +           
Sbjct  1082  GGEEIYVGPIGRHSSHLIEYFESIEGVPKIKDGYNPATWMLEITTAAQETTLG-------  1134

Query  1773  YRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSRE  1594
                V  N   +A + +   + L  EL+ P     S+     TK Y  S      +C  ++
Sbjct  1135  ---VNFNTLYKASELYRRNKALIKELSVP--NENSNELYFPTK-YSQSFFIQCIACLWKQ  1188

Query  1593  VLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSA  1414
              L   RN         +   +AL+  T+F     +R +       M S++  +  I    
Sbjct  1189  HLSYWRNPPYSAVRFLFTTFIALMFGTIFWDLGSKRGTQQDLFNAMGSMYAAVLFIGVQN  1248

Query  1413  LQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
                + P +     +FY++R    Y A  YA    ++ +P   I+  V+    Y +IG++ 
Sbjct  1249  ATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPYIFIQTVVYGVIVYGMIGFEW  1308

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRD  1063
                +    W +  ++  L    F     V  +  +  A +V S          GFI+ R 
Sbjct  1309  TAAKFF--WYIFFMYFTLLYFTFYGMMTVAVTPNHNIAAIVSSAFYGFWNLFSGFIVPRT  1366

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLVLKYRGLFP  898
              +  WW W YWI P+ +    +  ++F        S  TV  F S  FG     + G+  
Sbjct  1367  RIPIWWRWYYWICPVAWTLYGLVTSQFGDINDPMDSNQTVAEFVSNYFG-YEYDFLGVIA  1425

Query  897   EAYWYWLGVGALIGFTI-FSIFIYTL  823
               +   +G+  L GF   FSI ++  
Sbjct  1426  AVH---VGITVLFGFIFAFSIKVFNF  1448



>gb|ACU82515.1| pleiotropic drug resistance protein [Cucumis sativus]
Length=1451

 Score =  1419 bits (3674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1068 (65%), Positives = 848/1068 (79%), Gaps = 36/1068 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             R  S RINSSS+W N   + F++SSR    DDDDE ALKWA+++++PT+ R+++G++  L
Sbjct  8     RVSSARINSSSIWRNSAMEVFSRSSR----DDDDEEALKWASIERLPTYLRVRRGILN-L  62

Query  2937  RGETF-EVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEH  2761
              GE+  E+D+ N+G  E++ ILERL+K+ E DNE FLLKLK+RMERV +D+P +EVRFEH
Sbjct  63    DGESAREIDVQNLGLLERRNILERLVKIAEDDNERFLLKLKNRMERVGLDLPAIEVRFEH  122

Query  2760  LNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIKPGRMTLL  2584
             L V AEA+   RALP++ NF LN+LEG LSY ++ P  KK  SIL DVSGIIKPGRMTLL
Sbjct  123   LEVEAEAHTAGRALPTMFNFSLNMLEGFLSYFHIIPNRKKQLSILHDVSGIIKPGRMTLL  182

Query  2583  LGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTA  2404
             LGPPSSGKT+LL  LAG+L   L+FSGRV+YNGH MNEFVP RT+AYISQ DLHI EMT 
Sbjct  183   LGPPSSGKTTLLKTLAGKLGKDLKFSGRVTYNGHGMNEFVPQRTSAYISQQDLHIGEMTV  242

Query  2403  RETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYII  2224
             RETL+FSARCQGVG RY+ML ELSRREKAANI+PDPD+DI MKAAA  GQ+ NV+ DY++
Sbjct  243   RETLSFSARCQGVGPRYDMLTELSRREKAANIKPDPDLDIIMKAAALGGQETNVVTDYVL  302

Query  2223  KVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQIL  2044
             K+LGLE C DT+VG+E  RG+SGG++KR+T GEMLVGP+  L MDEISTGLDSSTT+QI+
Sbjct  303   KILGLEICADTMVGDEMFRGISGGQKKRVTTGEMLVGPSRALFMDEISTGLDSSTTYQIV  362

Query  2043  KSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRC  1864
              S++ YIHIL+GTA+I+LLQPAPE Y+LFDDIILIS+GQ+VYQGP   VLEFF+ +GF C
Sbjct  363   NSMRQYIHILNGTALISLLQPAPETYELFDDIILISDGQVVYQGPRENVLEFFQHMGFTC  422

Query  1863  PERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPF  1684
             P+RKGVADFLQEVTSRKDQ QYW ++D + YRFV++ EFSEAFQSFH+G+ LGDELATPF
Sbjct  423   PQRKGVADFLQEVTSRKDQEQYWTKRD-EVYRFVSVEEFSEAFQSFHVGKKLGDELATPF  481

Query  1683  QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFI  1504
              KS SHPAALTT+ YG SK ELLK+C SRE+LLMKRN  ++IF++  ++LMA +TMTLF 
Sbjct  482   DKSKSHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLIQLILMAFVTMTLFF  541

Query  1503  RTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAI  1324
             RT M R +     +YM +LFF + + MF+   ELA TI +LP+FYKQRD LF+P WAY+I
Sbjct  542   RTEMHRRTVDDGSVYMGALFFAIIITMFNGFSELALTILKLPVFYKQRDFLFFPPWAYSI  601

Query  1323  PTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGR  1144
             PT+IL+IPIT +EV +WV  TYYV+G+DPN GR  K +++L+   Q+AS LFR    +GR
Sbjct  602   PTWILKIPITFVEVGIWVVMTYYVVGFDPNAGRFFKHFLMLLFVNQMASALFRLIGALGR  661

Query  1143  SMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN  964
             ++  A   GSF +L +  LGGF+L+RDDV  WWIWGYWISP+MYAQN IAVNEFLG  W 
Sbjct  662   NIIVANTFGSFALLTVLVLGGFVLARDDVHPWWIWGYWISPMMYAQNGIAVNEFLGHKWR  721

Query  963   TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRA  784
                P S+E  GVL+LK RG+FP+A WYW+GVGA IG+ +   F++T+AL  L P  + +A
Sbjct  722   HPAPNSNESLGVLILKSRGIFPQASWYWIGVGATIGYILLFNFLFTIALQYLDPFEKPQA  781

Query  783   NISAESHSN----------EHDVSNGGSDNS-----------------VGERVSDGMSNR  685
              +S E+ ++          E ++S+ G  +S                 VG    +   N+
Sbjct  782   IVSKETSTDKSVKKSQDVQELELSSKGKSSSERTENQISLSSRTSSARVGSFSEEANQNK  841

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             K GM+LPFEPHSI F++I+Y VDMPQEMK +GV ++RLELLKGVSG+FRPGVLTALMGVS
Sbjct  842   KRGMVLPFEPHSITFDEIRYAVDMPQEMKSQGVTEDRLELLKGVSGSFRPGVLTALMGVS  901

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARI+GYCEQ DIHSPH+TVYESL+
Sbjct  902   GAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLV  961

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLP +V   TRK+F++EVMEL+EL  LR+A+VGLPGV+GLST QRKRLTIAVELV
Sbjct  962   YSAWLRLPPDVDSATRKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELV  1021

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1022  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1069


 Score =   149 bits (377),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 153/626 (24%), Positives = 271/626 (43%), Gaps = 68/626 (11%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   
Sbjct  875   TEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKK  933

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R A Y  Q D+H P +T  E+L +SA                       +R  PD
Sbjct  934   QETFARIAGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPD  971

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
             +D     +AT      + V+ +++++ L    D IVG   + G+S  +RKRLT    LV 
Sbjct  972   VD-----SAT----RKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELVA  1022

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+  
Sbjct  1023  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLRR  1081

Query  1932  G-QIVYQGPC----NCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + +Y GP     + ++E+FE +      + G   A ++ E+T+   +    +      
Sbjct  1082  GGEEIYVGPVGRHSSQLIEYFESIEGVPKIKDGYNPATWMLEITTAAQETTLGVN-----  1136

Query  1773  YRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSRE  1594
               F T+ + SE ++     + L  EL+ P     S+     TK Y  S      +C  ++
Sbjct  1137  --FNTLYKDSELYRR---NKALIKELSVP--NENSNELYFPTK-YSQSFFIQCIACLWKQ  1188

Query  1593  VLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSA  1414
              L   RN         +   +AL+  T+F     +R +       M S++  +  I    
Sbjct  1189  HLSYWRNPPYSAVRFLFTTFIALMFGTIFWDLGSKRGTQQDLFNAMGSMYAAVLFIGVQN  1248

Query  1413  LQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
                + P +     +FY++R    Y A  YA    ++ +P   I+  V+    Y +IG++ 
Sbjct  1249  ATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPYIFIQTVVYGVIVYGMIGFEW  1308

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRD  1063
                +    W +  ++  L    F     V  +  +  A +V S          GFI+ R 
Sbjct  1309  TAAKFF--WYIFFMYFTLLYFTFYGMMTVAVTPNHNIAAIVSSAFYGFWNLFSGFIVPRT  1366

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLVLKYRGLFP  898
              +  WW W YWI P+ +    +  ++F        S  TV  F S  FG    KY  L  
Sbjct  1367  RIPIWWRWYYWICPVAWTLYGLVTSQFGDINDPMDSNQTVAEFVSNYFG---YKYDFLGV  1423

Query  897   EAYWYWLGVGALIGFTI-FSIFIYTL  823
              A  + +G+  L GF   FSI ++  
Sbjct  1424  VAAVH-VGITVLFGFIFAFSIKVFNF  1448



>ref|XP_004156752.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
1-like [Cucumis sativus]
Length=1451

 Score =  1419 bits (3673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1068 (65%), Positives = 848/1068 (79%), Gaps = 36/1068 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             R  S RINSSS+W N   + F++SSR    DDDDE ALKWA+++++PT+ R+++G++  L
Sbjct  8     RVSSARINSSSIWRNSAMEVFSRSSR----DDDDEEALKWASIERLPTYLRVRRGILN-L  62

Query  2937  RGETF-EVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEH  2761
              GE+  E+D+ N+G  E++ ILERL+K+ E DNE FLLKLK+RMERV +D+P +EVRFEH
Sbjct  63    DGESAREIDVQNLGLLERRNILERLVKIAEDDNERFLLKLKNRMERVGLDLPAIEVRFEH  122

Query  2760  LNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIKPGRMTLL  2584
             L V AEA+   RALP++ NF LN+LEG LSY ++ P  KK  SIL DVSGIIKPGRMTLL
Sbjct  123   LEVEAEAHTAGRALPTMFNFSLNMLEGFLSYFHIIPNRKKQLSILHDVSGIIKPGRMTLL  182

Query  2583  LGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTA  2404
             LGPPSSGKT+LL  LAG+L   L+FSGRV+YNGH MNEFVP RT+AYISQ DLHI EMT 
Sbjct  183   LGPPSSGKTTLLKTLAGKLGKDLKFSGRVTYNGHGMNEFVPQRTSAYISQQDLHIGEMTV  242

Query  2403  RETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYII  2224
             RETL+FSARCQGVG RY+ML ELSRREKAANI+PDPD+DI MKAAA  GQ+ NV+ DY++
Sbjct  243   RETLSFSARCQGVGPRYDMLTELSRREKAANIKPDPDLDIIMKAAALGGQETNVVTDYVL  302

Query  2223  KVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQIL  2044
             K+LGLE C DT+VG+E  RG+SGG++KR+T GEMLVGP+  L MDEISTGLDSSTT+QI+
Sbjct  303   KILGLEICADTMVGDEMFRGISGGQKKRVTTGEMLVGPSRALFMDEISTGLDSSTTYQIV  362

Query  2043  KSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRC  1864
              S++ YIHIL+GTA+I+LLQPAPE Y+LFDDIILIS+GQ+VYQGP   VLEFF+ +GF C
Sbjct  363   NSMRQYIHILNGTALISLLQPAPETYELFDDIILISDGQVVYQGPRENVLEFFQHMGFTC  422

Query  1863  PERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPF  1684
             P+RKGVADFLQEVTSRKDQ QYW ++D + YRFV++ EFSEAF SFH+G+ LGDELATPF
Sbjct  423   PQRKGVADFLQEVTSRKDQEQYWTKRD-EVYRFVSVEEFSEAFXSFHVGKKLGDELATPF  481

Query  1683  QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFI  1504
              KS SHPAALTT+ YG SK ELLK+C SRE+LLMKRN  ++IF++  ++LMA +TMTLF 
Sbjct  482   DKSKSHPAALTTEKYGASKKELLKACISRELLLMKRNSFVYIFKLIQLILMAFVTMTLFF  541

Query  1503  RTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAI  1324
             RT M R +     +YM +LFF + +IMF+   ELA TI +LP+FYKQRD LF+P WAY+I
Sbjct  542   RTEMHRRTVDDGSVYMGALFFAIIIIMFNGFSELALTILKLPVFYKQRDFLFFPPWAYSI  601

Query  1323  PTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGR  1144
             PT+IL+IPIT +EV +WV  TYYV+G+DPN GR  K +++L+   Q+AS LFR    +GR
Sbjct  602   PTWILKIPITFVEVGIWVVMTYYVVGFDPNAGRFFKHFLMLLFVNQMASALFRLIGALGR  661

Query  1143  SMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN  964
             ++  A   GSF +L +  LGGF+L+RDDV  WWIWGYWISP+MYAQN IAVNEFLG  W 
Sbjct  662   NIIVANTFGSFALLTVLVLGGFVLARDDVHPWWIWGYWISPMMYAQNGIAVNEFLGHKWR  721

Query  963   TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRA  784
                P S+E  GVL+LK RG+FP+A WYW+GVGA IG+ +   F++T+AL  L P  + +A
Sbjct  722   HPAPNSNESLGVLILKSRGIFPQASWYWIGVGATIGYILLFNFLFTIALQYLDPFEKPQA  781

Query  783   NISAESHSN----------EHDVSNGGSDNS-----------------VGERVSDGMSNR  685
              +S E+ ++          E ++S+ G  +S                 VG    +   N+
Sbjct  782   IVSKETSTDKSVKKSQDVQELELSSKGKSSSERTENQISLSSRTSSARVGSFSEEANQNK  841

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             K GM+LPFEPHSI F++I+Y VDMPQEMK +GV ++RLELLKGVSG+FRPGVLTALMGVS
Sbjct  842   KRGMVLPFEPHSITFDEIRYAVDMPQEMKSQGVTEDRLELLKGVSGSFRPGVLTALMGVS  901

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRKTGGYIEG ITISG+ KKQ+TFARI+GYCEQ DIHSPH+TVYESL+
Sbjct  902   GAGKTTLMDVLAGRKTGGYIEGNITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLV  961

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLP +V   TRK+F++EVMEL+EL  LR+A+VGLPGV+GLST QRKRLTIAVELV
Sbjct  962   YSAWLRLPPDVDSATRKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELV  1021

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1022  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1069


 Score =   149 bits (377),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 153/626 (24%), Positives = 271/626 (43%), Gaps = 68/626 (11%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   
Sbjct  875   TEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKK  933

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R A Y  Q D+H P +T  E+L +SA                       +R  PD
Sbjct  934   QETFARIAGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPD  971

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
             +D     +AT      + V+ +++++ L    D IVG   + G+S  +RKRLT    LV 
Sbjct  972   VD-----SAT----RKMFVEEVMELIELNPLRDAIVGLPGVSGLSTEQRKRLTIAVELVA  1022

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+  
Sbjct  1023  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLRR  1081

Query  1932  G-QIVYQGPC----NCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + +Y GP     + ++E+FE +      + G   A ++ E+T+   +    +      
Sbjct  1082  GGEEIYVGPVGRHSSQLIEYFESIEGVPKIKDGYNPATWMLEITTAAQETTLGVN-----  1136

Query  1773  YRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSRE  1594
               F T+ + SE ++     + L  EL+ P     S+     TK Y  S      +C  ++
Sbjct  1137  --FNTLYKDSELYRR---NKALIKELSVP--NENSNELYFPTK-YSQSFFIQCIACLWKQ  1188

Query  1593  VLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSA  1414
              L   RN         +   +AL+  T+F     +R +       M S++  +  I    
Sbjct  1189  HLSYWRNPPYSAVRFLFTTFIALMFGTIFWDLGSKRGTQQDLFNAMGSMYAAVLFIGVQN  1248

Query  1413  LQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
                + P +     +FY++R    Y A  YA    ++ +P   I+  V+    Y +IG++ 
Sbjct  1249  ATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVVIELPYIFIQTVVYGVIVYGMIGFEW  1308

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRD  1063
                +    W +  ++  L    F     V  +  +  A +V S          GFI+ R 
Sbjct  1309  TAAKFF--WYIFFMYFTLLYFTFYGMMTVAVTPNHNIAAIVSSAFYGFWNLFSGFIVPRT  1366

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLVLKYRGLFP  898
              +  WW W YWI P+ +    +  ++F        S  TV  F S  FG    KY  L  
Sbjct  1367  RIPIWWRWYYWICPVAWTLYGLVTSQFGDINDPMDSNQTVAEFVSNYFG---YKYDFLGV  1423

Query  897   EAYWYWLGVGALIGFTI-FSIFIYTL  823
              A  + +G+  L GF   FSI ++  
Sbjct  1424  VAAVH-VGITVLFGFIFAFSIKVFNF  1448



>gb|AES81617.2| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1456

 Score =  1418 bits (3671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1071 (65%), Positives = 844/1071 (79%), Gaps = 39/1071 (4%)
 Frame = -2

Query  3108  GSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRGE  2929
             GSFRI SSS+W N +D     S    ++DD+EA LKWAA+QK+PTF+RL+KGL+T L+GE
Sbjct  5     GSFRIGSSSIWRN-SDAAEIFSNSFHQEDDEEA-LKWAAIQKLPTFERLRKGLLTSLQGE  62

Query  2928  TFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNVG  2749
               E+D+ N+G +E+K +LERL+++ E DNE FLLKLKDR++RV ID+P +EVRFE LN+ 
Sbjct  63    ATEIDVENLGLQERKDLLERLVRLAEEDNEKFLLKLKDRIDRVGIDLPTIEVRFEGLNIE  122

Query  2748  AEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGPP  2572
             AEA+VG R+LP+ TNF +NI+EGLL+ L+ LP+ K+H +IL+DVSGI+KP RMTLLLGPP
Sbjct  123   AEAHVGNRSLPTFTNFMVNIVEGLLNSLHVLPSRKQHLNILKDVSGILKPSRMTLLLGPP  182

Query  2571  SSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETL  2392
             SSGKT+LLLALAG+LDP L+FSG+V+YNGHEMNEFVP RTAAY+ Q+DLHI EMT RETL
Sbjct  183   SSGKTTLLLALAGKLDPKLKFSGKVTYNGHEMNEFVPQRTAAYVDQNDLHIGEMTVRETL  242

Query  2391  AFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLG  2212
             AFSAR QGVG RY++LAELSRREK ANI PDPDID++MKA AT+GQKAN+I DY++++LG
Sbjct  243   AFSARVQGVGPRYDLLAELSRREKHANIMPDPDIDVYMKAIATEGQKANLITDYVLRILG  302

Query  2211  LEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIK  2032
             LE C DT+VGN  LRG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTTFQI+ S+K
Sbjct  303   LEICADTVVGNAMLRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSMK  362

Query  2031  HYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERK  1852
              ++HIL GTAVI+LLQP PE Y+LFDDIIL+S+  I+YQGP   VLEFFE +GF+CP+RK
Sbjct  363   QFVHILKGTAVISLLQPPPETYNLFDDIILLSDSHIIYQGPREHVLEFFESIGFKCPDRK  422

Query  1851  GVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKST  1672
             GVADFLQEVTSRKDQ QYW  KD +PYRFVT  EFSEAFQSFH+GR LGDEL T F KS 
Sbjct  423   GVADFLQEVTSRKDQEQYWEHKD-QPYRFVTAEEFSEAFQSFHVGRRLGDELGTEFDKSK  481

Query  1671  SHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNM  1492
             SHPAALTTK YGV K EL K+C SRE LLMKRN  ++IF++  + +MA+I MT+F RT M
Sbjct  482   SHPAALTTKKYGVGKWELFKACLSREYLLMKRNSFVYIFKICQICIMAMIAMTIFFRTEM  541

Query  1491  QRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFI  1312
              R+S     IY+ +LF+ + VIMF+ + E++  + RLP+FYKQR  LF+P WAYA+P +I
Sbjct  542   HRDSVTLGGIYVGALFYGVVVIMFNGMAEISMVVSRLPVFYKQRGYLFFPPWAYALPAWI  601

Query  1311  LRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN  1132
             L+IP+T +EV+VWVF TYYVIG+DP  GR  + +++L++  Q+AS LFR  A VGR MT 
Sbjct  602   LKIPLTFVEVAVWVFLTYYVIGFDPYIGRFFRQYLILVLVNQMASALFRFIAAVGRDMTV  661

Query  1131  AFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLP  952
             A   GSF + +LFA+ GF+LS+D +KKWWIWG+WISP+MY QNA+  NEFLG  W  VLP
Sbjct  662   ALTFGSFALSILFAMSGFVLSKDRIKKWWIWGFWISPMMYGQNAMVNNEFLGNKWKHVLP  721

Query  951   FSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANISA  772
              S++P GV VLK RG F E+YWYW+GVGALIG+T+   F Y LAL  L PL + +  I  
Sbjct  722   NSTDPIGVEVLKSRGYFTESYWYWIGVGALIGYTLLFNFGYILALTFLNPLGKHQTVIPD  781

Query  771   ESHSNEHDVSNGGSDNSVGERVSDGMS---------------------------------  691
             ES S+   +  G    +V + + D  S                                 
Sbjct  782   ESQSDGQ-IGGGRKRTNVLKFIKDSFSQHSNKVRNGEIRSGSTSPSTSSDRQERVAAETN  840

Query  690   -NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALM  514
              +RK GM+LPFEPHSI F+++ Y VDMPQEM+  GV +++L LLKGVSGAFRPGVLTALM
Sbjct  841   HSRKRGMVLPFEPHSITFDEVTYSVDMPQEMRNRGVVEDKLVLLKGVSGAFRPGVLTALM  900

Query  513   GVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYE  334
             GV+GAGKTTLMDVL+GRKTGGYI G ITISG+ KKQ TFARISGYCEQ DIHSPH+TVYE
Sbjct  901   GVTGAGKTTLMDVLSGRKTGGYIGGNITISGYPKKQDTFARISGYCEQTDIHSPHVTVYE  960

Query  333   SLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAV  154
             SL++SAWLRL  ++  ETRK+FI+EVMELVEL  L+ A+VGLPGV+GLST QRKRLTIAV
Sbjct  961   SLLYSAWLRLSPDINAETRKMFIEEVMELVELKPLQNAIVGLPGVSGLSTEQRKRLTIAV  1020

Query  153   ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1021  ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1071


 Score =   140 bits (354),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 121/566 (21%), Positives = 258/566 (46%), Gaps = 68/566 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  L+G+        G ++ +G+   +    R
Sbjct  883   LLKGVSGAFRPGVLTALMGVTGAGKTTLMDVLSGRKTGGY-IGGNITISGYPKKQDTFAR  941

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  PDI+    
Sbjct  942   ISGYCEQTDIHSPHVTVYESLLYSAW----------------------LRLSPDIN----  975

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L+  ++ IVG   + G+S  +RKRLT    LV   +++ 
Sbjct  976   -----AETRKMFIEEVMELVELKPLQNAIVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1030

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+ +G + +Y
Sbjct  1031  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFESFDELLLLKQGGKEIY  1089

Query  1917  QGP----CNCVLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              G      + ++ +FE +    +  E    A ++ E+T+   ++   I            
Sbjct  1090  VGSLGHNSSNLISYFEGIHGVNKIKEGYNPATWMLEITNSSKEVDLGI------------  1137

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F+E +++   +   + L +EL+TP   ++       T  Y  S      +C  ++   
Sbjct  1138  -DFAEVYKNSDLYRRNKTLIEELSTP---ASGSKDLYFTSQYSRSFWTQCMACLWKQHWS  1193

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLF--IRTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
               RN V       +   +A++  T+F  + +N+++   +     M S++  + +I     
Sbjct  1194  YWRNPVYTAIRFLYSTSVAVLLGTMFWNLGSNIEKEQDLFNA--MGSMYSAVLLIGIKNS  1251

Query  1410  QELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
               + P +     +FY++R    Y A+ YA    ++ +P   ++  V+ F  Y +IG++ +
Sbjct  1252  NAVQPVVAVERTVFYRERAAGMYSAFPYAFAQVVIELPHVFVQSVVYGFIVYAMIGFEWS  1311

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDD  1060
               ++L  W L  ++       F     V  +  N  + +V S    V     GFI+ R  
Sbjct  1312  VVKVL--WYLFFMYFTFLYFTFYGMMAVAMTPNNHISTIVSSAFYSVWNLFSGFIVPRPR  1369

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF  982
             +  WW W  W +P+ ++   +  +++
Sbjct  1370  IPVWWRWYSWANPVAWSLYGLVASQY  1395



>ref|XP_004506879.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cicer 
arietinum]
Length=1434

 Score =  1418 bits (3671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/1058 (66%), Positives = 859/1058 (81%), Gaps = 19/1058 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D    S SFR NS+S+W N T D F+KSSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGSDIYKASNSFRTNSTSVWRNSTMDAFSKSSR---HEEDDEEALKWAALEKLPTYNRL  57

Query  2961  KKGLMTGLRGETFEVDI-NNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIP  2785
             +KGL+   RG   E+DI  ++G++E++K+L+RLI V E DNE FLLKLK+R++RV I+IP
Sbjct  58    RKGLLATSRGVVHEIDILTDLGFQERQKLLDRLINVAEEDNEKFLLKLKERIDRVGIEIP  117

Query  2784  KVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGII  2608
              +EVR+EHL + AEAYVG RALP+  N   N LE + + L+ L + KKH +IL+DVSGI+
Sbjct  118   TIEVRYEHLIIEAEAYVGGRALPTFMNSITNTLESIFTSLHILKSKKKHMTILKDVSGIV  177

Query  2607  KPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHD  2428
             KP RMTLLLGPPSSGKT+LLLAL+G+LDP+L+ SGRV+YNGHEM EFVP RTAAYISQHD
Sbjct  178   KPQRMTLLLGPPSSGKTTLLLALSGKLDPNLKVSGRVTYNGHEMEEFVPQRTAAYISQHD  237

Query  2427  LHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKA  2248
             +HI EMT RETLAFSARCQGVGSRY++L+ELSRREK A I+PD DID+FMKA +T GQ+ 
Sbjct  238   VHIGEMTVRETLAFSARCQGVGSRYDLLSELSRREKEAKIKPDQDIDVFMKAVSTGGQQE  297

Query  2247  NVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLD  2068
             +V+ DY++K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLD
Sbjct  298   SVVTDYVLKLLGLDVCADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLD  357

Query  2067  SSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEF  1888
             SSTTFQI++S+K Y+HIL+GTAVI+LLQPAPE Y+LFDDI+L+S+G+IVYQGP   VL+F
Sbjct  358   SSTTFQIVRSLKQYVHILNGTAVISLLQPAPETYELFDDIVLLSDGEIVYQGPRELVLDF  417

Query  1887  FECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNL  1708
             FE LGF+CP+RKGVADFLQEVTS+KDQ QYW+ K+ KPYRFVT+ +F+EAFQSFH+GR +
Sbjct  418   FESLGFKCPDRKGVADFLQEVTSKKDQEQYWVHKE-KPYRFVTVTQFAEAFQSFHVGRRI  476

Query  1707  GDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMA  1528
             GDELA PF KS SHPAAL TK YGV+K ELLK+ FSRE LLMKRN  ++IF++  ++LMA
Sbjct  477   GDELAIPFDKSKSHPAALNTKKYGVNKKELLKANFSREYLLMKRNSFVYIFKICQLILMA  536

Query  1527  LITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLF  1348
              +TMTLF+RT M R++     +Y  ++FFT+ ++MF+ L EL+ TI +LP FYKQRDLLF
Sbjct  537   TVTMTLFLRTEMHRDTLNDGGVYAGAIFFTVVMLMFNGLSELSMTIAKLPSFYKQRDLLF  596

Query  1347  YPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLF  1168
             +P WAYAIPT+IL+IP+T +EV+VWVF TYYVIG+DPN  R LK ++LL++  Q+AS LF
Sbjct  597   FPPWAYAIPTWILKIPVTFVEVAVWVFLTYYVIGFDPNVARFLKQYILLLLINQMASGLF  656

Query  1167  RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVN  988
             R+ A +GR+M  A   GSF +L L  LGGFILS+ D+K WWIWGYWISPLMY QNAI VN
Sbjct  657   RAIAALGRNMIVANTFGSFALLALLTLGGFILSKKDIKGWWIWGYWISPLMYGQNAIMVN  716

Query  987   EFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             EFLG SWN   P S++  G+ +L+ RG F +AYWYW+G+GAL GF +     +T+AL  L
Sbjct  717   EFLGDSWNHFTPNSNKTLGIQILESRGFFTDAYWYWIGIGALTGFMLLFNVAFTVALTYL  776

Query  807   RPLAQSRANISAESHSNEHDVSNGGSDN-------SVGE--RVSDGMSNRKHGMILPFEP  655
              P  + +A I+ ES   E    NG +         S GE   V D    +K GM+LPFEP
Sbjct  777   NPFDKPQATINEES---EGSTPNGIAQEVELPQLASSGESYNVVDSSQKKKRGMVLPFEP  833

Query  654   HSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDV  475
             HSI F+++ Y VDMPQEMK++GV ++RL LLKGV+GAFRPGVLTALMGVSGAGKTTLMDV
Sbjct  834   HSITFDEVVYSVDMPQEMKVQGVIEDRLVLLKGVNGAFRPGVLTALMGVSGAGKTTLMDV  893

Query  474   LAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSE  295
             LAGRKTGGYI+G I ISG+ K+Q+TFARISGYCEQNDIHSPH+TVYESL++SAWLRL +E
Sbjct  894   LAGRKTGGYIDGSIKISGYLKRQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLSAE  953

Query  294   VTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDE  115
             V   TRK+FI+EVMELVEL  LR ++VGLPGVNGLST QRKRLTIAVELVANPSIIFMDE
Sbjct  954   VDSNTRKMFIEEVMELVELNPLRNSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDE  1013

Query  114   PTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             PTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1014  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1051


 Score =   132 bits (332),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 126/566 (22%), Positives = 245/566 (43%), Gaps = 68/566 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ V+G  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  863   LLKGVNGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYLKRQETFAR  921

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  922   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  950

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
             +A  D     + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  951   SAEVDSNTRKMFIEEVMELVELNPLRNSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1010

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1011  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1069

Query  1917  QGP----CNCVLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +    +  +    A ++ EVTS   ++   +        F  I
Sbjct  1070  VGPLGRHSSQLIKYFESIEGVHKIKDGYNPATWMLEVTSSAQELTLGVD-------FHDI  1122

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVLLMK  1579
                SE ++     + L +EL  P   S   H +   ++++ V  +    +C  ++     
Sbjct  1123  YRNSELYRR---NKQLIEELGKPAIGSKDLHFSTQYSQSFLVQCL----ACLWKQHWSYW  1175

Query  1578  RNCVLHIFEVGWVVLMALITMTLFI---RTNMQRNSPIGA--QIYMSSLFFTLTVIMFSA  1414
             RN         +   +AL+  T+F    R    R     A   +Y S LF  L V   S+
Sbjct  1176  RNPPYTAVRFFFTTFIALMFGTMFWNLGRKYSNRQDLFNALGSMYTSVLF--LGVQNSSS  1233

Query  1413  LQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
             +Q +        +FY++R    Y A  YA    I+ +P    + + +    Y +IG++  
Sbjct  1234  VQPVVAV--ERSVFYRERAAGMYSALPYAFAQVIIELPYIFAQATSYGVIVYAMIGFEWT  1291

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDD  1060
               +    W +  ++  L    F     V  +  +  A +V S    +     GFI+ R  
Sbjct  1292  LAKFF--WYIFFMYFTLCYFTFYGMMAVAVTPNHHVASIVASAFYAIWNLFSGFIVPRPM  1349

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF  982
             +  WW W YW  P+ +    +  ++F
Sbjct  1350  IPVWWRWYYWACPVSWTIYGLVASQF  1375



>ref|XP_008346192.1| PREDICTED: pleiotropic drug resistance protein 1-like [Malus 
domestica]
Length=1433

 Score =  1418 bits (3670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 694/1057 (66%), Positives = 850/1057 (80%), Gaps = 17/1057 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             MEI+ +  ++G     SSS W   G+D F+KSS R    +DDE ALKWAALQ++PTF RL
Sbjct  1     MEISCNLEKAGHSFTRSSSFWVDKGSDVFSKSSSR---GEDDEEALKWAALQRLPTFQRL  57

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
              KGL++  +G   EVD++N+  +++K ++ERL+ V E D+E FLL+LK R++RV IDIPK
Sbjct  58    NKGLLSTPQGHANEVDVSNLEGKDRKSLIERLVGVAEEDHEKFLLRLKSRIDRVGIDIPK  117

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRF++L + AEAY G RA+P+V N+C+N++EGLL+ L+ LP+ KKH SIL+DVSGII 
Sbjct  118   IEVRFQNLKIAAEAYAGSRAVPTVLNYCVNMVEGLLNSLHILPSKKKHVSILKDVSGIIX  177

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RM LLLGPPSSGKT+LLLALAGQLD  LEFSGRV+YNGH M+EFVP RTAAYISQ D+
Sbjct  178   PCRMALLLGPPSSGKTTLLLALAGQLDQDLEFSGRVTYNGHGMHEFVPQRTAAYISQRDV  237

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             H  E+T  ETL FSARCQGVG RYE+L ELSRREK  NI+PD DIDI+MKA  ++ Q+A 
Sbjct  238   HTGELTVGETLNFSARCQGVGDRYEILVELSRREKEENIKPDADIDIYMKAVTSESQRAQ  297

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DYI+K+LGL+ C DT+VG++ +RG+SGG++KR+T GEMLVGP   L MDEISTGLDS
Sbjct  298   VVTDYILKILGLDVCADTMVGDDLIRGISGGQKKRVTTGEMLVGPXKALFMDEISTGLDS  357

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STT+QI+ +IK Y+HIL+GTA I+LLQPAPE Y+LFDDI+L+S+G IVYQGP   VLEFF
Sbjct  358   STTYQIVNTIKQYVHILNGTAFISLLQPAPETYELFDDIVLLSDGHIVYQGPRENVLEFF  417

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GFRCPERKGVADFLQEVTSRKDQ QYW  +D +PYRF+T+ EF EAFQ FH+GR L 
Sbjct  418   ESMGFRCPERKGVADFLQEVTSRKDQEQYWASRD-EPYRFITVEEFVEAFQXFHVGRKLT  476

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELA PF K+ SHPAALTTK YGVS+ ELLK+CF RE LLMKRN  ++IF++  + +MA+
Sbjct  477   DELAIPFDKAKSHPAALTTKKYGVSRTELLKACFEREFLLMKRNSFVYIFKLAQLSIMAM  536

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             ITMTLF+RT M  NS     +Y  +LFF+L  +MF+ + +L+ T+ RLP+FYKQR+LLF+
Sbjct  537   ITMTLFLRTEMHHNSVADGVVYTGALFFSLVAVMFNGMADLSMTVTRLPVFYKQRNLLFF  596

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P WAYAIPT+IL+IPITC+EV+VWVF+TYYVIGYDPN GRL K + LL +  Q+AS +FR
Sbjct  597   PPWAYAIPTWILKIPITCVEVAVWVFTTYYVIGYDPNVGRLFKQFFLLFLINQMASGMFR  656

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A VGR+MT A  +GSF +LVLFALGGF+LSR+D+KKWWIWGYW SPLMY QNAI VNE
Sbjct  657   FIAGVGRTMTIANTIGSFALLVLFALGGFVLSREDIKKWWIWGYWTSPLMYGQNAIVVNE  716

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFT-IFSIFIYTLALAKL  808
             FLGKSW  VLP S+EP GV VLK RG F E YWYW+G G L G+  IF+IF +TLAL  L
Sbjct  717   FLGKSWRHVLPNSTEPLGVAVLKSRGFFTEPYWYWIGAGVLAGYMLIFNIF-FTLALTYL  775

Query  807   RPLAQSRANISAESHSNEHDVSNGGSDNS--------VGERVSDGMSNRKHGMILPFEPH  652
             +P+ + +A +  E  ++   +S    D S          E  +D   N+K GM+LPFEPH
Sbjct  776   KPIGKPQA-VELEDLTSTPQISRENRDGSNSSRSSSVTKEATNDTNGNKKRGMVLPFEPH  834

Query  651   SIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVL  472
             SI F++I Y VDMPQEMK +GV +++L LL+ VSGAFRPGVLTALMGVSGAGKTTLMDVL
Sbjct  835   SITFDEITYSVDMPQEMKNQGVPEDKLVLLRRVSGAFRPGVLTALMGVSGAGKTTLMDVL  894

Query  471   AGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEV  292
             AGRKTGGYIEG ITISG+ KKQ++FARISGYCEQNDIHSP++T++ESL++SAWLRL SE+
Sbjct  895   AGRKTGGYIEGNITISGYPKKQESFARISGYCEQNDIHSPYVTIFESLMYSAWLRLSSEI  954

Query  291   TCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEP  112
               ETRK+F++EVM LVEL  LR+A+VGLPG +GLST QRKRLTIAVELVANPSIIFMDEP
Sbjct  955   NSETRKMFVEEVMRLVELNPLRQALVGLPGASGLSTEQRKRLTIAVELVANPSIIFMDEP  1014

Query  111   TSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             TSGLDARAAAIVMR VRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  TSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDI  1051


 Score =   142 bits (358),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 135/573 (24%), Positives = 254/573 (44%), Gaps = 82/573 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +LR VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  863   LLRRVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKKQESFAR  921

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   +I+    
Sbjct  922   ISGYCEQNDIHSPYVTIFESLMYSAW----------------------LRLSSEIN----  955

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ +++++ L      +VG     G+S  +RKRLT    LV   +++ 
Sbjct  956   -----SETRKMFVEEVMRLVELNPLRQALVGLPGASGLSTEQRKRLTIAVELVANPSIIF  1010

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ L+ +G Q +Y
Sbjct  1011  MDEPTSGLDARAAAIVMRAVRNTVDTGR-TVVCTIHQPSIDIFDAFDELFLLKKGGQEIY  1069

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    C  ++++FE +      R G   A ++ EVTS   ++   I            
Sbjct  1070  VGPLGRHCCNLIKYFEGIDNVSKIRDGYNPATWMLEVTSSAKEIAMEI------------  1117

Query  1755  NEFSEAFQSFHIGRN---LGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFSREV  1591
              +F+E +++  + R    L  EL+TP    K    P+      Y    +    +C  ++ 
Sbjct  1118  -DFAEVYKNSELYRRNKALIKELSTPAPGSKDLHFPSQ-----YSQPFLTQCIACLWKQH  1171

Query  1590  LLMKRNCVLHIFEVGWVVLMALITMTLFI----RTNMQRN--SPIGAQIYMSSLFFTLTV  1429
                 RN       + +   +AL+  T+F     +T  Q++  + IG+ +Y + LF  L +
Sbjct  1172  WSYWRNTQYTAIRLIYTTFVALMFGTMFWNLGSKTKKQKDLFNAIGS-MYAAVLF--LGI  1228

Query  1428  IMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVI  1249
                + +Q +        +FY++R    Y A AYA     + IP   ++   +    Y  I
Sbjct  1229  KNCTTVQPVVDV--ERTVFYRERAAGMYSALAYAFAQVTIEIPYVFVQALFYSVIVYATI  1286

Query  1248  GYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN----AFVVGSFIMLVLFALGG  1081
             G++    + L  W L  ++     + F    ++G ++T     A +  S    +     G
Sbjct  1287  GFEWTVAKFL--WYLFFMY--FTFLYFTYYGMMGVALTPDQHIAAISSSSFYAIWNLFSG  1342

Query  1080  FILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             FI+ R  +  WW W YW  P+ +    +A ++F
Sbjct  1343  FIIPRTRIPVWWRWYYWACPMAWTLYGLATSQF  1375



>ref|XP_010254261.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=1457

 Score =  1417 bits (3668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/1069 (66%), Positives = 857/1069 (80%), Gaps = 39/1069 (4%)
 Frame = -2

Query  3105  SFRINSSSLWSNGT--DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             S RI+SSS+  N    D F +SSR     +DDE ALKWAAL+K+PT++R++KGL++G+ G
Sbjct  12    SLRIDSSSIRRNSIVDDVFQRSSRH----EDDEEALKWAALEKLPTYNRIRKGLLSGVGG  67

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
             ET E+DI ++  +EKK +LERL+K+ + DNE FLLKLK+R++RV +DIPK+EVRFEHLNV
Sbjct  68    ETKEIDIESLSLQEKKVLLERLLKIADEDNENFLLKLKNRIDRVGLDIPKIEVRFEHLNV  127

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEAYVG RALP++ N+ +N+ E  L+YL+ LP+ KK  SIL DVSGIIKP RMTLLLGP
Sbjct  128   DAEAYVGSRALPTIFNYSVNMFEEFLNYLHILPSRKKPLSILHDVSGIIKPCRMTLLLGP  187

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             P SGKT+LLLALAG+L   ++FSGRV+YNGH+MNEFVP RTAAYISQ+DLHI EMT RET
Sbjct  188   PGSGKTTLLLALAGKLGSDVKFSGRVTYNGHKMNEFVPQRTAAYISQYDLHIGEMTVRET  247

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSARCQGVG+ YEMLAELSRREK  NI+PDPDIDI+MKAAA +GQ+A+V+ DYI+K+L
Sbjct  248   LAFSARCQGVGTGYEMLAELSRREKETNIKPDPDIDIYMKAAALEGQEASVVTDYILKIL  307

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GLE C DT+VG+E  RG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTTFQIL S+
Sbjct  308   GLEICADTLVGDEMFRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQILNSL  367

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             +  IHIL+GTA+I+LLQPAPE Y+LFDDIIL+S+GQIVYQGP   VLEFFE +GF+CPER
Sbjct  368   RQSIHILNGTALISLLQPAPETYELFDDIILLSDGQIVYQGPRENVLEFFESMGFKCPER  427

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTS KDQ QYW RKD +PYRF+ + EF+EAFQSFH+G  LGDELA PF K+
Sbjct  428   KGVADFLQEVTSWKDQEQYWARKD-EPYRFIPVKEFAEAFQSFHVGLKLGDELANPFDKT  486

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SHPA+LTTK YGVSK ELLK+C SRE+LLMKRN  ++IF++  + ++  I MTLF+R  
Sbjct  487   KSHPASLTTKKYGVSKKELLKACISRELLLMKRNYFVYIFKMTQLTILGFIAMTLFLRIK  546

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M R+S I   IY+ +LFFTL +IMF+   ELA TI +LP+FYKQRDLLFYP+WAY++PT+
Sbjct  547   MHRDSVIDGGIYIGALFFTLMMIMFNGYSELALTILKLPVFYKQRDLLFYPSWAYSLPTW  606

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             IL+IP T  EV+VWVF TYYVIG+DPN GRL K ++LL+   Q+AS LFR    VGR M 
Sbjct  607   ILKIPYTFFEVAVWVFMTYYVIGFDPNVGRLFKQYLLLLGVNQMASGLFRFIGAVGRDMI  666

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              A   GSF +L +  +GGF++SR+DVKKWW WGYWISP+MY QNAIAVNEFLG SW+ V 
Sbjct  667   VANTFGSFSLLAILVMGGFVVSREDVKKWWKWGYWISPMMYGQNAIAVNEFLGNSWSHVP  726

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
             P S+EP GV VLK RG+FP+AYWYWLGVGAL+G+      ++TLAL+ L P  + +  +S
Sbjct  727   PNSTEPLGVTVLKSRGIFPKAYWYWLGVGALVGYMFLFNVLFTLALSYLNPFGKPQPVVS  786

Query  774   AES------------------------HSNEHDVSNGGSDNSVGERVS-------DGMSN  688
              ES                         ++  D   G    S+   +S       +G  N
Sbjct  787   EESLNEKWANRTGEFIKLSSREKSSVCQTSSTDAEEGNEMRSMSSGISPASTETINGNQN  846

Query  687   RKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGV  508
             RK GM+LPF+P SI F++I+Y VDMPQE+K +GV +++LELLKGVSG+FRPGVLTALMGV
Sbjct  847   RKRGMVLPFQPLSITFDEIRYSVDMPQELKAQGVPEDQLELLKGVSGSFRPGVLTALMGV  906

Query  507   SGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESL  328
             SGAGKTTLMDVLAGRKT GYI+G ITISG+ KKQ+TFARISGYCEQNDIHSPH+TVYE+L
Sbjct  907   SGAGKTTLMDVLAGRKTCGYIDGCITISGYPKKQETFARISGYCEQNDIHSPHVTVYEAL  966

Query  327   IFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVEL  148
             ++SAWLRLP EV   TR++F++EVMELVELTSLREA+VGLP VNGLST QRKRLTIAVEL
Sbjct  967   LYSAWLRLPLEVKSATREMFVEEVMELVELTSLREALVGLPSVNGLSTEQRKRLTIAVEL  1026

Query  147   VANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             VANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1027  VANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1075


 Score =   137 bits (344),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 123/563 (22%), Positives = 250/563 (44%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  887   LLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTCGY-IDGCITISGYPKKQETFAR  945

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E L +SA  +                          + + +K
Sbjct  946   ISGYCEQNDIHSPHVTVYEALLYSAWLR--------------------------LPLEVK  979

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
             +A  +     + V+ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  980   SATRE-----MFVEEVMELVELTSLREALVGLPSVNGLSTEQRKRLTIAVELVANPSIIF  1034

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+ +G + +Y
Sbjct  1035  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKQGGEEIY  1093

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +        G   A ++ EVTSR  +    +        F  +
Sbjct  1094  VGPLGRHSCHLIKYFEGIQGVGKINDGYNPATWMLEVTSRAQETVLGVN-------FTDV  1146

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L +EL TP   S+          Y  S      +C  ++     R
Sbjct  1147  YKSSELYRR---NKALINELNTPAPGSSD---LYFPTRYSQSFFTQCMACLWKQHYSYWR  1200

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +    AL+  T+F     +R+        M S++  +  +       + P
Sbjct  1201  NPPYTAVRLLFTTFTALMFGTIFWDLGSRRSKQQDLFNAMGSMYAAVLFLGIQNASSVQP  1260

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   ++  ++    Y +IG++    +  
Sbjct  1261  VVAIERTVFYRERAAGMYSALPYAFGQVMIEVPYIFLQTLIYGVIVYSMIGFEWTVAKFF  1320

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W L  ++  L  + F    ++  ++T    + + I    +A+     GFI+ R  +  
Sbjct  1321  --WHLFFMYMTL--LYFTCYGMMTVAVTPNHNIAAIIATAFYAIWNLFSGFIVPRPRIPI  1376

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W YW+ P+ +    +  ++F
Sbjct  1377  WWRWYYWVCPVSWTLYGLVASQF  1399



>ref|XP_010023517.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Eucalyptus grandis]
Length=1448

 Score =  1417 bits (3668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 694/1068 (65%), Positives = 858/1068 (80%), Gaps = 25/1068 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLK  2959
             ME  D+   S S R  SS++  N        SR    D DDE +L+WAALQK+PTF+RL+
Sbjct  1     MEGGDTYRASNSLRATSSTMQKNHATTMDVLSRS-SCDGDDEESLRWAALQKLPTFERLR  59

Query  2958  KGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKV  2779
             KG++T   G   E+DI N+G+ E+K+++ERL++V E DNE+FLLKL++R++RV I++  +
Sbjct  60    KGILTAGGGAN-EIDIRNLGFHERKRLIERLVRVTEEDNESFLLKLRNRIDRVGIELSTI  118

Query  2778  EVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKP  2602
             EVRFEHLNV AEA+ G +ALP+V NFC +ILEG L++++ LP+ KK+ +IL+DVSGIIKP
Sbjct  119   EVRFEHLNVEAEAHEGSKALPTVINFCTSILEGFLNFMHILPSRKKYLTILQDVSGIIKP  178

Query  2601  GRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLH  2422
             GRMTLLLGPP SGKT+LLLALAG+LDP L+ +G+V+YNGH +NEFVP RTAAYISQHDLH
Sbjct  179   GRMTLLLGPPDSGKTTLLLALAGKLDPKLKTTGKVTYNGHVLNEFVPQRTAAYISQHDLH  238

Query  2421  IPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANV  2242
             I EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PD DIDIFMKAAA +GQ+ANV
Sbjct  239   IGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDLDIDIFMKAAAIEGQEANV  298

Query  2241  IVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSS  2062
             + DYI+K+LGLE C DT++G+E LRG+SGGERKR+T GEMLVGPA V  MDEISTGLDSS
Sbjct  299   VTDYILKILGLEICADTMIGDEMLRGISGGERKRVTIGEMLVGPAKVFFMDEISTGLDSS  358

Query  2061  TTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFE  1882
             TT+QI+ S+K +IH L GTA+I+LLQP PE YDLFDDIIL+S+GQ+VYQGP   VL+FFE
Sbjct  359   TTYQIVNSLKQFIHTLDGTAIISLLQPTPETYDLFDDIILLSDGQMVYQGPQELVLDFFE  418

Query  1881  CLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGD  1702
              +GF+CPERKGVADFLQEVTSRKDQ QYW+RKD +PY F+T+ EF+EAFQSFH+GR L D
Sbjct  419   SMGFKCPERKGVADFLQEVTSRKDQYQYWVRKD-EPYTFITVREFAEAFQSFHVGRKLRD  477

Query  1701  ELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALI  1522
             EL+TPF KS +HPAALTTK +GV   +LLK+C SRE LLMKRN  ++IF++  + +MA I
Sbjct  478   ELSTPFDKSKNHPAALTTKRFGVRTKDLLKACISREYLLMKRNSFVYIFKITQLTIMAFI  537

Query  1521  TMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYP  1342
             TMTLF+RT M R++     +Y+ +LFFT+  IMF+ + EL+ TI +LPIFYKQRDL FYP
Sbjct  538   TMTLFLRTKMHRDTVTDGGVYIGALFFTVMTIMFNGMAELSMTIAKLPIFYKQRDLRFYP  597

Query  1341  AWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRS  1162
             AWAYA+P +IL+IPIT +EV++WVF TYYVIGYDPN GRL K ++LL+   Q+AS LFR 
Sbjct  598   AWAYALPIWILKIPITFVEVAIWVFITYYVIGYDPNVGRLFKQYLLLVAVNQMASGLFRL  657

Query  1161  AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              A +G ++  A  +GSF++L LFALGG ILS++++KKWW+WG+WISPLMYAQNAI VNE 
Sbjct  658   IAALGGNLIVANTLGSFVLLTLFALGGVILSQENIKKWWVWGFWISPLMYAQNAIVVNEL  717

Query  981   LGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             LG +W+ + P SS  E  G+ VLK RG F EA+WYW+GVGAL GF I   F +++ALA L
Sbjct  718   LGSNWDKIPPNSSTNESLGIQVLKSRGFFTEAHWYWIGVGALFGFIILFNFGFSVALALL  777

Query  807   RPLAQSRANISAESHSNEH--------DVSNGGSD--NSVGERVSDG---------MSNR  685
              P  +S+   S +   NE+         + + GS   N +G ++S+           +NR
Sbjct  778   NPFGRSQTVKSDDPQGNENVNRMGRSIQLQSQGSSLKNGLGIKLSESTPTWPEMAITTNR  837

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             K GM+LPFE HSI F++I Y VDMPQEMK +G   ++L LLKGVSGAFRPGVLTA+MGVS
Sbjct  838   KSGMVLPFEQHSITFDEITYSVDMPQEMKSQGALKDKLVLLKGVSGAFRPGVLTAIMGVS  897

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRK GGYI+G +TISG+ K Q TFARISGYCEQ+DIHSPH+T+YESLI
Sbjct  898   GAGKTTLMDVLAGRKIGGYIKGSMTISGYPKNQDTFARISGYCEQDDIHSPHVTIYESLI  957

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLP  +  +TRKLF++EVMEL+EL  LR+A+VGLPGV+GLST QRKRLTIAVELV
Sbjct  958   YSAWLRLPPGMDNQTRKLFVEEVMELMELNLLRQALVGLPGVDGLSTEQRKRLTIAVELV  1017

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1018  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1065


 Score =   147 bits (371),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 144/630 (23%), Positives = 271/630 (43%), Gaps = 84/630 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T ++G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  877   LLKGVSGAFRPGVLTAIMGVSGAGKTTLMDVLAGRKIGGY-IKGSMTISGYPKNQDTFAR  935

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P +D    
Sbjct  936   ISGYCEQDDIHSPHVTIYESLIYSAW----------------------LRLPPGMD----  969

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  970   -----NQTRKLFVEEVMELMELNLLRQALVGLPGVDGLSTEQRKRLTIAVELVANPSIIF  1024

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+ +G Q +Y
Sbjct  1025  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLLKQGGQEIY  1083

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1084  VGPLGRHSSHLIEYFEGIQGVNKIKDGYNPATWMLEVTSAAQELALGV------------  1131

Query  1755  NEFSEAFQSFHI-GRN--LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++  + GRN  L +EL+ P     S      TK Y  S    L +C  ++   
Sbjct  1132  -DFSDLYKNSDLYGRNKALIEELSIP--PPNSKDLHFPTK-YSQSTFTQLMACLWKQHWS  1187

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + + +ALI  T+F     +          M S++  +  +       
Sbjct  1188  YWRNPSYTAVRFLFTIFIALILGTMFWDLGSKATRSQDLINAMGSMYVAIVFLGVQNAAS  1247

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY+++    Y A  YA+   ++ +P   I+   +    Y +I +     
Sbjct  1248  VQPVVAVERTVFYREQAAGMYSALPYALAQVLIEVPYVLIQAISYAIIVYTMIEFKWTLA  1307

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDD  1060
             +    W L  +   L    +     VG +  N   + S I    +A+     GFI+ R  
Sbjct  1308  KFF--WHLFFMCFTLLYFTYYGMMAVGMTPNNH--IASIISFAFYAIWNLFSGFIVPRTR  1363

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFP  898
             +  WW W YW +P  +    + V++F      L  +  TV  +  + FG     YR  F 
Sbjct  1364  IPIWWRWYYWANPASWTLYGLVVSQFGDLENVLEDTGGTVEEYVRDYFG-----YRHDFL  1418

Query  897   EAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             +          +IGFT+   F++ +++  L
Sbjct  1419  DVI-----ATMMIGFTVLFAFVFAISIKVL  1443



>ref|XP_004486706.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cicer 
arietinum]
Length=1423

 Score =  1417 bits (3668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/1049 (65%), Positives = 854/1049 (81%), Gaps = 12/1049 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D    + S R  SS++W N G + F++SSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGTDIYRATNSLRARSSTVWRNSGVEVFSRSSR----EEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   E+D+ ++GY+EK+K+LERL+KV E DNE FLLKLK+R++RV +DIP 
Sbjct  57    RKGLLTTSHGAANEIDVTDLGYQEKQKLLERLVKVAEEDNEGFLLKLKERVDRVGLDIPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIK  2605
             +EVR+EHL + AEA+VG RALPS  N   N++EGLL+ L++ P+ K+H +IL+DVSG+IK
Sbjct  117   IEVRYEHLKIDAEAFVGGRALPSFINAATNVVEGLLNVLHIVPSKKRHVAILKDVSGVIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPP SGKT+LLLAL+G+LD +L+ SG V+YNGH +NEFVP RTAAYISQHD+
Sbjct  177   PRRMTLLLGPPGSGKTTLLLALSGKLDTTLQLSGSVTYNGHGLNEFVPQRTAAYISQHDV  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPD+D++MKA AT+GQ+++
Sbjct  237   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDVDVYMKAIATEGQESS  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             +  DY++K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  297   ISTDYVMKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++ Y+HI++GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FF
Sbjct  357   STTFQIVSSLRQYVHIMNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTS+KDQ QYW+R+D +PYRFVT+ +F+EAFQSFHIGR L 
Sbjct  417   ESMGFKCPERKGVADFLQEVTSKKDQAQYWVRRD-QPYRFVTVTQFAEAFQSFHIGRKLT  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +EL+ PF K+ SHPAALTTK YG++K ELLK+ FSRE LLMKRN  ++IF++  + +MA 
Sbjct  476   EELSVPFDKTKSHPAALTTKEYGLNKKELLKANFSREYLLMKRNSFVYIFKLCQLFVMAF  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF RT M R++   A +Y  +LFFTL  IMF+ + E++ TI +LP+FYKQRDLLFY
Sbjct  536   IAMTLFFRTEMHRDNQDDAGVYAGALFFTLVTIMFNGMSEISMTIAKLPVFYKQRDLLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IPIT +EVS+WVF TYYVIG+DPN GR  K +++L    Q+AS LFR
Sbjct  596   PSWAYAIPSWILKIPITLMEVSLWVFLTYYVIGFDPNVGRFFKQFLVLFFMSQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   GSF +L L ALGGFILSR D+K WWIWGYWISPLMY QNA+  NE
Sbjct  656   ATAALGRNMIVANTFGSFAVLTLLALGGFILSRKDIKGWWIWGYWISPLMYGQNALMANE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG +W+     ++   G   L  RG FP AYWYW+GVG L+GF  F   ++ +ALA L 
Sbjct  716   FLGNNWHN----ATFDLGKQYLDNRGFFPHAYWYWIGVGGLVGFVFFFNALFGVALAVLG  771

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNS-VGERVSDGMSNRKHGMILPFEPHSIAFNDIK  628
             P  + +A I+ +S     +V     ++S  G+ V++    +K GM+LPFEPHSI F+DI 
Sbjct  772   PFDKPQATITEDSEEVVEEVELPRIESSGRGDSVTESSHGKKKGMVLPFEPHSITFDDIV  831

Query  627   YCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY  448
             Y VDMP EMK +GV+++RL LLKGVSGAFRP VLTALMGVSGAGKTTLMDVLAGRKTGGY
Sbjct  832   YSVDMPVEMKEQGVQEDRLVLLKGVSGAFRPSVLTALMGVSGAGKTTLMDVLAGRKTGGY  891

Query  447   IEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLF  268
             I+G I +SG+ KKQ+TFAR+SGYCEQNDIHSPH+TVYESL++SAWLRL S V  +TRK+F
Sbjct  892   IDGSIKVSGYPKKQETFARVSGYCEQNDIHSPHVTVYESLLYSAWLRLASGVDSKTRKMF  951

Query  267   IKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARA  88
             I+EVM+LVEL SLR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLDARA
Sbjct  952   IEEVMDLVELNSLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARA  1011

Query  87    AAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  AAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1040


 Score =   128 bits (321),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 119/567 (21%), Positives = 244/567 (43%), Gaps = 70/567 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +P  +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  852   LLKGVSGAFRPSVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKVSGYPKKQETFAR  910

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  911   VSGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  939

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
             A+  D +   + ++ ++ ++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  940   ASGVDSKTRKMFIEEVMDLVELNSLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  999

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1000  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1058

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVT+         ++ N    F   
Sbjct  1059  VGPLGRHSTHLIKYFESIEGVSKIKDGYNPATWMLEVTTTA-------QEHNLGVDFTDY  1111

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVLLMK  1579
              + S+ ++     + L  EL  P   S   H     ++++ V      ++C  ++     
Sbjct  1112  YKNSDLYRR---NKQLIQELGQPAPGSKDLHFPTQFSQSFLVQ----CQACLWKQRWSYW  1164

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE--  1405
             RN         +   +A++  T+F     + +S    Q  ++++    T ++F  +Q   
Sbjct  1165  RNPPYTAVRFFFTTFIAIMFGTMFWDLGGKHSS---RQDLLNAVGSMYTAVLFLGVQNSS  1221

Query  1404  -LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
              + P +     +FY+++    Y A  YA    ++ +P    +   +    Y +IG+D   
Sbjct  1222  SVQPVVAVERTVFYREKAAGMYSALPYAFSQILVELPYVFAQAVTYGVIVYAMIGFDWTA  1281

Query  1230  GRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRD  1063
              +    W L  ++  L    F     V  ++T    V S +    +A+     GF++ R 
Sbjct  1282  EKFF--WYLFFMYFTLLYFTFYGMMAV--AVTPNHHVASIVAAAFYAIWNLFSGFVVPRP  1337

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  WW W YW  P+ +    +  ++F
Sbjct  1338  SIPIWWRWYYWACPVAWTIYGLVASQF  1364



>gb|KHN07106.1| Pleiotropic drug resistance protein 1 [Glycine soja]
Length=1448

 Score =  1417 bits (3667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/1065 (65%), Positives = 847/1065 (80%), Gaps = 32/1065 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             R  S RI SS +W +G+ D F+ SSRR    DDDE  LKWAA++K+PT+ R+ +G++T  
Sbjct  7     RVASARIGSSGVWRSGSIDVFSGSSRR----DDDEQELKWAAIEKLPTYLRMTRGILTET  62

Query  2937  RGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHL  2758
              G+  E+DIN +   ++K ++ERL+K+ E+DNE FL KL+DR++RV ++IP +E+RFEHL
Sbjct  63    EGQPTEIDINKLCPLQRKNLVERLVKIAEQDNEKFLFKLRDRIDRVGLEIPTIEIRFEHL  122

Query  2757  NVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIKPGRMTLLL  2581
             NV AEA+VG RALP++ NFC+N+ EG L+ L+L P+ KK  ++L DVSGIIKP RMTLLL
Sbjct  123   NVEAEAHVGSRALPTIFNFCINLFEGFLNSLHLIPSRKKPFTVLDDVSGIIKPKRMTLLL  182

Query  2580  GPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTAR  2401
             GPPSSGKT+LLLALAG+L   L+FSGRVSYNGH M EFVP RT+AYISQ DLHI EMT R
Sbjct  183   GPPSSGKTTLLLALAGRLSKDLKFSGRVSYNGHGMEEFVPQRTSAYISQTDLHIGEMTVR  242

Query  2400  ETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIK  2221
             ETLAFSARCQG+G+RYEMLAELSRREKAANI+PDPD+DI+MKAAA +GQ+ NV+ DYI+K
Sbjct  243   ETLAFSARCQGIGTRYEMLAELSRREKAANIKPDPDLDIYMKAAALEGQETNVVTDYIMK  302

Query  2220  VLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILK  2041
             +LGLE C DT+VG++ +RG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTTFQ++ 
Sbjct  303   ILGLEVCADTMVGDDMIRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQMVN  362

Query  2040  SIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCP  1861
             S++  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+GQIVYQGP   VLEFFE +GF+CP
Sbjct  363   SLRQSIHILNGTAVISLLQPAPETYELFDDIILLSDGQIVYQGPRENVLEFFEYMGFKCP  422

Query  1860  ERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQ  1681
             ERKGVADFLQEVTSRKDQ QYW  KD +PY FVT+ EF+EAFQSFH GR LGDELATPF 
Sbjct  423   ERKGVADFLQEVTSRKDQEQYWANKD-EPYSFVTVKEFAEAFQSFHAGRKLGDELATPFD  481

Query  1680  KSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIR  1501
              S  HPA LT   +GV K ELLK+C SRE LLMKRN  ++IF++  ++L   ITMTLF+R
Sbjct  482   MSKGHPAVLTKNKFGVCKKELLKACVSREFLLMKRNSFVYIFKMWQLILTGFITMTLFLR  541

Query  1500  TNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIP  1321
             T M R++     IYM +LFF L VIMF+   EL+ +I +LP+FYKQRDLLF+P WAY++P
Sbjct  542   TEMHRDTETDGGIYMGALFFVLIVIMFNGYSELSMSIMKLPVFYKQRDLLFFPCWAYSLP  601

Query  1320  TFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRS  1141
             T+IL+IPIT +EV +WV  TYYVIG+DP+  R +K + LL+   Q+AS LFR    VGR+
Sbjct  602   TWILKIPITLVEVGIWVVMTYYVIGFDPSIERFIKQYFLLVCINQMASGLFRFMGAVGRN  661

Query  1140  MTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNT  961
             +  A  VGSF +L +  +GGFILSR DVKKWW+WGYW SP+MY QNA+AVNEFLGKSW+ 
Sbjct  662   IIVANTVGSFALLAVMVMGGFILSRVDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWSH  721

Query  960   VLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRAN  781
             V P S+EP GV VLK RG+FP+AYWYW+GVGA IG+ +   F++ LAL  L P  + +A 
Sbjct  722   VTPNSTEPLGVKVLKSRGIFPKAYWYWIGVGASIGYMLLFNFLFPLALHYLDPFGKPQAL  781

Query  780   ISAESHS------NEHDVS-----NGGSDNSVGER--------------VSDGMSNRKHG  676
             IS E+ +      NEH +       G SD     R              +     N+K G
Sbjct  782   ISEEALAERNAGRNEHIIELSSRIKGSSDKGNESRRNVSSRTLSARVGGIGASEHNKKRG  841

Query  675   MILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAG  496
             M+LPF P SI F++I+Y V+MPQEMK +G+ ++RLELLKGV+GAFRPGVLTALMGVSGAG
Sbjct  842   MVLPFTPLSITFDEIRYSVEMPQEMKSQGILEDRLELLKGVNGAFRPGVLTALMGVSGAG  901

Query  495   KTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSA  316
             KTTLMDVL+GRKT GYI+G+ITISG+ K+Q+TFARI+GYCEQ DIHSPH+TVYESL++SA
Sbjct  902   KTTLMDVLSGRKTAGYIQGQITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSA  961

Query  315   WLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANP  136
             WLRLP EV   TR++FI+EVMELVELTSLREA+VGLPGVNGLST QRKRLTIAVELVANP
Sbjct  962   WLRLPPEVDSSTRQMFIEEVMELVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANP  1021

Query  135   SIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1022  SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1066


 Score =   142 bits (359),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 144/637 (23%), Positives = 266/637 (42%), Gaps = 80/637 (13%)
 Frame = -2

Query  2661  LPTTKKHNSILRD-------VSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSG  2503
             +P   K   IL D       V+G  +PG +T L+G   +GKT+L+  L+G+        G
Sbjct  862   MPQEMKSQGILEDRLELLKGVNGAFRPGVLTALMGVSGAGKTTLMDVLSGRKTAGY-IQG  920

Query  2502  RVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRRE  2323
             +++ +G+   +    R A Y  Q D+H P +T  E+L +SA                   
Sbjct  921   QITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAW------------------  962

Query  2322  KAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERK  2143
                 +R  P++D              + ++ +++++ L    + +VG   + G+S  +RK
Sbjct  963   ----LRLPPEVD---------SSTRQMFIEEVMELVELTSLREALVGLPGVNGLSTEQRK  1009

Query  2142  RLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYD  1963
             RLT    LV   +++ MDE ++GLD+     +++++++ +     T V  + QP+ + +D
Sbjct  1010  RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFD  1068

Query  1962  LFDDIILISEG-QIVYQGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQM  1804
              FD+++L+  G + +Y GP    C+ ++  FE +      + G   A ++ EVTS   + 
Sbjct  1069  AFDELLLLKRGGEEIYVGPLGQHCSHLINHFEGINGVPKIKNGYNPATWMLEVTSEAQEA  1128

Query  1803  QYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKM  1624
                +        F  I + S+ ++     + L  EL TP   + S      TK Y  +  
Sbjct  1129  ALGVN-------FAEIYKNSDLYRR---NKALIRELTTP--PTGSKDLYFPTK-YSQTFF  1175

Query  1623  ELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLF  1444
                 +C  ++ L   RN       + +  ++AL+  T+F     +R         M S++
Sbjct  1176  TQCMACLWKQHLSYWRNPPYSAVRLLFTTIIALLFGTIFWDIGSKRQRKQDLFNAMGSMY  1235

Query  1443  FTLTVIMFSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVF  1267
               +  I       + P +     +FY++R    Y A  YA     + IP   I+  V+  
Sbjct  1236  AAVLFIGIQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVAIEIPYIFIQTLVYGV  1295

Query  1266  STYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL  1087
               Y +IG+D  F +       +       +     A  +      A +V     ++    
Sbjct  1296  IVYAMIGFDWTFSKFFWYLFFMFFTFLYFTFYGMMAVGLTPDHNVATIVSFGFYMIWNLF  1355

Query  1086  GGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLV  922
              GF++ R  +  WW W +WI P+ +    +  ++F        +  TV  F    FG   
Sbjct  1356  SGFVIPRTRMPVWWRWYFWICPVSWTLYGLVTSQFGDIKEPIDTGETVEEFVRSYFG---  1412

Query  921   LKYRGLFPEAYWYWLGVGA--LIGFTIFSIFIYTLAL  817
               YR  F       +GV A  L+GFT+   F +  ++
Sbjct  1413  --YRDDF-------VGVAAAVLVGFTLLFGFTFAFSI  1440



>ref|XP_010023518.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Eucalyptus grandis]
Length=1441

 Score =  1417 bits (3667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/1061 (65%), Positives = 854/1061 (80%), Gaps = 18/1061 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLK  2959
             ME  D+   S S R  SS++  N        SR    D DDE +L+WAALQK+PTF+RL+
Sbjct  1     MEGGDTYRASNSLRATSSTMQKNHATTMDVLSRS-SCDGDDEESLRWAALQKLPTFERLR  59

Query  2958  KGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKV  2779
             KG++T   G   E+DI N+G+ E+K+++ERL++V E DNE+FLLKL++R++RV I++  +
Sbjct  60    KGILTAGGGAN-EIDIRNLGFHERKRLIERLVRVTEEDNESFLLKLRNRIDRVGIELSTI  118

Query  2778  EVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKP  2602
             EVRFEHLNV AEA+ G +ALP+V NFC +ILEG L++++ LP+ KK+ +IL+DVSGIIKP
Sbjct  119   EVRFEHLNVEAEAHEGSKALPTVINFCTSILEGFLNFMHILPSRKKYLTILQDVSGIIKP  178

Query  2601  GRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLH  2422
             GRMTLLLGPP SGKT+LLLALAG+LDP L+ +G+V+YNGH +NEFVP RTAAYISQHDLH
Sbjct  179   GRMTLLLGPPDSGKTTLLLALAGKLDPKLKTTGKVTYNGHVLNEFVPQRTAAYISQHDLH  238

Query  2421  IPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANV  2242
             I EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PD DIDIFMKAAA +GQ+ANV
Sbjct  239   IGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDLDIDIFMKAAAIEGQEANV  298

Query  2241  IVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSS  2062
             + DYI+K+LGLE C DT++G+E LRG+SGGERKR+T GEMLVGPA V  MDEISTGLDSS
Sbjct  299   VTDYILKILGLEICADTMIGDEMLRGISGGERKRVTIGEMLVGPAKVFFMDEISTGLDSS  358

Query  2061  TTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFE  1882
             TT+QI+ S+K +IH L GTA+I+LLQP PE YDLFDDIIL+S+GQ+VYQGP   VL+FFE
Sbjct  359   TTYQIVNSLKQFIHTLDGTAIISLLQPTPETYDLFDDIILLSDGQMVYQGPQELVLDFFE  418

Query  1881  CLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGD  1702
              +GF+CPERKGVADFLQEVTSRKDQ QYW+RKD +PY F+T+ EF+EAFQSFH+GR L D
Sbjct  419   SMGFKCPERKGVADFLQEVTSRKDQYQYWVRKD-EPYTFITVREFAEAFQSFHVGRKLRD  477

Query  1701  ELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALI  1522
             EL+TPF KS +HPAALTTK +GV   +LLK+C SRE LLMKRN  ++IF++  + +MA I
Sbjct  478   ELSTPFDKSKNHPAALTTKRFGVRTKDLLKACISREYLLMKRNSFVYIFKITQLTIMAFI  537

Query  1521  TMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYP  1342
             TMTLF+RT M R++     +Y+ +LFFT+  IMF+ + EL+ TI +LPIFYKQRDL FYP
Sbjct  538   TMTLFLRTKMHRDTVTDGGVYIGALFFTVMTIMFNGMAELSMTIAKLPIFYKQRDLRFYP  597

Query  1341  AWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRS  1162
             AWAYA+P +IL+IPIT +EV++WVF TYYVIGYDPN GRL K ++LL+   Q+AS LFR 
Sbjct  598   AWAYALPIWILKIPITFVEVAIWVFITYYVIGYDPNVGRLFKQYLLLVAVNQMASGLFRL  657

Query  1161  AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              A +G ++  A  +GSF++L LFALGG ILS++++KKWW+WG+WISPLMYAQNAI VNE 
Sbjct  658   IAALGGNLIVANTLGSFVLLTLFALGGVILSQENIKKWWVWGFWISPLMYAQNAIVVNEL  717

Query  981   LGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             LG +W+ + P SS  E  G+ VLK RG F EA+WYW+GVGAL GF I   F +++ALA L
Sbjct  718   LGSNWDKIPPNSSTNESLGIQVLKSRGFFTEAHWYWIGVGALFGFIILFNFGFSVALALL  777

Query  807   RPLAQSRANISAESHSNEHDVSNGGS---DNSVGERVSDG---------MSNRKHGMILP  664
              P  +S+   S +   NE+    G S    +    R+S+           +NRK GM+LP
Sbjct  778   NPFGRSQTVKSDDPQGNENVNRMGRSIQLQSQGSRRLSESTPTWPEMAITTNRKSGMVLP  837

Query  663   FEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTL  484
             FE HSI F++I Y VDMPQEMK +G   ++L LLKGVSGAFRPGVLTA+MGVSGAGKTTL
Sbjct  838   FEQHSITFDEITYSVDMPQEMKSQGALKDKLVLLKGVSGAFRPGVLTAIMGVSGAGKTTL  897

Query  483   MDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRL  304
             MDVLAGRK GGYI+G +TISG+ K Q TFARISGYCEQ+DIHSPH+T+YESLI+SAWLRL
Sbjct  898   MDVLAGRKIGGYIKGSMTISGYPKNQDTFARISGYCEQDDIHSPHVTIYESLIYSAWLRL  957

Query  303   PSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIF  124
             P  +  +TRKLF++EVMEL+EL  LR+A+VGLPGV+GLST QRKRLTIAVELVANPSIIF
Sbjct  958   PPGMDNQTRKLFVEEVMELMELNLLRQALVGLPGVDGLSTEQRKRLTIAVELVANPSIIF  1017

Query  123   MDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             MDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1018  MDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1058


 Score =   147 bits (371),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 144/630 (23%), Positives = 271/630 (43%), Gaps = 84/630 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T ++G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  870   LLKGVSGAFRPGVLTAIMGVSGAGKTTLMDVLAGRKIGGY-IKGSMTISGYPKNQDTFAR  928

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P +D    
Sbjct  929   ISGYCEQDDIHSPHVTIYESLIYSAW----------------------LRLPPGMD----  962

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  963   -----NQTRKLFVEEVMELMELNLLRQALVGLPGVDGLSTEQRKRLTIAVELVANPSIIF  1017

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+ +G Q +Y
Sbjct  1018  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLLKQGGQEIY  1076

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +      + G   A ++ EVTS   ++   +            
Sbjct  1077  VGPLGRHSSHLIEYFEGIQGVNKIKDGYNPATWMLEVTSAAQELALGV------------  1124

Query  1755  NEFSEAFQSFHI-GRN--LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +FS+ +++  + GRN  L +EL+ P     S      TK Y  S    L +C  ++   
Sbjct  1125  -DFSDLYKNSDLYGRNKALIEELSIP--PPNSKDLHFPTK-YSQSTFTQLMACLWKQHWS  1180

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + + +ALI  T+F     +          M S++  +  +       
Sbjct  1181  YWRNPSYTAVRFLFTIFIALILGTMFWDLGSKATRSQDLINAMGSMYVAIVFLGVQNAAS  1240

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY+++    Y A  YA+   ++ +P   I+   +    Y +I +     
Sbjct  1241  VQPVVAVERTVFYREQAAGMYSALPYALAQVLIEVPYVLIQAISYAIIVYTMIEFKWTLA  1300

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDD  1060
             +    W L  +   L    +     VG +  N   + S I    +A+     GFI+ R  
Sbjct  1301  KFF--WHLFFMCFTLLYFTYYGMMAVGMTPNNH--IASIISFAFYAIWNLFSGFIVPRTR  1356

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFP  898
             +  WW W YW +P  +    + V++F      L  +  TV  +  + FG     YR  F 
Sbjct  1357  IPIWWRWYYWANPASWTLYGLVVSQFGDLENVLEDTGGTVEEYVRDYFG-----YRHDFL  1411

Query  897   EAYWYWLGVGALIGFTIFSIFIYTLALAKL  808
             +          +IGFT+   F++ +++  L
Sbjct  1412  DVI-----ATMMIGFTVLFAFVFAISIKVL  1436



>ref|XP_006476215.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X3 [Citrus sinensis]
Length=1450

 Score =  1417 bits (3667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/1071 (66%), Positives = 849/1071 (79%), Gaps = 28/1071 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             M+   +  R  S R+ SSS+W N T D FA+SSR    DDD+  AL WAA++K+PT+ R+
Sbjct  1     MDAGQASFRISSARLGSSSIWRNNTLDVFARSSREDTYDDDE--ALTWAAIEKLPTYLRV  58

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++T   G+  EVDI N+G+ E++ ++ERL+K+ E DNE FLLKLKDR+ERV +DIP 
Sbjct  59    QRGMLTEDEGQAREVDIKNLGFIERRNLIERLLKIAEEDNEKFLLKLKDRIERVGLDIPT  118

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEHLNV AEAY+G RALP+V N C N+LEG L+YL+ LP+ KK  +IL DVSGIIK
Sbjct  119   IEVRFEHLNVEAEAYIGSRALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIK  178

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPPSSGKT+LLLALAG+L   L+FSGRV+YNGH M EFVP RT+AYISQ+DL
Sbjct  179   PQRLTLLLGPPSSGKTTLLLALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDL  238

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG RYE+L ELSRREKAANI+PDPDID+ MKAA+ +GQ+ N
Sbjct  239   HIGEMTVRETLAFSARCQGVGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKN  298

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY++K+LGLE C DT+VG+E LRG+SGG+RKRLT GEMLVGPA  L MDEISTGLDS
Sbjct  299   VVTDYVLKILGLEVCADTMVGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDS  358

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STT+QI+ S++  IHIL+GTAVI+LLQPAPE Y+LFDD+IL+S+GQIVYQGP   VLEFF
Sbjct  359   STTYQIVNSLRQSIHILNGTAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFF  418

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTSRKDQ QYW  KD +PY FVT  EFSE FQSFHIG+ LG
Sbjct  419   ERMGFKCPERKGVADFLQEVTSRKDQEQYWANKD-EPYSFVTAKEFSEVFQSFHIGQKLG  477

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELATPF KS SHPAALTTK YG SK ELLK+CF+RE LLMKRN  ++ F++  +   A 
Sbjct  478   DELATPFDKSKSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSAS  537

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             + MTLF+RT M R++     IYM +LFF +  IMF+   EL+ TI +LP+FYKQRD LF+
Sbjct  538   VAMTLFLRTEMHRSTVEDGGIYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFF  597

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAY++PT+IL+IPIT IEV +WVF TYYV+G++ N  R +K + LL+   Q AS LFR
Sbjct  598   PAWAYSLPTWILKIPITFIEVGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFR  657

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                 +GR++  A   GSF  L +  LGGFILSRDDVKKWW+WGYW SP+MY QNA+AVNE
Sbjct  658   LMGALGRNIIVANTFGSFANLTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNE  717

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW  V P S+EP GV++LK RGLFP AYWYW+GVGAL+G+ +   F++T+AL  L 
Sbjct  718   FLGKSWGHVPPNSTEPLGVVILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLD  777

Query  804   PLAQSRANISAESHSNEHDVS-------NGGSDNSVGERVSDGMS---------------  691
             P  + +A +S E+ + ++          + G  +S G      +S               
Sbjct  778   PFGKPQAILSEEALAKKNACKTEEPVELSSGVQSSYGNESHRNVSFRTLSARVRSFNEAD  837

Query  690   -NRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALM  514
              NRK GMILPFEPHSI F+DI+Y +DMPQEMK +G+ D+RLE LKGVSGAFRPGVLTALM
Sbjct  838   QNRKRGMILPFEPHSITFDDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTALM  897

Query  513   GVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYE  334
             GVSGAGKTTLMDVLAGRKTGGY+ G ITISG+ K Q+TFARISGYCEQ DIHSPH+TVYE
Sbjct  898   GVSGAGKTTLMDVLAGRKTGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTVYE  957

Query  333   SLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAV  154
             SL++SAWLRLP EV  +TRK+F++EVMELVEL  +REA+VGLPGV+GLST QRKRLTIAV
Sbjct  958   SLVYSAWLRLPPEVDSDTRKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAV  1017

Query  153   ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1018  ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1068


 Score =   146 bits (369),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 131/563 (23%), Positives = 254/563 (45%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
              L+ VSG  +PG +T L+G   +GKT+L+  LAG+       SG ++ +G+  N+    R
Sbjct  880   FLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-VSGSITISGYPKNQETFAR  938

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P++D    
Sbjct  939   ISGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPEVD----  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                +D +K  + V+ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   ---SDTRK--MFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1027

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G + +Y
Sbjct  1028  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLMKRGGEEIY  1086

Query  1917  QGP----CNCVLEFFECLGF--RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    C+ ++++FE +    +  E    A ++ EVT+   +    I        F  +
Sbjct  1087  VGPLGRHCSQLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGIN-------FAKV  1139

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + +  EL+ P     S      T+ Y  S      +C  ++ L   R
Sbjct  1140  YKNSELYKG---NKEMIKELSIP--PPGSKNLYFQTR-YSQSFFTQCMACLWKQHLSYWR  1193

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R +       M S++  +  +       + P
Sbjct  1194  NPPYTAVRLFFTTFIALMFGTIFWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQP  1253

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   I+  ++    Y +IG+D    + L
Sbjct  1254  VVAVERTVFYRERAAGMYSALPYAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFL  1313

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W LL ++  L  + F    ++  ++T    + + I    + L     GFI+ R  +  
Sbjct  1314  --WYLLFMY--LTFLYFTLYGMMTVAVTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPI  1369

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W  WI P+ +    +  ++F
Sbjct  1370  WWRWYCWICPVSWTLYGLVASQF  1392



>ref|XP_007135719.1| hypothetical protein PHAVU_010G152500g [Phaseolus vulgaris]
 gb|ESW07713.1| hypothetical protein PHAVU_010G152500g [Phaseolus vulgaris]
Length=1433

 Score =  1417 bits (3667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/1058 (65%), Positives = 864/1058 (82%), Gaps = 20/1058 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNG-TDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D      S R +SS+ W     +GF++SS+   E+  DE ALKWAAL+K+PT++RL
Sbjct  1     MEGSDIYRARNSLRASSSTAWRRSIMEGFSRSSQ--HEEGADEEALKWAALEKLPTYNRL  58

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             KKGL+T  RG   E+DI  +G+ E++K+L+RLI V E DNE FLLKLK+R++RV IDIP 
Sbjct  59    KKGLLTTSRGVASEIDITELGFRERQKLLDRLINVAEEDNEKFLLKLKERIDRVGIDIPT  118

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVR+EHL+V AEAYVG RALP+  NF  N++E + + L+ L   KKH +IL+DVSGIIK
Sbjct  119   IEVRYEHLHVDAEAYVGSRALPTFVNFVTNMVESVFTSLHILSGKKKHVTILKDVSGIIK  178

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RM LLLGPPSSGKT+LLLAL+G+LDP+L+ SGRV+YNGH M+EFVP RTAAYISQ+D+
Sbjct  179   PRRMALLLGPPSSGKTTLLLALSGKLDPNLKASGRVTYNGHGMDEFVPQRTAAYISQNDV  238

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+RY++L+EL+RREK A I+PDPDID++MKAAAT GQ+A+
Sbjct  239   HIGEMTVRETLAFSARCQGVGTRYDLLSELARREKEAKIKPDPDIDVYMKAAATGGQEAS  298

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             ++ DY++K+LGL+ C DT++G+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  299   LVTDYVLKILGLDICADTMMGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  358

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+KS++ Y+HIL GTAVI+LLQPAPE Y+LFDDIILIS+GQIVYQGP   VL+FF
Sbjct  359   STTFQIVKSLRQYVHILDGTAVISLLQPAPETYELFDDIILISDGQIVYQGPREHVLQFF  418

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTSRKDQ QYW+ +D +PYRFVT+ EF+EAFQSFH+GR +G
Sbjct  419   ESVGFQCPERKGVADFLQEVTSRKDQEQYWMHRD-EPYRFVTVTEFAEAFQSFHVGRRIG  477

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             ++LATPF KS +HPAALTT+ YGV+K ELLK+  SRE LLMKRN  ++ F++  +  +A+
Sbjct  478   EQLATPFDKSKNHPAALTTERYGVNKKELLKANISREYLLMKRNSFVYFFKLFQLTTLAI  537

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             +TMT+F+RT M R++     +Y  +LFF + ++MF+ L E++ TI +LPIFYKQRDLLFY
Sbjct  538   LTMTMFLRTEMHRDNMGDGGVYTGALFFAVVILMFNGLAEISMTIVKLPIFYKQRDLLFY  597

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IPIT +E +VWVF TYYVIG+DPN GR LK +++L++  Q++S LFR
Sbjct  598   PSWAYAIPSWILKIPITFLEAAVWVFLTYYVIGFDPNVGRFLKQYLVLLLINQMSSGLFR  657

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   GSF +L+LFALGGF+LS++D+KKWWIWGYWISPLMY QNAI VNE
Sbjct  658   AIAALGRNMIVANTFGSFALLILFALGGFVLSKNDIKKWWIWGYWISPLMYGQNAIVVNE  717

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG SWN   P S++  G+ +L+ RG F  AYWYW+G+GALIGF      +YTLAL+ L 
Sbjct  718   FLGNSWNHFTPNSNKTLGIQILESRGFFTHAYWYWIGIGALIGFIFLFNIMYTLALSYLN  777

Query  804   PLAQSRANIS------AESHSNEHDVS---NGGSDNSVGERVSDGMSNRKH-GMILPFEP  655
             P  + +A I+      A   + E +++   + GS NSV   VS   S RK+ GM+LPFEP
Sbjct  778   PFDKPQATITESEGGMANGRAREEELTCLESCGSANSV---VS--CSRRKNRGMVLPFEP  832

Query  654   HSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDV  475
             +SI F+ I Y VDMPQEMK +GV + +L LLKGVSGAF PGVLTALMGVSGAGKTTLMDV
Sbjct  833   YSITFDQIVYSVDMPQEMKEQGVREEKLVLLKGVSGAFCPGVLTALMGVSGAGKTTLMDV  892

Query  474   LAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSE  295
             LAGRKTGGYIEG I +SG+ K+Q+TFARISGYCEQNDIHSPH+TVYESL++SAWLRL +E
Sbjct  893   LAGRKTGGYIEGNIKVSGYPKRQETFARISGYCEQNDIHSPHVTVYESLVYSAWLRLTAE  952

Query  294   VTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDE  115
             V  +TRK+F++EVMELVEL  LR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDE
Sbjct  953   VESKTRKMFVEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDE  1012

Query  114   PTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             PTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1013  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1050


 Score =   129 bits (324),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 122/566 (22%), Positives = 244/566 (43%), Gaps = 68/566 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG   PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  862   LLKGVSGAFCPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNIKVSGYPKRQETFAR  920

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +       + AE+  + +               
Sbjct  921   ISGYCEQNDIHSPHVTVYESLVYSAWLR-------LTAEVESKTR---------------  958

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                       + V+ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  959   ---------KMFVEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1009

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+   GQ +Y
Sbjct  1010  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1068

Query  1917  QGPCNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQ--YWIRKDNKPYRFVTIN-EF  1747
              GP          LG +  +     + ++ V+  KD      W+ +   P + +T+  +F
Sbjct  1069  VGP----------LGRQSSQLIKYFESIEGVSKIKDGYNPATWMLEVTTPAQELTLGVDF  1118

Query  1746  SEAFQS---FHIGRNLGDELATPFQ--KSTSHPAALTTKTYGVSKMELLKSCFSREVLLM  1582
              E +++   +   + L  EL  P    K    P       Y  S +    +C  ++    
Sbjct  1119  HEIYRNSELYRRNKQLIAELGNPGHGSKDIEFPT-----QYAQSLLVQCIACLWKQHWSY  1173

Query  1581  KRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE-  1405
              RN            + AL+  T+F     + +     Q   ++L      ++F  +Q  
Sbjct  1174  WRNPPYTAVRFLSTTVTALMFGTMFWDLGGKYSR---RQDLFNALGSMYNAVLFVGVQNS  1230

Query  1404  --LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
               + P +     +FY++R    Y A+ YA+   ++ +P   ++ S +    Y ++G++  
Sbjct  1231  SSVQPVVAIGRTVFYRERAAGMYSAFPYALAQVLIELPYIFVQASTYSVIVYSMMGFEWT  1290

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDD  1060
               +    W L  ++  L    F     V  +  +  A VV S    +     GF+++R  
Sbjct  1291  LEKFF--WYLFFMYFTLCYFTFYGMMTVAVTPNHHVASVVASAFYGIWNLFSGFVIARPS  1348

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF  982
             +  WW W YW  P+ +    +  ++F
Sbjct  1349  IPVWWRWYYWACPVAWTIYGLVASQF  1374



>ref|XP_003526427.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine 
max]
Length=1448

 Score =  1417 bits (3667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/1065 (65%), Positives = 847/1065 (80%), Gaps = 32/1065 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             R  S RI SS +W +G+ D F+ SSRR    DDDE  LKWAA++K+PT+ R+ +G++T  
Sbjct  7     RVASARIGSSGVWRSGSIDVFSGSSRR----DDDEQELKWAAIEKLPTYLRMTRGILTET  62

Query  2937  RGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHL  2758
              G+  E+DIN +   ++K ++ERL+K+ E+DNE FL KL+DR++RV ++IP +E+RFEHL
Sbjct  63    EGQPTEIDINKLCPLQRKNLVERLVKIAEQDNEKFLFKLRDRIDRVGLEIPTIEIRFEHL  122

Query  2757  NVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIKPGRMTLLL  2581
             NV AEA+VG RALP++ NFC+N+ EG L+ L+L P+ KK  ++L DVSGIIKP RMTLLL
Sbjct  123   NVEAEAHVGSRALPTIFNFCINLFEGFLNSLHLIPSRKKPFTVLDDVSGIIKPKRMTLLL  182

Query  2580  GPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTAR  2401
             GPPSSGKT+LLLALAG+L   L+FSGRVSYNGH M EFVP RT+AYISQ DLHI EMT R
Sbjct  183   GPPSSGKTTLLLALAGRLSKDLKFSGRVSYNGHGMEEFVPQRTSAYISQTDLHIGEMTVR  242

Query  2400  ETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIK  2221
             ETLAFSARCQG+G+RYEMLAELSRREKAANI+PDPD+DI+MKAAA +GQ+ NV+ DYI+K
Sbjct  243   ETLAFSARCQGIGTRYEMLAELSRREKAANIKPDPDLDIYMKAAALEGQETNVVTDYIMK  302

Query  2220  VLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILK  2041
             +LGLE C DT+VG++ +RG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTTFQ++ 
Sbjct  303   ILGLEVCADTMVGDDMIRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQMVN  362

Query  2040  SIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCP  1861
             S++  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+GQIVYQGP   VLEFFE +GF+CP
Sbjct  363   SLRQSIHILNGTAVISLLQPAPETYELFDDIILLSDGQIVYQGPRENVLEFFEYMGFKCP  422

Query  1860  ERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQ  1681
             ERKGVADFLQEVTSRKDQ QYW  KD +PY FVT+ EF+EAFQSFH GR LGDELATPF 
Sbjct  423   ERKGVADFLQEVTSRKDQEQYWANKD-EPYSFVTVKEFAEAFQSFHAGRKLGDELATPFD  481

Query  1680  KSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIR  1501
              S  HPA LT   +GV K ELLK+C SRE LLMKRN  ++IF++  ++L   ITMTLF+R
Sbjct  482   MSKGHPAVLTKNKFGVCKKELLKACVSREFLLMKRNSFVYIFKMWQLILTGFITMTLFLR  541

Query  1500  TNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIP  1321
             T M R++     IYM +LFF L VIMF+   EL+ +I +LP+FYKQRDLLF+P WAY++P
Sbjct  542   TEMHRDTETDGGIYMGALFFVLIVIMFNGYSELSMSIMKLPVFYKQRDLLFFPCWAYSLP  601

Query  1320  TFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRS  1141
             T+IL+IPIT +EV +WV  TYYVIG+DP+  R +K + LL+   Q+AS LFR    VGR+
Sbjct  602   TWILKIPITLVEVGIWVVMTYYVIGFDPSIERFIKQYFLLVCINQMASGLFRFMGAVGRN  661

Query  1140  MTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNT  961
             +  A  VGSF +L +  +GGFILSR DVKKWW+WGYW SP+MY QNA+AVNEFLGKSW+ 
Sbjct  662   IIVANTVGSFALLAVMVMGGFILSRVDVKKWWLWGYWFSPMMYGQNALAVNEFLGKSWSH  721

Query  960   VLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRAN  781
             V P S+EP GV VLK RG+FP+AYWYW+GVGA IG+ +   F++ LAL  L P  + +A 
Sbjct  722   VTPNSTEPLGVKVLKSRGIFPKAYWYWIGVGASIGYMLLFNFLFPLALHYLDPFGKPQAL  781

Query  780   ISAESHS------NEHDVS-----NGGSDNSVGER--------------VSDGMSNRKHG  676
             IS E+ +      NEH +       G SD     R              +     N+K G
Sbjct  782   ISEEALAERNAGRNEHIIELSSRIKGSSDKGNESRRNVSSRTLSARVGGIGASEHNKKRG  841

Query  675   MILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAG  496
             M+LPF P SI F++I+Y V+MPQEMK +G+ ++RLELLKGV+GAFRPGVLTALMGVSGAG
Sbjct  842   MVLPFTPLSITFDEIRYSVEMPQEMKSQGILEDRLELLKGVNGAFRPGVLTALMGVSGAG  901

Query  495   KTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSA  316
             KTTLMDVL+GRKT GYI+G+ITISG+ K+Q+TFARI+GYCEQ DIHSPH+TVYESL++SA
Sbjct  902   KTTLMDVLSGRKTAGYIQGQITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSA  961

Query  315   WLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANP  136
             WLRLP EV   TR++FI+EVMELVELTSLREA+VGLPGVNGLST QRKRLTIAVELVANP
Sbjct  962   WLRLPPEVDSSTRQMFIEEVMELVELTSLREALVGLPGVNGLSTEQRKRLTIAVELVANP  1021

Query  135   SIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1022  SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1066


 Score =   142 bits (359),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 144/637 (23%), Positives = 266/637 (42%), Gaps = 80/637 (13%)
 Frame = -2

Query  2661  LPTTKKHNSILRD-------VSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSG  2503
             +P   K   IL D       V+G  +PG +T L+G   +GKT+L+  L+G+        G
Sbjct  862   MPQEMKSQGILEDRLELLKGVNGAFRPGVLTALMGVSGAGKTTLMDVLSGRKTAGY-IQG  920

Query  2502  RVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRRE  2323
             +++ +G+   +    R A Y  Q D+H P +T  E+L +SA                   
Sbjct  921   QITISGYPKRQETFARIAGYCEQTDIHSPHVTVYESLVYSAW------------------  962

Query  2322  KAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERK  2143
                 +R  P++D              + ++ +++++ L    + +VG   + G+S  +RK
Sbjct  963   ----LRLPPEVD---------SSTRQMFIEEVMELVELTSLREALVGLPGVNGLSTEQRK  1009

Query  2142  RLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYD  1963
             RLT    LV   +++ MDE ++GLD+     +++++++ +     T V  + QP+ + +D
Sbjct  1010  RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFD  1068

Query  1962  LFDDIILISEG-QIVYQGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQM  1804
              FD+++L+  G + +Y GP    C+ ++  FE +      + G   A ++ EVTS   + 
Sbjct  1069  AFDELLLLKRGGEEIYVGPLGQHCSHLINHFEGINGVPKIKNGYNPATWMLEVTSEAQEA  1128

Query  1803  QYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKM  1624
                +        F  I + S+ ++     + L  EL TP   + S      TK Y  +  
Sbjct  1129  ALGVN-------FAEIYKNSDLYRR---NKALIRELTTP--PTGSKDLYFPTK-YSQTFF  1175

Query  1623  ELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLF  1444
                 +C  ++ L   RN       + +  ++AL+  T+F     +R         M S++
Sbjct  1176  TQCMACLWKQHLSYWRNPPYSAVRLLFTTIIALLFGTIFWDIGSKRQRKQDLFNAMGSMY  1235

Query  1443  FTLTVIMFSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVF  1267
               +  I       + P +     +FY++R    Y A  YA     + IP   I+  V+  
Sbjct  1236  AAVLFIGIQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQVAIEIPYIFIQTLVYGV  1295

Query  1266  STYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL  1087
               Y +IG+D  F +       +       +     A  +      A +V     ++    
Sbjct  1296  IVYAMIGFDWTFSKFFWYLFFMFFTFLYFTFYGMMAVGLTPDHNVAAIVSFGFYMIWNLF  1355

Query  1086  GGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLG-----KSWNTVLPFSSEPFGVLV  922
              GF++ R  +  WW W +WI P+ +    +  ++F        +  TV  F    FG   
Sbjct  1356  SGFVIPRTRMPVWWRWYFWICPVSWTLYGLVTSQFGDIKEPIDTGETVEEFVRSYFG---  1412

Query  921   LKYRGLFPEAYWYWLGVGA--LIGFTIFSIFIYTLAL  817
               YR  F       +GV A  L+GFT+   F +  ++
Sbjct  1413  --YRDDF-------VGVAAAVLVGFTLLFGFTFAFSI  1440



>ref|XP_008235577.1| PREDICTED: pleiotropic drug resistance protein 1-like [Prunus 
mume]
Length=1431

 Score =  1416 bits (3666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/1056 (66%), Positives = 854/1056 (81%), Gaps = 17/1056 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLK  2959
             MEI+    ++G    NSS    NG   F+ SSR     +DDE ALKWAALQ++PTF RLK
Sbjct  1     MEISCDLEKAGHSFKNSSFWTDNGAGVFSSSSR----GEDDEEALKWAALQRLPTFQRLK  56

Query  2958  KGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKV  2779
             KGL++   G   EVD++ +  +E+K ++ERL+ V E D+E FLL+LK+R++RV I +P +
Sbjct  57    KGLISTSEGGADEVDVSRLQVQERKNLIERLVGVAEEDHENFLLRLKNRIDRVGISLPTI  116

Query  2778  EVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLL-SYLYLPTTKKHNSILRDVSGIIKP  2602
             EVRFEHL + AEAYVG RALPSV N+C+N++EGLL S+  LP+ K+H +IL+DVSGIIKP
Sbjct  117   EVRFEHLKIAAEAYVGGRALPSVFNYCVNLVEGLLNSFRILPSKKQHLTILKDVSGIIKP  176

Query  2601  GRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLH  2422
              RMTLLLGPPSSGKT+LLLALAG+LD  L+FSGRV+YNGH+M+EFVP R+A YISQHD+H
Sbjct  177   CRMTLLLGPPSSGKTTLLLALAGELDRDLKFSGRVTYNGHDMHEFVPQRSAVYISQHDVH  236

Query  2421  IPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANV  2242
             I EMT  ETL FSARCQGVG+RY++LAE+SRREK ANI+PD D+DI+MKA A++ Q+A V
Sbjct  237   IGEMTVGETLTFSARCQGVGARYDILAEISRREKEANIKPDADLDIYMKAVASESQRAQV  296

Query  2241  IVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSS  2062
             + DYI+K+LGL+ C DT+VG++ +RG+SGG++KR+T GEMLVGPA  L MDEISTGLDSS
Sbjct  297   VTDYILKILGLDVCADTLVGDQLIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSS  356

Query  2061  TTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFE  1882
             TT+QI+ SIK Y+HIL GTA I+LLQPAPE Y+LFDDI+L+S+GQIVYQGP   VLEFFE
Sbjct  357   TTYQIVNSIKQYVHILKGTAFISLLQPAPETYELFDDIVLLSDGQIVYQGPREQVLEFFE  416

Query  1881  CLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGD  1702
              +GFRCPERKGVADFLQEVTSRKDQ QYW  KD +PY+F+T++EF EAF SF +GR   D
Sbjct  417   FMGFRCPERKGVADFLQEVTSRKDQEQYWATKD-EPYKFITVDEFVEAFNSFPVGRKFAD  475

Query  1701  ELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALI  1522
             ELATPF K+ SHPAALTTK YGV + ELLK+CF+RE LLMKRN  +++F++  + ++ALI
Sbjct  476   ELATPFDKTKSHPAALTTKKYGVQRTELLKACFAREFLLMKRNSFVYLFKLTQLSILALI  535

Query  1521  TMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYP  1342
             TMTLF+RT M R+S     IY  +LFF++  +MF+ + EL+ TI +LP+FYKQR LLF+P
Sbjct  536   TMTLFLRTEMHRDSVSNGGIYAGALFFSMVSVMFNGMAELSMTIAKLPVFYKQRKLLFFP  595

Query  1341  AWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRS  1162
              WAYA+P +IL+IPITC+EV+VWVF TYYVIGYDPN  RL K ++LL++  Q+AS LFR 
Sbjct  596   PWAYALPAWILKIPITCLEVAVWVFITYYVIGYDPNVERLFKQYLLLLLINQMASALFRF  655

Query  1161  AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              A VGRS+T A   GSF +++LFALGGF+LSR+D+KKWWIWGYWISPLMY QNAI VNEF
Sbjct  656   IAGVGRSLTIANTFGSFALVMLFALGGFVLSREDIKKWWIWGYWISPLMYGQNAIVVNEF  715

Query  981   LGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFT-IFSIFIYTLALAKLR  805
             LGKSW+ VLP S+EP GV VLK RG F    WYW+GVGAL G+  IF+IF +TLAL  L+
Sbjct  716   LGKSWSHVLPNSTEPLGVAVLKSRGFFTHPSWYWIGVGALAGYMLIFNIF-FTLALTYLK  774

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSVG--------ERVSDGMSNRKHGMILPFEPHS  649
             P  + +A +  E  S+   +S    + SV         E  +D   N+K GM+LPFEP+S
Sbjct  775   PFDKPQA-VRLEDSSSSPQISQENGNGSVSSRSSSARTEATADTNPNKKRGMVLPFEPYS  833

Query  648   IAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLA  469
             I F++I Y VDMPQEMK +GV +++L LL+ VSGAFRPGVLTALMGVSGAGKTTLMDVLA
Sbjct  834   ITFDEITYSVDMPQEMKNQGVPEDKLVLLRRVSGAFRPGVLTALMGVSGAGKTTLMDVLA  893

Query  468   GRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVT  289
             GRKTGGYIEG+ITISG  KKQ++FARISGYCEQNDIHSPH+TVYESL++SAWLRLP+ + 
Sbjct  894   GRKTGGYIEGKITISGHPKKQESFARISGYCEQNDIHSPHVTVYESLMYSAWLRLPAGIN  953

Query  288   CETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPT  109
              ETRK+F++EVM LVEL  LR+A+VGLPG NGLST QRKRLTIAVELVANPSIIFMDEPT
Sbjct  954   SETRKMFVEEVMGLVELNPLRQALVGLPGANGLSTEQRKRLTIAVELVANPSIIFMDEPT  1013

Query  108   SGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1014  SGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1049


 Score =   145 bits (365),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 136/568 (24%), Positives = 252/568 (44%), Gaps = 72/568 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +LR VSG  +PG +T L+G   +GKT+L+  LAG+        G+++ +GH   +    R
Sbjct  861   LLRRVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGKITISGHPKKQESFAR  919

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  920   ISGYCEQNDIHSPHVTVYESLMYSAWLR-------------------------------L  948

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              A  + +   + V+ ++ ++ L      +VG     G+S  +RKRLT    LV   +++ 
Sbjct  949   PAGINSETRKMFVEEVMGLVELNPLRQALVGLPGANGLSTEQRKRLTIAVELVANPSIIF  1008

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDI-ILISEGQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD++ IL   GQ +Y
Sbjct  1009  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDEVKILQKGGQELY  1067

Query  1917  QGPCN----CVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVTS   ++   I        F  +
Sbjct  1068  VGPLGRHSFHLIKYFEGIENVSKIKDGYNPATWMLEVTSSAKEIALGID-------FADV  1120

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L +EL+TP   S S      TK Y    +    +C  ++     R
Sbjct  1121  YKKSEIYRR---NKALIEELSTP--ASGSEDLYFPTK-YSQPFLTQCIACLWKQHWSYWR  1174

Query  1575  NCVLHIFEVGWVVLMALITMTLFI----RTNMQRN--SPIGAQIYMSSLFFTLTVIMFSA  1414
             N       + +   +AL+  T+F     +T  QR+  + IG+ +Y + LF  L +   + 
Sbjct  1175  NPPYTAIRLIYTTFIALMFGTMFWNLGSKTTKQRDLFNAIGS-MYAAVLF--LGIKNSTT  1231

Query  1413  LQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
             +Q +        +FY++R    Y A AYA     + IP    +  ++    Y +IG++  
Sbjct  1232  VQPVVDV--ERTVFYRERAAGMYSALAYAFAQVTIEIPYVFAQAVIYSVIVYAMIGFEWT  1289

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN----AFVVGSFIMLVLFALGGFILSR  1066
               + L  W L  ++     + F    ++G ++T     A +  S    +     GF++ R
Sbjct  1290  LAKFL--WYLFFMY--FTFLYFTYYGMMGVALTPNQHVAAISASAFYAIWNVFSGFVIPR  1345

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF  982
               +  WW W YW  P+ +    +A ++F
Sbjct  1346  TRIPIWWRWYYWACPMAWTLYGLAASQF  1373



>ref|XP_006465411.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus 
sinensis]
Length=1445

 Score =  1416 bits (3666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 702/1054 (67%), Positives = 853/1054 (81%), Gaps = 18/1054 (2%)
 Frame = -2

Query  3111  SGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             S S RI S+S+W + +      S   + ++DDE ALKWAAL+K+PT++RLKKG++T  RG
Sbjct  11    SNSLRIGSTSIWRSNSATLGAFSMSSRGEEDDEEALKWAALEKLPTYNRLKKGILTSSRG  70

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
             E  EVD+ N+G +E+++I+++L+KV + DNE FLLKLK+R++RV I +P +EVRFEHLNV
Sbjct  71    EANEVDVCNLGPQERQRIIDKLVKVADVDNEEFLLKLKNRIDRVGISLPTIEVRFEHLNV  130

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEAYVG RALP+  NFC NI+EG L+ +  LP+ KKH +IL+DVSGII+PGRMTLLLGP
Sbjct  131   EAEAYVGSRALPTFFNFCANIIEGFLNSVNILPSRKKHLAILKDVSGIIRPGRMTLLLGP  190

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             P+SGKT+LLLALAG+LD SL  SGRV+YNGH+M+EFVP RTAAYISQHD HI EMT RET
Sbjct  191   PASGKTTLLLALAGKLDSSLRVSGRVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRET  250

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSARCQGVGSR+EML+ELSRREKAA I+PDPDID+FMKAAAT+GQ+A+V+ DYI+K+L
Sbjct  251   LAFSARCQGVGSRHEMLSELSRREKAAGIKPDPDIDVFMKAAATEGQEASVVTDYILKIL  310

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GL+ C DT+VG+E LRG+SGG++KR+T GEM+VGPA  L MDEISTGLDSSTTFQI+ S+
Sbjct  311   GLDVCADTMVGDEMLRGISGGQKKRVTTGEMMVGPAQALFMDEISTGLDSSTTFQIVNSL  370

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             +  IHIL GT +I+LLQPAPE YDLFDDIILIS+GQIVYQGP   VLEFF+ +GF CP+R
Sbjct  371   RQSIHILKGTTLISLLQPAPETYDLFDDIILISDGQIVYQGPREHVLEFFKFMGFECPKR  430

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTSRKDQ QYW+ K+ +PYRFVT+ EF++AFQ F++G+ +GDEL  PF K 
Sbjct  431   KGVADFLQEVTSRKDQEQYWVHKE-EPYRFVTVKEFADAFQVFYMGQKVGDELRIPFDKR  489

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SH AALTTK YGVSK ELLK+C SRE+LLMKRN  ++IF++  + +M L+ MTLF RT 
Sbjct  490   KSHRAALTTKIYGVSKKELLKACMSRELLLMKRNSFVYIFKLCQLTIMGLVAMTLFFRTK  549

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M R+S     IY  +LFF + +IMF+ + E+  TI +LPIFYKQRDL FYP+WAYA+ T+
Sbjct  550   MHRDSITDGVIYTGALFFIVLMIMFNGMAEIPMTIAKLPIFYKQRDLRFYPSWAYALSTW  609

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             IL+IPI+ IEV+VWVF TYYVIG+DPN GRL + ++LL+   Q+AS LFR  A  GR++ 
Sbjct  610   ILKIPISYIEVAVWVFLTYYVIGFDPNVGRLFRQYLLLLFLNQMASALFRLIAATGRNIV  669

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              A   GSF +L+LF LGGF+LSR+D+KKWWIW YW SPLMYAQNAI VNEFLG SW  VL
Sbjct  670   VANTFGSFALLLLFVLGGFVLSREDIKKWWIWAYWCSPLMYAQNAIVVNEFLGNSWRKVL  729

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
             P ++EP GV VLK RG F +AYWYWLG+GAL GF +   F +TLAL+ L P  +++A IS
Sbjct  730   PNTTEPLGVQVLKSRGFFTDAYWYWLGLGALAGFILLFNFGFTLALSFLNPFGKNQAVIS  789

Query  774   AESHSNEHDVSNGG----SDNSVGERVSDGMS------------NRKHGMILPFEPHSIA  643
              ES SNEHD   GG    S + +G  +    S            ++K GM+LPF+PHSI 
Sbjct  790   EESQSNEHDNRTGGTIQLSTSEIGHDIMGTYSSSLIEAEVKANHHKKRGMVLPFKPHSIT  849

Query  642   FNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGR  463
             F++I Y VDMPQEM   GV +++L LL GVSGAFRPGVLTALMGVSGAGKTTLMDVLAGR
Sbjct  850   FDEITYSVDMPQEMMRPGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGR  909

Query  462   KTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCE  283
             KTGGYI G I ISG+ KKQ+TFARISGYCEQNDIHSP++TVYESL++SAWLRLP EV   
Sbjct  910   KTGGYISGSIMISGYPKKQETFARISGYCEQNDIHSPNVTVYESLLYSAWLRLPLEVDSP  969

Query  282   TRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSG  103
             T+K+FI+EVMELVEL  LR+A+VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSG
Sbjct  970   TQKMFIEEVMELVELKPLRQALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSG  1029

Query  102   LDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             LDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1030  LDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1063


 Score =   123 bits (308),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 126/567 (22%), Positives = 245/567 (43%), Gaps = 70/567 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+       SG +  +G+   +    R
Sbjct  875   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-ISGSIMISGYPKKQETFAR  933

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   ++D    
Sbjct  934   ISGYCEQNDIHSPNVTVYESLLYSAW----------------------LRLPLEVD----  967

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                +  QK  + ++ +++++ L+     +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  968   ---SPTQK--MFIEEVMELVELKPLRQALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1022

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ +  + FD++ L+  G Q +Y
Sbjct  1023  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIVEAFDELFLLKRGGQEIY  1081

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              G      + ++++FE +      + G   A ++ EVT+   +    I        F  I
Sbjct  1082  VGSLGRHSSHLIKYFEGIRGVSKIKDGYNPATWMLEVTAPSQETALGID-------FADI  1134

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVLLMK  1579
              + SE ++     + L  +++ P   S   H A    +++    M    +C  ++     
Sbjct  1135  YKSSELYRR---NKALIKDISKPAPGSKDLHFATQYAQSFFTQCM----ACLWKQHWSYW  1187

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELA  1399
             RN         +  ++AL   T+F     +          M S++   T ++F  +Q  A
Sbjct  1188  RNPPYSAVRFLFTTIIALAFGTMFWDMGTKTKKQQDLFNAMGSMY---TAVLFLGVQNAA  1244

Query  1398  ---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
                P +     +FY++R    Y A  YA    ++ IP   ++   +    Y +IG++   
Sbjct  1245  SVQPVVSIERTVFYRERAAGMYSALPYAFAQALIEIPYIFVQSVTYGVIVYAMIGFEWTA  1304

Query  1230  GRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRD  1063
              + L  W    +F  L  + F    ++  +MT    +   +    + L     GFI+ R 
Sbjct  1305  AKFL--WYQFFMFFTL--LYFTYYGMMAVAMTPNHHISGIVAFAFYGLWNVFSGFIIPRT  1360

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  WW W YW  P+ +    +  ++F
Sbjct  1361  RIPIWWRWYYWACPVSWTLYGLVASQF  1387



>ref|XP_006476214.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Citrus sinensis]
Length=1452

 Score =  1416 bits (3665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/1073 (66%), Positives = 851/1073 (79%), Gaps = 30/1073 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             M+   +  R  S R+ SSS+W N T D FA+SSR    DDD+  AL WAA++K+PT+ R+
Sbjct  1     MDAGQASFRISSARLGSSSIWRNNTLDVFARSSREDTYDDDE--ALTWAAIEKLPTYLRV  58

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++T   G+  EVDI N+G+ E++ ++ERL+K+ E DNE FLLKLKDR+ERV +DIP 
Sbjct  59    QRGMLTEDEGQAREVDIKNLGFIERRNLIERLLKIAEEDNEKFLLKLKDRIERVGLDIPT  118

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEHLNV AEAY+G RALP+V N C N+LEG L+YL+ LP+ KK  +IL DVSGIIK
Sbjct  119   IEVRFEHLNVEAEAYIGSRALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIK  178

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+TLLLGPPSSGKT+LLLALAG+L   L+FSGRV+YNGH M EFVP RT+AYISQ+DL
Sbjct  179   PQRLTLLLGPPSSGKTTLLLALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDL  238

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG RYE+L ELSRREKAANI+PDPDID+ MKAA+ +GQ+ N
Sbjct  239   HIGEMTVRETLAFSARCQGVGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKN  298

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY++K+LGLE C DT+VG+E LRG+SGG+RKRLT GEMLVGPA  L MDEISTGLDS
Sbjct  299   VVTDYVLKILGLEVCADTMVGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDS  358

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STT+QI+ S++  IHIL+GTAVI+LLQPAPE Y+LFDD+IL+S+GQIVYQGP   VLEFF
Sbjct  359   STTYQIVNSLRQSIHILNGTAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFF  418

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTSRKDQ QYW  KD +PY FVT  EFSE FQSFHIG+ LG
Sbjct  419   ERMGFKCPERKGVADFLQEVTSRKDQEQYWANKD-EPYSFVTAKEFSEVFQSFHIGQKLG  477

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELATPF KS SHPAALTTK YG SK ELLK+CF+RE LLMKRN  ++ F++  +   A 
Sbjct  478   DELATPFDKSKSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSAS  537

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             + MTLF+RT M R++     IYM +LFF +  IMF+   EL+ TI +LP+FYKQRD LF+
Sbjct  538   VAMTLFLRTEMHRSTVEDGGIYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFF  597

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAY++PT+IL+IPIT IEV +WVF TYYV+G++ N  R +K + LL+   Q AS LFR
Sbjct  598   PAWAYSLPTWILKIPITFIEVGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFR  657

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                 +GR++  A   GSF  L +  LGGFILSRDDVKKWW+WGYW SP+MY QNA+AVNE
Sbjct  658   LMGALGRNIIVANTFGSFANLTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNE  717

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW  V P S+EP GV++LK RGLFP AYWYW+GVGAL+G+ +   F++T+AL  L 
Sbjct  718   FLGKSWGHVPPNSTEPLGVVILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLD  777

Query  804   PLAQSRANISAESHSNE------------------HDVSNGGSDN----SVGERV---SD  700
             P  + +A +S E+ + +                  +D  N    N    ++  RV   ++
Sbjct  778   PFGKPQAILSEEALAKKNACKTEEPVELSSGVQSSYDRGNESHRNVSFRTLSARVRSFNE  837

Query  699   GMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTA  520
                NRK GMILPFEPHSI F+DI+Y +DMPQEMK +G+ D+RLE LKGVSGAFRPGVLTA
Sbjct  838   ADQNRKRGMILPFEPHSITFDDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTA  897

Query  519   LMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTV  340
             LMGVSGAGKTTLMDVLAGRKTGGY+ G ITISG+ K Q+TFARISGYCEQ DIHSPH+TV
Sbjct  898   LMGVSGAGKTTLMDVLAGRKTGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTV  957

Query  339   YESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTI  160
             YESL++SAWLRLP EV  +TRK+F++EVMELVEL  +REA+VGLPGV+GLST QRKRLTI
Sbjct  958   YESLVYSAWLRLPPEVDSDTRKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTI  1017

Query  159   AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1018  AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1070


 Score =   146 bits (369),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 131/563 (23%), Positives = 254/563 (45%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
              L+ VSG  +PG +T L+G   +GKT+L+  LAG+       SG ++ +G+  N+    R
Sbjct  882   FLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-VSGSITISGYPKNQETFAR  940

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P++D    
Sbjct  941   ISGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPEVD----  974

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                +D +K  + V+ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  975   ---SDTRK--MFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1029

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G + +Y
Sbjct  1030  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLMKRGGEEIY  1088

Query  1917  QGP----CNCVLEFFECLGF--RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    C+ ++++FE +    +  E    A ++ EVT+   +    I        F  +
Sbjct  1089  VGPLGRHCSQLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGIN-------FAKV  1141

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + +  EL+ P     S      T+ Y  S      +C  ++ L   R
Sbjct  1142  YKNSELYKG---NKEMIKELSIP--PPGSKNLYFQTR-YSQSFFTQCMACLWKQHLSYWR  1195

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R +       M S++  +  +       + P
Sbjct  1196  NPPYTAVRLFFTTFIALMFGTIFWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQP  1255

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   I+  ++    Y +IG+D    + L
Sbjct  1256  VVAVERTVFYRERAAGMYSALPYAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFL  1315

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W LL ++  L  + F    ++  ++T    + + I    + L     GFI+ R  +  
Sbjct  1316  --WYLLFMY--LTFLYFTLYGMMTVAVTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPI  1371

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W  WI P+ +    +  ++F
Sbjct  1372  WWRWYCWICPVSWTLYGLVASQF  1394



>ref|XP_004247841.1| PREDICTED: pleiotropic drug resistance protein 1 [Solanum lycopersicum]
Length=1440

 Score =  1416 bits (3665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/1046 (65%), Positives = 851/1046 (81%), Gaps = 7/1046 (1%)
 Frame = -2

Query  3132  INDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKK  2956
             I+ SR  S S R NS+S+W N G + F++S+R    D+DDE ALKWAAL+K+PTFDRL+K
Sbjct  18    ISGSRRGSVSLRANSNSIWRNTGVEIFSRSAR----DEDDEEALKWAALEKLPTFDRLRK  73

Query  2955  GLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVE  2776
             GL+ G +G   E+DI++IG +E+K +LERL++V + DNE FLLKLK+R++RV ID+P +E
Sbjct  74    GLLFGSQGAAAEIDIDDIGLQERKNLLERLVRVADEDNEKFLLKLKNRIDRVGIDLPTIE  133

Query  2775  VRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPG  2599
             VR+E+LN+ A+AYVG R LP+  NF  N LE LL+ L+ LP++K+  +IL+D+SGIIKP 
Sbjct  134   VRYENLNIEADAYVGSRGLPTFINFMTNFLETLLNTLHILPSSKRQITILKDISGIIKPC  193

Query  2598  RMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHI  2419
             RMTLLLGPPSSGKT+LLLALAG+LD SL+ +G+VSYNGHE++EFVP RTAAYISQHDLHI
Sbjct  194   RMTLLLGPPSSGKTTLLLALAGKLDSSLKVTGKVSYNGHELHEFVPQRTAAYISQHDLHI  253

Query  2418  PEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVI  2239
              EMT RETL FSARCQGVGSRYEMLAELSRREKAANI+PDPDIDI+MKA+AT+GQ+ANV+
Sbjct  254   GEMTVRETLEFSARCQGVGSRYEMLAELSRREKAANIKPDPDIDIYMKASATEGQEANVV  313

Query  2238  VDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSST  2059
              DY++K+LGL+ C DT+VG+E LRG+SGG++KR+T GEMLVGP+  L MDEISTGLDSST
Sbjct  314   TDYVLKILGLDICADTMVGDEMLRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSST  373

Query  2058  TFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFEC  1879
             T+ I+ S++  + IL GTAVI+LLQPAPE Y+LFDDIILIS+G IVYQGP + VL+FFE 
Sbjct  374   TYSIVNSLRQSVQILKGTAVISLLQPAPETYNLFDDIILISDGYIVYQGPRDDVLQFFES  433

Query  1878  LGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDE  1699
             +GF+CPERKGVADFLQEVTS+KDQ QYW R+ N+ YRF++  EFS+A+QSFH+GR LGDE
Sbjct  434   MGFKCPERKGVADFLQEVTSKKDQPQYWSRR-NEHYRFISSKEFSDAYQSFHVGRKLGDE  492

Query  1698  LATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALIT  1519
             LA PF ++  HPAALT + YG+ K ELLK C  RE LLMKRN  +++F+   + +MAL+T
Sbjct  493   LAIPFDRTKCHPAALTNEKYGIGKKELLKVCTEREYLLMKRNSFVYVFKFFQLTIMALMT  552

Query  1518  MTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPA  1339
             MTLF RT M R++     IY  +LFF + +IMF+ + E+A TIF+LP+FYKQRDLLF+P+
Sbjct  553   MTLFFRTEMPRDTVDDGGIYAGALFFVVVMIMFNGMSEMAMTIFKLPVFYKQRDLLFFPS  612

Query  1338  WAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSA  1159
             WAYAIP++IL+IP+T +EV +WV  TYYVIG+DPN  R LK ++LL++  Q+AS LFR  
Sbjct  613   WAYAIPSWILKIPVTLVEVGLWVILTYYVIGFDPNITRFLKQFMLLVLVNQMASGLFRFM  672

Query  1158  AVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFL  979
               VGR+M  A   G+F +L+ FAL GF+LSR+DVK WWIWGYWISPLMY+ N+I VNEF 
Sbjct  673   GAVGRTMGVASTFGAFALLLQFALCGFVLSREDVKGWWIWGYWISPLMYSVNSILVNEFD  732

Query  978   GKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPL  799
             G  W  + P  +EP GV V+K RG FP+AYWYW+G  AL GFT+   F Y+L+LA L+P 
Sbjct  733   GSKWKHIAPNGTEPLGVAVVKSRGFFPDAYWYWIGFAALFGFTVVFNFFYSLSLAYLKPY  792

Query  798   AQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCV  619
              +S+     +S + E+  +     ++ G  +     ++K GM+LPFEPHSI F+D+ Y V
Sbjct  793   GKSQTVRPEDSGNAENGQAASQMTSTDGGDIVSAGQSKKKGMVLPFEPHSITFDDVVYSV  852

Query  618   DMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEG  439
             DMPQEMK +G  ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G
Sbjct  853   DMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDG  912

Query  438   EITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKE  259
             +I ISG+ KKQ+TFARISGYCEQNDIHSP++TVYESL++SAWLRLP +V  +TRK+F+ E
Sbjct  913   DIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPKDVDEKTRKMFVDE  972

Query  258   VMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAI  79
             VMELVEL  LR A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAI
Sbjct  973   VMELVELEPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAI  1032

Query  78    VMRTVRNIVDTGRTIVCTIHQPSIDI  1
             VMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1033  VMRTVRNTVDTGRTVVCTIHQPSIDI  1058


 Score =   145 bits (366),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 129/564 (23%), Positives = 247/564 (44%), Gaps = 64/564 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  870   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGDIKISGYPKKQETFAR  928

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+D    
Sbjct  929   ISGYCEQNDIHSPYVTVYESLVYSAW----------------------LRLPKDVD----  962

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + VD +++++ LE     +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  963   -----EKTRKMFVDEVMELVELEPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1017

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1018  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1076

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      ++G   A ++ EVT+   +M   +            
Sbjct  1077  VGPLGRHSCHLIKYFESIPGVAKIKEGYNPATWMLEVTASAQEMMLGV------------  1124

Query  1755  NEFSEAFQSFHIGRN---LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F++ +++  + R    L  EL+ P  +  S      T+ Y  S      +C  ++   
Sbjct  1125  -DFTDLYKNSDLYRRNKALITELSVP--RPGSKDLYFETQ-YSQSIWIQCMACLWKQNWS  1180

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         + + +AL+  T+F     + +        M S++  +  +       
Sbjct  1181  YWRNPAYTAVRFIFTMFIALVFGTMFWDIGTKVSQSQDLFNAMGSMYAAVLFLGVQNASS  1240

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA     + IP   ++  V+    Y +IG++   G
Sbjct  1241  VQPVVDVERTVFYRERAAGMYSAIPYAFGQVFIEIPYVFVQAIVYGIIVYAMIGFEWEAG  1300

Query  1227  RLLKMWVLLIIFRQLASVLFRS--AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVK  1054
             +    W L I+F  L    F    +  V  +   A +V +F   +     GFI+ R  + 
Sbjct  1301  KFF--WYLFIMFTTLLYFTFYGMMSVAVTPNQNVASIVAAFFYAIWNLFSGFIVPRPRMP  1358

Query  1053  KWWIWGYWISPLMYAQNAIAVNEF  982
              WW W YW  P+ +    +  ++F
Sbjct  1359  IWWRWYYWCCPVAWTLYGLVASQF  1382



>ref|XP_003546218.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
1 [Glycine max]
Length=1426

 Score =  1416 bits (3665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1052 (65%), Positives = 855/1052 (81%), Gaps = 16/1052 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D    S S R  SS++W N G + F++SSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGSDIYRASNSLR-RSSTVWRNSGVEVFSRSSR----EEDDEEALKWAALEKLPTYNRL  55

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   E+D++++G +E++K+LERL+KV E DNE FLLKLK+R++RV +DIP 
Sbjct  56    RKGLLTASHGVANEIDVSDLGIQERQKLLERLVKVAEEDNERFLLKLKERIDRVGLDIPT  115

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVR+EHLN+ AEA+VG RALPS  N   N++EG  + L++ T+KK H +IL+DVSGIIK
Sbjct  116   IEVRYEHLNIEAEAFVGSRALPSFINSVTNVVEGFFNLLHISTSKKKHVTILKDVSGIIK  175

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLAL+G+LD +L+ SGRV+YNGHE+NEFVP RTAAYISQHDL
Sbjct  176   PRRMTLLLGPPSSGKTTLLLALSGKLDKTLKVSGRVTYNGHELNEFVPQRTAAYISQHDL  235

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPD+D++MKA AT+GQ+++
Sbjct  236   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATEGQESS  295

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             ++ DY +K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  296   LVTDYTLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  355

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+  ++ Y+HIL+GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FF
Sbjct  356   STTFQIVSFLRQYVHILNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFF  415

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GFRCPERKGVADFLQEVTS+KDQ QYW R+D +PYRFVT+ +FSEAFQSFHIG  LG
Sbjct  416   ESMGFRCPERKGVADFLQEVTSKKDQAQYWARRD-QPYRFVTVTQFSEAFQSFHIGGKLG  474

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +ELA PF K+ SHPAALTTK YG++K ELLK+  SRE LLMKRN  ++IF++  + +MAL
Sbjct  475   EELAVPFDKTKSHPAALTTKKYGINKKELLKANLSREYLLMKRNSFVYIFKLCQLSIMAL  534

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             +TMTLF+RT + RN+   A +Y  +LFFTL +IMF+ + E++ TI +LP+FYKQRDLLFY
Sbjct  535   MTMTLFLRTELHRNNMDDAGLYAGALFFTLVMIMFNGMAEISMTIAKLPVFYKQRDLLFY  594

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IP+T +EV+VWVF TYYVIG+DPN GRL K +++L+   Q+AS LFR
Sbjct  595   PSWAYAIPSWILKIPVTLLEVAVWVFLTYYVIGFDPNVGRLFKQYLILLFIGQMASALFR  654

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  +   G+F +L    LGGF++++ D+K WWIWGYWISPLMY Q A+ VNE
Sbjct  655   AIAALGRNMIVSNTFGAFAVLTFLTLGGFVMAKSDIKNWWIWGYWISPLMYGQTALMVNE  714

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FL  SW+     SS   GV  L+ RG    AYWYWLG+GA+ GF +    +++ AL  L 
Sbjct  715   FLSNSWHN----SSRNLGVEYLESRGFPSSAYWYWLGLGAMAGFVLLFNVMFSAALEILG  770

Query  804   PLAQSRANISAESHSNEHDVSNGG----SDNSVGERVSDGMSNRKHGMILPFEPHSIAFN  637
             P  + +A I+ E   NE  V+         +  G  V +    +K GM+LPFEPHSI F+
Sbjct  771   PFDKPQATIAEEESPNEVTVAEVELPRIESSGRGGSVVESSHGKKKGMVLPFEPHSITFD  830

Query  636   DIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  457
             ++ Y VDMPQEMK +GV+++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT
Sbjct  831   EVVYSVDMPQEMKEQGVQEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  890

Query  456   GGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETR  277
             GGYI+G I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS V  +TR
Sbjct  891   GGYIDGNIKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSSVDSQTR  950

Query  276   KLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLD  97
             K+FI+EVMELVEL  LR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  951   KMFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1010

Query  96    ARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1011  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1042


 Score =   120 bits (300),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 116/565 (21%), Positives = 238/565 (42%), Gaps = 66/565 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  854   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGNIKISGYPKKQETFAR  912

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  913   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  941

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              ++ D Q   + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  942   PSSVDSQTRKMFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1001

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1002  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1060

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EVT+   ++   +            
Sbjct  1061  VGPLGRHSSHLIKYFESIEGVSKIKDGYNPATWMLEVTTSAQELSLGV------------  1108

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F++ +++   +   + L  EL  P   S           Y  S +   ++C  ++   
Sbjct  1109  -DFTDLYKNSDLYRRNKQLIQELGQPAPGSKD---LYFPTQYSQSFLVQCQACLWKQRWS  1164

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +AL+  T+F     +R +       + S++   T ++F  +Q 
Sbjct  1165  YWRNPPYTAVRFFFTTFIALMFGTMFWDLGSRRTTRGDLLNALGSMY---TAVLFLGIQN  1221

Query  1404  ---LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
                + P +     +FY+++    Y A  YA    ++ IP    +   +    Y +IG+D 
Sbjct  1222  ASSVQPVVAVERTVFYREKAAGMYSALPYAFAQVLVEIPYIFAQAVTYGLIVYAMIGFDW  1281

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDV  1057
                +               +     A  V  +   A +V +    +     GFI+ R  +
Sbjct  1282  TAEKFFWYLFFSFFSLLYFTFYGMMAVGVTPNHHVAAIVAAAFYAIWNLFSGFIVVRPKM  1341

Query  1056  KKWWIWGYWISPLMYAQNAIAVNEF  982
               WW W YW  P+ +    +  ++F
Sbjct  1342  PVWWRWYYWACPVAWTLYGLIASQF  1366



>ref|XP_003597818.1| Pleiotropic drug resistance protein [Medicago truncatula]
 gb|AES68069.1| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1427

 Score =  1416 bits (3665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/1057 (65%), Positives = 851/1057 (81%), Gaps = 25/1057 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D    + S R  SS++W  +G + F+KSSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGTDIYRATNSLRARSSTVWRQSGVEVFSKSSR----EEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   EVD+ ++ ++EK+K+LERL+KV E DNE FLLK+K+R++RV +DIP 
Sbjct  57    RKGLLTASHGGAHEVDVGDLAFQEKQKLLERLVKVAEEDNERFLLKVKERVDRVGLDIPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIK  2605
             +EVR+++L + AEA+VG RALPS  N   N++EG+L++L++ PT K+H SIL+DVSGI+K
Sbjct  117   IEVRYQNLKIDAEAFVGSRALPSFINAATNVVEGVLNFLHIIPTKKRHVSILKDVSGIVK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPP SGKT+LLLAL+G+LDPSL+ +G V+YNGH +NEFVP RTAAYISQHD+
Sbjct  177   PRRMTLLLGPPGSGKTTLLLALSGKLDPSLQLTGSVTYNGHGLNEFVPQRTAAYISQHDV  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPDID++MKA AT+GQ+ +
Sbjct  237   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDIDVYMKAIATEGQEYS  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             +  DY++K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  297   ISTDYVLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++ Y+HI++GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FF
Sbjct  357   STTFQIVSSLRQYVHIMNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKG ADFLQEVTS+KDQ QYW+R+D +PYRFVT+ +F+EAFQSFHIGR L 
Sbjct  417   ETMGFKCPERKGAADFLQEVTSKKDQAQYWVRRD-QPYRFVTVTQFAEAFQSFHIGRKLA  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +EL+ PF K+ SHPAALTTK YG++K ELLK+ FSRE LLMKRN  ++IF++  + +MAL
Sbjct  476   EELSVPFDKTKSHPAALTTKEYGLNKTELLKANFSREYLLMKRNSFVYIFKLTQLFIMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF RT M RN    A +Y  +LFFTL  +MF+ + E++ TI +LP++YKQRDLLFY
Sbjct  536   IAMTLFFRTEMHRNDQDDAGVYAGALFFTLVTMMFNGMSEISMTIAKLPVYYKQRDLLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IP++ +EVS+WVF TYYVIG+DPN GR+ K +V+L    Q+AS LFR
Sbjct  596   PSWAYAIPSWILKIPVSLMEVSLWVFLTYYVIGFDPNVGRMFKQFVVLFFMSQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   GSF +L   +LGGFILSR D+K WWIWGYWISPLMY QNA+  NE
Sbjct  656   AIASLGRNMIVANTFGSFALLTFLSLGGFILSRKDIKGWWIWGYWISPLMYGQNALMANE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG SW+     ++   G   L  RG FP AYWYW+GVG L+GF       + +ALA L 
Sbjct  716   FLGHSWHN----ATADLGKDYLDTRGFFPHAYWYWIGVGGLVGFVFLFNVAFGVALAVLG  771

Query  804   PLAQSRANISAESHSNEHDV---------SNGGSDNSVGERVSDGMSNRKHGMILPFEPH  652
             P  +  A I+ +S  +   V         S+G +D+     V++    +K GM+LPFEPH
Sbjct  772   PFDKPSATITEDSEDDSSTVQEVELPRIESSGRADS-----VTESSHGKKKGMVLPFEPH  826

Query  651   SIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVL  472
             SI F+DI Y VDMP EMK +GV ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVL
Sbjct  827   SITFDDIVYSVDMPVEMKEQGVREDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVL  886

Query  471   AGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEV  292
             AGRKTGGYI+G+I +SG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS V
Sbjct  887   AGRKTGGYIDGDIKVSGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSGV  946

Query  291   TCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEP  112
                TRK+FI EVM+LVEL SLR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEP
Sbjct  947   DSNTRKMFIDEVMDLVELNSLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEP  1006

Query  111   TSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             TSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1007  TSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1043


 Score =   134 bits (337),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 121/567 (21%), Positives = 246/567 (43%), Gaps = 70/567 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  855   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGDIKVSGYPKKQETFAR  913

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  914   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  942

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +  D     + +D ++ ++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  943   PSGVDSNTRKMFIDEVMDLVELNSLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1002

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1003  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1061

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVT+   ++       N    F  +
Sbjct  1062  VGPLGRHSTHLIKYFESIDGVSKIKDGYNPATWMLEVTTTAQEL-------NLGVDFTDL  1114

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVLLMK  1579
              + S+ ++     + L  EL+ P   S   H     ++++ V      ++C  ++     
Sbjct  1115  YKNSDLYRR---NKQLIQELSVPAPGSKDLHFPTQFSQSFLVQ----CQACLWKQRWSYW  1167

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE--  1405
             RN         +   + L+  T+F     + +S    Q  ++++    T ++F  +Q   
Sbjct  1168  RNPPYTAVRFFFTTFIGLMFGTMFWDLGGKHSS---RQDLLNAVGSMYTAVLFLGVQNSS  1224

Query  1404  -LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
              + P +     +FY+++    Y A  YA    ++ +P    +  ++    Y +IG+D   
Sbjct  1225  SVQPVVAVERTVFYREKAAGMYSALPYAFSQILVELPYVFAQAVIYGVIVYAMIGFDWTA  1284

Query  1230  GRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRD  1063
              + L  W L  ++  L    F     V  ++T    V S +    +A+     GF++ R 
Sbjct  1285  EKFL--WYLFFMYFTLLYFTFYGMMAV--AVTPNHHVASIVAAAFYAIWNLFSGFVVPRP  1340

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  WW W YW  P+ +    +  ++F
Sbjct  1341  SIPIWWRWYYWACPVAWTIYGLVASQF  1367



>gb|AIU41654.1| ABC transporter family protein [Hevea brasiliensis]
Length=1438

 Score =  1415 bits (3664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1060 (65%), Positives = 854/1060 (81%), Gaps = 19/1060 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLK  2959
             ME +  R  +   R +SS   +NG D F++SSR    D+DDE ALKWAAL+K+PT+DRL+
Sbjct  1     MEGDHYRASTSLRRGSSSVFRNNGLDVFSRSSR----DEDDEEALKWAALEKLPTYDRLR  56

Query  2958  KGLMTGL-RGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             KG++  + +G   E+D++N+G++E+K +LERL+KV E DNE FLLKLK+R++RV I+IP 
Sbjct  57    KGILVSVSKGGANEIDVDNLGFQERKTLLERLVKVAEEDNEKFLLKLKNRIDRVGIEIPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVR+EHLN+ AEA VG  ALPS  NF ++I E  L+ L+ LP  K+  +IL+DVSG+IK
Sbjct  117   IEVRYEHLNIEAEALVGSNALPSFLNFTMSIAEVFLNCLHVLPNRKRPLTILKDVSGVIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLALAG+LDP+L+ SG V+YN H +NEF+P RTAAYISQHDL
Sbjct  177   PSRMTLLLGPPSSGKTTLLLALAGKLDPNLKVSGNVTYNAHTLNEFIPQRTAAYISQHDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+++EMLAELSRREKAANI+PDPD+D+FMKAAAT+GQ+ +
Sbjct  237   HIGEMTVRETLAFSARCQGVGTQHEMLAELSRREKAANIKPDPDLDVFMKAAATEGQETS  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY++K+LGL+ C DT+VGNE +RG+SGG+RKR+T GEMLVGPA  L MDEISTGLDS
Sbjct  297   VVTDYVLKILGLDICADTLVGNEMIRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTF I+ S++  IHIL+GTAVI+LLQPAPE Y+LFDDIIL+S+GQ+VYQGP   VL FF
Sbjct  357   STTFSIINSLRQSIHILNGTAVISLLQPAPETYNLFDDIILLSDGQVVYQGPREQVLGFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GFRCPERKGVADFLQEVTS+KDQ QYW RKD +PYRFVT+NEF+EAFQS+ +GR + 
Sbjct  417   EYMGFRCPERKGVADFLQEVTSKKDQQQYWARKD-QPYRFVTVNEFAEAFQSYEVGRRIA  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             ++L+ PF ++ +HPAALTTK YGV KMELLK+  SRE LLMKRN  ++IF++  +++MA 
Sbjct  476   EDLSVPFDRTKNHPAALTTKHYGVGKMELLKANLSREYLLMKRNSFVYIFKLTQLIVMAT  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF RT M+R++   A +Y+ +LFF+L  IMF+ + EL+ TI +LP+FYKQR+LLF+
Sbjct  536   IGMTLFFRTEMKRDTLEDAGVYLGALFFSLITIMFNGMAELSMTIAKLPVFYKQRNLLFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAW+Y+IP++IL+IP+T +EV VWVF TYYVIG+DPN GRL K ++LL++  Q+AS LFR
Sbjct  596   PAWSYSIPSWILKIPVTFVEVGVWVFITYYVIGFDPNVGRLFKQYMLLLLVNQMASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A VGR+M  A   GSF +L LFALGGFIL R ++KKWWIWGYWISPLMY QNAI  NE
Sbjct  656   FIASVGRNMIVANTFGSFALLTLFALGGFILKRPEIKKWWIWGYWISPLMYGQNAIVANE  715

Query  984   FLGKSWNTVLP--FSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAK  811
             FLG SWN +     S+E  GV  +K  G FP AYWYWLG+GA  G+      +YT+AL  
Sbjct  716   FLGHSWNHIPANSNSTESLGVQFIKNNGFFPHAYWYWLGLGASAGYIFVFNILYTVALTF  775

Query  810   LRPLAQSRANISAESHSNEH----------DVSNGGSDNSVGERVSDGMSNRKHGMILPF  661
             L    + +A IS E    E           + S+  +  S    + +   N+K GM+LPF
Sbjct  776   LDQFEKPQAIISDEPEERERSGGAIQLSQVESSHRNNTESGTSGIDESNHNKKKGMVLPF  835

Query  660   EPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  481
             EPHSI F+++ Y VDMPQEMK +GV +++L LLKGVSGAFRPGVLTALMGVSGAGKTTLM
Sbjct  836   EPHSITFDNVIYSVDMPQEMKNQGVVEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLM  895

Query  480   DVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLP  301
             DVLAGRKTGGYIEG+I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLP
Sbjct  896   DVLAGRKTGGYIEGDIRISGYPKKQETFARISGYCEQNDIHSPHVTVYESLVYSAWLRLP  955

Query  300   SEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFM  121
             S+V  ETRK+F++EVMELVEL  LR+A+VGLPGVNGLST QRKRLTIAVELVANPSIIFM
Sbjct  956   SDVNSETRKMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM  1015

Query  120   DEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1055


 Score =   120 bits (300),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 123/591 (21%), Positives = 252/591 (43%), Gaps = 76/591 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  867   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGDIRISGYPKKQETFAR  925

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D++    
Sbjct  926   ISGYCEQNDIHSPHVTVYESLVYSAW----------------------LRLPSDVN----  959

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  960   -----SETRKMFVEEVMELVELNPLRQALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1014

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1015  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGEEIY  1073

Query  1917  QGPC---NC-VLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +    +  +    A ++ EV+S   ++   +        F  I
Sbjct  1074  VGPLGRHSCHLIKYFEGIEGVSKITDGYNPATWMLEVSSSAQELSLGVD-------FANI  1126

Query  1755  NEFSEAFQSFHIGRNLGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLM  1582
                S+ ++     + +  EL+ P    K    P       Y    +    +C  ++    
Sbjct  1127  YRNSDLYRR---NKAMIQELSKPAPGTKDLYFPT-----QYSQPFLTQCMACLWKQSWSY  1178

Query  1581  KRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQEL  1402
              RN         +   +AL+  T+F     +          M S++  +  +       +
Sbjct  1179  WRNPPYTGVRFWFTTFIALMFGTIFWDLGSKLEKEGDLSNAMGSMYVAVLFLGVQNSSSV  1238

Query  1401  APTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGR  1225
              P +     +FY+++    Y A  YA    ++ +P    +  V+   TY +IG++    +
Sbjct  1239  QPVVAIERTVFYREKAAGMYSAMPYAYAQALIELPYIFTQAGVYSLITYAMIGFEWTAAK  1298

Query  1224  LLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRD  1063
                        +L   +  + +V       +   +++AF    + +  LFA  GFI+ R 
Sbjct  1299  FFWYLFFLYFTLLYFTYYGMMAVAVTPNHHIASIISSAF----YAIWNLFA--GFIVPRP  1352

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGV  928
              +  WW W YW  P+ +    +  ++F      LG++  TV  + S+ +G+
Sbjct  1353  KMPVWWRWYYWGCPISWTLYGLFASQFGDITKPLGETGKTVEQYVSDFYGI  1403



>ref|XP_003543663.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine 
max]
Length=1426

 Score =  1415 bits (3664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/1051 (65%), Positives = 856/1051 (81%), Gaps = 14/1051 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLK  2959
             ME +D    S S R +S++  ++G + F++SSR    ++DDE ALKWAAL+K+PT++RL+
Sbjct  1     MEGSDIYRASNSLRRSSTAWRNSGVEVFSRSSR----EEDDEEALKWAALEKLPTYNRLR  56

Query  2958  KGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKV  2779
             KGL+T   G   E+D++++G +E+ K+LERL+KV E DNE FLLKLK+R++RV +DIP +
Sbjct  57    KGLLTASHGVANEIDVSDLGTQERHKLLERLVKVAEEDNERFLLKLKERIDRVGLDIPTI  116

Query  2778  EVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIKP  2602
             EVR+EHLN+ AEA+VG RALPS  N   NI+EG  + L++ T+KK H +IL+DVSGIIKP
Sbjct  117   EVRYEHLNIEAEAFVGSRALPSFINSVTNIIEGFFNLLHITTSKKKHVTILKDVSGIIKP  176

Query  2601  GRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLH  2422
              RMTLLLGPPSSGKT+LLLAL+G+LD +L+ SGRV+YNGHE+NEFVP RTAAYISQHDLH
Sbjct  177   RRMTLLLGPPSSGKTTLLLALSGKLDKTLKVSGRVTYNGHELNEFVPQRTAAYISQHDLH  236

Query  2421  IPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANV  2242
             I EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPD+D++MKA AT+GQ++++
Sbjct  237   IGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATEGQESSI  296

Query  2241  IVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSS  2062
             + DY +K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDSS
Sbjct  297   VTDYTLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSS  356

Query  2061  TTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFE  1882
             TTFQI+ S++ Y+HIL+GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FFE
Sbjct  357   TTFQIVNSLRQYVHILNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFFE  416

Query  1881  CLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGD  1702
              +GFRCPERKGVADFLQEVTS+KDQ QYW R+D +PYRFV + +F+EAFQSFHIGR LG+
Sbjct  417   SMGFRCPERKGVADFLQEVTSKKDQAQYWARRD-QPYRFVKVTQFAEAFQSFHIGRKLGE  475

Query  1701  ELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALI  1522
             EL  PF K+ SHPAALTTK YG++K ELLK+  SRE LLMKRN  ++IF++  + +MAL+
Sbjct  476   ELVVPFDKTKSHPAALTTKKYGINKKELLKANLSREYLLMKRNSFVYIFKLCQLSIMALM  535

Query  1521  TMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYP  1342
             TMTLF+RT + RN+   A +Y  +LFFTL +IMF+ + E++ TI +LP+FYKQRDLLFYP
Sbjct  536   TMTLFLRTELHRNNMDDAGLYSGALFFTLIMIMFNGMAEISMTIAKLPVFYKQRDLLFYP  595

Query  1341  AWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRS  1162
             +WAYAIP++IL+IP+T +EV+VWVF TYYVIG+DPN GR  K +++L+   Q+AS LFR+
Sbjct  596   SWAYAIPSWILKIPVTLLEVAVWVFLTYYVIGFDPNVGRFFKQYLILLFIGQMASALFRA  655

Query  1161  AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              A +GR+M  +   G+F +L    LGG+++S++D+K WWIWGYWISPLMY QNA+ VNEF
Sbjct  656   IAALGRNMIVSNTFGAFAVLTFLTLGGYVMSKNDIKNWWIWGYWISPLMYGQNALMVNEF  715

Query  981   LGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRP  802
             L  SW+     +S   GV  L+ RG    +YWYWLG+GA+ GF +    +++ AL  L P
Sbjct  716   LSNSWHN----TSRNLGVEYLESRGFPSSSYWYWLGLGAMAGFVLLFNVMFSAALEILGP  771

Query  801   LAQSRANISAESHSNEHDVSNGG----SDNSVGERVSDGMSNRKHGMILPFEPHSIAFND  634
               + +A I+ E   NE  V+         +  G+ V +    +K GM+LPFEPHSI F++
Sbjct  772   FDKPQATITEEESPNEGTVAEVELPRIESSGRGDSVVESSHGKKKGMVLPFEPHSITFDE  831

Query  633   IKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG  454
             + Y VDMPQEMK +GV+++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG
Sbjct  832   VIYSVDMPQEMKEQGVQEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG  891

Query  453   GYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRK  274
             GYI+G I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS V  +TRK
Sbjct  892   GYIDGSIKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSGVDSKTRK  951

Query  273   LFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDA  94
             +FI+EVMELVEL  LR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLDA
Sbjct  952   MFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDA  1011

Query  93    RAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             RAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1042


 Score =   120 bits (300),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 113/562 (20%), Positives = 233/562 (41%), Gaps = 60/562 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  854   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPKKQETFAR  912

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  913   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  941

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +  D +   + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  942   PSGVDSKTRKMFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1001

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1002  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1060

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +G     + G   A ++ EVT+   ++   +            
Sbjct  1061  VGPLGRHSTHLIKYFESIGGVSKIKDGYNPATWMLEVTTSAQELSLGV------------  1108

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F++ +++   +   + L  EL  P   S           Y  S +   ++C  ++   
Sbjct  1109  -DFTDLYKNSDLYRRNKQLIQELGQPAPGSKD---LYFPTQYSQSFLVQCQACLWKQRWS  1164

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +AL+  T+F     +R +       + S++  +  +       
Sbjct  1165  YWRNPPYTAVRFFFTTFIALMFGTMFWDLGSRRTTRGDLLNALGSMYSAVLFLGIQNASS  1224

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY+++    Y A  YA    ++ IP    +   +    Y +IG+D    
Sbjct  1225  VQPVVAVERTVFYREKAAGMYSALPYAFAQVLVEIPYIFAQAVTYGLIVYAMIGFDWTAE  1284

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKW  1048
             +               +     A  V  +   A +V +    +     GFI+ R  +  W
Sbjct  1285  KFFWYLFFSFFSLLYFTFYGMMAVGVTPNHHVAAIVAAAFYAIWNLFSGFIVVRPKMPVW  1344

Query  1047  WIWGYWISPLMYAQNAIAVNEF  982
             W W YW  P+ +    +  ++F
Sbjct  1345  WRWYYWACPVAWTLYGLIASQF  1366



>ref|XP_011081908.1| PREDICTED: pleiotropic drug resistance protein 1-like [Sesamum 
indicum]
Length=1451

 Score =  1415 bits (3662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/1065 (66%), Positives = 842/1065 (79%), Gaps = 32/1065 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             R  S R++SS++W N G + F++SSR    + DDE ALKWAAL+K+PT  R+++G+ T  
Sbjct  9     RVSSARLSSSNIWRNTGMEAFSRSSR----EADDEEALKWAALEKLPTNLRIRRGIFTEE  64

Query  2937  RGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHL  2758
              G+T E+DI N+G  E+K ++ERL+++ E  NE FLLKLK+R++RV +D P +EVR+EHL
Sbjct  65    EGKTREIDIKNLGLVERKNLVERLLRIAEEGNEKFLLKLKERIQRVGLDFPTIEVRYEHL  124

Query  2757  NVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLL  2581
             NV AEAYVG RALP+V NF +NILEG LSYL+ LP+ KK   IL DVSGIIKPGRMTLLL
Sbjct  125   NVDAEAYVGSRALPTVFNFTVNILEGFLSYLHVLPSRKKPLPILHDVSGIIKPGRMTLLL  184

Query  2580  GPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTAR  2401
             GPP SGKT+LLLALAG+LDP L+ SGRV+YNGHEM EFVP RT+AYISQ+DLHI E+T R
Sbjct  185   GPPCSGKTTLLLALAGKLDPELKVSGRVTYNGHEMEEFVPQRTSAYISQNDLHIGELTVR  244

Query  2400  ETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIK  2221
             ETLAFSARCQGVG+RYEMLAELSRREK ANI+PDPD+DIFMKAA+ +GQ A+V+ DYIIK
Sbjct  245   ETLAFSARCQGVGARYEMLAELSRREKEANIKPDPDLDIFMKAASIEGQDASVVTDYIIK  304

Query  2220  VLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILK  2041
             +LGLE C DT+VG+E +RG+SGG+RKRLT GEMLVGPA  L MDEISTGLDSSTTFQI+ 
Sbjct  305   ILGLEVCADTLVGDEMVRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDSSTTFQIVN  364

Query  2040  SIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCP  1861
             SI+  IHIL GTAVI+LLQPAPE Y+LFDDIIL+S+G+IVYQGP   VLEFFE +GFRCP
Sbjct  365   SIRQSIHILQGTAVISLLQPAPETYNLFDDIILLSDGEIVYQGPREHVLEFFEFMGFRCP  424

Query  1860  ERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQ  1681
             ERKGVADFLQEVTS+KDQ QY I KD +PY +V+  EFSEAFQSFH+GR LGDELA PF 
Sbjct  425   ERKGVADFLQEVTSKKDQEQYRIHKD-EPYSYVSSKEFSEAFQSFHVGRKLGDELAVPFD  483

Query  1680  KSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIR  1501
             K  SH  ALTT  YGVSK ELLK+C +RE LLMKRN  ++IF++  ++LM  I+MT+F+R
Sbjct  484   KEKSHRDALTTVKYGVSKKELLKACVAREFLLMKRNSFVYIFKLIQLILMGSISMTVFLR  543

Query  1500  TNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIP  1321
             T M +N+     IYM +LF+ L +IMF+   ELA +I +LP+FYKQRDLLF+P WAY++P
Sbjct  544   TEMPKNTVTDGGIYMGALFYALIMIMFNGFSELALSILKLPVFYKQRDLLFFPPWAYSLP  603

Query  1320  TFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRS  1141
              +IL+IPIT +EV++WV  TYY  GYD + GR  K  +LLI+  Q+A  LFR    +GR+
Sbjct  604   AWILKIPITLVEVAIWVGLTYYPTGYDSDAGRFFKQLLLLIVINQMAGGLFRLVGALGRN  663

Query  1140  MTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNT  961
             +  A   GS  +L +  LGGFILSRD++K WWIWGYW SPLMY QNAIAVNEFLGKSW+ 
Sbjct  664   IIVANTFGSCALLTVLVLGGFILSRDNIKSWWIWGYWFSPLMYGQNAIAVNEFLGKSWSH  723

Query  960   VLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRAN  781
             + P ++EP GV +LK RG+FPEA WYW+G+GA+IG+     F+ TLAL  L PL + +A 
Sbjct  724   IPPGATEPVGVSILKARGIFPEARWYWIGLGAIIGYAFLFNFLVTLALTYLNPLGKPQAI  783

Query  780   ISAE----------------------SHSNEHDVSNGGSDNSVGERV---SDGMSNRKHG  676
             +S E                      +   E DV    S  S+  RV   S+   +RK G
Sbjct  784   LSEETLAERTASKRIEPIELSSRGKRTSGREDDVQRSVSARSMSSRVGSISNADPSRKRG  843

Query  675   MILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAG  496
             MILPFEP S+ F+DI Y VDMPQEMK  G+++ RLELLKGVSGAFRPGVLTALMG+SGAG
Sbjct  844   MILPFEPLSMTFDDIHYAVDMPQEMKAHGIQEERLELLKGVSGAFRPGVLTALMGISGAG  903

Query  495   KTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSA  316
             KTTLMDVL+GRKTGGYI+G ITISG+ KKQ+TFARI+GYCEQ DIHSPH+TVYESL FSA
Sbjct  904   KTTLMDVLSGRKTGGYIDGRITISGYPKKQETFARIAGYCEQTDIHSPHVTVYESLQFSA  963

Query  315   WLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANP  136
             WLRLP EV   TR +FI+EVMELVELT LR+A+VGLPGV+GLST QRKRLTIAVELVANP
Sbjct  964   WLRLPPEVDAATRTMFIEEVMELVELTPLRDALVGLPGVDGLSTEQRKRLTIAVELVANP  1023

Query  135   SIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             SIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1024  SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1068


 Score =   141 bits (356),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 130/564 (23%), Positives = 252/564 (45%), Gaps = 64/564 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  L+G+        GR++ +G+   +    R
Sbjct  880   LLKGVSGAFRPGVLTALMGISGAGKTTLMDVLSGRKTGGY-IDGRITISGYPKKQETFAR  938

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              A Y  Q D+H P +T  E+L FSA                       +R  P++D    
Sbjct  939   IAGYCEQTDIHSPHVTVYESLQFSAW----------------------LRLPPEVD----  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              AAT      + ++ +++++ L    D +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   -AATR----TMFIEEVMELVELTPLRDALVGLPGVDGLSTEQRKRLTIAVELVANPSIIF  1027

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G + +Y
Sbjct  1028  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKRGGEEIY  1086

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + +++FFE +      + G   A ++ EVTS   +    +        F  +
Sbjct  1087  VGPLGRHSSQLIKFFEGIDGISKIKDGYNPATWMLEVTSEAQEAALGVN-------FAEV  1139

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKT-YGVSKMELLKSCFSREVLLMK  1579
                SE ++     + L  EL+TP   S      L  +T Y  S      +C  ++     
Sbjct  1140  YRNSELYRR---NKALIKELSTPAPGSKD----LYFQTHYSQSFWTQCMACLWKQHWSYW  1192

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELA  1399
             RN       + +   +A++  T+F     +R         M S++  +  +       + 
Sbjct  1193  RNPPYTAVRLLFTTFIAIMFGTIFWDLGSKRKKQQDIFNAMGSMYAAVLFLGVQNATSVQ  1252

Query  1398  PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRL  1222
             P +     +FY++R    Y A  YA    ++ +P   I+  V+    Y +IG++    + 
Sbjct  1253  PVVAIERTVFYRERAAGMYSALPYAFGQAVVELPNLLIQTLVYGVIVYAMIGFEWTVAKF  1312

Query  1221  LKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVK  1054
             L  W L  ++  L  + F    ++  ++T    + + +    +AL     GFI+ +  + 
Sbjct  1313  L--WYLFFMYFTL--LYFTLYGMMTVAVTPNHNIAAIVSSAFYALWNLFSGFIIPKTRIP  1368

Query  1053  KWWIWGYWISPLMYAQNAIAVNEF  982
              WW W Y++ P+ +    +  ++F
Sbjct  1369  VWWRWYYYVCPISWTLYGLVASQF  1392



>ref|XP_010654715.1| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis 
vinifera]
Length=1454

 Score =  1415 bits (3662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1066 (66%), Positives = 857/1066 (80%), Gaps = 35/1066 (3%)
 Frame = -2

Query  3108  GSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             GS R +SSS+W N G + F++SSR    D+DDE ALKWAAL+K+PT++R++KGL+ G  G
Sbjct  11    GSLRKDSSSIWRNSGEEVFSRSSR----DEDDEEALKWAALEKLPTYNRMRKGLLMGSAG  66

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
             E  EVDI+N+G++EKK ++ERL+K+ E DNE FLLKL++R++RV ID+P++EVRFEHL +
Sbjct  67    EASEVDIHNLGFQEKKNLVERLVKIAEEDNEKFLLKLRNRIDRVGIDLPEIEVRFEHLTI  126

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEA+VG RALPS      N +E +L+ L  LP+ KK  +IL DVSGIIKP RMTLLLGP
Sbjct  127   DAEAHVGSRALPSFIYSAFNQIEDILNTLRILPSRKKKLTILHDVSGIIKPRRMTLLLGP  186

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             PSSGKT+LLLAL+G+LD SL+ +G+V+YNGH MNEFVP RTA YISQHD HI EMT RET
Sbjct  187   PSSGKTTLLLALSGKLDSSLKVTGKVTYNGHGMNEFVPQRTATYISQHDTHIGEMTVRET  246

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSARCQGVG RY+MLAELSRREKAANI+PDPDID+FMKA AT+GQK NVI DY +K+L
Sbjct  247   LAFSARCQGVGDRYDMLAELSRREKAANIKPDPDIDVFMKAVATEGQKENVITDYTLKIL  306

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GLE C DT+VG++ +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDSSTT+QI+ S+
Sbjct  307   GLEVCADTLVGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSL  366

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             +  IHIL+GTA+I+LLQPAPE YDLFDDIIL+S+ QIVYQGP   VL+FFE +GFRCPER
Sbjct  367   RQTIHILNGTALISLLQPAPETYDLFDDIILLSDSQIVYQGPREDVLDFFESMGFRCPER  426

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTSRKDQ QYW RKD +PY FVT+ EF+EAFQSFHIGR LG ELATPF K+
Sbjct  427   KGVADFLQEVTSRKDQQQYWARKD-EPYSFVTVKEFAEAFQSFHIGRKLGHELATPFDKT  485

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SHPAAL T+ YGV K ELL +C SRE LLMKRN  ++IF++  +++MA I+MT+F+RT 
Sbjct  486   KSHPAALKTEKYGVRKKELLDACISREYLLMKRNSFVYIFKLTQLIIMAAISMTIFLRTE  545

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M +NS     IY  +LFFT+ +IMF+ + ELA TI +LP+FYKQR LLFYPAWAYA+P++
Sbjct  546   MHKNSTDDGSIYTGALFFTVVMIMFNGMSELAMTIAKLPVFYKQRGLLFYPAWAYALPSW  605

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             IL+IPIT +EV+VWVF +YYVIG+DPN GRL K ++LL++  Q+AS LFR  A  GR+M 
Sbjct  606   ILKIPITFVEVAVWVFMSYYVIGFDPNVGRLFKQYLLLVLVNQMASALFRFIAAAGRNMI  665

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN-TV  958
              A   GSF +L+LFALGGF+LSR++VKKWWIWGYW SPLMYAQNAI VNEFLGKSW+   
Sbjct  666   VANTFGSFSLLLLFALGGFVLSRENVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKNS  725

Query  957   LPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANI  778
                S+E  GV VLK RG F EAYWYW+G GAL+GF +   F YT+AL  L    + +A I
Sbjct  726   STDSTESLGVAVLKSRGFFTEAYWYWIGAGALLGFILVFNFCYTVALTYLNAFEKPQAVI  785

Query  777   SAESHSNE-------HDVSNGGSDNSV--------------------GERVSDGMSNRKH  679
             + ES +++            G  D +                      E +++   N K 
Sbjct  786   TEESENSKTGGKIELSSHRRGSIDQTASTERRDEIGRSISSTSSSVRAEAIAEARRNNKK  845

Query  678   GMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGA  499
             GM+LPF+P SI F+DI+Y VDMP+EMK +GV ++RLELLKGVSGAFRPGVLTALMGVSGA
Sbjct  846   GMVLPFQPLSITFDDIRYSVDMPEEMKSQGVLEDRLELLKGVSGAFRPGVLTALMGVSGA  905

Query  498   GKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFS  319
             GKTTLMDVLAGRKTGGYIEG I ISG+ KKQ+TFARISGYCEQNDIHSPH+T++ESL++S
Sbjct  906   GKTTLMDVLAGRKTGGYIEGNINISGYPKKQETFARISGYCEQNDIHSPHVTIHESLLYS  965

Query  318   AWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVAN  139
             AWLRLP++V  +TRK+FI+EVMELVELT L++++VGLPGVNGLST QRKRLTIAVELVAN
Sbjct  966   AWLRLPADVDSKTRKMFIEEVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELVAN  1025

Query  138   PSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             PSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1026  PSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1071


 Score =   139 bits (349),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 136/628 (22%), Positives = 268/628 (43%), Gaps = 86/628 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  883   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNINISGYPKKQETFAR  941

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+D    
Sbjct  942   ISGYCEQNDIHSPHVTIHESLLYSAW----------------------LRLPADVD----  975

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L   +D++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  976   -----SKTRKMFIEEVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1030

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1031  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGQEIY  1089

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++F+ +      + G   A ++ EVTS   +             F+  
Sbjct  1090  VGPLGRHSSHLIKYFQGIEGVSKIKDGYNPATWMLEVTSSAQE-------------FLLG  1136

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              +F+E +++  + R   D +    Q +           Y  S      +C  ++     R
Sbjct  1137  VDFTEIYKNSDLYRRNKDLIKELSQPAPGSKDLYFPTQYSQSFFTQCMACLWKQRRSYWR  1196

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N         +   +ALI  T+F     +R         M S++  +  +       + P
Sbjct  1197  NPPYTAVRFFFTTFIALIFGTMFWDLGTKRKKQQDLSNAMGSMYAAVLFLGVQNSSSVQP  1256

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ IP    +  V+    Y +IG++    +  
Sbjct  1257  VVAVERTVFYRERAAGMYSAMPYAFAQALVEIPYVFAQAVVYGVIVYAMIGFEWTAAKFF  1316

Query  1218  KMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDV  1057
                      +L   F  + +V    AA   + +        + +  LF+  GFI+ R  +
Sbjct  1317  WYLFFMFFTLLYFTFYGMMAV----AATPNQHIAAIVAAAFYGLWNLFS--GFIVPRTRI  1370

Query  1056  KKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLFPE  895
               WW W YW  P+ +    +  ++F         + +TV  + ++ FG         F  
Sbjct  1371  PVWWRWYYWACPVAWTLYGLVTSQFGDIQDRFEDTGDTVEQYLNDYFG---------FEH  1421

Query  894   AYWYWLGVGA--LIGFTIFSIFIYTLAL  817
              +   LGV A  ++GFT+  +FI+  A+
Sbjct  1422  DF---LGVVAAVIVGFTVLFLFIFAFAI  1446



>ref|XP_010254262.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=1455

 Score =  1415 bits (3662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/1068 (66%), Positives = 856/1068 (80%), Gaps = 39/1068 (4%)
 Frame = -2

Query  3105  SFRINSSSLWSNGT--DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRG  2932
             S RI+SSS+  N    D F +SSR     +DDE ALKWAAL+K+PT++R++KGL++G+ G
Sbjct  12    SLRIDSSSIRRNSIVDDVFQRSSRH----EDDEEALKWAALEKLPTYNRIRKGLLSGVGG  67

Query  2931  ETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNV  2752
             ET E+DI ++  +EKK +LERL+K+ + DNE FLLKLK+R++RV +DIPK+EVRFEHLNV
Sbjct  68    ETKEIDIESLSLQEKKVLLERLLKIADEDNENFLLKLKNRIDRVGLDIPKIEVRFEHLNV  127

Query  2751  GAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGP  2575
              AEAYVG RALP++ N+ +N+ E  L+YL+ LP+ KK  SIL DVSGIIKP RMTLLLGP
Sbjct  128   DAEAYVGSRALPTIFNYSVNMFEEFLNYLHILPSRKKPLSILHDVSGIIKPCRMTLLLGP  187

Query  2574  PSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARET  2395
             P SGKT+LLLALAG+L   ++FSGRV+YNGH+MNEFVP RTAAYISQ+DLHI EMT RET
Sbjct  188   PGSGKTTLLLALAGKLGSDVKFSGRVTYNGHKMNEFVPQRTAAYISQYDLHIGEMTVRET  247

Query  2394  LAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVL  2215
             LAFSARCQGVG+ YEMLAELSRREK  NI+PDPDIDI+MKAAA +GQ+A+V+ DYI+K+L
Sbjct  248   LAFSARCQGVGTGYEMLAELSRREKETNIKPDPDIDIYMKAAALEGQEASVVTDYILKIL  307

Query  2214  GLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSI  2035
             GLE C DT+VG+E  RG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTTFQIL S+
Sbjct  308   GLEICADTLVGDEMFRGISGGQKKRVTTGEMLVGPARALFMDEISTGLDSSTTFQILNSL  367

Query  2034  KHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPER  1855
             +  IHIL+GTA+I+LLQPAPE Y+LFDDIIL+S+GQIVYQGP   VLEFFE +GF+CPER
Sbjct  368   RQSIHILNGTALISLLQPAPETYELFDDIILLSDGQIVYQGPRENVLEFFESMGFKCPER  427

Query  1854  KGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKS  1675
             KGVADFLQEVTS KDQ QYW RKD +PYRF+ + EF+EAFQSFH+G  LGDELA PF K+
Sbjct  428   KGVADFLQEVTSWKDQEQYWARKD-EPYRFIPVKEFAEAFQSFHVGLKLGDELANPFDKT  486

Query  1674  TSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTN  1495
              SHPA+LTTK YGVSK ELLK+C SRE+LLMKRN  ++IF++  + ++  I MTLF+R  
Sbjct  487   KSHPASLTTKKYGVSKKELLKACISRELLLMKRNYFVYIFKMTQLTILGFIAMTLFLRIK  546

Query  1494  MQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTF  1315
             M R+S I   IY+ +LFFTL +IMF+   ELA TI +LP+FYKQRDLLFYP+WAY++PT+
Sbjct  547   MHRDSVIDGGIYIGALFFTLMMIMFNGYSELALTILKLPVFYKQRDLLFYPSWAYSLPTW  606

Query  1314  ILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMT  1135
             IL+IP T  EV+VWVF TYYVIG+DPN GRL K ++LL+   Q+AS LFR    VGR M 
Sbjct  607   ILKIPYTFFEVAVWVFMTYYVIGFDPNVGRLFKQYLLLLGVNQMASGLFRFIGAVGRDMI  666

Query  1134  NAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVL  955
              A   GSF +L +  +GGF++SR+DVKKWW WGYWISP+MY QNAIAVNEFLG SW+ V 
Sbjct  667   VANTFGSFSLLAILVMGGFVVSREDVKKWWKWGYWISPMMYGQNAIAVNEFLGNSWSHVP  726

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
             P S+EP GV VLK RG+FP+AYWYWLGVGAL+G+      ++TLAL+ L P  + +  +S
Sbjct  727   PNSTEPLGVTVLKSRGIFPKAYWYWLGVGALVGYMFLFNVLFTLALSYLNPFGKPQPVVS  786

Query  774   AES------------------------------HSNEHDVSNGGSDNSVGERVSDGMSNR  685
              ES                                NE    + G   +  E + +G  NR
Sbjct  787   EESLNEKWANRTGEFIKLSSREKSSVCQTSSTEEGNEMRSMSSGISPASTETI-NGNQNR  845

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             K GM+LPF+P SI F++I+Y VDMPQE+K +GV +++LELLKGVSG+FRPGVLTALMGVS
Sbjct  846   KRGMVLPFQPLSITFDEIRYSVDMPQELKAQGVPEDQLELLKGVSGSFRPGVLTALMGVS  905

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRKT GYI+G ITISG+ KKQ+TFARISGYCEQNDIHSPH+TVYE+L+
Sbjct  906   GAGKTTLMDVLAGRKTCGYIDGCITISGYPKKQETFARISGYCEQNDIHSPHVTVYEALL  965

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLP EV   TR++F++EVMELVELTSLREA+VGLP VNGLST QRKRLTIAVELV
Sbjct  966   YSAWLRLPLEVKSATREMFVEEVMELVELTSLREALVGLPSVNGLSTEQRKRLTIAVELV  1025

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1026  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1073


 Score =   137 bits (344),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 123/563 (22%), Positives = 250/563 (44%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  885   LLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTCGY-IDGCITISGYPKKQETFAR  943

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E L +SA  +                          + + +K
Sbjct  944   ISGYCEQNDIHSPHVTVYEALLYSAWLR--------------------------LPLEVK  977

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
             +A  +     + V+ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  978   SATRE-----MFVEEVMELVELTSLREALVGLPSVNGLSTEQRKRLTIAVELVANPSIIF  1032

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+ +G + +Y
Sbjct  1033  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKQGGEEIY  1091

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +        G   A ++ EVTSR  +    +        F  +
Sbjct  1092  VGPLGRHSCHLIKYFEGIQGVGKINDGYNPATWMLEVTSRAQETVLGVN-------FTDV  1144

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + L +EL TP   S+          Y  S      +C  ++     R
Sbjct  1145  YKSSELYRR---NKALINELNTPAPGSSD---LYFPTRYSQSFFTQCMACLWKQHYSYWR  1198

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +    AL+  T+F     +R+        M S++  +  +       + P
Sbjct  1199  NPPYTAVRLLFTTFTALMFGTIFWDLGSRRSKQQDLFNAMGSMYAAVLFLGIQNASSVQP  1258

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   ++  ++    Y +IG++    +  
Sbjct  1259  VVAIERTVFYRERAAGMYSALPYAFGQVMIEVPYIFLQTLIYGVIVYSMIGFEWTVAKFF  1318

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W L  ++  L  + F    ++  ++T    + + I    +A+     GFI+ R  +  
Sbjct  1319  --WHLFFMYMTL--LYFTCYGMMTVAVTPNHNIAAIIATAFYAIWNLFSGFIVPRPRIPI  1374

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W YW+ P+ +    +  ++F
Sbjct  1375  WWRWYYWVCPVSWTLYGLVASQF  1397



>ref|XP_006366078.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum 
tuberosum]
Length=1453

 Score =  1415 bits (3662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/1068 (66%), Positives = 853/1068 (80%), Gaps = 35/1068 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             +  S R++SS++W N   D F++SSR   ED DDE ALKWAAL+K+PT+ R+++G+++  
Sbjct  9     KVSSARLSSSNVWRNSAMDVFSRSSR---EDYDDEEALKWAALEKLPTYLRIRRGILSEE  65

Query  2937  RGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHL  2758
              G+  EVDI  +   E++ +LERL+K+ + DNE FLLKLK R++RV +D+P +EVRFEHL
Sbjct  66    EGQYREVDITKLDLVERRNLLERLVKIADEDNEKFLLKLKKRIDRVGLDLPTIEVRFEHL  125

Query  2757  NVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLL  2581
             NV AEA VG RALP++ NF +NILE  L+YL+ LP+ KK   IL DVSGIIKPGRMTLLL
Sbjct  126   NVDAEARVGSRALPTIFNFTVNILEDFLNYLHILPSRKKPLPILHDVSGIIKPGRMTLLL  185

Query  2580  GPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTAR  2401
             GPPSSGKT+LLL LAG+LD  L+ SGRV+YNGH M+EFVP RT+AYISQ+DLHI EMT R
Sbjct  186   GPPSSGKTTLLLGLAGKLDKDLKVSGRVTYNGHGMDEFVPQRTSAYISQNDLHIGEMTVR  245

Query  2400  ETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIK  2221
             ETLAFSARCQGVG++YE+LAELSRREK ANI+PDPD+DIFMK+A  DGQ+ANV+ DY +K
Sbjct  246   ETLAFSARCQGVGAKYEILAELSRREKEANIKPDPDVDIFMKSAWNDGQEANVVTDYTLK  305

Query  2220  VLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILK  2041
             +LGLE C DTIVG+E +RG+SGG+RKRLT GEM+VGPA  L MDEISTGLDSSTT+QI+ 
Sbjct  306   ILGLEICADTIVGDEMIRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVN  365

Query  2040  SIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCP  1861
             SI+  IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFFE LGF+CP
Sbjct  366   SIRQSIHILQGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYLGFKCP  425

Query  1860  ERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQ  1681
             +RKGVADFLQEVTSRKDQ QYW R+D +PY+F+T+ EFSEAFQSFH+GR LGDELA PF 
Sbjct  426   QRKGVADFLQEVTSRKDQEQYWARRD-EPYKFITVREFSEAFQSFHVGRKLGDELAVPFD  484

Query  1680  KSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIR  1501
             KS SHPAALTTK YGVSK ELLK+C +RE LLMKRN  ++IF++  + LMA ITMTLF+R
Sbjct  485   KSKSHPAALTTKRYGVSKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMATITMTLFLR  544

Query  1500  TNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIP  1321
             T M RN+ I   +++ +L++ + +IMF+   ELA +I +LP FYKQRDLLF+PAW YA+P
Sbjct  545   TEMHRNTMIDGAVFLGALYYAVIMIMFNGFSELALSIMKLPSFYKQRDLLFFPAWTYALP  604

Query  1320  TFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRS  1141
             T+IL+IPIT +EV++WV  TYYVIG++ + GR  K   LLI   Q+AS LFR  A +GR+
Sbjct  605   TWILKIPITLVEVAIWVCMTYYVIGFEADVGRFFKQLFLLICLNQMASGLFRFLAALGRN  664

Query  1140  MTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNT  961
             +  A   GS  +L++  +GGFILSRD+VK+W IWGYWISP+MYAQNAIAVNEFLGKSW  
Sbjct  665   IIVANTFGSCALLIVLVMGGFILSRDNVKQWLIWGYWISPMMYAQNAIAVNEFLGKSWAH  724

Query  960   VLPFS--SEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSR  787
             V P S  ++  GV  LK RG+FPEA WYW+GVGAL+G+ +   F++T+ALA L P  + +
Sbjct  725   VPPNSTGTDTLGVSFLKSRGIFPEARWYWIGVGALLGYVLLFNFLFTVALAYLNPFGKPQ  784

Query  786   ANISAESHSNEHDVSNGGS-------DNSVGER-------------------VSDGMSNR  685
             A +S E+ + E + S  G          S  ER                   +++G  N+
Sbjct  785   AVLSEETVA-ERNASKKGEVIELSPIGKSSSERGNDVRRSASSRSMSSRVGNITEGDINK  843

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             + GMILPFEP SI F+DI+Y VDMPQEMK +G  ++RLELLKGVSGAFRPGVLTALMGVS
Sbjct  844   RKGMILPFEPLSITFDDIRYAVDMPQEMKSQGFIEDRLELLKGVSGAFRPGVLTALMGVS  903

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRKTGGYIEG I+ISG+ K+Q+TFARI+GYCEQ DIHSPH+TVYESL 
Sbjct  904   GAGKTTLMDVLAGRKTGGYIEGTISISGYPKQQETFARIAGYCEQTDIHSPHVTVYESLQ  963

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLP EV  ETRK FI+EVMELVEL  LREA+VGLPGVNGLST QRKRLT+AVELV
Sbjct  964   YSAWLRLPREVDTETRKRFIEEVMELVELKPLREALVGLPGVNGLSTEQRKRLTVAVELV  1023

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1024  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1071


 Score =   129 bits (325),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 123/564 (22%), Positives = 243/564 (43%), Gaps = 64/564 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +S +G+   +    R
Sbjct  883   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGTISISGYPKQQETFAR  941

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              A Y  Q D+H P +T  E+L +SA  +           L R                  
Sbjct  942   IAGYCEQTDIHSPHVTVYESLQYSAWLR-----------LPRE-----------------  973

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                 D +     ++ +++++ L+   + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  974   ---VDTETRKRFIEEVMELVELKPLREALVGLPGVNGLSTEQRKRLTVAVELVANPSIIF  1030

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G + ++
Sbjct  1031  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKRGGEEIF  1089

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      R G   A ++ ++TS   +    +            
Sbjct  1090  VGPLGRHSSHLIKYFEGIDGVPKIRDGYNPATWMLDITSVAQEAALGV------------  1137

Query  1755  NEFSEAFQSFHIGRN---LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F+E +++  + R    L  EL+ P     S      TK Y  S      +CF ++   
Sbjct  1138  -DFTELYRNSELYRRNKALIKELSVP--APGSKDLYFQTK-YSQSFFTQSMACFWKQHWS  1193

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN       + +   +AL+  T+F     +R         + S++ ++  +       
Sbjct  1194  YWRNPPYTAVRLLFTFFIALMFGTIFWDLGSKRRRQQDILNAIGSMYASVLFLGVQNATS  1253

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY++R    Y A  YA    ++ +P   I+  ++    Y +IG++    
Sbjct  1254  VQPVVAIERTVFYRERAAGMYSALPYAFGQIMIELPYIFIQTIIYGVIVYAMIGFEWTVA  1313

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRDDVK  1054
             +    W L  ++  L          V  +  +  A +V S    V     GFI+ +  + 
Sbjct  1314  KFF--WYLFFMYFTLLYFTLYGMMTVAVTPNHSIAAIVSSAFYAVWNLFSGFIVPKTRMP  1371

Query  1053  KWWIWGYWISPLMYAQNAIAVNEF  982
              WW W Y+I P+ +    +  ++F
Sbjct  1372  VWWRWYYYICPISWTLYGLIASQF  1395



>gb|KCW59823.1| hypothetical protein EUGRSUZ_H02569 [Eucalyptus grandis]
Length=1405

 Score =  1414 bits (3661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/1052 (66%), Positives = 845/1052 (80%), Gaps = 33/1052 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             M+  D      S R  SS+ W N     D F++SSR    D+DDE AL+WAAL+K+PTF+
Sbjct  1     MDGGDIYRAGNSLRATSSTTWRNHASIADVFSRSSR----DEDDEEALRWAALEKLPTFE  56

Query  2967  RLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDI  2788
             RL+KG++T   G   ++DI N+G+ ++K++LERL++V E DNE FLLKL++R++RV ID+
Sbjct  57    RLQKGILTAGGGAN-QIDIWNLGFHDRKRLLERLVRVTEEDNEGFLLKLRNRIDRVGIDL  115

Query  2787  PKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGI  2611
             P +EVRFEHL V AEA+ G RALP+V NFC +ILEG L++L+ LP+ KKH +IL+DVSGI
Sbjct  116   PTIEVRFEHLKVEAEAHEGSRALPTVINFCTSILEGFLNFLHILPSRKKHLTILQDVSGI  175

Query  2610  IKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQH  2431
             IKPGRMTLLLGPPSSGKT+LLLALAG+LDP L+ +GRV+YNGH MNEFVP RTAAYISQ 
Sbjct  176   IKPGRMTLLLGPPSSGKTTLLLALAGKLDPELKTTGRVTYNGHVMNEFVPQRTAAYISQQ  235

Query  2430  DLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQK  2251
             DLHI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAA+I+PDPD+DIFMKAA  +GQ+
Sbjct  236   DLHIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAASIKPDPDVDIFMKAAVIEGQE  295

Query  2250  ANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGL  2071
             ANV++DYI+K+LGLE C D +VG+E LRG+SGG+RKR+TAGEMLVGP  V LMDEISTGL
Sbjct  296   ANVVIDYILKILGLEICADAMVGDEMLRGISGGQRKRVTAGEMLVGPVEVFLMDEISTGL  355

Query  2070  DSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLE  1891
             DSSTT+QI+  +K +IHIL GTA+I+LLQPAPE YDLFDDIIL+S+GQIVYQGP   +L+
Sbjct  356   DSSTTYQIVNFLKQFIHILDGTAIISLLQPAPETYDLFDDIILLSDGQIVYQGPRELILD  415

Query  1890  FFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRN  1711
             FF+ +GF+CP RKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF EAFQSFH+GR 
Sbjct  416   FFKSMGFKCPRRKGVADFLQEVTSRKDQHQYWVRKD-EPYTFVTVREFVEAFQSFHVGRK  474

Query  1710  LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLM  1531
             LGDEL+TPF KS +HPAALTTK +GV   +LLK+C  RE LLMKRN  ++IF+V  ++++
Sbjct  475   LGDELSTPFDKSKNHPAALTTKRFGVGMKDLLKACILREYLLMKRNSFVYIFKVSQLIIL  534

Query  1530  ALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLL  1351
             A I++TLF+RT M R++     +Y+ +LFFT+  IMF+ + E++ TI +LPIFYKQRDLL
Sbjct  535   AFISVTLFLRTKMHRDTVTDGGVYIGALFFTVITIMFNGMSEISMTIAKLPIFYKQRDLL  594

Query  1350  FYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVL  1171
             FYPAWAYA+P++IL+IPIT +EV+ WVF TYYV GYDPN GRL K ++LL+   Q+AS L
Sbjct  595   FYPAWAYALPSWILKIPITFVEVAAWVFITYYVTGYDPNVGRLFKHYLLLVAINQMASGL  654

Query  1170  FRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAV  991
             FR  A +GR++  A   GSF++L L ALGG +LSR+DVKKWWIWGYW SPLMY QNAI V
Sbjct  655   FRLIAALGRNLIVANTFGSFVLLALVALGGVVLSREDVKKWWIWGYWTSPLMYGQNAIVV  714

Query  990   NEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLAL  817
             NE LG +WN + P SS  EP G+ VLK RG F EAYWYW+G+GAL GF +   F +++AL
Sbjct  715   NELLGSNWNKIPPNSSTNEPLGIQVLKSRGFFTEAYWYWIGLGALFGFIVLFNFGFSVAL  774

Query  816   AKLRPLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFN  637
             A L     +R +        E  V+                +N K GM+LPFEPHSI F+
Sbjct  775   ALL-----NRRSSKPTPAWPETAVA----------------ANTKRGMVLPFEPHSITFD  813

Query  636   DIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  457
             +I Y VDMP+EM  +G  ++RL LLKG SG+FRPGVLTALMGVSGAGKTTLMDVLAGRKT
Sbjct  814   EITYSVDMPREMTNQGAPEDRLVLLKGASGSFRPGVLTALMGVSGAGKTTLMDVLAGRKT  873

Query  456   GGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETR  277
             GGYIEG ITISG+ K Q TFARISGYCEQNDIHSPH+TVYESLI+SAWLRLP  V  +TR
Sbjct  874   GGYIEGNITISGYPKNQDTFARISGYCEQNDIHSPHVTVYESLIYSAWLRLPPGVDDQTR  933

Query  276   KLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLD  97
             KLF++EVMELVEL  LR+A+VGLPGV+GLS  QRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  934   KLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIFMDEPTSGLD  993

Query  96    ARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  994   ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1025


 Score =   139 bits (350),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 140/633 (22%), Positives = 274/633 (43%), Gaps = 90/633 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+  SG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+  N+    R
Sbjct  837   LLKGASGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNITISGYPKNQDTFAR  895

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P +D    
Sbjct  896   ISGYCEQNDIHSPHVTVYESLIYSAW----------------------LRLPPGVD----  929

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   Q   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  930   -----DQTRKLFVEEVMELVELNPLRQALVGLPGVDGLSIEQRKRLTIAVELVANPSIIF  984

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  985   MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1043

Query  1917  QGP----CNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQ--YWIRKDNKPYRFVTI  1756
              GP     + ++E+FE +              Q V+  KD      W+ +   P + +T+
Sbjct  1044  VGPLGRHSSHLIEYFEGI--------------QGVSKIKDGYNPATWMLEVTSPAQELTL  1089

Query  1755  N-EFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVL  1588
               +FS+ +++   +   + L +EL+ P     +      TK Y  S    L +C  ++  
Sbjct  1090  GVDFSDLYKNSDLYRRNKALIEELSIP--PPNAKDLYFPTK-YSQSTFTQLMACLWKQHW  1146

Query  1587  LMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQ  1408
                RN         + + +AL+  T+F     +          M S++  +  +      
Sbjct  1147  SYWRNPPYTAVRFLFTISIALMFGTMFWDLGSKTTRSQDLLNAMGSMYAAIFFLGMQNAS  1206

Query  1407  ELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
              + P +     +FY++R    Y A  YA+   ++ +P   ++   +    Y +IG+    
Sbjct  1207  SVQPVVAVERTVFYRERAAGMYSALPYALAQVLIEVPYVLVQAISYGIIVYAMIGFKWTV  1266

Query  1230  GRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRD  1063
              +        + F     + F    ++   MT    + S +    +A+     GF++ R 
Sbjct  1267  VKFFWY----LFFMFFTLLYFTYYGMMAVGMTPNHHIASIVSFAFYAIWNLFSGFVVPRT  1322

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYRGLF  901
              +  WW W YW+ P+ +    + V++F      L  +  TV  +  + FG     YR  F
Sbjct  1323  RIPIWWRWFYWVCPVSWTLYGLVVSQFGNLTNRLEDTGETVEEYMRDYFG-----YRHGF  1377

Query  900   PEAYWYWLGVGA--LIGFTIFSIFIYTLALAKL  808
                    LG+ A  +IGFT+  +F++ +++  L
Sbjct  1378  -------LGMIAAVMIGFTMLFVFVFAISIKIL  1403



>gb|KHN09389.1| Pleiotropic drug resistance protein 1 [Glycine soja]
Length=1445

 Score =  1414 bits (3659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1061 (65%), Positives = 840/1061 (79%), Gaps = 25/1061 (2%)
 Frame = -2

Query  3117  GRSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             G   SFRI SSS+W N +D     S    +++D+EA LKWAA+QK+PT  RL+K L+T  
Sbjct  3     GGGSSFRIGSSSIWRN-SDAAEIFSNSFHQENDEEA-LKWAAIQKLPTVARLRKALITSP  60

Query  2937  RGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHL  2758
              GE+ E+D+  +G +EKK +LERL+K  + DNE FLLKLKDR++RV ID+P +EVRFE+L
Sbjct  61    DGESNEIDVKKLGLQEKKALLERLVKTAQEDNEKFLLKLKDRIDRVGIDLPTIEVRFENL  120

Query  2757  NVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLL  2581
             ++ AEA  G RALP+ TNF +NILEGLL+ L+ LP  K+H +IL DVSGIIKPGRMTLLL
Sbjct  121   SIEAEARAGTRALPTFTNFIVNILEGLLNSLHVLPNRKQHLNILEDVSGIIKPGRMTLLL  180

Query  2580  GPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTAR  2401
             GPPSSGKT+LLLALAG+LDP L+FSG+V+YNGH MNEFVP RTAAY++Q+DLH+ E+T R
Sbjct  181   GPPSSGKTTLLLALAGKLDPKLKFSGKVTYNGHGMNEFVPQRTAAYVNQNDLHVAELTVR  240

Query  2400  ETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIK  2221
             ETLAFSAR QGVG RY++LAELSRREK ANI+PDPDID +MKA A++GQKAN+I DYI++
Sbjct  241   ETLAFSARVQGVGPRYDLLAELSRREKEANIKPDPDIDAYMKAVASEGQKANMITDYILR  300

Query  2220  VLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILK  2041
             +LGLE C DT+VGN  LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTTFQI+ 
Sbjct  301   ILGLEVCADTVVGNAMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVN  360

Query  2040  SIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCP  1861
             S+K Y+HIL GT VI+LLQPAPE Y+LFDDIIL+S+  IVYQGP   VLEFFE +GF+CP
Sbjct  361   SLKQYVHILKGTTVISLLQPAPETYNLFDDIILLSDSHIVYQGPREHVLEFFELMGFKCP  420

Query  1860  ERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQ  1681
             +RKGVADFLQEVTSRKDQ QYW  KD +PYRFVT  EFSEA +SFHIGR+LG+ELAT F 
Sbjct  421   QRKGVADFLQEVTSRKDQEQYWAHKD-QPYRFVTAKEFSEAHKSFHIGRSLGEELATEFD  479

Query  1680  KSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIR  1501
             KS SHPAALTTK YGV K ELLK+C SRE LLMKRN  ++ F++  + ++A+I MT+F+R
Sbjct  480   KSKSHPAALTTKMYGVGKWELLKACLSREYLLMKRNSFVYTFKLCQLAVLAIIAMTIFLR  539

Query  1500  TNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIP  1321
             T M R+S     IY+ +LF+ + VIMF+ L EL+  + RLP+FYKQRD LF+P+W YA+P
Sbjct  540   TEMHRDSVTHGGIYVGALFYGVVVIMFNGLAELSMVVSRLPVFYKQRDYLFFPSWVYALP  599

Query  1320  TFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRS  1141
              +IL+IP+T +EV VWVF TYY IG+DP  GRL + +++L++  Q+AS LFR  A VGR 
Sbjct  600   AWILKIPLTFVEVGVWVFLTYYAIGFDPYVGRLFRQYLVLVLVNQMASALFRLVAAVGRE  659

Query  1140  MTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNT  961
             MT A  +GSF + +LFA+ GF+LS++++KKWW+WG+WISP+MY QNA+  NEFLGK W  
Sbjct  660   MTVALTLGSFTLAILFAMSGFVLSKENIKKWWLWGFWISPMMYGQNAMVNNEFLGKRWRH  719

Query  960   VLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRAN  781
              LP S+E  GV +LK RG F ++YWYW+GVGALIG+T+   F Y LAL  L PL + +A 
Sbjct  720   FLPNSTEALGVEILKSRGFFTQSYWYWIGVGALIGYTLLFNFGYILALTYLNPLGKHQAV  779

Query  780   ISAESHSNEHDVSNGGSDNSV----------GERVSDGMS-----------NRKHGMILP  664
             IS E   N+    +    N +            RV +G S           NR  GMILP
Sbjct  780   ISEEPQINDQSGDSKKGTNVLKSIQRSFSQHSNRVRNGKSLSGSTSPETNHNRTRGMILP  839

Query  663   FEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTL  484
              EPHSI F+D+ Y VDMP EM+  GV +++L LLKGVSGAFRPGVLTALMGV+GAGKTTL
Sbjct  840   SEPHSITFDDVTYSVDMPVEMRNRGVVEDKLALLKGVSGAFRPGVLTALMGVTGAGKTTL  899

Query  483   MDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRL  304
             MDVLAGRKTGGYI G ITISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRL
Sbjct  900   MDVLAGRKTGGYIGGNITISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRL  959

Query  303   PSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIF  124
               E+  +TRK+FI+EVMELVEL +LR A+VGLPG+NGLST QRKRLTIAVELVANPSIIF
Sbjct  960   SPEINADTRKMFIEEVMELVELKALRNALVGLPGINGLSTEQRKRLTIAVELVANPSIIF  1019

Query  123   MDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             MDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1020  MDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1060


 Score =   135 bits (341),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 121/568 (21%), Positives = 255/568 (45%), Gaps = 70/568 (12%)
 Frame = -2

Query  2637  SILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPM  2458
             ++L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    
Sbjct  871   ALLKGVSGAFRPGVLTALMGVTGAGKTTLMDVLAGRKTGGY-IGGNITISGYPKKQETFA  929

Query  2457  RTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFM  2278
             R + Y  Q+D+H P +T  E+L +SA                       +R  P+I+   
Sbjct  930   RISGYCEQNDIHSPHVTVYESLLYSAW----------------------LRLSPEIN---  964

Query  2277  KAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVL  2098
                  D +K  + ++ +++++ L+   + +VG   + G+S  +RKRLT    LV   +++
Sbjct  965   ----ADTRK--MFIEEVMELVELKALRNALVGLPGINGLSTEQRKRLTIAVELVANPSII  1018

Query  2097  LMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIV  1921
              MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+ +G Q +
Sbjct  1019  FMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFESFDELLLMKQGGQEI  1077

Query  1920  YQGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVT  1759
             Y GP     + ++ +FE +      + G   A ++ EV++   +M+  I           
Sbjct  1078  YVGPLGHHSSHLINYFEGIQGVNKIKDGYNPATWMLEVSTSAKEMELGI-----------  1126

Query  1758  INEFSEAFQSFHIGRN---LGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFSRE  1594
               +F+E +++  + R    L  EL+TP    K    P+      Y  S +    +C  ++
Sbjct  1127  --DFAEVYKNSELYRRNKALIKELSTPAPGSKDLYFPS-----QYSTSFLTQCMACLWKQ  1179

Query  1593  VLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSA  1414
                  RN +       +   +A +  ++F     + +        M S++  + +I    
Sbjct  1180  HWSYWRNPLYTAIRFLYSTAVAAVLGSMFWDLGSKIDKQQDLFNAMGSMYAAVLLIGIKN  1239

Query  1413  LQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
                + P +     +FY+++    Y A  YA    ++ +P   ++  V+    Y +IG++ 
Sbjct  1240  ANAVQPVVAVERTVFYREKAAGMYSALPYAFAQVLIELPYVLVQAVVYGIIIYAMIGFEW  1299

Query  1236  NFGRLLKMWVLLIIFRQLASVLF---RSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSR  1066
                ++   W L  ++    +  +    S AV      ++ V  +F   V     GFI+ R
Sbjct  1300  TVTKVF--WYLFFMYFTFLTFTYYGMMSVAVTPNQHISSIVSSAFYA-VWNLFSGFIVPR  1356

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF  982
               +  WW W  W +P+ ++   +  +++
Sbjct  1357  PRIPVWWRWYSWANPVAWSLYGLVASQY  1384



>gb|KHN44144.1| Pleiotropic drug resistance protein 1 [Glycine soja]
Length=1426

 Score =  1413 bits (3658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/1051 (65%), Positives = 855/1051 (81%), Gaps = 14/1051 (1%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLK  2959
             ME +D    S S R +S++  ++G + F++SSR    ++DDE ALKWAAL+K+PT++RL 
Sbjct  1     MEGSDIYRASNSLRRSSTAWRNSGVEVFSRSSR----EEDDEEALKWAALEKLPTYNRLG  56

Query  2958  KGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKV  2779
             KGL+T   G   E+D++++G +E+ K+LERL+KV E DNE FLLKLK+R++RV +DIP +
Sbjct  57    KGLLTASHGVANEIDVSDLGTQERHKLLERLVKVAEEDNERFLLKLKERIDRVGLDIPTI  116

Query  2778  EVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIKP  2602
             EVR+EHLN+ AEA+VG RALPS  N   NI+EG  + L++ T+KK H +IL+DVSGIIKP
Sbjct  117   EVRYEHLNIEAEAFVGSRALPSFINSVTNIIEGFFNLLHITTSKKKHVTILKDVSGIIKP  176

Query  2601  GRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLH  2422
              RMTLLLGPPSSGKT+LLLAL+G+LD +L+ SGRV+YNGHE+NEFVP RTAAYISQHDLH
Sbjct  177   RRMTLLLGPPSSGKTTLLLALSGKLDKTLKASGRVTYNGHELNEFVPQRTAAYISQHDLH  236

Query  2421  IPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANV  2242
             I EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPD+D++MKA AT+GQ++++
Sbjct  237   IGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATEGQESSI  296

Query  2241  IVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSS  2062
             + DY +K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDSS
Sbjct  297   VTDYTLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSS  356

Query  2061  TTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFE  1882
             TTFQI+ S++ Y+HIL+GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FFE
Sbjct  357   TTFQIVNSLRQYVHILNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFFE  416

Query  1881  CLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGD  1702
              +GFRCPERKGVADFLQEVTS+KDQ QYW R+D +PYRFV + +F+EAFQSFHIGR LG+
Sbjct  417   SMGFRCPERKGVADFLQEVTSKKDQAQYWARRD-QPYRFVKVTQFAEAFQSFHIGRKLGE  475

Query  1701  ELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALI  1522
             EL  PF K+ SHPAALTTK YG++K ELLK+  SRE LLMKRN  ++IF++  + +MAL+
Sbjct  476   ELVVPFDKTKSHPAALTTKKYGINKKELLKANLSREYLLMKRNSFVYIFKLCQLSIMALM  535

Query  1521  TMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYP  1342
             TMTLF+RT + RN+   A +Y  +LFFTL +IMF+ + E++ TI +LP+FYKQRDLLFYP
Sbjct  536   TMTLFLRTELHRNNMDDAGLYSGALFFTLIMIMFNGMAEISMTIAKLPVFYKQRDLLFYP  595

Query  1341  AWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRS  1162
             +WAYAIP++IL+IP+T +EV+VWVF TYYVIG+DPN GR  K +++L+   Q+AS LFR+
Sbjct  596   SWAYAIPSWILKIPVTLLEVAVWVFLTYYVIGFDPNVGRFFKQYLILLFIGQMASALFRA  655

Query  1161  AAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              A +GR+M  +   G+F +L    LGG+++S++D+K WWIWGYWISPLMY QNA+ VNEF
Sbjct  656   IAALGRNMIVSNTFGAFAVLTFLTLGGYVMSKNDIKNWWIWGYWISPLMYGQNALMVNEF  715

Query  981   LGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRP  802
             L  SW+     +S   GV  L+ RG    +YWYWLG+GA+ GF +    +++ AL  L P
Sbjct  716   LSNSWHN----TSRNLGVEYLESRGFPSSSYWYWLGLGAMAGFVLLFNVMFSAALEILGP  771

Query  801   LAQSRANISAESHSNEHDVSNGG----SDNSVGERVSDGMSNRKHGMILPFEPHSIAFND  634
               + +A I+ E   NE  V+         +  G+ V +    +K GM+LPFEPHSI F++
Sbjct  772   FDKPQATITEEESPNEGTVAEVELPRIESSGRGDSVVESSHGKKKGMVLPFEPHSITFDE  831

Query  633   IKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG  454
             + Y VDMPQEMK +GV+++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG
Sbjct  832   VIYSVDMPQEMKEQGVQEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG  891

Query  453   GYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRK  274
             GYI+G I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS V  +TRK
Sbjct  892   GYIDGSIKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSGVDSKTRK  951

Query  273   LFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDA  94
             +FI+EVMELVEL  LR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLDA
Sbjct  952   MFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDA  1011

Query  93    RAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             RAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1042


 Score =   120 bits (300),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 113/562 (20%), Positives = 233/562 (41%), Gaps = 60/562 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  854   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPKKQETFAR  912

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  913   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  941

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +  D +   + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  942   PSGVDSKTRKMFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1001

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1002  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1060

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +G     + G   A ++ EVT+   ++   +            
Sbjct  1061  VGPLGRHSTHLIKYFESIGGVSKIKDGYNPATWMLEVTTSAQELSLGV------------  1108

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F++ +++   +   + L  EL  P   S           Y  S +   ++C  ++   
Sbjct  1109  -DFTDLYKNSDLYRRNKQLIQELGQPAPGSKD---LYFPTQYSQSFLVQCQACLWKQRWS  1164

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +AL+  T+F     +R +       + S++  +  +       
Sbjct  1165  YWRNPPYTAVRFFFTTFIALMFGTMFWDLGSRRTTRGDLLNALGSMYSAVLFLGIQNASS  1224

Query  1404  LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
             + P +     +FY+++    Y A  YA    ++ IP    +   +    Y +IG+D    
Sbjct  1225  VQPVVAVERTVFYREKAAGMYSALPYAFAQVLVEIPYIFAQAVTYGLIVYAMIGFDWTAE  1284

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKW  1048
             +               +     A  V  +   A +V +    +     GFI+ R  +  W
Sbjct  1285  KFFWYLFFSFFSLLYFTFYGMMAVGVTPNHHVAAIVAAAFYAIWNLFSGFIVVRPKMPVW  1344

Query  1047  WIWGYWISPLMYAQNAIAVNEF  982
             W W YW  P+ +    +  ++F
Sbjct  1345  WRWYYWACPVAWTLYGLIASQF  1366



>gb|KHN22480.1| Pleiotropic drug resistance protein 1 [Glycine soja]
Length=1426

 Score =  1413 bits (3658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1052 (65%), Positives = 854/1052 (81%), Gaps = 16/1052 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME +D    S S R  SS++W N G + F++SSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGSDIYRASNSLR-RSSTVWRNSGVEVFSRSSR----EEDDEEALKWAALEKLPTYNRL  55

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   E+D++++G +E++K+LERL+KV E DNE FLLKLK+R++RV +DIP 
Sbjct  56    RKGLLTASHGVANEIDVSDLGIQERQKLLERLVKVAEEDNERFLLKLKERIDRVGLDIPT  115

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKK-HNSILRDVSGIIK  2605
             +EVR+EHLN+ AEA+VG RALPS  N   N++EG  + L++ T+KK H +IL+DVSGIIK
Sbjct  116   IEVRYEHLNIEAEAFVGSRALPSFINSVTNVVEGFFNLLHISTSKKKHVTILKDVSGIIK  175

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPPSSGKT+LLLAL+G+LD +L+ SGRV+YNGHE+NEFVP RTAAYISQHDL
Sbjct  176   PRRMTLLLGPPSSGKTTLLLALSGKLDKTLKVSGRVTYNGHELNEFVPQRTAAYISQHDL  235

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREKAANI+PDPD+D++MKA AT+GQ+++
Sbjct  236   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATEGQESS  295

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             ++ DY +K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  296   LVTDYTLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  355

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+  ++ Y+HIL+GTAVI+LLQPAPE YDLFDDIILIS+GQ VY GP   VL+FF
Sbjct  356   STTFQIVSFLRQYVHILNGTAVISLLQPAPETYDLFDDIILISDGQGVYHGPREYVLDFF  415

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GFRCPERKGVADFLQEVTS+KDQ QYW R+D +PYRFVT+ +FSEAFQSFHIG  LG
Sbjct  416   ESMGFRCPERKGVADFLQEVTSKKDQAQYWARRD-QPYRFVTVTQFSEAFQSFHIGGKLG  474

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +ELA PF K+ SHPAALTTK YG++K ELLK+  SRE LLMKRN  ++IF++  + +MAL
Sbjct  475   EELAVPFDKTKSHPAALTTKKYGINKKELLKANLSREYLLMKRNSFVYIFKLCQLSIMAL  534

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             +TMTLF+RT + RN+   A +Y  +LFFTL +IMF+ + E++ TI +LP+FYKQRDLLFY
Sbjct  535   MTMTLFLRTELHRNNMDDAGLYAGALFFTLVMIMFNGMAEISMTIAKLPVFYKQRDLLFY  594

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IP+T +EV+VWVF TYYVIG+DPN GRL K +++L+   Q+AS LFR
Sbjct  595   PSWAYAIPSWILKIPVTLLEVAVWVFLTYYVIGFDPNVGRLFKQYLILLFIGQMASALFR  654

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  +   G+F +L    LGGF++++ D+K WWIWGYWISPLMY Q A+ VNE
Sbjct  655   AIAALGRNMIVSNTFGAFAVLTFLTLGGFVMAKSDIKNWWIWGYWISPLMYGQTALMVNE  714

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FL  SW+     SS   GV  L+ RG    AYWYWLG+GA+ GF +    +++ AL  L 
Sbjct  715   FLSNSWHN----SSRNLGVEYLESRGFPSSAYWYWLGLGAMAGFVLLFNVMFSAALEILG  770

Query  804   PLAQSRANISAESHSNEHDVSNGG----SDNSVGERVSDGMSNRKHGMILPFEPHSIAFN  637
             P  + +A I+ E   NE  V+         +  G  V +    +K GM+LPFEPHSI F+
Sbjct  771   PFDKPQATIAEEESPNEVTVAEVELPRIESSGRGGSVVESSHGKKKGMVLPFEPHSITFD  830

Query  636   DIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  457
             ++ Y VDMPQEMK +GV+++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT
Sbjct  831   EVVYSVDMPQEMKEQGVQEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKT  890

Query  456   GGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETR  277
             GGYI+G I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS V  +TR
Sbjct  891   GGYIDGNIKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSSVDSQTR  950

Query  276   KLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLD  97
             K+FI+EVMELVEL  LR ++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDEPTSGLD
Sbjct  951   KMFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLD  1010

Query  96    ARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1011  ARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1042


 Score =   120 bits (300),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 116/565 (21%), Positives = 238/565 (42%), Gaps = 66/565 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  854   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGNIKISGYPKKQETFAR  912

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  913   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  941

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              ++ D Q   + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  942   PSSVDSQTRKMFIEEVMELVELNPLRNSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1001

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1002  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1060

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EVT+   ++   +            
Sbjct  1061  VGPLGRHSSHLIKYFESIEGVSKIKDGYNPATWMLEVTTSAQELSLGV------------  1108

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F++ +++   +   + L  EL  P   S           Y  S +   ++C  ++   
Sbjct  1109  -DFTDLYKNSDLYRRNKQLIQELGQPAPGSKD---LYFPTQYSQSFLVQCQACLWKQRWS  1164

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQE  1405
               RN         +   +AL+  T+F     +R +       + S++   T ++F  +Q 
Sbjct  1165  YWRNPPYTAVRFFFTTFIALMFGTMFWDLGSRRTTRGDLLNALGSMY---TAVLFLGIQN  1221

Query  1404  ---LAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
                + P +     +FY+++    Y A  YA    ++ IP    +   +    Y +IG+D 
Sbjct  1222  ASSVQPVVAVERTVFYREKAAGMYSALPYAFAQVLVEIPYIFAQAVTYGLIVYAMIGFDW  1281

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDV  1057
                +               +     A  V  +   A +V +    +     GFI+ R  +
Sbjct  1282  TAEKFFWYLFFSFFSLLYFTFYGMMAVGVTPNHHVAAIVAAAFYAIWNLFSGFIVVRPKM  1341

Query  1056  KKWWIWGYWISPLMYAQNAIAVNEF  982
               WW W YW  P+ +    +  ++F
Sbjct  1342  PVWWRWYYWACPVAWTLYGLIASQF  1366



>gb|KDP36996.1| hypothetical protein JCGZ_06052 [Jatropha curcas]
Length=1425

 Score =  1413 bits (3658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/1053 (66%), Positives = 845/1053 (80%), Gaps = 36/1053 (3%)
 Frame = -2

Query  3090  SSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL-RGETFEV  2917
             SSS W N G D F++SSR    +DDDE ALKWAAL+K+PT+DRL+KG++  + +G   E+
Sbjct  2     SSSAWRNTGVDVFSRSSR----EDDDEEALKWAALEKLPTYDRLRKGILVSVSKGGVNEI  57

Query  2916  DINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNVGAEAY  2737
             D+ ++G++E+K +LERL++V E DNE FLLKLK+R++RV I+IP +EVRFE LN+  EA+
Sbjct  58    DVGDLGFQERKSLLERLVRVAEEDNEKFLLKLKNRIDRVGIEIPTIEVRFERLNIEGEAF  117

Query  2736  VGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGPPSSGK  2560
             VG RALP+  NF +NI+EG L+ L+ LP  KK  +IL+DVSGIIKP RMTLLLGPPSSGK
Sbjct  118   VGNRALPTFVNFSVNIVEGFLNSLHILPGRKKRFTILKDVSGIIKPSRMTLLLGPPSSGK  177

Query  2559  TSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSA  2380
             T+LLLALAG+LDP+L+FSG V+YNGH MNEF+P RTAAYISQHDLHI EMT RETLAFSA
Sbjct  178   TTLLLALAGKLDPNLKFSGSVTYNGHGMNEFIPQRTAAYISQHDLHIGEMTVRETLAFSA  237

Query  2379  RCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGC  2200
             RCQGVG++ EMLAELSRREKAANI+PDPDID FMKAAA +GQ+ +V+ DYI+K+LGLE C
Sbjct  238   RCQGVGTQQEMLAELSRREKAANIKPDPDIDFFMKAAAIEGQETSVVTDYILKILGLEIC  297

Query  2199  EDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIH  2020
              DT+VG E LRG+SGG+RKR+T GEMLVGPA  L MDEISTGLDSSTT+QI+ S+K  I+
Sbjct  298   ADTLVGAEMLRGISGGQRKRVTTGEMLVGPARALFMDEISTGLDSSTTYQIVNSLKQSIN  357

Query  2019  ILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERKGVAD  1840
             I +GTAVI+LLQPA E YDLFDDIIL+S+GQIVYQGP + VL FFE +GF+CPERKGVAD
Sbjct  358   IFNGTAVISLLQPATETYDLFDDIILLSDGQIVYQGPRDDVLGFFEYMGFKCPERKGVAD  417

Query  1839  FLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPA  1660
             FLQEVTS+KDQ QYW RKD+ PY FVT+ EFS AFQS+ IGR +  +L+TPF K+ SHPA
Sbjct  418   FLQEVTSKKDQQQYWARKDH-PYSFVTVPEFSRAFQSYEIGRKIEHDLSTPFDKTKSHPA  476

Query  1659  ALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNS  1480
             AL T  YG  KMELLKSCFSRE LLMKRN  ++IF++  + +MA+ITMT+F+RTNM R+ 
Sbjct  477   ALATGKYGAGKMELLKSCFSREYLLMKRNSFVYIFKLSQLTIMAIITMTVFLRTNMHRDD  536

Query  1479  PIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIP  1300
                  IY+ +LFFT+  +MF+ + E++ TI +LP+FYKQRDLLFYPAWAY++PT+I++IP
Sbjct  537   VTDGGIYLGALFFTMVAVMFNGMSEISLTIVKLPVFYKQRDLLFYPAWAYSLPTWIIKIP  596

Query  1299  ITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVV  1120
             IT +EVSVWVF TYYVIG+DPN GRL K ++LL++  Q++S LFR  A VGR+M  A   
Sbjct  597   ITILEVSVWVFITYYVIGFDPNVGRLFKQYLLLLLVNQMSSALFRLIASVGRNMIVANTF  656

Query  1119  GSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSE  940
             GSF +L LFALGG ILSR+D+KKWWIWGYWISP+MY QNAI VNEFLGKSW+ +   S E
Sbjct  657   GSFALLALFALGGVILSREDIKKWWIWGYWISPMMYGQNAIIVNEFLGKSWSHIPENSGE  716

Query  939   PFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS-----  775
             P G+ V+K RG FP+AYWYWLG+GAL GF +     +TLAL  L P  + +A IS     
Sbjct  717   PLGIQVMKTRGFFPQAYWYWLGLGALAGFILLFNLCFTLALHFLNPFEKPQAVISEVPEP  776

Query  774   --------------AE-SHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAF  640
                           AE SH  + ++   G+D        +   N+K GM+LPFEPH + F
Sbjct  777   RDRIEGATAIQLSQAECSHRTKTEIGTSGND--------EVNYNKKKGMVLPFEPHCLTF  828

Query  639   NDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  460
             +++ Y VDMPQEMK +GV +++L LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK
Sbjct  829   DNVVYSVDMPQEMKSQGVLEDKLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  888

Query  459   TGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCET  280
             TGGYIEG I ISG+ K+Q+T ARISGYCEQ DIHSPH+TVYESL+FSAWLRLP E+   T
Sbjct  889   TGGYIEGSIPISGYPKQQETCARISGYCEQKDIHSPHVTVYESLLFSAWLRLPPEIDSGT  948

Query  279   RKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGL  100
             R +F+ E+MELVEL  LR A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  949   RDMFVDEIMELVELNPLRHALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1008

Query  99    DARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1009  DARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1041


 Score =   139 bits (351),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 136/567 (24%), Positives = 246/567 (43%), Gaps = 70/567 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  853   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGSIPISGYPKQQETCAR  911

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L FSA                       +R  P+ID    
Sbjct  912   ISGYCEQKDIHSPHVTVYESLLFSAW----------------------LRLPPEID----  945

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                  G + ++ VD I++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  946   ----SGTR-DMFVDEIMELVELNPLRHALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1000

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1001  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGEEIY  1059

Query  1917  QGPCNC----VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVTS   +M   +        F  I
Sbjct  1060  VGPLGGHSYHLIKYFEEIEGVSKIKDGYNPATWMLEVTSSAQEMALGVD-------FSVI  1112

Query  1755  NEFSEAFQSFHIGRNLGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLM  1582
              + SE ++     + +  EL+ P    K    PA      Y  S +    +C  ++ L  
Sbjct  1113  YKNSELYRR---NKAIIKELSVPAPGSKDLYFPA-----QYSQSFLTQCIACLWKQRLSY  1164

Query  1581  KRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQI-YMSSLFFTLTVIMFSALQE  1405
              RN         +   MAL+  T+F        S IG Q   ++S       ++F  +Q 
Sbjct  1165  WRNPPYTAVRFLFTTFMALMFGTIF----WNLGSKIGKQQDLINSTGSLYAAVLFLGVQN  1220

Query  1404  LA---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDP  1237
              A   P +     +FY++R    Y A  YA    I+ +P    +  V+   TY +IG++ 
Sbjct  1221  AASVQPVVAIERTVFYRERAAGMYSALPYAYAQVIIELPYIFCQAIVYGLITYAMIGFEW  1280

Query  1236  NFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSRD  1063
                +    W +  ++  L    +     V  S  +  A ++ S    +     GF++ R 
Sbjct  1281  TSAKFF--WYIFFMYFTLLYFTYYGMMTVAVSPNHHIASIISSAFYAIWNLFSGFVIPRT  1338

Query  1062  DVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  WW W YW  PL +    +  +++
Sbjct  1339  RMPVWWRWYYWACPLSWTLYGLIASQY  1365



>ref|XP_011072269.1| PREDICTED: pleiotropic drug resistance protein 1-like [Sesamum 
indicum]
Length=1423

 Score =  1413 bits (3657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1029 (67%), Positives = 840/1029 (82%), Gaps = 9/1029 (1%)
 Frame = -2

Query  3081  LWSNG-TDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRGETFEVDINN  2905
              W NG  + F+ S+R    ++DDEAALKWAAL+K+PT+DRL +GL+ G RG T EVD+ N
Sbjct  20    FWRNGGLEAFSHSAR----EEDDEAALKWAALEKLPTYDRLTRGLLVGSRGATSEVDVRN  75

Query  2904  IGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNVGAEAYVGKR  2725
             +G++E++ +L+RLIK  + DNE FLLKL++R++RV I++P VEVRFEHL VGAEAY+G R
Sbjct  76    LGFQERRLLLDRLIKAADEDNEKFLLKLRNRIDRVGINLPMVEVRFEHLTVGAEAYIGSR  135

Query  2724  ALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLL  2548
             +LP+  NF +NILEG L+Y++ LP+ KKH SIL+DVSGII+P R+TLLLGPPSSGKT+LL
Sbjct  136   SLPTFFNFTINILEGFLNYVHILPSKKKHISILQDVSGIIRPCRLTLLLGPPSSGKTTLL  195

Query  2547  LALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQG  2368
             LALAG+LD SL+ SG V+YNGH+MNEFVP RTAAYISQ D+HI E+T RETL FSARCQG
Sbjct  196   LALAGKLDASLKVSGSVTYNGHKMNEFVPQRTAAYISQDDVHIGELTVRETLEFSARCQG  255

Query  2367  VGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTI  2188
             +GSRYEML+ELSRREK ANI+PD DIDIFMKA +T+GQ+A +I DYI+KVLGLE C DT+
Sbjct  256   IGSRYEMLSELSRREKNANIKPDMDIDIFMKAVSTEGQEARIITDYILKVLGLEVCADTL  315

Query  2187  VGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHG  2008
             VG++ +RG+SGG++KR+T GEMLVGP N L MDEISTGLDSSTTFQI+ S++ Y+HIL G
Sbjct  316   VGDQLVRGISGGQKKRVTTGEMLVGPTNALFMDEISTGLDSSTTFQIVNSLRQYVHILDG  375

Query  2007  TAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERKGVADFLQE  1828
             TA+I+LLQPAPE YDLFDDIIL+S+G++VYQGP + VLEFFE +GF+CPERKGVADFLQE
Sbjct  376   TALISLLQPAPETYDLFDDIILLSDGKVVYQGPRDNVLEFFESVGFKCPERKGVADFLQE  435

Query  1827  VTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTT  1648
             VTS+KDQ QYW+R D +PYRFVT++EF+EAFQSFH+G+ L D+LA+PF KS SHPAALTT
Sbjct  436   VTSKKDQQQYWMRVD-EPYRFVTVSEFAEAFQSFHVGQRLKDDLASPFDKSKSHPAALTT  494

Query  1647  KTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGA  1468
             + YG    ELLK+C SRE+LLMKRN   +IF+V  +  MA I MT+F+RTNM R+S    
Sbjct  495   RKYGAGMEELLKACCSRELLLMKRNSFFYIFKVSQITTMAFIAMTIFLRTNMHRHSVEDG  554

Query  1467  QIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCI  1288
              +Y+ +LFFT T+IMF+ + E +  I++LP+FYKQR  LF+P W YA+P +IL+IPI+ +
Sbjct  555   YMYVGALFFTATLIMFNGMAENSMLIYKLPVFYKQRRALFFPPWVYALPMWILKIPISFV  614

Query  1287  EVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFI  1108
             EV VWVF TYYVIG+DPN GRL K ++LL++  Q+AS LFR    VGR M  +   G+F+
Sbjct  615   EVGVWVFITYYVIGFDPNIGRLFKQYLLLLLLNQMASGLFRLIGAVGRHMIVSNTFGAFV  674

Query  1107  MLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGV  928
             + +LFALGG +LSR +VKKWWIWGYW SPLMYAQNAI VNEF G SW  V+P ++E  GV
Sbjct  675   LFILFALGGVVLSRVNVKKWWIWGYWSSPLMYAQNAIIVNEFTGNSWKKVIPNTTESLGV  734

Query  927   LVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANISAESHSNEHD  748
              V+K RG  PEA  YW+GVGAL GFTI     + +AL  L PL + RA I  ES   ++D
Sbjct  735   AVMKARGFLPEAQMYWIGVGALFGFTILFNIGFIVALTYLNPLGRVRAVIPKESDDKQND  794

Query  747   VSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLE  568
                G   +    R +D M  RK GMILPFEP+SI+FN+I Y +DMPQEMK  G  +N+L 
Sbjct  795   KEMGEISHVNANREADQM--RKRGMILPFEPYSISFNEIVYSIDMPQEMKDRGFLENKLV  852

Query  567   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARI  388
             LLKGVSG FRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G ITISG+ KKQ+TF+RI
Sbjct  853   LLKGVSGTFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGTITISGYPKKQETFSRI  912

Query  387   SGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGL  208
             SGYCEQNDIHSPH+TV+ESL++SAWLRL  EV  ETRK+FI+EVMELVELT LR A+VGL
Sbjct  913   SGYCEQNDIHSPHVTVHESLLYSAWLRLAPEVDVETRKMFIEEVMELVELTPLRGALVGL  972

Query  207   PGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVC  28
             PGV GLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VC
Sbjct  973   PGVTGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC  1032

Query  27    TIHQPSIDI  1
             TIHQPSIDI
Sbjct  1033  TIHQPSIDI  1041


 Score =   134 bits (337),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 124/567 (22%), Positives = 255/567 (45%), Gaps = 72/567 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  853   LLKGVSGTFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGTITISGYPKKQETFSR  911

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P++D+   
Sbjct  912   ISGYCEQNDIHSPHVTVHESLLYSAW----------------------LRLAPEVDV---  946

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  947   ------ETRKMFIEEVMELVELTPLRGALVGLPGVTGLSTEQRKRLTIAVELVANPSIIF  1000

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1001  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLLKRGGEEIY  1059

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVT+   +M   I        F  +
Sbjct  1060  AGPLGRHSTQLIKYFEGIPGVSKIKDGYNPATWMLEVTASAQEMALGID-------FAQV  1112

Query  1755  NEFSEAFQSFHIGRNLGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLM  1582
              + SE ++     + L  EL+TP    K  + P   + + + +  M    +C  ++    
Sbjct  1113  YKNSELYRR---NKALISELSTPRPGMKEPNFPTRYS-QPFHIQCM----ACLWKQHWSY  1164

Query  1581  KRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSP------IGAQIYMSSLFFTLTVIMF  1420
              RN +       + + +A+   ++F     +RNS       IG+ +Y S LF  L +  +
Sbjct  1165  WRNPLYTAIRFLFTIFIAVSFGSMFWDLGSKRNSVQDIFNCIGS-MYASVLF--LGIQNY  1221

Query  1419  SALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYD  1240
              ++Q +        +FY++R    Y +  YAI    +  P    + +V+    Y ++G++
Sbjct  1222  VSVQPVVAV--ERTVFYRERAAGMYSSLPYAIAQVAIEFPYIFSQAAVYGSIVYVMMGFE  1279

Query  1239  PNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSR  1066
                 +    W +  ++  L+   F     V  +  +  + ++G+  +       GFI+ R
Sbjct  1280  RTAAKFF--WYIYFMYLTLSYFTFYGMMTVSVAPNHHISTIIGAGFISTWNLFSGFIVPR  1337

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNE  985
               +  WW W YW  P+ +    +A ++
Sbjct  1338  PKIPVWWRWYYWACPVAWTLYGLATSQ  1364



>gb|KDO58225.1| hypothetical protein CISIN_1g000540mg [Citrus sinensis]
Length=1433

 Score =  1412 bits (3654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1067 (65%), Positives = 841/1067 (79%), Gaps = 26/1067 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDG-FAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME N+    + +    S S W   + G F++SSR    ++DDE ALKWAA++K+PT++RL
Sbjct  1     MEGNNDIYMASTSLPRSISRWRTSSMGAFSRSSR----EEDDEEALKWAAIEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             KKGL+T  RGE FEVD++N+G +E+++++ +L+ VPE DNE FLLKLK+R+ERV ID+PK
Sbjct  57    KKGLLTTSRGEAFEVDVSNLGPQERQRLINKLVTVPEVDNEKFLLKLKNRIERVGIDLPK  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             VEVR+EHLN+ AEAY+  +ALPS T F  +I EG L+YL+ LP+ K+H +IL+DVSGIIK
Sbjct  117   VEVRYEHLNIEAEAYIASKALPSFTKFYTSIFEGFLNYLHILPSRKQHLTILKDVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             PGR+TLLLGPP+SGKT+LLLALAG+LD SL+ SGRV+YNGH M+EFVP RTAAYISQHD 
Sbjct  177   PGRLTLLLGPPASGKTTLLLALAGKLDSSLKVSGRVTYNGHNMDEFVPERTAAYISQHDN  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+RYEML EL+RREKAA I+PDPDID++MKA AT+GQ+AN
Sbjct  237   HIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEAN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             VI DY +KVLGL+ C DT+VG+E +RG+SGG+RKR+T GEM+VGPA  L MDEISTGLDS
Sbjct  297   VITDYYLKVLGLDVCADTVVGDEMIRGISGGQRKRVTTGEMMVGPALALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+   K  IHI  GTAVI+LLQPAPE Y+LFDDIIL+S GQIVYQGP   VLEFF
Sbjct  357   STTFQIVNCFKQNIHINCGTAVISLLQPAPETYNLFDDIILLSNGQIVYQGPRELVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CP+RKGVADFLQEVTS+KDQ QYW+ K+ +PYRFVT+ EF+E FQSFH+G+ + 
Sbjct  417   ESMGFKCPKRKGVADFLQEVTSKKDQKQYWVHKE-RPYRFVTVQEFTEGFQSFHVGQKIS  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DEL TPF KS SH AALTT+ YG  + ELLK+C SRE+LLMKRN  ++IF++  +  +AL
Sbjct  476   DELQTPFDKSKSHRAALTTEVYGAGRRELLKACISRELLLMKRNSFVYIFKLIQIASVAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             + MTLF RT M ++S     IY  +LFF   ++MF+   E++ TI +LP+FYKQRD  F+
Sbjct  536   VYMTLFFRTKMHKDSVTDGGIYAGALFFATVMVMFNGFSEISMTIAKLPVFYKQRDFRFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P WAYAIP++IL+IPI+ +EV+VWVF TYYVIG DPN GR  K + LL+   Q+AS LFR
Sbjct  596   PPWAYAIPSWILKIPISFLEVAVWVFLTYYVIGLDPNAGRFFKQYFLLLAANQMASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A  GR+M  A   GSF +LVLF+LGGF+LSR+D+KKWW W YW SPL YAQNAI  NE
Sbjct  656   LIAATGRNMVVANTFGSFALLVLFSLGGFVLSREDIKKWWKWAYWCSPLSYAQNAIVANE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG SW    P S E  GV VLK RG F  AYW+WLG+GAL GF +     +TLAL  L 
Sbjct  716   FLGHSWKKFTPNSIESLGVQVLKSRGFFAHAYWFWLGLGALFGFVLLFNLGFTLALTFLN  775

Query  804   PLAQSRANISAESHSNEHDVSNGG---------SDNSVGERVS----------DGMSNRK  682
              L + RA ++ ES SNE D + GG         S N + ER S          +G   +K
Sbjct  776   RLEKPRAILTEESESNEQDSTIGGTVQLSTHGESGNDIRERNSSSHSLTLTEAEGSHPKK  835

Query  681   HGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSG  502
              GM+LPFEPHS+ F+++ Y VDMPQ+MK++GV D++L LL GVSGAFRPGVLTALMGVSG
Sbjct  836   RGMVLPFEPHSLTFDEVVYSVDMPQQMKLQGVSDDKLVLLNGVSGAFRPGVLTALMGVSG  895

Query  501   AGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIF  322
             AGKTTLMDVLAGRKTGGYI G I +SG+ KKQ+TFARISGYCEQNDIHSP +TVYESL++
Sbjct  896   AGKTTLMDVLAGRKTGGYITGNIKVSGYPKKQETFARISGYCEQNDIHSPFVTVYESLLY  955

Query  321   SAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVA  142
             SAWLRLP E+  ETRK+FI EVMELVEL  L++++VGLPGV+GLST QRKRLTIAVELVA
Sbjct  956   SAWLRLPPEIDSETRKMFIGEVMELVELKPLKQSLVGLPGVSGLSTEQRKRLTIAVELVA  1015

Query  141   NPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             NPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1062


 Score =   130 bits (326),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 124/568 (22%), Positives = 247/568 (43%), Gaps = 72/568 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+       +G +  +G+   +    R
Sbjct  874   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-ITGNIKVSGYPKKQETFAR  932

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P+ID    
Sbjct  933   ISGYCEQNDIHSPFVTVYESLLYSAW----------------------LRLPPEID----  966

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + +  +++++ L+  + ++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  967   -----SETRKMFIGEVMELVELKPLKQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1021

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQI-VY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G   +Y
Sbjct  1022  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGYEIY  1080

Query  1917  QGP-----CNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTIN  1753
              GP     C+ V  +FE +    P  + + D     T        W+ + + P + V + 
Sbjct  1081  VGPLGRHSCHLV-SYFEAI----PGVEKIKDGYNPAT--------WMLEVSAPSQEVALG  1127

Query  1752  -EFSEAFQS---FHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVL  1588
              +FS+ ++    +   ++L ++L+ P   S   H AA     Y  S      +C  ++  
Sbjct  1128  VDFSDIYKRSELYRRNKSLIEDLSKPAPGSKDLHFAA----QYSQSAFTQFLACLWKQHW  1183

Query  1587  LMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQ  1408
                RN         +   +AL+  ++F     +          M S+F   T IMF  +Q
Sbjct  1184  SYWRNPAYTAVRFFFTTFIALLLGSIFWDLGGKTEKRQDLLNAMGSMF---TAIMFLGIQ  1240

Query  1407  ---ELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYD  1240
                 + P +     +FY+++    Y    +A+   ++ IP   ++  V+    Y ++ +D
Sbjct  1241  YCSSVQPIVSVERTVFYREKAAGMYSGIPWALAQVMIEIPYIFVQSLVYSSIVYAMMEFD  1300

Query  1239  PNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSR  1066
                 +    W +  ++  L    F     V  +  +  A +V +    +     GFI+ R
Sbjct  1301  WTAAKFF--WYIFFMYVTLLFFTFYGMLTVAITPNHHIAAIVSTLFYGIWNIFSGFIIPR  1358

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF  982
               +  WW W YW +P+ +    +  ++F
Sbjct  1359  PRIPVWWRWYYWANPIAWTLYGLIASQF  1386



>ref|XP_006450535.1| hypothetical protein CICLE_v10010431mg [Citrus clementina]
 gb|ESR63775.1| hypothetical protein CICLE_v10010431mg [Citrus clementina]
Length=1452

 Score =  1411 bits (3653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/1073 (66%), Positives = 849/1073 (79%), Gaps = 30/1073 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             M+   +  R  S R+ SSS+W N T D FA+SSR    DDD+  AL WAA++K+PT+ R+
Sbjct  1     MDAGQASFRISSARLGSSSIWRNNTLDVFARSSREDTYDDDE--ALTWAAIEKLPTYLRV  58

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++T   G+  EVDI N+G+ E++ ++ERL+K+ E DNE FLLKLK R+ERV +DIP 
Sbjct  59    QRGMLTADEGQAREVDIKNLGFIERRNLIERLLKIAEEDNEKFLLKLKVRIERVGLDIPT  118

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEHLNV AEAY+G RALP+V N C N+LEG L+YL+ LP+ KK  +IL DVSGIIK
Sbjct  119   IEVRFEHLNVEAEAYIGSRALPTVFNSCANMLEGFLNYLHVLPSRKKPLTILHDVSGIIK  178

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P R+ LLLGPPSSGKT+LLLALAG+L   L+FSGRV+YNGH M EFVP RT+AYISQ+DL
Sbjct  179   PRRLALLLGPPSSGKTTLLLALAGKLGKDLKFSGRVTYNGHGMEEFVPQRTSAYISQNDL  238

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG RYE+L ELSRREKAANI+PDPDID+ MKAA+ +GQ+ N
Sbjct  239   HIGEMTVRETLAFSARCQGVGPRYEVLQELSRREKAANIKPDPDIDLIMKAASLEGQEKN  298

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY++K+LGLE C DT+VG+E LRG+SGG+RKRLT GEMLVGPA  L MDEISTGLDS
Sbjct  299   VVTDYVLKILGLEVCADTMVGDEMLRGISGGQRKRLTTGEMLVGPARALFMDEISTGLDS  358

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STT+QI+ S++  IHIL+GTAVI+LLQPAPE Y+LFDD+IL+S+GQIVYQGP   VLEFF
Sbjct  359   STTYQIVNSLRQSIHILNGTAVISLLQPAPETYELFDDLILLSDGQIVYQGPRENVLEFF  418

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTSRKDQ QYW  KD +PY FVT  EFSE FQSFHIG+ LG
Sbjct  419   ERMGFKCPERKGVADFLQEVTSRKDQEQYWANKD-EPYSFVTAKEFSEVFQSFHIGQKLG  477

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELATPF KS SHPAALTTK YG SK ELLK+CF+RE LLMKRN  ++ F++  +   A 
Sbjct  478   DELATPFDKSKSHPAALTTKKYGASKKELLKACFAREYLLMKRNSFVYFFKMFQIFFSAS  537

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             + MTLF+RT M R++     IYM +LFF +  IMF+   EL+ TI +LP+FYKQRD LF+
Sbjct  538   VAMTLFLRTEMHRSTVEDGGIYMGALFFAVITIMFNGFSELSMTIMKLPVFYKQRDFLFF  597

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAY++PT+IL+IPIT IEV +WVF TYYV+G++ N  R +K + LL+   Q AS LFR
Sbjct  598   PAWAYSLPTWILKIPITFIEVGIWVFMTYYVVGFESNIERFVKQYFLLLCVNQTASGLFR  657

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                 +GR++  A   GSF  L +  LGGFILSRDDVKKWW+WGYW SP+MY QNA+AVNE
Sbjct  658   LMGALGRNIIVANTFGSFANLTVLVLGGFILSRDDVKKWWLWGYWFSPMMYGQNALAVNE  717

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLGKSW  V P S+EP GV++LK RGLFP AYWYW+GVGAL+G+ +   F++T+AL  L 
Sbjct  718   FLGKSWGHVPPNSTEPLGVVILKSRGLFPNAYWYWIGVGALLGYVLLFNFLFTVALKYLD  777

Query  804   PLAQSRANISAESHSNE------------------HDVSNGGSDN----SVGERV---SD  700
             P  + +A +S E+ + +                  +D  N    N    ++  RV   ++
Sbjct  778   PFGKPQAILSEEALAKKNACKTEEPVELSSGVQSSYDRGNESHRNVSFRTLSARVRSFNE  837

Query  699   GMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTA  520
                NRK GMILPFEPHSI F+DI+Y +DMPQEMK +G+ D+RLE LKGVSGAFRPGVLTA
Sbjct  838   ADQNRKRGMILPFEPHSITFDDIRYALDMPQEMKAQGIPDDRLEFLKGVSGAFRPGVLTA  897

Query  519   LMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTV  340
             LMGVSGAGKTTLMDVLAGRKTGGY+ G ITISG+ K Q+TFARISGYCEQ DIHSPH+TV
Sbjct  898   LMGVSGAGKTTLMDVLAGRKTGGYVSGSITISGYPKNQETFARISGYCEQTDIHSPHVTV  957

Query  339   YESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTI  160
             YESL++SAWLRLP EV  +TRK+F++EVMELVEL  +REA+VGLPGV+GLST QRKRLTI
Sbjct  958   YESLVYSAWLRLPPEVDSDTRKMFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTI  1017

Query  159   AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1018  AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1070


 Score =   147 bits (370),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 131/563 (23%), Positives = 254/563 (45%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
              L+ VSG  +PG +T L+G   +GKT+L+  LAG+       SG ++ +G+  N+    R
Sbjct  882   FLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-VSGSITISGYPKNQETFAR  940

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q D+H P +T  E+L +SA                       +R  P++D    
Sbjct  941   ISGYCEQTDIHSPHVTVYESLVYSAW----------------------LRLPPEVD----  974

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                +D +K  + V+ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  975   ---SDTRK--MFVEEVMELVELNPIREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1029

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G + +Y
Sbjct  1030  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLMKRGGEEIY  1088

Query  1917  QGP----CNCVLEFFECLGF--RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    C+ ++++FE +    +  E    A ++ EVT+   +    I        F  +
Sbjct  1089  VGPLGRHCSQLIKYFEGIDGVPKIKEGYNPATWMLEVTTPAQEAALGIN-------FAKV  1141

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              + SE ++     + +  EL+ P     S      T+ Y  S      +C  ++ L   R
Sbjct  1142  YKNSELYKG---NKEMIKELSIP--PPGSKNLYFQTR-YSQSFFTQCMACLWKQHLSYWR  1195

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R +       M S++  +  +       + P
Sbjct  1196  NPPYTAVRLFFTTFIALMFGTIFWDIGSKRANRQDLFNAMGSMYAAILFLGVQNATSVQP  1255

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              +     +FY++R    Y A  YA    ++ +P   I+  ++    Y +IG+D    + L
Sbjct  1256  VVAVERTVFYRERAAGMYSALPYAFGQVVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFL  1315

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W LL ++  L  + F    ++  ++T    + + I    + L     GFI+ R  +  
Sbjct  1316  --WYLLFMY--LTFLYFTLYGMMTVAVTPNHNIAAIIASAFYVLWNLFSGFIIPRPRMPI  1371

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W  WI P+ +    +  ++F
Sbjct  1372  WWRWYCWICPVSWTLYGLVASQF  1394



>ref|XP_009781738.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nicotiana 
sylvestris]
Length=1904

 Score =  1411 bits (3652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 682/1053 (65%), Positives = 850/1053 (81%), Gaps = 23/1053 (2%)
 Frame = -2

Query  3132  INDSRGRS------GSFRINSS-SLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVP  2977
             +N  RG S      GS R ++S S+W +NG + F++S+R    D+DDE ALKWAAL+K+P
Sbjct  6     LNGLRGSSMRGSMRGSLRASTSNSIWRNNGVEVFSRSAR----DEDDEEALKWAALEKLP  61

Query  2976  TFDRLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVA  2797
             TFDRL+KGL+ G +G   EVDIN++G +E+K +LERL+KV + DNE FLLKLK+R++RV 
Sbjct  62    TFDRLRKGLLFGSKGAAAEVDINDLGIQERKTLLERLVKVADEDNEKFLLKLKNRIDRVG  121

Query  2796  IDIPKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYLPTTKKHN-SILRDV  2620
             ID+P +EVR+EHLN+ A+AYVG RALP+  NF  N +E  L+ L++  +KK   +IL+DV
Sbjct  122   IDLPSIEVRYEHLNIEADAYVGSRALPTFINFMTNFVETFLNSLHILRSKKRQITILKDV  181

Query  2619  SGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYI  2440
             SG+IKP RMTLLLGPPSSGKT+LLLALAG+LD +L+ +G+V+YNGHE++EFVP RTA YI
Sbjct  182   SGMIKPCRMTLLLGPPSSGKTTLLLALAGKLDSALKVTGKVTYNGHELHEFVPQRTAVYI  241

Query  2439  SQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATD  2260
             SQHDLHI EMT RETL FSARCQGVGSRYEMLAELSRREKAANI+PDPDID++MKA+AT+
Sbjct  242   SQHDLHIGEMTVRETLEFSARCQGVGSRYEMLAELSRREKAANIKPDPDIDVYMKASATE  301

Query  2259  GQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEIS  2080
             GQ+ANV+ DY++K+LGL+ C DT+VG+E +RG+SGG++KR+T GEMLVGPA  L MDEIS
Sbjct  302   GQEANVVTDYVLKILGLDICADTMVGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEIS  361

Query  2079  TGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNC  1900
             TGLDSSTTF I+ S++  + +L GTAVI+LLQPAPE Y+LFDDIIL+S+G IVYQGP   
Sbjct  362   TGLDSSTTFSIVNSLRQSVQLLKGTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPREA  421

Query  1899  VLEFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHI  1720
             VL+FFE +GF+CPERKGVADFLQEVTS+KDQ QYW +KD +PYRF+T  EF+EA+QSFH+
Sbjct  422   VLDFFESMGFKCPERKGVADFLQEVTSKKDQQQYWAKKD-EPYRFITSKEFAEAYQSFHV  480

Query  1719  GRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWV  1540
             GR LGDELA P+ KS SHPAAL+T+ YG+   +LLK C  RE LLMKRN  ++IF++  +
Sbjct  481   GRKLGDELAIPYDKSKSHPAALSTQKYGIGTKQLLKVCAEREYLLMKRNSFVYIFKLSQL  540

Query  1539  VLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQR  1360
              +MALITMT+F RT M R+      IY  +LFF + +IMF+ + E+A TIF+LP+++K R
Sbjct  541   AIMALITMTVFFRTKMPRDDMDDGGIYAGALFFVVVMIMFNGMAEIALTIFKLPVYFKHR  600

Query  1359  DLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLA  1180
             DLLF+P+WAYA+PT+IL+IP+T +EV +W F TYYV+G+DPN  RL K +++LI+  Q+A
Sbjct  601   DLLFFPSWAYALPTWILKIPVTFVEVGLWTFLTYYVMGFDPNVSRLFKQFLILILVHQMA  660

Query  1179  SVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNA  1000
             S LFR    VGR+M  A   G+F +L+ FALGGFIL+R+DVKKWWIWGYW SPLMY+ N+
Sbjct  661   SALFRFIGAVGRTMGVASTFGAFALLLQFALGGFILAREDVKKWWIWGYWTSPLMYSVNS  720

Query  999   IAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLA  820
             I VNEF GK+W  +    +EP G  V++ RG FP+AYWYW+GVGAL+GFT+     Y+++
Sbjct  721   ILVNEFDGKNWKHIAQGGTEPLGAAVIRARGFFPDAYWYWIGVGALVGFTMVFNLFYSIS  780

Query  819   LAKLRPLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSIAF  640
             LA L P  + +A IS +S +   D S G    + GE       N+K GM+LPFEPHSI F
Sbjct  781   LAYLNPFGKPQAMISEDSEN--ADSSEGVDSVTEGE-------NKKRGMVLPFEPHSITF  831

Query  639   NDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  460
             +D+ Y VDMP EMK +G  D+RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK
Sbjct  832   DDVVYSVDMPPEMKEQGSTDDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRK  891

Query  459   TGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCET  280
             TGGYI+G I ISG+ KKQ+TFARISGYCEQNDIHSP++TVYESL++SAWLRLP +V    
Sbjct  892   TGGYIDGSIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVDENK  951

Query  279   RKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGL  100
             +K+F++EVMELVELT LR A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGL
Sbjct  952   KKMFVEEVMELVELTPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGL  1011

Query  99    DARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DARAAAIVMR VRN VDTGRT+VCTIHQPSIDI
Sbjct  1012  DARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDI  1044


 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/899 (46%), Positives = 566/899 (63%), Gaps = 90/899 (10%)
 Frame = -2

Query  2655  TTKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEM  2476
             +T     +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+  
Sbjct  849   STDDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPK  907

Query  2475  NEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDP  2296
              +    R + Y  Q+D+H P +T  E+L +SA                       +R   
Sbjct  908   KQETFARISGYCEQNDIHSPYVTVYESLVYSAW----------------------LRLPQ  945

Query  2295  DIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLV  2116
             D+D           K  + V+ +++++ L      +VG   + G+S  +RKRLT    LV
Sbjct  946   DVD---------ENKKKMFVEEVMELVELTPLRSALVGLPGVNGLSTEQRKRLTIAVELV  996

Query  2115  GPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILIS  1936
                +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+ 
Sbjct  997   ANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMK  1055

Query  1935  EG-QIVYQGPC---NC-VLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNK  1777
              G Q +Y GP    +C ++++FE +    +  E    A ++ EVT+   +M         
Sbjct  1056  RGGQEIYVGPLGRHSCHLIKYFESMPGVSKIKEAYNPATWMLEVTASSQEMM--------  1107

Query  1776  PYRFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHP--AALTTKTYGVSKMELLKSCF  1603
                                   LG + A  ++KS  +    AL  +   +S +   +S F
Sbjct  1108  ----------------------LGVDFADLYKKSDLYKRNKALIVE---LSTLTRKRSMF  1142

Query  1602  SREVLLMKRNCVLHIFEVGWVVLMALIT-----MTLFIRTNMQRNSPIGAQIYMSSLFFT  1438
               EV+ +     L    VG   +  L T     +T+ +   M R+      IY  +LFF 
Sbjct  1143  VEEVMELVELTPLRSALVGLPGVNGLSTEQRKRLTIAVEL-MPRDDMDDGGIYAGALFFV  1201

Query  1437  LTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTY  1258
             + +IMF+ + E+A TIF+LP+++K RDLLF+P+WAYA+PT+IL+IP+T +EV +W F TY
Sbjct  1202  VVMIMFNGMAEIALTIFKLPVYFKHRDLLFFPSWAYALPTWILKIPVTFVEVGLWTFLTY  1261

Query  1257  YVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGF  1078
             YV+G+DPN  RL K +++LI+  Q+AS LFR    VGR+M  A   G+F +L+ FALGGF
Sbjct  1262  YVMGFDPNVSRLFKQFLILILVHQMASALFRFIGAVGRTMGVASTFGAFALLLQFALGGF  1321

Query  1077  ILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFP  898
             IL+R+DVKKWWIWGYW SPLMY+ N+I VNEF GK+W  +    +EP G  V++ RG FP
Sbjct  1322  ILAREDVKKWWIWGYWTSPLMYSVNSILVNEFDGKNWKHIAQGGTEPLGAAVIRARGFFP  1381

Query  897   EAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANISAESHSNEHDVSNGGSDNSV  718
             +AYWYW+GVGAL+GFT+     Y+++LA L P  + +A IS +S +   D S G    + 
Sbjct  1382  DAYWYWIGVGALVGFTMVFNLFYSISLAYLNPFGKPQAMISEDSEN--ADSSEGVDSVTE  1439

Query  717   GERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFR  538
             GE       N+K GM+LPFEPHSI F+D+ Y VDMP EMK +G  D+RL LLKGVSGAFR
Sbjct  1440  GE-------NKKRGMVLPFEPHSITFDDVVYSVDMPPEMKEQGSTDDRLVLLKGVSGAFR  1492

Query  537   PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIH  358
             PGVLTALMGVSGAGKTTLMDVLAGRKT GYI+G I ISG+ KKQ+TFARISGYCEQNDIH
Sbjct  1493  PGVLTALMGVSGAGKTTLMDVLAGRKTRGYIDGSIKISGYPKKQETFARISGYCEQNDIH  1552

Query  357   SPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQ  178
             SP++TVYESL++SAWLRLP +V    +K+F++EVMELVELT LR A+VGLPGVNGLST Q
Sbjct  1553  SPYVTVYESLVYSAWLRLPQDVDENKKKMFVEEVMELVELTPLRSALVGLPGVNGLSTEQ  1612

Query  177   RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMR VRN VDTGRT+VCTIHQPSIDI
Sbjct  1613  RKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDI  1671


 Score = 85.9 bits (211),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/244 (25%), Positives = 116/244 (48%), Gaps = 33/244 (14%)
 Frame = -2

Query  2655  TTKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEM  2476
             +T     +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+  
Sbjct  1476  STDDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTRGY-IDGSIKISGYPK  1534

Query  2475  NEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDP  2296
              +    R + Y  Q+D+H P +T  E+L +SA                       +R   
Sbjct  1535  KQETFARISGYCEQNDIHSPYVTVYESLVYSAW----------------------LRLPQ  1572

Query  2295  DIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLV  2116
             D+D           K  + V+ +++++ L      +VG   + G+S  +RKRLT    LV
Sbjct  1573  DVD---------ENKKKMFVEEVMELVELTPLRSALVGLPGVNGLSTEQRKRLTIAVELV  1623

Query  2115  GPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILIS  1936
                +++ MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+ +  +
Sbjct  1624  ANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGR-TVVCTIHQPSIDIFEAFDEDLFNA  1682

Query  1935  EGQI  1924
              G +
Sbjct  1683  MGSM  1686



>ref|XP_009589545.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nicotiana 
tomentosiformis]
Length=1452

 Score =  1410 bits (3651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1076 (65%), Positives = 855/1076 (79%), Gaps = 36/1076 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  +   R  S R++SS++W N   D F++SSR    + DDE ALKWAAL+K+PT+ R+
Sbjct  1     MEGGEDSFRVSSARLSSSNVWRNSAMDVFSRSSR----EADDEEALKWAALEKLPTYLRI  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             ++G++T   G++ EVDI  +   E++ +LERL+K+ + DNE FLLKLK R+ RV +D+P 
Sbjct  57    RRGILTEEEGQSREVDITKLDLVERRNLLERLVKIADEDNEKFLLKLKKRIARVGLDLPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             +EVRFEH++V AEA VG RALP++ NF +NILE  L+YL+ LP+ KK   IL +VSGIIK
Sbjct  117   IEVRFEHVSVDAEARVGSRALPTIFNFTVNILEDFLNYLHILPSRKKPLPILHEVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             PGRMTLLLGPPSSGKT+LLLALAG+LD  L+ SGRV+YNGH M+EFVP R++AYISQ+DL
Sbjct  177   PGRMTLLLGPPSSGKTTLLLALAGKLDKDLKVSGRVTYNGHGMDEFVPQRSSAYISQNDL  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG++YE+LAELSRREK ANI+PDPD+DIFMK+A  +GQ+AN
Sbjct  237   HIGEMTVRETLAFSARCQGVGAKYEILAELSRREKGANIKPDPDVDIFMKSAWNEGQEAN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             V+ DY +K+LGLE C DT+VG+E +RG+SGG+RKRLT GEM+VGPA  L MDEISTGLDS
Sbjct  297   VVTDYTLKILGLEICADTLVGDEMIRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STT+QI+ SI+  IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFF
Sbjct  357   STTYQIVNSIRQSIHILQGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF CPERKGVADFLQEVTSRKDQ QYW R+D +PY+++T+ EFSE+FQSFHIGR LG
Sbjct  417   EYMGFMCPERKGVADFLQEVTSRKDQEQYWARRD-EPYKYITVREFSESFQSFHIGRKLG  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DELA PF KS SHPAALTTK YG+SK ELLK+C +RE LLMKRN  ++IF++  + LMA 
Sbjct  476   DELAVPFDKSKSHPAALTTKNYGISKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMAS  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             ITMTLF+RT M RN+     +++ +LF+ + +IMF+   ELA +I +LP FYKQRDLLF+
Sbjct  536   ITMTLFLRTEMHRNTTTDGAVFLGALFYAVIMIMFNGFSELALSIMKLPSFYKQRDLLFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             PAWAYA+PT+IL+IP+T +EV++WV  TYYVIG++ + GR  K   LLI   Q+AS LFR
Sbjct  596   PAWAYALPTWILKIPVTLVEVAIWVCMTYYVIGFEADVGRFFKQLFLLICVNQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
                 +GR++  A   GS  +L +  +GGFILSRDDVKKWWIWGYWISP+MYAQNAIAVNE
Sbjct  656   FIGALGRNVIVANTFGSCALLTVLVMGGFILSRDDVKKWWIWGYWISPMMYAQNAIAVNE  715

Query  984   FLGKSWNTVLPFS--SEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAK  811
             FLGKSW  V P S  +E  GV  LK RG+FPEA WYW+G GAL+G+ +   F++T+ALA 
Sbjct  716   FLGKSWAHVPPNSTGTETLGVSFLKSRGIFPEARWYWIGAGALLGYVLLFNFMFTVALAY  775

Query  810   LRPLAQSRANISAESHSNEHDVSNGGS-------DNSVGER-------------------  709
             L P  +S+A +S E+ + E + S  G        +    ER                   
Sbjct  776   LNPFGKSQAVLSEETVA-ERNASKRGEVIELSPIEKRSSERGNDVRRSASSRSMSSRVGS  834

Query  708   VSDGMSNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGV  529
             +++   N++ GMILPFEP SI F+DI+Y VDMPQEMK +GV ++RLELLKGVSGAFRPGV
Sbjct  835   ITEADLNKRRGMILPFEPLSITFDDIRYAVDMPQEMKAQGVAEDRLELLKGVSGAFRPGV  894

Query  528   LTALMGVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPH  349
             LTALMGVSGAGKTTLMDVLAGRKTGGYI+G I+ISG+ K+Q+TFARI+GYCEQ DIHSPH
Sbjct  895   LTALMGVSGAGKTTLMDVLAGRKTGGYIDGTISISGYPKQQETFARIAGYCEQTDIHSPH  954

Query  348   LTVYESLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKR  169
             +TVYESL FSA LRLP EV  ETRK+F++EVMELVELT LREA+VGLPGVNGLST QRKR
Sbjct  955   VTVYESLQFSALLRLPREVDTETRKMFVEEVMELVELTPLREALVGLPGVNGLSTEQRKR  1014

Query  168   LTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             LT+AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1015  LTVAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1070


 Score =   139 bits (349),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 126/563 (22%), Positives = 245/563 (44%), Gaps = 62/563 (11%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +S +G+   +    R
Sbjct  882   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGTISISGYPKQQETFAR  940

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              A Y  Q D+H P +T  E+L FSA           L  L R                  
Sbjct  941   IAGYCEQTDIHSPHVTVYESLQFSA-----------LLRLPRE-----------------  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                 D +   + V+ +++++ L    + +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   ---VDTETRKMFVEEVMELVELTPLREALVGLPGVNGLSTEQRKRLTVAVELVANPSIIF  1029

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  G + +Y
Sbjct  1030  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKRGGEEIY  1088

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ E+TS   +            R +  
Sbjct  1089  VGPLGRHSSHLIKYFEGIDGVPKIKDGYNPATWMLEITSVAQEAA----------RVIDF  1138

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              E  +  + +   + L  EL+ P     S      TK Y  S     K+CF ++     R
Sbjct  1139  TELYKNSELYRRNKALIKELSVP--APCSKDLYFPTK-YSQSFFTQCKACFWKQHWSYWR  1195

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAP  1396
             N       + +   +AL+  T+F     +R         + S++  +  +       + P
Sbjct  1196  NPPYTAVRLMFTFFIALMFGTIFWDLGSRRKRQQDLLNAIGSMYAAVLFLGVQNATSVQP  1255

Query  1395  TI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLL  1219
              I     +FY++R    Y A  YA    ++ +P   I+  ++    Y +IG++    +  
Sbjct  1256  VIAIERTVFYRERAAGMYSALPYAFGQVMIELPYLFIQTIIYGVIVYVMIGFEWTVAKFF  1315

Query  1218  KMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDDVKK  1051
               W L  ++  L  + F    ++  ++T    + + I    +A+     GF++ +  +  
Sbjct  1316  --WYLFFMYFTL--LYFTLYGMMTVAVTPNHSIAAIISSAFYAIWNLFCGFVVPKTRMPV  1371

Query  1050  WWIWGYWISPLMYAQNAIAVNEF  982
             WW W Y+I P+ +    +  ++F
Sbjct  1372  WWRWYYYICPVSWTLYGLIASQF  1394



>gb|KEH28743.1| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1437

 Score =  1410 bits (3651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/1045 (67%), Positives = 857/1045 (82%), Gaps = 16/1045 (2%)
 Frame = -2

Query  3105  SFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRGE  2929
             S R +S++ W NGT + FAKSSRR  E+DDDE ALKWAAL+K+PT++RL+KGL+   RG 
Sbjct  16    SMRSSSTTGWRNGTMEAFAKSSRR--EEDDDEEALKWAALEKLPTYNRLRKGLLATSRGV  73

Query  2928  TFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNVG  2749
               EVDI ++G++EK+K+L+RLI V E  NE FLLKLK+R++RV I+IP +EVR+EHLNV 
Sbjct  74    ANEVDITDLGFQEKQKLLDRLINVAEEGNEKFLLKLKERIDRVGIEIPAIEVRYEHLNVE  133

Query  2748  AEAYVGKRALPSVTNFCLNILEGLLSYLYLPTT-KKHNSILRDVSGIIKPGRMTLLLGPP  2572
             AEA+VG RALP++ N   N +E +L  L++ T+ KK  +IL+DVSGI+KP RMTLLLGPP
Sbjct  134   AEAFVGGRALPTLLNSVTNTVESILISLHILTSRKKQMTILKDVSGIVKPRRMTLLLGPP  193

Query  2571  SSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETL  2392
             SSGKT+LLLAL+G+LDP+L+ SGRV+YNGH M+EFVP RTAAYISQHD+HI EMT RETL
Sbjct  194   SSGKTTLLLALSGKLDPNLKVSGRVTYNGHGMDEFVPQRTAAYISQHDVHIGEMTVRETL  253

Query  2391  AFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLG  2212
             AFSARCQGVGSRY++LAELSRREK ANI+PDPD+D+FMKA AT GQ+ +V  DY++K+LG
Sbjct  254   AFSARCQGVGSRYDLLAELSRREKEANIKPDPDVDVFMKAMATGGQQESVATDYVLKLLG  313

Query  2211  LEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIK  2032
             L+ C DT+VGNE LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDSSTTFQI++S++
Sbjct  314   LDVCADTMVGNEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSSTTFQIVRSLQ  373

Query  2031  HYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERK  1852
              Y+HIL+GT VI+LLQPAPE Y+LFDDIILIS+GQIVYQGP   +LEFFE +GF+CPERK
Sbjct  374   QYVHILNGTTVISLLQPAPETYELFDDIILISDGQIVYQGPREHILEFFESVGFKCPERK  433

Query  1851  GVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKST  1672
             G ADFLQEVTS+KDQ QYW+ ++ KPYRFVT+ +F+EAFQS+H+GR  GDELA PF KS 
Sbjct  434   GAADFLQEVTSKKDQEQYWVDRE-KPYRFVTVTQFAEAFQSYHVGRKTGDELAIPFDKSK  492

Query  1671  SHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNM  1492
             +HPAALTTK YGV+K ELLK+ FSRE LLMKRN  ++IF++  ++LMA I MTLF+RT M
Sbjct  493   NHPAALTTKKYGVNKKELLKANFSREYLLMKRNSFVYIFKICQLLLMATIAMTLFLRTEM  552

Query  1491  QRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFI  1312
              R+S  G  +Y  +LFF + +IMF+ + EL+ TI +LP FYKQRDLLF+P+WAYAIPT+I
Sbjct  553   HRDSLNGGGVYSGALFFAVVMIMFNGMAELSMTIAKLPSFYKQRDLLFFPSWAYAIPTWI  612

Query  1311  LRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN  1132
             L+IPIT +EV+ WVF TYYVIG+DPN  RLLK ++LL++  Q+AS LFR+ A +GR+M  
Sbjct  613   LKIPITFLEVAAWVFLTYYVIGFDPNVTRLLKQYLLLLLINQMASGLFRAIAALGRNMIV  672

Query  1131  AFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNTVLP  952
             A   GSF +L L  LGGF++SR D+K WWIWGYWISPLMY QNAI VNEFLG SWN   P
Sbjct  673   ANTFGSFALLALLTLGGFVMSRKDIKSWWIWGYWISPLMYGQNAIMVNEFLGDSWNHFTP  732

Query  951   FSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANISA  772
              S++  G+ VL+ RG F EAYWYW+G+GAL GF      ++T+AL  L P  + +A I+ 
Sbjct  733   NSNKTLGIQVLESRGFFTEAYWYWIGIGALTGFMFLFNILFTVALTYLDPFDKPQATINE  792

Query  771   ESHSNEHDVSNGGSD--------NSVGERVSDGMSNRKHGMILPFEPHSIAFNDIKYCVD  616
             ES   E   +NG +         +S G   +D     + GM+LPFEPHSIAF+D+ Y VD
Sbjct  793   ES---EDSTTNGTTQEVELPRIASSGGSNGADPSQRERRGMVLPFEPHSIAFDDVVYSVD  849

Query  615   MPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGE  436
             MPQEMK++GV ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYI+G 
Sbjct  850   MPQEMKVQGVLEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIDGS  909

Query  435   ITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTCETRKLFIKEV  256
             I ISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLP++V   TRK+FI+EV
Sbjct  910   IKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLVYSAWLRLPADVDSNTRKMFIEEV  969

Query  255   MELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIV  76
             MELVEL  LR ++VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIV
Sbjct  970   MELVELNPLRNSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIV  1029

Query  75    MRTVRNIVDTGRTIVCTIHQPSIDI  1
             MRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1030  MRTVRNTVDTGRTVVCTIHQPSIDI  1054


 Score =   134 bits (336),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 125/568 (22%), Positives = 245/568 (43%), Gaps = 72/568 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  866   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGSIKISGYPKKQETFAR  924

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+D    
Sbjct  925   ISGYCEQNDIHSPHVTVYESLVYSAW----------------------LRLPADVD----  958

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                       + ++ +++++ L    +++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  959   -----SNTRKMFIEEVMELVELNPLRNSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1013

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G + +Y
Sbjct  1014  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGEEIY  1072

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP     + ++++FE +      + G   A ++ EV+S   ++   I            
Sbjct  1073  VGPLGRHSSQLIKYFESIEGVSKIKDGYNPATWMLEVSSSAQELTLGI------------  1120

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLL  1585
              +F  A+++   +   + L +EL  P   S        +  Y  S +    +C  ++   
Sbjct  1121  -DFHHAYKNSELYRRNKQLIEELGKPAPGSND---LYFSAQYSQSFLVQCLACLWKQHWS  1176

Query  1584  MKRNCVLHIFEVGWVVLMALITMTLFI---RTNMQRNSPIGAQIYMSSLFFTLTVIMFSA  1414
               RN         + V + L+  T+F    R   +R     A   M +    L V   SA
Sbjct  1177  YWRNPPYTSVRFFFTVFIGLMFGTIFWDLGRKYSKRQDLFNALGSMYTAVLFLGVQNSSA  1236

Query  1413  LQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPN  1234
             +Q +        +FY++R    Y A  YA    ++ +P   ++ + +    Y +IG++  
Sbjct  1237  VQPVVAV--ERSVFYRERAAGMYSALPYAFAQVLIELPYIFVQAASYGVIVYAMIGFEWT  1294

Query  1233  FGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSR  1066
               + L  W +  ++  L    F     V  ++T    V S +    +A+     GFI+ R
Sbjct  1295  VAKFL--WYIFFMYCTLCYFTFYGMMAV--AITPNHHVASIVAAAFYAIWNLFSGFIVPR  1350

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF  982
               +  WW W YW  P+ +    +  ++F
Sbjct  1351  PMIPVWWRWYYWGCPVSWTLYGLIASQF  1378



>gb|KCW53776.1| hypothetical protein EUGRSUZ_J03025 [Eucalyptus grandis]
Length=1151

 Score =  1410 bits (3650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/1071 (65%), Positives = 846/1071 (79%), Gaps = 30/1071 (3%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGT---DGFAKSSRRLQEDDDDEAALKWAALQKVPTFD  2968
             ME  +  G S S R  SS+   N     D F++SSR    D+DDE AL WAAL+K+PTFD
Sbjct  1     MEGGNIYGASNSLRAVSSTTRRNRATTMDVFSRSSR----DEDDEEALTWAALEKLPTFD  56

Query  2967  RLKKG-LMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAID  2791
             RL+KG LM    G  +EVDI N+G+ EKK+++ER+++V E DNE FLLKL++R++RV ID
Sbjct  57    RLRKGILMASHGGGAYEVDIQNLGFHEKKRLMERIVRVAEEDNEKFLLKLRNRIDRVGID  116

Query  2790  IPKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSG  2614
             I  +EVRFEHLNV A+A    RALP+  N   +IL+G L++L  LP+ KKH +IL+D+SG
Sbjct  117   IATIEVRFEHLNVEADALAASRALPTFINIWTDILQGFLNFLPLLPSRKKHVTILQDISG  176

Query  2613  IIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQ  2434
             IIKPGRMTLLLGPPSSGKT+LLLALAG+LD  L+ +GRV+YNGH++NEFVP RTAA+ISQ
Sbjct  177   IIKPGRMTLLLGPPSSGKTTLLLALAGKLDSKLKTTGRVTYNGHDLNEFVPQRTAAFISQ  236

Query  2433  HDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQ  2254
             HDLHI EMT RETLAFSARCQGVGSRY++L+EL RREKAANI+PD DIDIFMKAAA +GQ
Sbjct  237   HDLHIGEMTVRETLAFSARCQGVGSRYDLLSELLRREKAANIKPDLDIDIFMKAAAAEGQ  296

Query  2253  KANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTG  2074
             +ANVI DYI+K+LGLE C DT+VG+E LRG+SGG+RKR+T GEMLVGP+N   MDEIS G
Sbjct  297   EANVITDYILKILGLEICADTMVGDEMLRGISGGQRKRVTTGEMLVGPSNAFFMDEISNG  356

Query  2073  LDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVL  1894
             LDSSTT QI+ S+K ++HIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGPC  VL
Sbjct  357   LDSSTTSQIVNSLKQFVHILDGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPCELVL  416

Query  1893  EFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGR  1714
              FFE +GF+CPERKGVADFLQEVTSRKDQ QYW+RKD +PY FVT+ EF+EAFQSF++GR
Sbjct  417   GFFESMGFKCPERKGVADFLQEVTSRKDQHQYWVRKD-EPYSFVTVREFAEAFQSFYVGR  475

Query  1713  NLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVL  1534
              LGDEL+ PF KS +HPAALTTK +GV    LLK+C SRE LLMKRN  ++IF++  + L
Sbjct  476   KLGDELSIPFDKSKNHPAALTTKKFGVGMNNLLKACISREFLLMKRNSFVYIFKITLLTL  535

Query  1533  MALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDL  1354
             +A + MTLF+RT M R++     IY+ + FFTLT++MF  + E++ T+ +LP+FYKQRDL
Sbjct  536   LAFVAMTLFLRTKMHRDTVTDGGIYIGAFFFTLTIMMFIGMAEISMTVAKLPVFYKQRDL  595

Query  1353  LFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASV  1174
             LFYP WAYA+PT+IL+IPIT +EV+VWVF TYYVIGYDPN GRL K ++LL++  Q+AS 
Sbjct  596   LFYPTWAYALPTWILKIPITFVEVAVWVFITYYVIGYDPNVGRLFKQYLLLVLVSQMASG  655

Query  1173  LFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIA  994
             LFR  A +GR+   A   GSF +  L+ALGGF+LSR+D+KKWWIWGYWISPLMY QNAI 
Sbjct  656   LFRLIAALGRNQIIASTFGSFALFTLYALGGFVLSREDIKKWWIWGYWISPLMYGQNAIV  715

Query  993   VNEFLGKSWNTVLPFSS--EPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLA  820
             VNE LG SW+ + P SS  E  G+ VLK RGLF EAYWYW+GVGAL GF I   F + +A
Sbjct  716   VNELLGSSWDKIPPISSSNESLGIQVLKARGLFTEAYWYWIGVGALFGFIILFNFGFVVA  775

Query  819   LAKLRPLAQSRANISAESHSNEHDVSNGG-----SDNSVGERVSDGM-------------  694
             LA L     S+   S E   N+     GG     S  S  +  S                
Sbjct  776   LALLNSFGNSQTAKSEELEGNDDANKMGGLIQLQSQGSSHKNGSGRSSRSRRARFETAIA  835

Query  693   SNRKHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALM  514
             +N K GM+L FEP+SI+F+++ Y +DMP+EMK +GV +++L LL+ VSGAFRPGVLTALM
Sbjct  836   ANGKRGMVLSFEPYSISFDELTYSIDMPKEMKNQGVLEDKLVLLQDVSGAFRPGVLTALM  895

Query  513   GVSGAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYE  334
             GVSGAGKTT+MDVLAGRKTGGYI+G+I ISG+ K Q TFARISGYCEQNDIHSPHLTV+E
Sbjct  896   GVSGAGKTTMMDVLAGRKTGGYIKGDIKISGYPKDQDTFARISGYCEQNDIHSPHLTVHE  955

Query  333   SLIFSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAV  154
             SL++SAWLRLP ++   TR++FI+EVMELVEL  LR+A+VGLPGV+GLST QRKRLTIA+
Sbjct  956   SLLYSAWLRLPPDMDDRTREMFIEEVMELVELNPLRQALVGLPGVDGLSTEQRKRLTIAI  1015

Query  153   ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ELVANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  ELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1066


 Score = 99.4 bits (246),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 142/284 (50%), Gaps = 40/284 (14%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+DVSG  +PG +T L+G   +GKT+++  LAG+        G +  +G+  ++    R
Sbjct  878   LLQDVSGAFRPGVLTALMGVSGAGKTTMMDVLAGRKTGGY-IKGDIKISGYPKDQDTFAR  936

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  PD+D    
Sbjct  937   ISGYCEQNDIHSPHLTVHESLLYSAW----------------------LRLPPDMD----  970

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  971   -----DRTREMFIEEVMELVELNPLRQALVGLPGVDGLSTEQRKRLTIAIELVANPSIIF  1025

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE-GQIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+   GQ +Y
Sbjct  1026  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1084

Query  1917  QGP----CNCVLEFFECL-GFR-CPERKGVADFLQEVTSRKDQM  1804
              GP     + ++++FE + G R   +    A ++ EVTS   ++
Sbjct  1085  VGPLGHQSSHLIKYFEGIQGVRQIKDGHNPATWMLEVTSPAQEL  1128



>ref|XP_006465418.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus 
sinensis]
Length=1444

 Score =  1410 bits (3650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/1067 (65%), Positives = 841/1067 (79%), Gaps = 26/1067 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLWSNGTDG-FAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME N+    + +    S S W   + G F++SSR    ++DDE ALKWAA++K+PT++RL
Sbjct  1     MEGNNDIYMASTSLPRSISRWRTSSMGAFSRSSR----EEDDEEALKWAAIEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             KKGL+T  RGE FEVD++N+G +E+++++ +L+ VPE DNE FLLKLK+R+ERV ID+PK
Sbjct  57    KKGLLTTSRGEAFEVDVSNLGPQERQRLINKLVTVPEVDNEKFLLKLKNRIERVGIDLPK  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIK  2605
             VEVR+EHLN+ AEAY+  +ALPS T F  +I EG L+YL+ LP+ K+H +IL+DVSG IK
Sbjct  117   VEVRYEHLNIEAEAYIASKALPSFTKFYTSIFEGFLNYLHILPSRKQHLTILKDVSGFIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             PGR+TLLLGPP+SGKT+LLLALAG+LD SL+ SGRV+YNGH M+EFVP RTAAYISQHD 
Sbjct  177   PGRLTLLLGPPASGKTTLLLALAGKLDSSLKVSGRVTYNGHNMDEFVPERTAAYISQHDN  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVG+RYEML EL+RREKAA I+PDPDID++MKA AT+GQ+AN
Sbjct  237   HIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEAN  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             VI DY +KVLGL+ C DT+VG+E +RG+SGG+RKR+T GEM+VGPA  L MDEISTGLDS
Sbjct  297   VITDYYLKVLGLDVCADTVVGDEMIRGISGGQRKRVTTGEMMVGPALALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+   K  IHI  GTAVI+LLQPAPE Y+LFDDIIL+S+GQIVYQGP   VLEFF
Sbjct  357   STTFQIVNCFKQNIHINCGTAVISLLQPAPETYNLFDDIILLSDGQIVYQGPRELVLEFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CP+RKGVADFLQEVTS+KDQ QYW+ K+ +PYRFVT+ EF+E FQSFH+G+ + 
Sbjct  417   ESMGFKCPKRKGVADFLQEVTSKKDQKQYWVHKE-RPYRFVTVQEFTEGFQSFHVGQKIS  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             DEL TPF KS SH AALTT+ YG  + ELLK+C SRE+LLMKRN  ++IF++  +  +AL
Sbjct  476   DELQTPFDKSKSHRAALTTEVYGAGRRELLKACISRELLLMKRNSFVYIFKLIQIASVAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             + MTLF RT M ++S     IY  +LFF   ++MF+   E++ TI +LP+FYKQRD  F+
Sbjct  536   VYMTLFFRTKMHKDSVTDGGIYAGALFFATVMVMFNGFSEISMTIAKLPVFYKQRDFRFF  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P WAYAIP++IL+IPI+ +EV+VWVF TYYVIG DPN GR  K + LL+   Q+AS LFR
Sbjct  596   PPWAYAIPSWILKIPISFLEVAVWVFLTYYVIGLDPNAGRFFKQYFLLLAANQMASALFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
               A  GR+M  A   GSF +LVLF+LGGF+LSR+D+KKWW W YW SPL YAQNAI  NE
Sbjct  656   LIAATGRNMVVANTFGSFALLVLFSLGGFVLSREDIKKWWKWAYWCSPLSYAQNAIVANE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FLG SW    P S E  GV VLK RG F  AYW+WLG+GAL GF +     +TLAL  L 
Sbjct  716   FLGHSWKKFTPNSIESLGVQVLKSRGFFAHAYWFWLGLGALFGFVLLFNLGFTLALTFLN  775

Query  804   PLAQSRANISAESHSNEHDVSNGG---------SDNSVGERVS----------DGMSNRK  682
              L + RA ++ ES SNE D + GG         S N + ER S          +G   +K
Sbjct  776   RLEKPRAILTEESESNEQDSTIGGTVQLSTHGESGNDIRERNSSSHSLTLTEAEGSHPKK  835

Query  681   HGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSG  502
              GM+LPFEPHS+ F+++ Y VDMPQ+MK++GV D++L LL GVSGAFRPGVLTALMGVSG
Sbjct  836   RGMVLPFEPHSLTFDEVVYSVDMPQQMKLQGVSDDKLVLLNGVSGAFRPGVLTALMGVSG  895

Query  501   AGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIF  322
             AGKTTLMDVLAGRKTGGYI G I +SG+ KKQ+TFARISGYCEQNDIHSP +TVYESL++
Sbjct  896   AGKTTLMDVLAGRKTGGYITGNIKVSGYPKKQETFARISGYCEQNDIHSPFVTVYESLLY  955

Query  321   SAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVA  142
             SAWLRLP E+  ETRK+FI EVMELVEL  L++++VGLPGV+GLST QRKRLTIAVELVA
Sbjct  956   SAWLRLPPEIDSETRKMFIGEVMELVELKPLKQSLVGLPGVSGLSTEQRKRLTIAVELVA  1015

Query  141   NPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             NPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1016  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1062


 Score =   130 bits (326),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 124/568 (22%), Positives = 247/568 (43%), Gaps = 72/568 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L  VSG  +PG +T L+G   +GKT+L+  LAG+       +G +  +G+   +    R
Sbjct  874   LLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-ITGNIKVSGYPKKQETFAR  932

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R  P+ID    
Sbjct  933   ISGYCEQNDIHSPFVTVYESLLYSAW----------------------LRLPPEID----  966

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + +  +++++ L+  + ++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  967   -----SETRKMFIGEVMELVELKPLKQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1021

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQI-VY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G   +Y
Sbjct  1022  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGYEIY  1080

Query  1917  QGP-----CNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTIN  1753
              GP     C+ V  +FE +    P  + + D     T        W+ + + P + V + 
Sbjct  1081  VGPLGRHSCHLV-SYFEAI----PGVEKIKDGYNPAT--------WMLEVSAPSQEVALG  1127

Query  1752  -EFSEAFQS---FHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVL  1588
              +FS+ ++    +   ++L ++L+ P   S   H AA     Y  S      +C  ++  
Sbjct  1128  VDFSDIYKRSELYRRNKSLIEDLSKPAPGSKDLHFAA----QYSQSAFTQFLACLWKQHW  1183

Query  1587  LMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQ  1408
                RN         +   +AL+  ++F     +          M S+F   T IMF  +Q
Sbjct  1184  SYWRNPAYTAVRFFFTTFIALLLGSIFWDLGGKTEKRQDLLNAMGSMF---TAIMFLGIQ  1240

Query  1407  ---ELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYD  1240
                 + P +     +FY+++    Y    +A+   ++ IP   ++  V+    Y ++ +D
Sbjct  1241  YCSSVQPIVSVERTVFYREKAAGMYSGIPWALAQVMIEIPYIFVQSLVYSSIVYAMMEFD  1300

Query  1239  PNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILSR  1066
                 +    W +  ++  L    F     V  +  +  A +V +    +     GFI+ R
Sbjct  1301  WTAAKFF--WYIFFMYVTLLFFTFYGMLTVAITPNHHIAAIVSTLFYGIWNIFSGFIIPR  1358

Query  1065  DDVKKWWIWGYWISPLMYAQNAIAVNEF  982
               +  WW W YW +P+ +    +  ++F
Sbjct  1359  PRIPVWWRWYYWANPIAWTLYGLIASQF  1386



>ref|XP_004239864.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum 
lycopersicum]
Length=1425

 Score =  1410 bits (3650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/1055 (64%), Positives = 847/1055 (80%), Gaps = 24/1055 (2%)
 Frame = -2

Query  3138  MEINDSRGRS------GSFRINSS-SLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQK  2983
             + +N  RG S      GS R ++S S+W +NG D F++S+R    D+DDE ALKWAAL+K
Sbjct  4     VNLNSMRGSSMRGSMRGSLRASTSNSIWRNNGVDAFSRSTR----DEDDEEALKWAALEK  59

Query  2982  VPTFDRLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMER  2803
             +PTFDRL+KGL+ G +G   E+D+N++GY+E+K +LERL+KV + DNE FL+KLK+R++R
Sbjct  60    LPTFDRLRKGLLFGSQGAANEIDVNDLGYQERKNLLERLVKVADEDNEKFLMKLKNRIDR  119

Query  2802  VAIDIPKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILR  2626
             V ID+P +EVR+EHLN+ A+AY G RALP+  NF  N +E LL+ L+ LP+ K+  +IL+
Sbjct  120   VGIDMPSIEVRYEHLNIEADAYAGSRALPTFINFMTNFVETLLNSLHILPSKKRQITILK  179

Query  2625  DVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAA  2446
             DVSG+IKP RMTLLLGPPSSGKT+LLLALAG+LDP+L  +G V+YNGHE++EFVP RTA 
Sbjct  180   DVSGMIKPCRMTLLLGPPSSGKTTLLLALAGKLDPALRVTGNVTYNGHELHEFVPQRTAV  239

Query  2445  YISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAA  2266
             YISQHDLHI EMT RETL FSARCQGVGSR+EMLAELSRREKAANI+PDPDIDI+MKAAA
Sbjct  240   YISQHDLHIGEMTVRETLEFSARCQGVGSRFEMLAELSRREKAANIKPDPDIDIYMKAAA  299

Query  2265  TDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDE  2086
             T+GQ+ANV+ DY++K+LGL+ C DT+VG+E +RG+SGG++KR+T GEMLVGP+  L MDE
Sbjct  300   TEGQEANVVTDYVLKILGLDICADTMVGDEMIRGISGGQKKRVTTGEMLVGPSKALFMDE  359

Query  2085  ISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPC  1906
             ISTGLDSSTTF I+ S++  + +L GTAVI+LLQPAPE Y+LFDDIIL+S+G IVYQGP 
Sbjct  360   ISTGLDSSTTFSIVNSLRQSVQLLKGTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPR  419

Query  1905  NCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSF  1726
               VL+FFE +GF+CPERKG ADFLQEVTS+KDQ QYW ++ N+PYRF+T  EFSEA+QSF
Sbjct  420   EAVLDFFESMGFKCPERKGAADFLQEVTSKKDQQQYWAKR-NEPYRFITSKEFSEAYQSF  478

Query  1725  HIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVG  1546
             H+GR L DELATP+ K+ SHPAAL+TK YG+   +LLK C  RE LLMKRN  ++IF++ 
Sbjct  479   HVGRKLSDELATPYDKTKSHPAALSTKKYGIGTKQLLKVCAEREFLLMKRNSFVYIFKLT  538

Query  1545  WVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYK  1366
              + +MALITM++F RT + R+      IY  +LFF + +IMF+ + E+A TIF+LP+++K
Sbjct  539   QLAIMALITMSVFFRTKLPRDDMDDGGIYAGALFFVVVMIMFNGMAEIALTIFKLPVYFK  598

Query  1365  QRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQ  1186
             QRDLLF+P+WAYA+PT+IL+IPIT +E  +W F TYYV+G+DPN  RL K ++LL++  Q
Sbjct  599   QRDLLFFPSWAYALPTWILKIPITFVECGMWTFLTYYVMGFDPNVSRLFKQFLLLVLVHQ  658

Query  1185  LASVLFRSAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQ  1006
             +AS LFR    VGR+M  A   G+F +L+ FALGGF+L+R+DVKKWWIWGYW SPLMY+ 
Sbjct  659   MASALFRFIGAVGRTMGVASTFGAFALLLQFALGGFVLAREDVKKWWIWGYWTSPLMYSV  718

Query  1005  NAIAVNEFLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYT  826
             N+I VNEF GK+W  + P  +EP G  V++ RG FP+AYWYW+G GAL GFT+   F Y+
Sbjct  719   NSILVNEFDGKNWKHIAPNGTEPLGAAVVRSRGFFPDAYWYWIGCGALFGFTMIFNFFYS  778

Query  825   LALAKLRPLAQSRANISAESHSNEHDVSNGGSDNSVGERVSDGMSNRKHGMILPFEPHSI  646
             +ALA L P  + +A IS           +G     + ER      ++K GM+LPFEPHSI
Sbjct  779   IALAYLDPFGKPQAMIS----------EDGEDAVELTERSETEGQDKKKGMVLPFEPHSI  828

Query  645   AFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  466
              F++I Y VDMPQEMK +G  ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG
Sbjct  829   TFDNIVYSVDMPQEMKEQGSAEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG  888

Query  465   RKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSEVTC  286
             RKTGGYI+G+I ISG+ KKQ+TFARISGYCEQNDIHSP++TVYESL++SAWLRLP +V  
Sbjct  889   RKTGGYIDGDIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVDE  948

Query  285   ETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDEPTS  106
               RK+F+ EVMELVEL  LR A+VGLPGVNGLST QRKRLTIAVELVANPSIIFMDEPTS
Sbjct  949   NKRKMFVDEVMELVELAPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS  1008

Query  105   GLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             GLDARAAAIVMR VRN VDTGRT+VCTIHQPSIDI
Sbjct  1009  GLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDI  1043


 Score =   138 bits (347),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 129/569 (23%), Positives = 251/569 (44%), Gaps = 74/569 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  855   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGDIKISGYPKKQETFAR  913

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+D    
Sbjct  914   ISGYCEQNDIHSPYVTVYESLVYSAW----------------------LRLPQDVD----  947

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                    K  + VD +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  948   -----ENKRKMFVDEVMELVELAPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1002

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1003  MDEPTSGLDARAAAIVMRAVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1061

Query  1917  QGPC---NC-VLEFFECLGF--RCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +    +  E    A ++ EVT+   +M   +            
Sbjct  1062  VGPLGRHSCHLIKYFESMPGVGKIKEAYNPATWMLEVTASSQEMMLGV------------  1109

Query  1755  NEFSEAFQS---FHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVL  1588
              +F++ +++   +   + L  EL+TP   +   H     ++ +    M    +C  ++  
Sbjct  1110  -DFADLYKNSDLYRRNKALIAELSTPRPATKDLHFETQFSQPFWTQCM----ACLWKQHW  1164

Query  1587  LMKRNCVLHIFEVGWVVLMALITMTLF--IRTNMQRNSPI---GAQIYMSSLFFTLTVIM  1423
                RN         +   +AL+  T+F  + T + R+  +      +Y ++LF  L V  
Sbjct  1165  SYWRNPAYTAVRFIFTTFIALVFGTMFWDLGTKVSRSQDLINAMGSMYAATLF--LGVQN  1222

Query  1422  FSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGY  1243
              S++Q +        +FY+++    Y A  YA    ++ IP   ++ + +    Y +IG+
Sbjct  1223  SSSVQPVVAV--ERTVFYREKAAGMYSAIPYAFGQVVIEIPYVFVQSAFYGVIVYAMIGF  1280

Query  1242  DPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILS  1069
             +    + L  W    ++  L    F     V  +     A +V +F   V     GFI+ 
Sbjct  1281  EWTAVKFL--WYFFFMYCTLLYFTFYGMMTVAVTPNQNVASIVAAFFYAVWNLFSGFIVP  1338

Query  1068  RDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             R  +  WW W YW  P+ +    +  ++F
Sbjct  1339  RPRIPIWWRWYYWACPVAWTLYGLVASQF  1367



>ref|XP_003597816.1| Pleiotropic drug resistance protein [Medicago truncatula]
Length=1492

 Score =  1410 bits (3649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/1058 (65%), Positives = 848/1058 (80%), Gaps = 24/1058 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D    + S R  SS++W  +G + F+KSSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  63    MEGTDIYRATNSLRARSSTVWRQSGVEVFSKSSR----EEDDEEALKWAALEKLPTYNRL  118

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   EVD+ ++ ++EK+K+LERL++V E DNE FLLK+K+R++RV +DIP 
Sbjct  119   RKGLLTASHGGAHEVDVGDLAFKEKQKLLERLVRVAEEDNEGFLLKVKERVDRVGLDIPT  178

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIK  2605
             +EVR+++L + AEA+VG RALPS  N   N++EG+ ++L++ PT K+H +ILRDVSGIIK
Sbjct  179   IEVRYQNLKIDAEAFVGSRALPSFINAATNVVEGVFNFLHIIPTKKRHVAILRDVSGIIK  238

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPP SGKT+LLLAL+G+LD S + SG V+YNGH +NEFVP RTAAYISQHD+
Sbjct  239   PRRMTLLLGPPGSGKTTLLLALSGKLDSSFQLSGNVTYNGHGLNEFVPQRTAAYISQHDV  298

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREK ANI+PDPDID++MKA AT+GQ+++
Sbjct  299   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKVANIKPDPDIDVYMKAIATEGQESS  358

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             +  DY++K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  359   ISTDYVLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  418

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++ Y+HI++GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FF
Sbjct  419   STTFQIVSSLRQYVHIMNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFF  478

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTS+KDQ QYW+R+D +PYR+VT+ +F+EAFQSFHIG  L 
Sbjct  479   ESMGFKCPERKGVADFLQEVTSKKDQAQYWVRRD-QPYRYVTVTQFAEAFQSFHIGGKLA  537

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +EL+ PF K+ SHPAALTTK YG++K ELLK+ FSRE LLMKRN  ++IF++  + +MAL
Sbjct  538   EELSIPFDKTKSHPAALTTKEYGLNKTELLKANFSREYLLMKRNSFVYIFKLTQLFIMAL  597

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF RT M R+    A +Y  +LFFTL  +MF+ + E++ TI +LP++YKQRDLLFY
Sbjct  598   IAMTLFFRTEMHRDDQDDAGVYAGALFFTLVTMMFNGMSEISMTIAKLPVYYKQRDLLFY  657

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IP++ +EVS+WVF TYYVIG+DPN GR+ K +V+L    Q+AS LFR
Sbjct  658   PSWAYAIPSWILKIPVSLVEVSLWVFLTYYVIGFDPNVGRMFKQFVVLFFMSQMASGLFR  717

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   GSF +L LFALGGFILSR D+K WWIWGYWISP+MY QNA+  NE
Sbjct  718   AIASLGRNMIVANTFGSFAVLTLFALGGFILSRKDIKSWWIWGYWISPMMYGQNALMANE  777

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FL  SW+     ++   G   L  RG FP AYWYW+GVG L GF       + +ALA L 
Sbjct  778   FLANSWHN----ATSDLGKDYLDTRGFFPHAYWYWIGVGGLAGFVFLFNAAFGVALAVLG  833

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSV----------GERVSDGMSNRKHGMILPFEP  655
             P  +  A I+  S   E D SN  +   V          G+ V+     +K GM+LPFEP
Sbjct  834   PFDKPSATITDNS---EDDSSNYMTAQEVELPRIESSGRGDSVTVSSHGKKKGMVLPFEP  890

Query  654   HSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDV  475
             HSI F+DI Y VDMP EMK +GV ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDV
Sbjct  891   HSITFDDIVYSVDMPAEMKEQGVTEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDV  950

Query  474   LAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSE  295
             LAGRKTGGYI+G+I +SG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS 
Sbjct  951   LAGRKTGGYIDGDIKVSGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSG  1010

Query  294   VTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDE  115
             V   TRK+FI+EVM+LVEL SLR+++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDE
Sbjct  1011  VDSNTRKMFIEEVMDLVELNSLRDSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDE  1070

Query  114   PTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             PTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1071  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1108


 Score =   129 bits (323),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 122/566 (22%), Positives = 241/566 (43%), Gaps = 68/566 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  920   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGDIKVSGYPKKQETFAR  978

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  979   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  1007

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +  D     + ++ ++ ++ L    D++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  1008  PSGVDSNTRKMFIEEVMDLVELNSLRDSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1067

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1068  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1126

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVT+   ++       N    F  +
Sbjct  1127  VGPLGRHSTHLIKYFESIDGVSKIKDGYNPATWMLEVTTTAQEL-------NLGVDFTDL  1179

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVLLMK  1579
              + S+ ++     + L  EL  P   S   H     ++++ V      ++C  ++     
Sbjct  1180  YKNSDLYRR---NKQLIQELGVPAPGSKDLHFPTQFSQSFLVQ----CQACLWKQRWSYW  1232

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIR---TNMQRNSPIGAQIYMSSLFFTLTVIMFSALQ  1408
             RN         +   +AL+  T+F      + +R   + A   M +    L V   S++Q
Sbjct  1233  RNPPYTAVRFFFTTFIALMFGTMFWDLGGKHSRRQDLLNAVGSMYTAVLFLGVQNSSSVQ  1292

Query  1407  ELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
              +        +F +++    Y A  YA    ++ +P    +   +    Y +IG+D    
Sbjct  1293  PVVAV--ERTVFNREKAAGMYSALPYAFSQILVELPYVFAQAVTYGVIVYAMIGFDWTAE  1350

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDD  1060
             + L  W L  ++  L    F     V  ++T    V S +    +A+     GF++ R  
Sbjct  1351  KFL--WYLFFMYFTLLYFTFYGMMAV--AVTPNHHVASIVAAAFYAIWNLFSGFVVPRPS  1406

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF  982
             +  WW W YW  P+ +    +  ++F
Sbjct  1407  IPIWWRWYYWACPVAWTIYGLVASQF  1432



>ref|XP_004245225.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum 
lycopersicum]
Length=1453

 Score =  1409 bits (3648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/1068 (65%), Positives = 851/1068 (80%), Gaps = 35/1068 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSN-GTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             +  S R+ SS++W N G D F++SSR   ED DDE ALKWAAL+K+PT+ R+++G+++  
Sbjct  9     KVSSARLGSSTVWRNSGVDVFSRSSR---EDYDDEEALKWAALEKLPTYLRIRRGILSEE  65

Query  2937  RGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHL  2758
              G+  EVDI  +   E++ +LERL+K+ + DNE FLLKLK R++RV +D+P +EVRFEHL
Sbjct  66    EGQYREVDITKLDLVERRNLLERLVKIADEDNEKFLLKLKKRIDRVGLDLPTIEVRFEHL  125

Query  2757  NVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLLL  2581
             NV AEA VG RALP++ NF +NI+E  L+YL+ LP+ KK   IL ++SGIIKPGRMTLLL
Sbjct  126   NVDAEARVGSRALPTIFNFTVNIIEDFLNYLHILPSRKKPLPILHEISGIIKPGRMTLLL  185

Query  2580  GPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTAR  2401
             GPPSSGKT+LLL LAG+LD  L+ SGRV+YNGH M+EFVP RT+AYISQ+DLHI EMT R
Sbjct  186   GPPSSGKTTLLLGLAGKLDKDLKVSGRVTYNGHGMDEFVPQRTSAYISQNDLHIGEMTVR  245

Query  2400  ETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIK  2221
             ETLAFSARCQGVG++YE+LAELSRREK ANI+PDPD+DIFMK+A  DGQ+ANV+ DY +K
Sbjct  246   ETLAFSARCQGVGAKYEILAELSRREKEANIKPDPDVDIFMKSAWNDGQEANVVTDYTLK  305

Query  2220  VLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILK  2041
             +LGLE C DTIVG+E +RG+SGG+RKRLT GEM+VGPA  L MDEISTGLDSSTT+QI+ 
Sbjct  306   ILGLEICADTIVGDEMIRGISGGQRKRLTTGEMMVGPARALFMDEISTGLDSSTTYQIVN  365

Query  2040  SIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCP  1861
             SI+  IHIL GTAVI+LLQPAPE YDLFDDIIL+S+GQIVYQGP   VLEFFE +GF+CP
Sbjct  366   SIRQSIHILQGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRENVLEFFEYIGFKCP  425

Query  1860  ERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQ  1681
             +RKGVADFLQEVTSRKDQ QYW R+D +PY+F+T+ EFSEAFQSFH+GR LGDELA PF 
Sbjct  426   QRKGVADFLQEVTSRKDQEQYWARRD-EPYKFITVREFSEAFQSFHVGRKLGDELAVPFD  484

Query  1680  KSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIR  1501
             KS SHPAALTT+ YGVSK ELLK+C +RE LLMKRN  ++IF++  + LMA ITMTLF+R
Sbjct  485   KSKSHPAALTTERYGVSKKELLKACTAREYLLMKRNSFVYIFKMIQLTLMATITMTLFLR  544

Query  1500  TNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIP  1321
             T M R++ I   +++ +L++ + +IMF+   ELA +I +LP FYK RDLLF+PAW YA+P
Sbjct  545   TEMHRDTMIDGAVFLGALYYAVIMIMFNGFSELALSIMKLPSFYKHRDLLFFPAWTYALP  604

Query  1320  TFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRS  1141
             T+IL+IPIT +EV++WV  TYYVIG++ + GR  K   LLI   Q+AS LFR  A +GR+
Sbjct  605   TWILKIPITLVEVAIWVCMTYYVIGFEADVGRFFKQLFLLICLNQMASGLFRFLAALGRN  664

Query  1140  MTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWNT  961
             +  A   GS  +L++  +GGFILSRD+VK+W IWGYWISP+MYAQNAIAVNEFLGKSW  
Sbjct  665   VIVANTFGSCALLIVLVMGGFILSRDNVKQWLIWGYWISPMMYAQNAIAVNEFLGKSWAH  724

Query  960   VLPFS--SEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSR  787
             V P S  ++  GV  LK RG+FPEA WYW+GVGAL+G+ +   F++T+ALA L P  + +
Sbjct  725   VPPNSTGTDTLGVSFLKSRGIFPEARWYWIGVGALLGYVLLFNFLFTVALAYLNPFGKPQ  784

Query  786   ANISAESHSNEHDVSNGGS-------DNSVGER-------------------VSDGMSNR  685
             A +S E+ + E + S  G          S  ER                   +++G  N+
Sbjct  785   AVLSEETVA-ERNASKRGEVIELSPIGKSSSERGNDVRRSASSRSMSSRVGNIAEGDLNK  843

Query  684   KHGMILPFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVS  505
             + GMILPFEP SI F+DI+Y VDMPQEMK +G  ++RLELLKGVSGAFRPGVLTALMGVS
Sbjct  844   RKGMILPFEPLSITFDDIRYAVDMPQEMKAQGFTEDRLELLKGVSGAFRPGVLTALMGVS  903

Query  504   GAGKTTLMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLI  325
             GAGKTTLMDVLAGRKTGGYIEG I+ISG+ K+Q TFARI+GYCEQ DIHSPH+TVYESL 
Sbjct  904   GAGKTTLMDVLAGRKTGGYIEGTISISGYPKQQATFARIAGYCEQTDIHSPHVTVYESLQ  963

Query  324   FSAWLRLPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELV  145
             +SAWLRLP EV  ETRK FI+EVMELVEL  LREA+VGLPGVNGLST QRKRLT+AVELV
Sbjct  964   YSAWLRLPREVDTETRKRFIEEVMELVELKPLREALVGLPGVNGLSTEQRKRLTVAVELV  1023

Query  144   ANPSIIFMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             ANPSIIFMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1024  ANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1071


 Score =   129 bits (325),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 121/570 (21%), Positives = 245/570 (43%), Gaps = 64/570 (11%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +S +G+   
Sbjct  877   TEDRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGTISISGYPKQ  935

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R A Y  Q D+H P +T  E+L +SA  +           L R            
Sbjct  936   QATFARIAGYCEQTDIHSPHVTVYESLQYSAWLR-----------LPRE-----------  973

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
                       D +     ++ +++++ L+   + +VG   + G+S  +RKRLT    LV 
Sbjct  974   ---------VDTETRKRFIEEVMELVELKPLREALVGLPGVNGLSTEQRKRLTVAVELVA  1024

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ +     T V  + QP+ + +D FD+++L+  
Sbjct  1025  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFDAFDELLLLKR  1083

Query  1932  G-QIVYQGP----CNCVLEFFECLG--FRCPERKGVADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + ++ GP     + ++++FE +    +  +    A ++ ++TS   +    I      
Sbjct  1084  GGEEIFVGPLGRHSSHLIKYFEGIDGVLKIKDGYNPATWMLDITSVAQEAALGI------  1137

Query  1773  YRFVTINEFSEAFQSFHIGRN---LGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCF  1603
                    +F+E +++  + R    L  EL+ P     S      TK Y  S      +CF
Sbjct  1138  -------DFTELYRNSELYRRNKALIQELSVP--APGSKDLYFETK-YSQSFFTQSMACF  1187

Query  1602  SREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIM  1423
              ++     RN       + +   +AL+  T+F     +R         + S++  +  + 
Sbjct  1188  WKQHWSYWRNPPYTAVRLMFTFFIALMFGTIFWDLGSKRRRQQDILNAIGSMYAAVLFLG  1247

Query  1422  FSALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIG  1246
                   + P +     +FY++R    Y A  YA    ++ +P   I+  ++    Y +IG
Sbjct  1248  VQNATSVQPVVAIERTVFYRERAAGMYSALPYAFGQIMIELPYIFIQTIIYGVIVYAMIG  1307

Query  1245  YDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFIL  1072
             ++    + +  W L  ++  L          V  +  +  A ++ S    V     GFI+
Sbjct  1308  FEWTVAKFI--WYLFFMYFTLLYFTLYGMMTVAVTPNHSIAAIISSAFYAVWNLFSGFIV  1365

Query  1071  SRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
              +  +  WW W ++I P+ +    +  ++F
Sbjct  1366  PKTRMPVWWRWYFYICPISWTLYGLVASQF  1395



>emb|CBI36227.3| unnamed protein product [Vitis vinifera]
Length=1451

 Score =  1409 bits (3647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/1062 (66%), Positives = 854/1062 (80%), Gaps = 30/1062 (3%)
 Frame = -2

Query  3108  GSFRINSSSLWSNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGLRGE  2929
             GS R +SSS+W N  +  +  S R   D+DDE ALKWAAL+K+PT++R++KGL+ G  GE
Sbjct  11    GSLRKDSSSIWRNSGEEVSSRSSR---DEDDEEALKWAALEKLPTYNRMRKGLLMGSAGE  67

Query  2928  TFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEHLNVG  2749
               EVDI+N+G++EKK ++ERL+K+ E DNE FLLKL++R++RV ID+P++EVRFEHL + 
Sbjct  68    ASEVDIHNLGFQEKKNLVERLVKIAEEDNEKFLLKLRNRIDRVGIDLPEIEVRFEHLTID  127

Query  2748  AEAYVGKRALPSVTNFCLNILEGLLSYL-YLPTTKKHNSILRDVSGIIKPGRMTLLLGPP  2572
             AEA+VG RALPS  N   N +E +L+ L  LP+ KK  +IL DVSGIIKP RMTLLLGPP
Sbjct  128   AEAHVGSRALPSFINSAFNQIEDILNTLRILPSRKKKFTILHDVSGIIKPRRMTLLLGPP  187

Query  2571  SSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTARETL  2392
             SSGKT+LLLAL+G+LD SL+ +G+V+YNGH MNEFVP RTA YISQHD HI EMT RETL
Sbjct  188   SSGKTTLLLALSGKLDSSLKVTGKVTYNGHGMNEFVPQRTATYISQHDTHIGEMTVRETL  247

Query  2391  AFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYIIKVLG  2212
             AFSARCQGVG RY+MLAELSRREKAANI+PDPDID+FMKAAAT+GQK NVI DY +K+LG
Sbjct  248   AFSARCQGVGDRYDMLAELSRREKAANIKPDPDIDVFMKAAATEGQKENVITDYTLKILG  307

Query  2211  LEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQILKSIK  2032
             LE C DT+VG++ +RG+SGG+RKR+T GEMLVGP+  L MDEISTGLDSSTT+QI+ S++
Sbjct  308   LEVCADTLVGDQMIRGISGGQRKRVTTGEMLVGPSKALFMDEISTGLDSSTTYQIVNSLR  367

Query  2031  HYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRCPERK  1852
               IHIL+GTA+I+LLQPAPE YDLFDDIIL+S+ QIVYQGP   VL+FFE +GFRCPERK
Sbjct  368   QTIHILNGTALISLLQPAPETYDLFDDIILLSDSQIVYQGPREDVLDFFESMGFRCPERK  427

Query  1851  GVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPFQKST  1672
             GVADFLQEVTSRKDQ QYW RKD +PY FVT+ +F+EAFQSFH GR +GDELATPF K+ 
Sbjct  428   GVADFLQEVTSRKDQQQYWARKD-EPYSFVTVKQFAEAFQSFHSGRKVGDELATPFDKTK  486

Query  1671  SHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNM  1492
             SHPAAL T+ YGV K ELL +C SRE  LMKRN  ++I ++  +++MA I+MT+F+RT M
Sbjct  487   SHPAALKTEKYGVRKKELLDACISREYWLMKRNSFVYILQLTQLIIMAAISMTIFLRTEM  546

Query  1491  QRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFI  1312
              +NS     IYM +LFFT+ +IMF+ + ELA TI +LP+FYKQR LLFYPAWAYA+ ++I
Sbjct  547   HKNSTDDGSIYMGALFFTVVMIMFNGMSELAMTIAKLPVFYKQRGLLFYPAWAYALSSWI  606

Query  1311  LRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN  1132
             L+IPIT +EV+VWVF +YYVIG+DPN GRL K ++LL++  Q+AS LFR  A  GR+M  
Sbjct  607   LKIPITFVEVAVWVFMSYYVIGFDPNVGRLFKQYLLLVLVNQMASALFRFIAAAGRNMIV  666

Query  1131  AFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN-TVL  955
             A   GSF +L+LFALGGF+LSR++VKKWWIWGYW SPLMYAQNAI VNEFLGKSW+    
Sbjct  667   ANTFGSFSLLLLFALGGFVLSRENVKKWWIWGYWSSPLMYAQNAIVVNEFLGKSWSKNSS  726

Query  954   PFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRANIS  775
               S+E  GV VLK RG F EAYWYW+G GAL+GF +   F YT+AL  L    + +A I+
Sbjct  727   TNSTESLGVAVLKSRGFFTEAYWYWIGAGALLGFILVFNFCYTVALTYLNAFEKPQAVIT  786

Query  774   AESHSNEH------------DVSNGGSDNSVG------------ERVSDGMSNRKHGMIL  667
              ES +++              +    S + +G            E +++   N K GM+L
Sbjct  787   EESENSKTGGKIELSSHRRGSIDQTASTDEIGRSISSTSSSVRAEAIAEARRNTKRGMVL  846

Query  666   PFEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTT  487
             PF+P SI F+DI+Y VDMP+EMK +GV ++RL+LLKGVSGAFRPGVLTALMGVSGAGKTT
Sbjct  847   PFQPLSITFDDIRYSVDMPEEMKSQGVLEDRLKLLKGVSGAFRPGVLTALMGVSGAGKTT  906

Query  486   LMDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLR  307
             LMDVLAGRKTGGYIEG I ISG+ KKQ+TF RISGYCEQNDIHSPH+T++ESL++SAWLR
Sbjct  907   LMDVLAGRKTGGYIEGNINISGYPKKQETFTRISGYCEQNDIHSPHVTIHESLLYSAWLR  966

Query  306   LPSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSII  127
             LP++V  +TRK+FI++VMELVELT L++++VGLPGVNGLST QRKRLTIAVELVANPSII
Sbjct  967   LPADVDSKTRKMFIEKVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPSII  1026

Query  126   FMDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             FMDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1027  FMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1068


 Score =   140 bits (353),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 146/633 (23%), Positives = 274/633 (43%), Gaps = 96/633 (15%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G ++ +G+   +    R
Sbjct  880   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGNINISGYPKKQETFTR  938

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   D+D    
Sbjct  939   ISGYCEQNDIHSPHVTIHESLLYSAW----------------------LRLPADVD----  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + ++ +++++ L   +D++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   -----SKTRKMFIEKVMELVELTPLKDSLVGLPGVNGLSTEQRKRLTIAVELVANPSIIF  1027

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD+++L+  G Q +Y
Sbjct  1028  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELLLLKRGGQEIY  1086

Query  1917  QG----PCNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              G      +C++++FE +      + G   A ++ EVT+   +             F+  
Sbjct  1087  VGLLGRHSSCLIKYFEGIEGVSKIKGGYNPATWMLEVTTSAQE-------------FLLG  1133

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
              +F+E +++ ++ R   D +    Q +           Y  S      +C  ++     R
Sbjct  1134  VDFTEIYKNSNLYRRNKDLIKELSQPAPGSKDLYFPTQYSQSFFTQCMACLWKQRRSYWR  1193

Query  1575  NCVLHIFEVGWVVLMALITMTLFI-----RTNMQRNSPIGAQIYMSSLFFTLTVIMFSAL  1411
             N         +   +ALI  T+F      RT  Q  S     +Y + LF  L V   S++
Sbjct  1194  NPPYTAVRFFFTTFIALIFGTMFWDLGTKRTKQQDLSNAMGSMYAAVLF--LGVQNSSSV  1251

Query  1410  QELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNF  1231
             Q +        +FY++R    Y A  YA    ++ IP    +  V+    Y +IG++   
Sbjct  1252  QPVVAV--ERTVFYRERAAGIYSAMPYAFAHALVEIPYVFAQAVVYGVIVYAMIGFEWTA  1309

Query  1230  GRLLKMW------VLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLV-LFALGGFIL  1072
              +           +L   F  + +V     A        A V  +F  L  LF+  GFI+
Sbjct  1310  AKFFWYLFFMFFTLLYFTFYGMMAV-----AATPNQHIAAIVAAAFYGLWNLFS--GFIV  1362

Query  1071  SRDDVKKWWIWGYWISPLMYAQNAIAVNEF------LGKSWNTVLPFSSEPFGVLVLKYR  910
              R  +  WW W YW  P+ +    +  ++F         + +TV  + ++ FG       
Sbjct  1363  PRTRIPVWWRWYYWACPVAWTLYGLVTSQFGDIQDRFEDTGDTVEQYLNDYFG-------  1415

Query  909   GLFPEAYWYWLGVGA--LIGFTIFSIFIYTLAL  817
               F   +   LGV A  ++GFT+  +FI+  A+
Sbjct  1416  --FEHDF---LGVVAAVIVGFTVLFLFIFAFAI  1443



>gb|AES68067.2| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1430

 Score =  1409 bits (3646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/1058 (65%), Positives = 848/1058 (80%), Gaps = 24/1058 (2%)
 Frame = -2

Query  3138  MEINDSRGRSGSFRINSSSLW-SNGTDGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRL  2962
             ME  D    + S R  SS++W  +G + F+KSSR    ++DDE ALKWAAL+K+PT++RL
Sbjct  1     MEGTDIYRATNSLRARSSTVWRQSGVEVFSKSSR----EEDDEEALKWAALEKLPTYNRL  56

Query  2961  KKGLMTGLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPK  2782
             +KGL+T   G   EVD+ ++ ++EK+K+LERL++V E DNE FLLK+K+R++RV +DIP 
Sbjct  57    RKGLLTASHGGAHEVDVGDLAFKEKQKLLERLVRVAEEDNEGFLLKVKERVDRVGLDIPT  116

Query  2781  VEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLYL-PTTKKHNSILRDVSGIIK  2605
             +EVR+++L + AEA+VG RALPS  N   N++EG+ ++L++ PT K+H +ILRDVSGIIK
Sbjct  117   IEVRYQNLKIDAEAFVGSRALPSFINAATNVVEGVFNFLHIIPTKKRHVAILRDVSGIIK  176

Query  2604  PGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDL  2425
             P RMTLLLGPP SGKT+LLLAL+G+LD S + SG V+YNGH +NEFVP RTAAYISQHD+
Sbjct  177   PRRMTLLLGPPGSGKTTLLLALSGKLDSSFQLSGNVTYNGHGLNEFVPQRTAAYISQHDV  236

Query  2424  HIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKAN  2245
             HI EMT RETLAFSARCQGVGSRY+ML+ELSRREK ANI+PDPDID++MKA AT+GQ+++
Sbjct  237   HIGEMTVRETLAFSARCQGVGSRYDMLSELSRREKVANIKPDPDIDVYMKAIATEGQESS  296

Query  2244  VIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDS  2065
             +  DY++K+LGL+ C DT+VG+E LRG+SGG+RKR+T GEMLVGPAN L MDEISTGLDS
Sbjct  297   ISTDYVLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDS  356

Query  2064  STTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFF  1885
             STTFQI+ S++ Y+HI++GTAVI+LLQPAPE YDLFDDIILIS+GQ+VY GP   VL+FF
Sbjct  357   STTFQIVSSLRQYVHIMNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFF  416

Query  1884  ECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLG  1705
             E +GF+CPERKGVADFLQEVTS+KDQ QYW+R+D +PYR+VT+ +F+EAFQSFHIG  L 
Sbjct  417   ESMGFKCPERKGVADFLQEVTSKKDQAQYWVRRD-QPYRYVTVTQFAEAFQSFHIGGKLA  475

Query  1704  DELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMAL  1525
             +EL+ PF K+ SHPAALTTK YG++K ELLK+ FSRE LLMKRN  ++IF++  + +MAL
Sbjct  476   EELSIPFDKTKSHPAALTTKEYGLNKTELLKANFSREYLLMKRNSFVYIFKLTQLFIMAL  535

Query  1524  ITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFY  1345
             I MTLF RT M R+    A +Y  +LFFTL  +MF+ + E++ TI +LP++YKQRDLLFY
Sbjct  536   IAMTLFFRTEMHRDDQDDAGVYAGALFFTLVTMMFNGMSEISMTIAKLPVYYKQRDLLFY  595

Query  1344  PAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFR  1165
             P+WAYAIP++IL+IP++ +EVS+WVF TYYVIG+DPN GR+ K +V+L    Q+AS LFR
Sbjct  596   PSWAYAIPSWILKIPVSLVEVSLWVFLTYYVIGFDPNVGRMFKQFVVLFFMSQMASGLFR  655

Query  1164  SAAVVGRSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNE  985
             + A +GR+M  A   GSF +L LFALGGFILSR D+K WWIWGYWISP+MY QNA+  NE
Sbjct  656   AIASLGRNMIVANTFGSFAVLTLFALGGFILSRKDIKSWWIWGYWISPMMYGQNALMANE  715

Query  984   FLGKSWNTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLR  805
             FL  SW+     ++   G   L  RG FP AYWYW+GVG L GF       + +ALA L 
Sbjct  716   FLANSWHN----ATSDLGKDYLDTRGFFPHAYWYWIGVGGLAGFVFLFNAAFGVALAVLG  771

Query  804   PLAQSRANISAESHSNEHDVSNGGSDNSV----------GERVSDGMSNRKHGMILPFEP  655
             P  +  A I+  S   E D SN  +   V          G+ V+     +K GM+LPFEP
Sbjct  772   PFDKPSATITDNS---EDDSSNYMTAQEVELPRIESSGRGDSVTVSSHGKKKGMVLPFEP  828

Query  654   HSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLMDV  475
             HSI F+DI Y VDMP EMK +GV ++RL LLKGVSGAFRPGVLTALMGVSGAGKTTLMDV
Sbjct  829   HSITFDDIVYSVDMPAEMKEQGVTEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDV  888

Query  474   LAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLPSE  295
             LAGRKTGGYI+G+I +SG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL++SAWLRLPS 
Sbjct  889   LAGRKTGGYIDGDIKVSGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSAWLRLPSG  948

Query  294   VTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFMDE  115
             V   TRK+FI+EVM+LVEL SLR+++VGLPGV+GLST QRKRLTIAVELVANPSIIFMDE
Sbjct  949   VDSNTRKMFIEEVMDLVELNSLRDSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDE  1008

Query  114   PTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             PTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1009  PTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1046


 Score =   129 bits (323),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 122/566 (22%), Positives = 241/566 (43%), Gaps = 68/566 (12%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+L+  LAG+        G +  +G+   +    R
Sbjct  858   LLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IDGDIKVSGYPKKQETFAR  916

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA  +                                
Sbjct  917   ISGYCEQNDIHSPHVTVYESLLYSAWLR-------------------------------L  945

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
              +  D     + ++ ++ ++ L    D++VG   + G+S  +RKRLT    LV   +++ 
Sbjct  946   PSGVDSNTRKMFIEEVMDLVELNSLRDSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIF  1005

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1006  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLMKRGGQEIY  1064

Query  1917  QGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP       ++++FE +      + G   A ++ EVT+   ++       N    F  +
Sbjct  1065  VGPLGRHSTHLIKYFESIDGVSKIKDGYNPATWMLEVTTTAQEL-------NLGVDFTDL  1117

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTS-HPAALTTKTYGVSKMELLKSCFSREVLLMK  1579
              + S+ ++     + L  EL  P   S   H     ++++ V      ++C  ++     
Sbjct  1118  YKNSDLYRR---NKQLIQELGVPAPGSKDLHFPTQFSQSFLVQ----CQACLWKQRWSYW  1170

Query  1578  RNCVLHIFEVGWVVLMALITMTLFIR---TNMQRNSPIGAQIYMSSLFFTLTVIMFSALQ  1408
             RN         +   +AL+  T+F      + +R   + A   M +    L V   S++Q
Sbjct  1171  RNPPYTAVRFFFTTFIALMFGTMFWDLGGKHSRRQDLLNAVGSMYTAVLFLGVQNSSSVQ  1230

Query  1407  ELAPTIFRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGYDPNFG  1228
              +        +F +++    Y A  YA    ++ +P    +   +    Y +IG+D    
Sbjct  1231  PVVAV--ERTVFNREKAAGMYSALPYAFSQILVELPYVFAQAVTYGVIVYAMIGFDWTAE  1288

Query  1227  RLLKMWVLLIIFRQLASVLFRSAAVVGRSMTNAFVVGSFIMLVLFAL----GGFILSRDD  1060
             + L  W L  ++  L    F     V  ++T    V S +    +A+     GF++ R  
Sbjct  1289  KFL--WYLFFMYFTLLYFTFYGMMAV--AVTPNHHVASIVAAAFYAIWNLFSGFVVPRPS  1344

Query  1059  VKKWWIWGYWISPLMYAQNAIAVNEF  982
             +  WW W YW  P+ +    +  ++F
Sbjct  1345  IPIWWRWYYWACPVAWTIYGLVASQF  1370



>emb|CDP04827.1| unnamed protein product [Coffea canephora]
Length=1445

 Score =  1408 bits (3645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/1060 (66%), Positives = 849/1060 (80%), Gaps = 27/1060 (3%)
 Frame = -2

Query  3114  RSGSFRINSSSLWSNGT-DGFAKSSRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMTGL  2938
             R GS R++SS++W N T D F+KSSR    ++DDE ALKWAA++++PT+ RL++G++T  
Sbjct  8     RLGSLRLSSSNVWRNTTIDVFSKSSR----EEDDEEALKWAAIERLPTYHRLRRGILTDE  63

Query  2937  -RGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFEH  2761
              +G+  EVDI ++G  E+K ILER +K  E DNE FLLKLK R++RV ID+P VEVRF++
Sbjct  64    EKGQRREVDIEHLGPAERKIILERQVKFAEEDNEKFLLKLKQRVDRVGIDLPTVEVRFQN  123

Query  2760  LNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTLL  2584
             L+V AEA+VG RALP++ NF  NI+EGLL YL+ LP  KK   IL DVSGIIKP R+TLL
Sbjct  124   LSVEAEAHVGSRALPTLVNFSANIVEGLLGYLHILPNRKKPFPILHDVSGIIKPARLTLL  183

Query  2583  LGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMTA  2404
             LGPPSSGKT+LLLALAG+LD  L+ SG ++YNGH +NEFVP RT+AYISQHDLHI EMT 
Sbjct  184   LGPPSSGKTTLLLALAGRLDSDLKVSGNITYNGHGLNEFVPQRTSAYISQHDLHIGEMTV  243

Query  2403  RETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYII  2224
             RETLAFS RCQGVG R++ML ELSRREK ANI+PDPDIDIFMKAAA + Q++ V  DYI+
Sbjct  244   RETLAFSERCQGVGPRHDMLEELSRREKQANIKPDPDIDIFMKAAALENQESTVKSDYIM  303

Query  2223  KVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQIL  2044
             K+LGLE C DT+VGNE +RG+SGG+RKR+T GEM+VG + V LMDEISTGLDSSTTFQI+
Sbjct  304   KILGLEVCADTLVGNEMIRGISGGQRKRVTTGEMMVGASRVFLMDEISTGLDSSTTFQIV  363

Query  2043  KSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFRC  1864
              SIK  IHIL GTAVI+LLQPAPE YDLFDD+IL+S+GQIVYQGP   VL+FFE +GF+C
Sbjct  364   NSIKESIHILQGTAVISLLQPAPETYDLFDDVILLSDGQIVYQGPREHVLDFFENMGFKC  423

Query  1863  PERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATPF  1684
             PERKGVADFLQEVTS+KDQ QYW  + N PY FV+   F+EAFQSFH+G  LGDEL+  F
Sbjct  424   PERKGVADFLQEVTSKKDQEQYWADR-NAPYSFVSEKTFAEAFQSFHVGTQLGDELSVRF  482

Query  1683  QKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLFI  1504
              K+ SHPAAL+TK YGVSKMELLK+C  RE LLMKRN  ++ F +  +++MALITMT+F+
Sbjct  483   DKTKSHPAALSTKKYGVSKMELLKACMLREFLLMKRNSFVYTFAMIKLIVMALITMTVFL  542

Query  1503  RTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYAI  1324
             RT + +++     I M +LFFTL +IMF+   ELA TI +LP+FYKQRDLLF+PAWAYA+
Sbjct  543   RTKIHKDTATDGGIVMGALFFTLIMIMFNGFSELALTIMKLPVFYKQRDLLFFPAWAYAL  602

Query  1323  PTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGR  1144
             PT+IL+IPIT +E ++WV  TYYVIG+D N GR  + ++LL+   Q+AS LFR    +GR
Sbjct  603   PTWILKIPITLVETALWVGMTYYVIGFDSNAGRFFRQYLLLVCVSQMASGLFRLMGSLGR  662

Query  1143  SMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSWN  964
             +M  A   GSF +L +  LGGF+LS D++KKWWIWGYWISP+MY QNAIAVNEFLGKSW 
Sbjct  663   NMIIANTFGSFSLLAVMLLGGFLLSHDNIKKWWIWGYWISPMMYGQNAIAVNEFLGKSWR  722

Query  963   TVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQSRA  784
              VLP S+EP G  VL+ RG+F EA WYW+GVGALIG+     F+YTLAL  L+P  + +A
Sbjct  723   KVLPGSTEPLGASVLESRGIFAEARWYWIGVGALIGYLFLFNFLYTLALTYLKPFEKPQA  782

Query  783   NISAESHS--------NEHDVSNGGSD--------NSVGERV---SDGMSNRKHGMILPF  661
              IS ES +         E ++S+ G D         S+  RV   S+    RK GM+LPF
Sbjct  783   VISEESLAERNAGKTGEEAELSSEGKDMNERRTPGRSISSRVGSRSEAEPTRKRGMLLPF  842

Query  660   EPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTLM  481
             EP +I +++I+Y VDMPQEMK +G  ++RLELLKG+SGAFRPGVLTALMGVSGAGKTTLM
Sbjct  843   EPLAITYDEIRYSVDMPQEMKDQGQTEDRLELLKGISGAFRPGVLTALMGVSGAGKTTLM  902

Query  480   DVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRLP  301
             DVLAGRKTGGYIEG I+ISG+ KKQ+TFARI+GYCEQNDIHSPH+TVYESL++SAWLRLP
Sbjct  903   DVLAGRKTGGYIEGTISISGYPKKQETFARIAGYCEQNDIHSPHVTVYESLLYSAWLRLP  962

Query  300   SEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIFM  121
             +EV   TRK+F++EVMELVELT LREA+VGLPGV+GLST QRKRLTIAVELVANPSIIFM
Sbjct  963   NEVDASTRKMFVEEVMELVELTPLREALVGLPGVSGLSTEQRKRLTIAVELVANPSIIFM  1022

Query  120   DEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             DEPTSGLDARAAAIVMRTVRN V+TGRT+VCTIHQPSIDI
Sbjct  1023  DEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDI  1062


 Score =   140 bits (353),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 129/571 (23%), Positives = 250/571 (44%), Gaps = 66/571 (12%)
 Frame = -2

Query  2652  TKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMN  2473
             T+    +L+ +SG  +PG +T L+G   +GKT+L+  LAG+        G +S +G+   
Sbjct  868   TEDRLELLKGISGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGY-IEGTISISGYPKK  926

Query  2472  EFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPD  2293
             +    R A Y  Q+D+H P +T  E+L +SA  +                      P+  
Sbjct  927   QETFARIAGYCEQNDIHSPHVTVYESLLYSAWLR---------------------LPN--  963

Query  2292  IDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVG  2113
                       D     + V+ +++++ L    + +VG   + G+S  +RKRLT    LV 
Sbjct  964   --------EVDASTRKMFVEEVMELVELTPLREALVGLPGVSGLSTEQRKRLTIAVELVA  1015

Query  2112  PANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISE  1933
               +++ MDE ++GLD+     +++++++ ++    T V  + QP+ + +D FD+++L+  
Sbjct  1016  NPSIIFMDEPTSGLDARAAAIVMRTVRNTVNTGR-TVVCTIHQPSIDIFDAFDELVLLKR  1074

Query  1932  G-QIVYQGP----CNCVLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKP  1774
             G + +Y GP     + ++++FE +      R G   A ++ +VTS   +    +      
Sbjct  1075  GGEEIYVGPLGHHSSELIKYFEGIDGVSKIRDGYNPATWMLDVTSLAQESALGVN-----  1129

Query  1773  YRFVTINEFSEAFQSFHIGRNLGDELATPF--QKSTSHPAALTTKTYGVSKMELLKSCFS  1600
               F  + + SE ++     + L  EL+TP    K    P A     Y         +C  
Sbjct  1130  --FAELYKSSELYRR---NKTLIKELSTPAPGSKDLFFPTA-----YSQPFFTQFTACLW  1179

Query  1599  REVLLMKRNCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFTLTVIMF  1420
             ++ L   RN       + +   +AL+  T+F     +R         M S++  +  I  
Sbjct  1180  KQHLSYWRNPKYTAVRLIFTTFIALMFGTVFWNLGSKRTVRQDLFNAMGSMYAAVLFIGV  1239

Query  1419  SALQELAPTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGY  1243
                  + P I     +FY++R    Y A +YA    ++ +P   ++  ++    Y +IG+
Sbjct  1240  QNATAIQPVIAIERTVFYRERAAGMYSALSYAFGQIVIELPYILVQTIIYGVLVYAMIGF  1299

Query  1242  DPNFGRLLKMWVLLIIFRQL---ASVLFRSAAVVGRSMTNAFVVGSF-IMLVLFALGGFI  1075
             +    +    W L  ++  L    +    + AV       A    +F I+  LF+  GF+
Sbjct  1300  EWTAAKFF--WYLFFMYFTLLYYTTYGMMTVAVTPNQQVAAIASSAFYILWNLFS--GFL  1355

Query  1074  LSRDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             + +  +  WW W Y+I P+ +    + V++F
Sbjct  1356  IPKPKIPVWWRWYYYICPVAWTLYGLVVSQF  1386



>ref|XP_011012297.1| PREDICTED: pleiotropic drug resistance protein 1-like [Populus 
euphratica]
Length=1449

 Score =  1408 bits (3644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/1061 (67%), Positives = 857/1061 (81%), Gaps = 22/1061 (2%)
 Frame = -2

Query  3120  RGRSGSFRINSSSLWSNGTDGFAKS-SRRLQEDDDDEAALKWAALQKVPTFDRLKKGLMT  2944
             R  SG  R NSS ++SN      ++ S+  Q  DDDE ALKWAAL+K+PT+DRL+KG++T
Sbjct  8     RADSGGRRGNSSGIFSNNAAADHQAFSQSFQGQDDDEEALKWAALEKLPTYDRLRKGILT  67

Query  2943  GLRGETFEVDINNIGYeekkkilerliKVPERDNETFLLKLKDRMERVAIDIPKVEVRFE  2764
                GE  EV++ N+G++E+K ++ERL+ V E DNE FLLKLK+R++RV I +P +EVRFE
Sbjct  68    TSTGEASEVEVQNLGFQERKNLVERLVNVAEEDNEKFLLKLKNRIDRVRIHVPTIEVRFE  127

Query  2763  HLNVGAEAYVGKRALPSVTNFCLNILEGLLSYLY-LPTTKKHNSILRDVSGIIKPGRMTL  2587
             HLNV AEAYVG RALP+  N+ +N++EG+L+YL+ L + KKH  IL+DVSGIIKP RMTL
Sbjct  128   HLNVEAEAYVGSRALPTFFNYSVNMMEGVLNYLHILSSRKKHMWILKDVSGIIKPSRMTL  187

Query  2586  LLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMRTAAYISQHDLHIPEMT  2407
             LLGPP+SGKT+LLLALAG+LD +L+ SGRV+YNGHEM+EFVP RTAAYISQHDLHI EMT
Sbjct  188   LLGPPNSGKTTLLLALAGKLDHALKISGRVTYNGHEMDEFVPQRTAAYISQHDLHIGEMT  247

Query  2406  ARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMKAAATDGQKANVIVDYI  2227
              RETLAFSARCQGVGSRY+MLAELSRREK A I+PDPDID+FMKAAA +GQ+ +V++DYI
Sbjct  248   VRETLAFSARCQGVGSRYDMLAELSRREKEAGIKPDPDIDVFMKAAAAEGQEESVVIDYI  307

Query  2226  IKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLLMDEISTGLDSSTTFQI  2047
             +KVLGLE C DT+VG+E LRG+SGG++KR+T GEMLVGPA  L MDEISTGLDSSTT+QI
Sbjct  308   LKVLGLEVCADTLVGDEMLRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDSSTTYQI  367

Query  2046  LKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEGQIVYQGPCNCVLEFFECLGFR  1867
             + SIK Y+ IL GTA+I+LLQPAPE YDLFDDIIL+S+G+IVYQGP   VL FFE +GF+
Sbjct  368   VNSIKQYVQILEGTALISLLQPAPETYDLFDDIILLSDGEIVYQGPREHVLRFFEYMGFK  427

Query  1866  CPERKGVADFLQEVTSRKDQMQYWIRKDNKPYRFVTINEFSEAFQSFHIGRNLGDELATP  1687
             CP RKGVADFLQEVTSRKDQMQYW R D  PYRFVT+ EFSEAF SFH G+ LG+ELA P
Sbjct  428   CPARKGVADFLQEVTSRKDQMQYWARGD-VPYRFVTVKEFSEAFHSFHEGKRLGNELAVP  486

Query  1686  FQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKRNCVLHIFEVGWVVLMALITMTLF  1507
             F KS +HPAALTTK YGV+K EL KS FSRE LLMKRN  ++ F+   + ++A+I MTLF
Sbjct  487   FDKSKNHPAALTTKKYGVTKRELCKSSFSREFLLMKRNSFVYAFKFIQLTIIAVIAMTLF  546

Query  1506  IRTNMQRNSPIGAQIYMSSLFFTLTVIMFSALQELAPTIFRLPIFYKQRDLLFYPAWAYA  1327
             +RT M R+S     IY+ ++FF + VIMF+ + E++ T+ +LP+FYKQRDLLF+PAW YA
Sbjct  547   LRTEMHRDSVTDGGIYVGAMFFIVVVIMFNGMAEISMTLAKLPVFYKQRDLLFFPAWIYA  606

Query  1326  IPTFILRIPITCIEVSVWVFSTYYVIGYDPNFGRLLKMWVLLIIFRQLASVLFRSAAVVG  1147
             +PT+IL+IPIT IEV++ VF TY+VIG+DPN GRL K +++L++  Q+AS LFR+ A VG
Sbjct  607   LPTWILKIPITFIEVAIMVFITYFVIGFDPNVGRLFKHYLVLLLTNQMASGLFRTIAAVG  666

Query  1146  RSMTNAFVVGSFIMLVLFALGGFILSRDDVKKWWIWGYWISPLMYAQNAIAVNEFLGKSW  967
             R+M  A   GSF++L+LF LGGF+LSRDD+KKWWIWG+W SP+MYAQNA+ VNEFLGKSW
Sbjct  667   RNMVVANTFGSFVLLLLFVLGGFVLSRDDIKKWWIWGFWTSPMMYAQNAVVVNEFLGKSW  726

Query  966   NTVLPFSSEPFGVLVLKYRGLFPEAYWYWLGVGALIGFTIFSIFIYTLALAKLRPLAQ-S  790
             N VLP S EP G+ VLK RG F EAYWYWL V AL GF +    +Y LALA L PL +  
Sbjct  727   NHVLPNSMEPLGIEVLKSRGFFTEAYWYWLAVAALFGFILLYNLLYILALAFLNPLGKPQ  786

Query  789   RANISAESHS-----------------NEHDVSNGGSDNSVGERVSDGMS-NRKHGMILP  664
             +A IS E  S                 N    ++  S + +G   S   + N++ G+I+P
Sbjct  787   QAGISEEPQSINVGRIGEAIHLMKPGINSSLHTSAESIDEIGRSKSSRFTRNKQKGVIIP  846

Query  663   FEPHSIAFNDIKYCVDMPQEMKIEGVEDNRLELLKGVSGAFRPGVLTALMGVSGAGKTTL  484
             FEPHSI F+ + Y VDMPQEMK  GV +++L LLKGVSGAFRPGVLTALMG+SGAGKTT+
Sbjct  847   FEPHSITFDKVMYSVDMPQEMKSHGVHEDKLVLLKGVSGAFRPGVLTALMGISGAGKTTM  906

Query  483   MDVLAGRKTGGYIEGEITISGFTKKQKTFARISGYCEQNDIHSPHLTVYESLIFSAWLRL  304
             MDVLAGRKTGGYIEG ITISG+ KKQ+TFARISGYCEQNDIHSPH+TVYESL +SAWLRL
Sbjct  907   MDVLAGRKTGGYIEGNITISGYPKKQETFARISGYCEQNDIHSPHITVYESLHYSAWLRL  966

Query  303   PSEVTCETRKLFIKEVMELVELTSLREAVVGLPGVNGLSTGQRKRLTIAVELVANPSIIF  124
             P+EV  ETRK+F++EVMELVEL  LR+A+VGLPGV+GLST QRKRLTIAVELVANPSIIF
Sbjct  967   PAEVDIETRKMFVEEVMELVELNPLRQALVGLPGVDGLSTEQRKRLTIAVELVANPSIIF  1026

Query  123   MDEPTSGLDARAAAIVMRTVRNIVDTGRTIVCTIHQPSIDI  1
             MDEPTSGLDARAAAIVMRTVRN VDTGRT+VCTIHQPSIDI
Sbjct  1027  MDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDI  1067


 Score =   130 bits (326),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 128/569 (22%), Positives = 243/569 (43%), Gaps = 74/569 (13%)
 Frame = -2

Query  2634  ILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSYNGHEMNEFVPMR  2455
             +L+ VSG  +PG +T L+G   +GKT+++  LAG+        G ++ +G+   +    R
Sbjct  879   LLKGVSGAFRPGVLTALMGISGAGKTTMMDVLAGRKTGGY-IEGNITISGYPKKQETFAR  937

Query  2454  TAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAANIRPDPDIDIFMK  2275
              + Y  Q+D+H P +T  E+L +SA                       +R   ++DI   
Sbjct  938   ISGYCEQNDIHSPHITVYESLHYSAW----------------------LRLPAEVDI---  972

Query  2274  AAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTAGEMLVGPANVLL  2095
                   +   + V+ +++++ L      +VG   + G+S  +RKRLT    LV   +++ 
Sbjct  973   ------ETRKMFVEEVMELVELNPLRQALVGLPGVDGLSTEQRKRLTIAVELVANPSIIF  1026

Query  2094  MDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDDIILISEG-QIVY  1918
             MDE ++GLD+     +++++++ +     T V  + QP+ + ++ FD++ L+  G Q +Y
Sbjct  1027  MDEPTSGLDARAAAIVMRTVRNTVDTGR-TVVCTIHQPSIDIFEAFDELFLLKRGGQEIY  1085

Query  1917  QGPC---NC-VLEFFECLGFRCPERKGV--ADFLQEVTSRKDQMQYWIRKDNKPYRFVTI  1756
              GP    +C ++++FE +      + G   A ++ EV+S  +++   +        F  I
Sbjct  1086  VGPLGRLSCHLIKYFEGIEGVNKIKDGYNPATWMLEVSSTAEELALGVD-------FAEI  1138

Query  1755  NEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREVLLMKR  1576
                SE F+     R L  +L+TP   S        +  Y  S      +C  ++     R
Sbjct  1139  YRNSELFRR---NRALIKDLSTPAPGSKD---LYFSTQYSRSFFTQCLACLWKQHWSYWR  1192

Query  1575  NCVLHIFEVGWVVLMALITMTLFIRTNMQRNSPIGAQIYMSSLFFT-----LTVIMFSAL  1411
             N            ++ LI  T+F          IG++I      F       T ++F  +
Sbjct  1193  NPPYTAVRFLSTTVIGLIFGTMFW--------DIGSKITKRQDLFNAMGSMYTAVLFLGV  1244

Query  1410  QELA---PTI-FRLPIFYKQRDLLFYPAWAYAIPTFILRIPITCIEVSVWVFSTYYVIGY  1243
             Q  A   P +     +FY++R    Y A  YA    ++ +P   ++   +    Y +IG+
Sbjct  1245  QNAASVQPVVAVERTVFYRERAAGMYSALPYAFAQVLIELPYVFVQAVAYGVIVYSMIGF  1304

Query  1242  DPNFGRLLKMWVLLIIFRQLASVLFRSAAVVGRSMTN--AFVVGSFIMLVLFALGGFILS  1069
                  +    W L  ++  L    F     V  S  +  A V+ +    +     GF++ 
Sbjct  1305  GWTISKFF--WYLYFMYFTLLYFTFYGMMAVAVSPNHQIASVISAAFYGIWNVFSGFVIP  1362

Query  1068  RDDVKKWWIWGYWISPLMYAQNAIAVNEF  982
             R  +  WW W  WI P+ +    +  ++F
Sbjct  1363  RSRMPVWWRWYSWICPVFWTLYGLVASQF  1391



>gb|KDO58232.1| hypothetical protein CISIN_1g047682mg, partial [Citrus sinensis]
Length=1425

 Score =  1408 bits (3644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/1041 (66%), Positives = 839/1041 (81%), Gaps = 34/1041 (3%)
 Frame = -2

Query  3027  DDDDEAALKWAALQKVPTFDRLKKGLMTGLRGETFEVDINNIGYeekkkilerliKVPER  2848
             D+DDE AL WAAL+K+PT++RLKKG++T   G   EVD++ +G  E+++++++L+KV + 
Sbjct  4     DEDDEEALIWAALEKLPTYNRLKKGILTASTGAANEVDVHKLGLLERQRLIDKLVKVADV  63

Query  2847  DNETFLLKLKDRMERVAIDIPKVEVRFEHLNVGAEAYVGKRALPSVTNFCLNILEGLLSY  2668
             DNE  LLKLK+R++RV I +P++EVRFEHLNV AEAYVG RALP+  NFC N++EG L+ 
Sbjct  64    DNEQLLLKLKNRVDRVGISLPEIEVRFEHLNVEAEAYVGGRALPTFFNFCANLIEGFLNC  123

Query  2667  LY-LPTTKKHNSILRDVSGIIKPGRMTLLLGPPSSGKTSLLLALAGQLDPSLEFSGRVSY  2491
             L+ LP+ KK  +IL+DV+GI+KP R+TLLLGPP+SGKT+LLLALAG+LDPSL+ SGRV+Y
Sbjct  124   LHILPSRKKKFTILKDVNGIVKPSRLTLLLGPPASGKTTLLLALAGKLDPSLKLSGRVTY  183

Query  2490  NGHEMNEFVPMRTAAYISQHDLHIPEMTARETLAFSARCQGVGSRYEMLAELSRREKAAN  2311
             NGH M+EFVP RTAAYISQHD+HI EMT RETLAFSARCQGVGSRY+ML ELSRREK AN
Sbjct  184   NGHNMDEFVPQRTAAYISQHDVHIGEMTVRETLAFSARCQGVGSRYDMLVELSRREKDAN  243

Query  2310  IRPDPDIDIFMKAAATDGQKANVIVDYIIKVLGLEGCEDTIVGNEYLRGMSGGERKRLTA  2131
             I+PDPDID+FMKA AT+GQ+A+V+ DY+IKVLGL+ C DT+VG+E LRG+SGG+RKR+T 
Sbjct  244   IKPDPDIDVFMKALATEGQEASVVTDYVIKVLGLDVCADTMVGDEMLRGISGGQRKRVTT  303

Query  2130  GEMLVGPANVLLMDEISTGLDSSTTFQILKSIKHYIHILHGTAVIALLQPAPECYDLFDD  1951
             GEMLVGPA  L MDEISTGLDSSTTFQI+ S++  IHIL+GTAVI+LLQPAPE YDLFDD
Sbjct  304   GEMLVGPALALFMDEISTGLDSSTTFQIVTSLRQIIHILNGTAVISLLQPAPETYDLFDD  363

Query  1950  IILISEGQIVYQGPCNCVLEFFECLGFRCPERKGVADFLQEVTSRKDQMQYWIRKDNKPY  1771
             IILISEGQIV+QGP   VLEFF+ +GF CP+RKGVADFLQEVTS+KDQ QYW+RK+ +PY
Sbjct  364   IILISEGQIVFQGPREHVLEFFKSMGFECPKRKGVADFLQEVTSKKDQQQYWVRKE-EPY  422

Query  1770  RFVTINEFSEAFQSFHIGRNLGDELATPFQKSTSHPAALTTKTYGVSKMELLKSCFSREV  1591
             RFVT+ EFS+AFQ+FH+G+ LGD L TPF KS SHPAALTTK+YG++K ELLK+C SRE+
Sbjct  423   RFVTVKEFSDAFQAFHVGQKLGDGLRTPFDKSKSHPAALTTKSYGINKKELLKACISREL  482

Q