BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18688_g1_i2 len=1721 path=[1699:0-602 2302:603-638 2338:639-679
2379:680-1085 2785:1086-1124 2824:1125-1268 2968:1269-1720]

Length=1721
                                                                      Score     E

gb|KDO72510.1|  hypothetical protein CISIN_1g039529mg                   467   8e-156   
ref|XP_004228838.1|  PREDICTED: serine carboxypeptidase-like 45 i...    467   8e-156   
ref|XP_006431097.1|  hypothetical protein CICLE_v10013776mg             466   2e-155   
ref|XP_006363923.1|  PREDICTED: serine carboxypeptidase-like 45-like    465   5e-155   
ref|XP_006482672.1|  PREDICTED: serine carboxypeptidase-like 46-like    464   1e-154   
ref|XP_009762845.1|  PREDICTED: serine carboxypeptidase-like 45         456   2e-151   
ref|XP_006363922.1|  PREDICTED: serine carboxypeptidase-like 45-like    454   2e-150   
ref|XP_004228389.1|  PREDICTED: serine carboxypeptidase-like 45         453   5e-150   
ref|XP_006363924.1|  PREDICTED: serine carboxypeptidase-like 45-like    451   2e-149   
ref|XP_009627244.1|  PREDICTED: serine carboxypeptidase-like 46         446   2e-147   
ref|XP_010265020.1|  PREDICTED: serine carboxypeptidase-like 45         443   2e-146   
ref|XP_003633850.1|  PREDICTED: serine carboxypeptidase-like 46         437   3e-144   
ref|XP_007046208.1|  Serine carboxypeptidase 46 isoform 1               437   5e-144   
ref|XP_010256545.1|  PREDICTED: serine carboxypeptidase-like 45         436   1e-143   
ref|XP_010068795.1|  PREDICTED: serine carboxypeptidase-like 45         429   5e-141   
gb|KCW64994.1|  hypothetical protein EUGRSUZ_G02536                     429   5e-141   
ref|XP_006431096.1|  hypothetical protein CICLE_v10013839mg             429   9e-141   
ref|XP_002277201.1|  PREDICTED: serine carboxypeptidase-like 45 i...    428   2e-140   Vitis vinifera
gb|KDO72509.1|  hypothetical protein CISIN_1g037032mg                   426   6e-140   
emb|CBI22166.3|  unnamed protein product                                429   7e-140   
ref|XP_010068798.1|  PREDICTED: serine carboxypeptidase-like 45         424   5e-139   
gb|KCW64996.1|  hypothetical protein EUGRSUZ_G02538                     424   5e-139   
gb|KHG07552.1|  Serine carboxypeptidase-like 45                         424   6e-139   
ref|XP_010661029.1|  PREDICTED: serine carboxypeptidase-like 45 i...    423   1e-138   
ref|XP_010068797.1|  PREDICTED: serine carboxypeptidase-like 46         422   5e-138   
ref|XP_007046207.1|  Serine carboxypeptidase 46                         416   9e-136   
ref|XP_010322533.1|  PREDICTED: serine carboxypeptidase-like 45 i...    406   2e-132   
ref|XP_006482671.1|  PREDICTED: serine carboxypeptidase-like 44-like    408   1e-131   
ref|XP_007099702.1|  Serine carboxypeptidase 46                         400   1e-129   
ref|XP_006838780.1|  hypothetical protein AMTR_s00002p00258640          399   2e-129   
ref|XP_010322561.1|  PREDICTED: serine carboxypeptidase-like 46 i...    383   3e-124   
ref|XP_007162064.1|  hypothetical protein PHAVU_001G120600g             356   1e-112   
gb|ABR16719.1|  unknown                                                 355   3e-112   Picea sitchensis
ref|XP_010044871.1|  PREDICTED: serine carboxypeptidase-like 45         353   1e-111   
ref|XP_007139316.1|  hypothetical protein PHAVU_008G019100g             353   2e-111   
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45         352   4e-111   Vitis vinifera
ref|XP_003531913.1|  PREDICTED: serine carboxypeptidase-like 45-l...    352   5e-111   
ref|XP_007145476.1|  hypothetical protein PHAVU_007G242200g             351   9e-111   
ref|XP_007043816.1|  Serine carboxypeptidase-like 45 isoform 1          351   9e-111   
ref|XP_003551804.1|  PREDICTED: serine carboxypeptidase-like 45-like    350   1e-110   
gb|AES77859.2|  serine carboxypeptidase-like protein                    350   1e-110   
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45         350   2e-110   
ref|XP_006829355.1|  hypothetical protein AMTR_s02986p00003470          349   2e-110   
ref|XP_004492026.1|  PREDICTED: serine carboxypeptidase-like 45-like    350   2e-110   
ref|XP_009334311.1|  PREDICTED: serine carboxypeptidase-like 45         350   2e-110   
gb|KDP23272.1|  hypothetical protein JCGZ_23105                         350   3e-110   
ref|XP_009368797.1|  PREDICTED: serine carboxypeptidase-like 45         349   4e-110   
ref|XP_010250555.1|  PREDICTED: serine carboxypeptidase-like 45         350   6e-110   
ref|XP_008777393.1|  PREDICTED: serine carboxypeptidase-like 45 i...    348   6e-110   
ref|XP_011036160.1|  PREDICTED: serine carboxypeptidase-like 45 i...    348   1e-109   
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...    348   1e-109   
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45         349   1e-109   
ref|XP_002512656.1|  serine carboxypeptidase, putative                  347   2e-109   Ricinus communis
ref|XP_009337518.1|  PREDICTED: serine carboxypeptidase-like 45         348   2e-109   
gb|KHN31265.1|  Serine carboxypeptidase-like 45                         347   2e-109   
ref|XP_002297872.2|  serine carboxypeptidase S10 family protein         347   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_009143848.1|  PREDICTED: serine carboxypeptidase-like 46         347   3e-109   
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like    347   3e-109   
ref|XP_011036159.1|  PREDICTED: serine carboxypeptidase-like 45 i...    347   4e-109   
gb|KHG09716.1|  Serine carboxypeptidase-like 45                         346   5e-109   
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...    346   5e-109   
gb|KHN08898.1|  Serine carboxypeptidase-like 45                         346   6e-109   
ref|XP_006304410.1|  hypothetical protein CARUB_v10010972mg             346   6e-109   
ref|XP_003554110.2|  PREDICTED: serine carboxypeptidase-like 45-like    346   6e-109   
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like    346   7e-109   
ref|XP_011073181.1|  PREDICTED: serine carboxypeptidase-like 45         346   7e-109   
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                   345   1e-108   
ref|XP_006415698.1|  hypothetical protein EUTSA_v10007573mg             345   2e-108   
ref|XP_011086871.1|  PREDICTED: serine carboxypeptidase-like 45         345   2e-108   
ref|XP_006844530.1|  hypothetical protein AMTR_s00016p00162700          344   2e-108   
ref|XP_010929656.1|  PREDICTED: serine carboxypeptidase-like 45         344   3e-108   
gb|EYU21824.1|  hypothetical protein MIMGU_mgv1a006099mg                344   3e-108   
ref|XP_011020860.1|  PREDICTED: serine carboxypeptidase-like 45         344   3e-108   
ref|NP_564298.1|  serine carboxypeptidase-like 45                       344   3e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008390188.1|  PREDICTED: serine carboxypeptidase-like 45         343   5e-108   
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg             343   6e-108   
gb|KHN47533.1|  Serine carboxypeptidase-like 45                         343   8e-108   
ref|XP_003532390.1|  PREDICTED: serine carboxypeptidase-like 45-l...    343   8e-108   
ref|XP_010942380.1|  PREDICTED: serine carboxypeptidase-like 45         343   8e-108   
ref|XP_002893504.1|  SCPL45                                             343   9e-108   
ref|XP_007137891.1|  hypothetical protein PHAVU_009G164600g             343   1e-107   
ref|XP_010478165.1|  PREDICTED: serine carboxypeptidase-like 45         343   1e-107   
ref|XP_006584695.1|  PREDICTED: serine carboxypeptidase-like 45-l...    343   1e-107   
emb|CDY19500.1|  BnaC04g10990D                                          343   1e-107   
gb|KFK44682.1|  hypothetical protein AALP_AA1G289900                    342   1e-107   
gb|KEH35690.1|  serine carboxypeptidase-like protein                    342   1e-107   
emb|CDO98312.1|  unnamed protein product                                342   1e-107   
emb|CDY11750.1|  BnaC03g58280D                                          342   1e-107   
ref|XP_003528093.2|  PREDICTED: serine carboxypeptidase-like 45-like    343   2e-107   
ref|XP_007223032.1|  hypothetical protein PRUPE_ppa005360mg             342   2e-107   
gb|ABK25202.1|  unknown                                                 342   2e-107   Picea sitchensis
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like    342   2e-107   
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like    342   2e-107   
ref|XP_008374178.1|  PREDICTED: serine carboxypeptidase-like 45         342   2e-107   
gb|AAG51475.1|AC069471_6  serine carboxypeptidase II, putative          342   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009359890.1|  PREDICTED: serine carboxypeptidase-like 45         342   2e-107   
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45         342   2e-107   
ref|XP_008369640.1|  PREDICTED: serine carboxypeptidase-like 45         342   2e-107   
gb|KHN30341.1|  Serine carboxypeptidase-like 45                         342   3e-107   
gb|KHN30340.1|  Serine carboxypeptidase-like 45                         342   3e-107   
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g             341   3e-107   Populus trichocarpa [western balsam poplar]
gb|KHN13827.1|  Serine carboxypeptidase-like 45                         340   7e-107   
ref|XP_007223033.1|  hypothetical protein PRUPE_ppa005360mg             341   7e-107   
ref|XP_010460580.1|  PREDICTED: serine carboxypeptidase-like 45         342   9e-107   
ref|XP_004310134.1|  PREDICTED: serine carboxypeptidase-like 45-like    340   2e-106   
ref|XP_006589008.1|  PREDICTED: serine carboxypeptidase-like 45-like    340   2e-106   
ref|XP_009113703.1|  PREDICTED: serine carboxypeptidase-like 45         339   2e-106   
gb|KHN07932.1|  Serine carboxypeptidase-like 45                         340   2e-106   
gb|KHN09723.1|  Serine carboxypeptidase-like 45                         339   2e-106   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2         340   2e-106   
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1         340   2e-106   
ref|XP_010549305.1|  PREDICTED: serine carboxypeptidase-like 45 i...    340   2e-106   
ref|XP_008777392.1|  PREDICTED: serine carboxypeptidase-like 45 i...    340   2e-106   
ref|XP_010509871.1|  PREDICTED: serine carboxypeptidase-like 46         339   3e-106   
emb|CBI32794.3|  unnamed protein product                                339   3e-106   
ref|XP_004513403.1|  PREDICTED: serine carboxypeptidase-like 45-like    339   4e-106   
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1          339   4e-106   
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249              339   4e-106   
ref|XP_008791046.1|  PREDICTED: serine carboxypeptidase-like 45         338   4e-106   
ref|XP_010469459.1|  PREDICTED: serine carboxypeptidase-like 46         338   5e-106   
ref|XP_009109757.1|  PREDICTED: serine carboxypeptidase-like 45         338   5e-106   
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45         338   6e-106   
ref|XP_010549304.1|  PREDICTED: serine carboxypeptidase-like 45 i...    338   7e-106   
emb|CDX90124.1|  BnaA08g18600D                                          338   8e-106   
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like    340   8e-106   
ref|XP_010499305.1|  PREDICTED: serine carboxypeptidase-like 45         339   9e-106   
ref|XP_002280796.2|  PREDICTED: serine carboxypeptidase-like 45         338   1e-105   Vitis vinifera
gb|KHN08897.1|  Serine carboxypeptidase-like 45                         337   1e-105   
emb|CDY61693.1|  BnaC05g51120D                                          337   1e-105   
ref|XP_003520486.1|  PREDICTED: serine carboxypeptidase-like 45-l...    337   1e-105   
ref|XP_009380118.1|  PREDICTED: serine carboxypeptidase-like 45 i...    337   2e-105   
ref|XP_002277400.2|  PREDICTED: serine carboxypeptidase-like 45         337   2e-105   Vitis vinifera
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor          337   2e-105   Zea mays [maize]
ref|XP_006410496.1|  hypothetical protein EUTSA_v10016623mg             337   2e-105   
emb|CBI32795.3|  unnamed protein product                                336   2e-105   
gb|EYU28449.1|  hypothetical protein MIMGU_mgv1a004999mg                337   4e-105   
ref|XP_003554111.1|  PREDICTED: serine carboxypeptidase-like 45-like    336   4e-105   
gb|KEH33274.1|  serine carboxypeptidase-like protein                    336   5e-105   
ref|XP_004298533.1|  PREDICTED: serine carboxypeptidase-like 45-like    336   5e-105   
gb|KDP37688.1|  hypothetical protein JCGZ_06345                         336   6e-105   
ref|XP_009380117.1|  PREDICTED: serine carboxypeptidase-like 45 i...    337   6e-105   
ref|XP_007162065.1|  hypothetical protein PHAVU_001G120700g             335   6e-105   
gb|EAY93940.1|  hypothetical protein OsI_15713                          335   9e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580          335   1e-104   Sorghum bicolor [broomcorn]
ref|XP_009415855.1|  PREDICTED: serine carboxypeptidase-like 45         335   2e-104   
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...    336   2e-104   
ref|XP_007159977.1|  hypothetical protein PHAVU_002G282700g             334   2e-104   
ref|XP_007028221.1|  Serine carboxypeptidase 45                         334   3e-104   
gb|AAB80670.1|  putative serine carboxypeptidase II                     333   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159978.1|  hypothetical protein PHAVU_002G282700g             333   5e-104   
ref|XP_010413849.1|  PREDICTED: serine carboxypeptidase-like 46         333   5e-104   
ref|XP_002307963.1|  hypothetical protein POPTR_0006s03490g             333   5e-104   Populus trichocarpa [western balsam poplar]
ref|XP_002517289.1|  serine carboxypeptidase, putative                  333   7e-104   Ricinus communis
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...    333   1e-103   
ref|XP_004136792.1|  PREDICTED: serine carboxypeptidase-like 45-like    331   1e-103   
ref|XP_003621641.1|  Serine carboxypeptidase-like protein               333   1e-103   
ref|NP_850212.1|  serine carboxypeptidase-like 46                       332   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881286.1|  hypothetical protein ARALYDRAFT_482299             332   2e-103   
ref|XP_004501743.1|  PREDICTED: serine carboxypeptidase-like 45-like    332   2e-103   
ref|XP_009355272.1|  PREDICTED: serine carboxypeptidase-like 45 i...    332   2e-103   
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g             332   3e-103   Populus trichocarpa [western balsam poplar]
ref|NP_001052663.1|  Os04g0396800                                       332   3e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011075459.1|  PREDICTED: serine carboxypeptidase-like 45         332   3e-103   
ref|XP_004503800.1|  PREDICTED: serine carboxypeptidase-like 45-like    331   3e-103   
ref|XP_010678341.1|  PREDICTED: serine carboxypeptidase-like 45         331   5e-103   
ref|XP_006662960.1|  PREDICTED: serine carboxypeptidase-like 45-like    331   6e-103   
ref|XP_011040748.1|  PREDICTED: serine carboxypeptidase-like 45 i...    330   6e-103   
ref|XP_002282978.2|  PREDICTED: serine carboxypeptidase-like 45         330   8e-103   Vitis vinifera
ref|XP_009404114.1|  PREDICTED: serine carboxypeptidase-like 45         330   9e-103   
gb|KDP37690.1|  hypothetical protein JCGZ_06347                         330   1e-102   
ref|XP_007209121.1|  hypothetical protein PRUPE_ppa005457mg             330   1e-102   
ref|XP_008239549.1|  PREDICTED: serine carboxypeptidase-like 45         330   1e-102   
ref|XP_006652227.1|  PREDICTED: serine carboxypeptidase-like 45-like    329   2e-102   
ref|XP_007046209.1|  Serine carboxypeptidase 46 isoform 2               327   3e-102   
ref|XP_008454133.1|  PREDICTED: serine carboxypeptidase-like 45         328   3e-102   
ref|XP_006380972.1|  hypothetical protein POPTR_0006s03480g             329   3e-102   
ref|XP_009355265.1|  PREDICTED: serine carboxypeptidase-like 45         328   4e-102   
ref|XP_010099600.1|  Serine carboxypeptidase-like 45                    328   4e-102   
ref|XP_004152156.1|  PREDICTED: serine carboxypeptidase-like 45-like    328   5e-102   
ref|XP_010682654.1|  PREDICTED: serine carboxypeptidase-like 45         328   6e-102   
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45         328   7e-102   
ref|XP_006294161.1|  hypothetical protein CARUB_v10023154mg             327   1e-101   
emb|CAN72076.1|  hypothetical protein VITISV_041583                     327   1e-101   Vitis vinifera
ref|XP_002511104.1|  serine carboxypeptidase, putative                  327   1e-101   Ricinus communis
ref|XP_006430527.1|  hypothetical protein CICLE_v10011695mg             327   1e-101   
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45         326   3e-101   
ref|XP_002307961.1|  hypothetical protein POPTR_0006s03440g             327   3e-101   Populus trichocarpa [western balsam poplar]
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...    326   3e-101   
ref|XP_011040753.1|  PREDICTED: serine carboxypeptidase-like 45         327   3e-101   
ref|XP_008443350.1|  PREDICTED: serine carboxypeptidase-like 45         327   4e-101   
ref|XP_007043818.1|  Serine carboxypeptidase-like 45 isoform 3          326   4e-101   
ref|XP_006482059.1|  PREDICTED: serine carboxypeptidase-like 45-like    325   5e-101   
ref|XP_006380973.1|  hypothetical protein POPTR_0006s03480g             326   5e-101   
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...    326   7e-101   
ref|XP_011040747.1|  PREDICTED: serine carboxypeptidase-like 45 i...    325   7e-101   
gb|EEC68261.1|  hypothetical protein OsI_36290                          325   7e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like    325   7e-101   
ref|NP_001176565.1|  Os11g0522900                                       325   8e-101   
ref|XP_004136793.1|  PREDICTED: serine carboxypeptidase-like 45-like    325   1e-100   
ref|NP_001151474.1|  LOC100285107 precursor                             325   1e-100   Zea mays [maize]
ref|XP_008443351.1|  PREDICTED: serine carboxypeptidase-like 45         325   1e-100   
ref|XP_003577529.1|  PREDICTED: serine carboxypeptidase-like 45         325   1e-100   
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...    324   2e-100   
ref|XP_004241645.1|  PREDICTED: serine carboxypeptidase-like 45         323   3e-100   
ref|XP_002520628.1|  serine carboxypeptidase, putative                  323   4e-100   Ricinus communis
ref|XP_009355271.1|  PREDICTED: serine carboxypeptidase-like 45 i...    323   5e-100   
ref|XP_010055754.1|  PREDICTED: serine carboxypeptidase-like 45         323   6e-100   
ref|XP_009355270.1|  PREDICTED: serine carboxypeptidase-like 45 i...    323   6e-100   
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45         323   7e-100   
ref|XP_004159625.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    323   7e-100   
ref|XP_008378883.1|  PREDICTED: serine carboxypeptidase-like 45         322   1e-99    
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45         322   3e-99    
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45         321   3e-99    
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45         320   3e-99    
ref|XP_011040750.1|  PREDICTED: serine carboxypeptidase-like 45         322   5e-99    
ref|XP_004979352.1|  PREDICTED: serine carboxypeptidase-like 45-like    320   7e-99    
emb|CBI32802.3|  unnamed protein product                                329   8e-99    
gb|ABK26025.1|  unknown                                                 317   9e-99    Picea sitchensis
ref|XP_002517286.1|  serine carboxypeptidase, putative                  319   9e-99    Ricinus communis
gb|KHG30064.1|  Serine carboxypeptidase-like 45                         320   1e-98    
ref|XP_009615670.1|  PREDICTED: serine carboxypeptidase-like 45 i...    319   1e-98    
ref|XP_004136677.1|  PREDICTED: serine carboxypeptidase-like 45-like    319   2e-98    
gb|KCW90016.1|  hypothetical protein EUGRSUZ_A02215                     318   3e-98    
gb|KDP37687.1|  hypothetical protein JCGZ_06344                         318   3e-98    
ref|XP_009355268.1|  PREDICTED: serine carboxypeptidase-like 45 i...    317   1e-97    
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg             317   2e-97    
gb|EMS58238.1|  Serine carboxypeptidase-like 45                         316   2e-97    
ref|XP_009355267.1|  PREDICTED: serine carboxypeptidase-like 45 i...    316   2e-97    
ref|XP_007224935.1|  hypothetical protein PRUPE_ppa021576mg             315   4e-97    
ref|XP_010023719.1|  PREDICTED: serine carboxypeptidase-like 45         316   4e-97    
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45         315   8e-97    
ref|XP_003630573.1|  Serine carboxypeptidase                            314   1e-96    
ref|XP_002990798.1|  serine carboxypeptidase-like enzyme                314   2e-96    
ref|XP_010673054.1|  PREDICTED: serine carboxypeptidase-like 45         313   2e-96    
ref|XP_010271869.1|  PREDICTED: serine carboxypeptidase-like 45 i...    313   3e-96    
ref|XP_004238587.1|  PREDICTED: putative serine carboxypeptidase-...    314   3e-96    
ref|XP_008670742.1|  PREDICTED: serine carboxypeptidase-like 45         313   3e-96    
ref|XP_009355269.1|  PREDICTED: serine carboxypeptidase-like 45         313   3e-96    
gb|ABK25236.1|  unknown                                                 313   5e-96    Picea sitchensis
ref|XP_010271866.1|  PREDICTED: serine carboxypeptidase-like 45 i...    314   6e-96    
ref|XP_002974500.1|  serine carboxypeptidase-like enzyme                313   6e-96    
gb|EMS60816.1|  Serine carboxypeptidase-like 45                         313   1e-95    
gb|EYU18606.1|  hypothetical protein MIMGU_mgv1a004861mg                313   1e-95    
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme                311   2e-95    
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme                311   2e-95    
ref|XP_008218862.1|  PREDICTED: serine carboxypeptidase-like 45         311   3e-95    
ref|XP_010271865.1|  PREDICTED: serine carboxypeptidase-like 45 i...    312   4e-95    
gb|KEH37845.1|  serine carboxypeptidase-like protein                    310   6e-95    
gb|KHN30339.1|  Serine carboxypeptidase-like 45                         310   7e-95    
ref|NP_001242846.1|  uncharacterized protein LOC100819443 precursor     310   8e-95    
ref|XP_002972549.1|  serine carboxypeptidase-like enzyme                309   1e-94    
ref|XP_002972012.1|  serine carboxypeptidase-like enzyme                307   6e-94    
ref|XP_006354958.1|  PREDICTED: serine carboxypeptidase-like 40-like    306   3e-93    
ref|XP_009777076.1|  PREDICTED: putative serine carboxypeptidase-...    306   3e-93    
gb|AIC80774.1|  serine carboxypeptidase                                 303   5e-93    
emb|CAN70439.1|  hypothetical protein VITISV_011900                     302   5e-92    Vitis vinifera
ref|XP_006585840.1|  PREDICTED: serine carboxypeptidase-like 45-l...    301   5e-92    
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g             302   1e-91    Populus trichocarpa [western balsam poplar]
ref|XP_002277420.3|  PREDICTED: serine carboxypeptidase-like 45         301   1e-91    Vitis vinifera
emb|CBI32801.3|  unnamed protein product                                299   2e-91    
gb|EMT30771.1|  Serine carboxypeptidase-like 45                         300   3e-91    
ref|XP_010318664.1|  PREDICTED: serine carboxypeptidase-like 45 i...    297   1e-90    
ref|XP_010653632.1|  PREDICTED: serine carboxypeptidase-like 45         298   1e-90    
ref|XP_009107652.1|  PREDICTED: serine carboxypeptidase-like 44 i...    298   2e-90    
ref|XP_009107653.1|  PREDICTED: serine carboxypeptidase-like 44 i...    297   2e-90    
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          299   2e-90    
ref|XP_004148827.1|  PREDICTED: serine carboxypeptidase-like 42-like    298   3e-90    
emb|CDY48945.1|  BnaA08g04690D                                          298   4e-90    
ref|XP_009107650.1|  PREDICTED: serine carboxypeptidase-like 44 i...    297   4e-90    
ref|XP_009107648.1|  PREDICTED: serine carboxypeptidase-like 44 i...    297   6e-90    
ref|XP_009607740.1|  PREDICTED: serine carboxypeptidase-like 40         296   8e-90    
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         297   1e-89    
ref|XP_004488543.1|  PREDICTED: serine carboxypeptidase-like 45-like    297   3e-89    
ref|XP_010100042.1|  Serine carboxypeptidase-like 45                    294   3e-89    
emb|CDX80725.1|  BnaC08g05590D                                          295   6e-89    
gb|KEH35413.1|  serine carboxypeptidase-like protein                    294   1e-88    
ref|XP_009377698.1|  PREDICTED: serine carboxypeptidase-like 42         293   1e-88    
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               294   1e-88    
ref|XP_002449560.1|  hypothetical protein SORBIDRAFT_05g019090          294   2e-88    Sorghum bicolor [broomcorn]
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         293   2e-88    
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme                293   2e-88    
ref|XP_004488374.1|  PREDICTED: serine carboxypeptidase-like 45-like    295   3e-88    
ref|XP_006307408.1|  hypothetical protein CARUB_v10009034mg             292   4e-88    
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme                292   5e-88    
ref|XP_006351861.1|  PREDICTED: serine carboxypeptidase-like 42-like    292   7e-88    
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         291   1e-87    
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               292   1e-87    
ref|XP_002517750.1|  serine carboxypeptidase, putative                  292   1e-87    
ref|XP_010479023.1|  PREDICTED: serine carboxypeptidase-like 44         291   1e-87    
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             291   2e-87    
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    290   2e-87    
gb|KFK24266.1|  hypothetical protein AALP_AAs40498U001000               291   2e-87    
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         290   2e-87    
ref|XP_010055765.1|  PREDICTED: serine carboxypeptidase-like 45         290   2e-87    
ref|XP_010315077.1|  PREDICTED: serine carboxypeptidase-like 42 i...    290   2e-87    
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         289   6e-87    
ref|XP_002298413.2|  putative serine carboxypeptidase family protein    290   6e-87    
gb|KGN59387.1|  hypothetical protein Csa_3G816000                       290   6e-87    
ref|XP_011008273.1|  PREDICTED: serine carboxypeptidase-like 40         290   8e-87    
ref|XP_008443181.1|  PREDICTED: serine carboxypeptidase-like 45 i...    289   1e-86    
ref|XP_010930631.1|  PREDICTED: serine carboxypeptidase-like 42         288   2e-86    
ref|XP_009136205.1|  PREDICTED: serine carboxypeptidase-like 42         287   2e-86    
ref|XP_009377728.1|  PREDICTED: serine carboxypeptidase-like 42         288   2e-86    
ref|XP_003527966.2|  PREDICTED: serine carboxypeptidase-like 42-l...    287   3e-86    
gb|AES71588.2|  serine carboxypeptidase-like protein                    288   3e-86    
ref|XP_004230572.1|  PREDICTED: serine carboxypeptidase-like 42 i...    288   3e-86    
ref|XP_002314061.1|  hypothetical protein POPTR_0009s06080g             288   3e-86    
ref|XP_010679983.1|  PREDICTED: serine carboxypeptidase-like 42         287   4e-86    
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         287   5e-86    
ref|XP_003592242.1|  Serine carboxypeptidase-like protein               287   5e-86    
ref|XP_011041420.1|  PREDICTED: serine carboxypeptidase-like 45         289   6e-86    
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             286   6e-86    
ref|XP_010245825.1|  PREDICTED: serine carboxypeptidase-like 42         286   7e-86    
ref|XP_006858474.1|  hypothetical protein AMTR_s00071p00113850          286   7e-86    
ref|XP_007028219.1|  Serine carboxypeptidase-like 45                    290   7e-86    
ref|NP_175046.1|  serine carboxypeptidase-like 44                       286   8e-86    
ref|XP_010244030.1|  PREDICTED: serine carboxypeptidase-like 42 i...    286   1e-85    
ref|XP_008220190.1|  PREDICTED: serine carboxypeptidase II-3-like       286   1e-85    
ref|XP_010055737.1|  PREDICTED: serine carboxypeptidase-like 45         286   1e-85    
ref|XP_006393769.1|  hypothetical protein EUTSA_v10011445mg             286   1e-85    
ref|XP_008373913.1|  PREDICTED: serine carboxypeptidase-like 42         285   2e-85    
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42         285   2e-85    
ref|XP_010244029.1|  PREDICTED: serine carboxypeptidase-like 42 i...    286   2e-85    
ref|XP_010055750.1|  PREDICTED: serine carboxypeptidase-like 45 i...    283   2e-85    
emb|CDP08509.1|  unnamed protein product                                285   3e-85    
ref|XP_009586680.1|  PREDICTED: serine carboxypeptidase-like 42         285   3e-85    
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             285   4e-85    
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25-like    284   6e-85    
gb|KCW90015.1|  hypothetical protein EUGRSUZ_A02214                     284   6e-85    
ref|XP_008443182.1|  PREDICTED: serine carboxypeptidase-like 45 i...    284   6e-85    
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    284   8e-85    
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       283   1e-84    
ref|XP_009767155.1|  PREDICTED: serine carboxypeptidase-like 42 i...    283   1e-84    
ref|NP_001151858.1|  serine carboxypeptidase F13S12.6 precursor         283   1e-84    
gb|AFW60600.1|  serine carboxypeptidase F13S12.6                        283   1e-84    
emb|CDY55623.1|  BnaC03g77560D                                          283   1e-84    
ref|XP_003522555.2|  PREDICTED: serine carboxypeptidase-like 42-l...    283   2e-84    
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3            283   2e-84    
ref|XP_003542323.2|  PREDICTED: serine carboxypeptidase-like 40-l...    283   2e-84    
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       283   2e-84    
ref|XP_006292523.1|  hypothetical protein CARUB_v10018754mg             281   2e-84    
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               283   3e-84    
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    282   3e-84    
ref|XP_002449388.1|  hypothetical protein SORBIDRAFT_05g009120          282   3e-84    
gb|AAQ63884.1|  putative serine carboxypeptidase                        283   3e-84    
gb|KHN23425.1|  Serine carboxypeptidase-like 42                         281   3e-84    
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         282   3e-84    
ref|XP_009123167.1|  PREDICTED: serine carboxypeptidase-like 42         282   3e-84    
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         282   3e-84    
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         282   3e-84    
gb|KHN46300.1|  Serine carboxypeptidase II-3                            281   3e-84    
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       282   4e-84    
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42         282   4e-84    
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         282   4e-84    
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    282   4e-84    
emb|CDY23340.1|  BnaA08g12060D                                          281   4e-84    
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       284   4e-84    
ref|XP_009406489.1|  PREDICTED: serine carboxypeptidase-like 42         281   4e-84    
ref|XP_006434388.1|  hypothetical protein CICLE_v10000998mg             281   5e-84    
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             281   6e-84    
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1          281   6e-84    
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    281   6e-84    
emb|CDP12019.1|  unnamed protein product                                281   7e-84    
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         281   7e-84    
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         281   8e-84    
emb|CDO99730.1|  unnamed protein product                                281   8e-84    
ref|XP_003615811.1|  Serine carboxypeptidase-like protein               281   9e-84    
ref|NP_001183841.1|  hypothetical protein precursor                     281   9e-84    
gb|KHN12757.1|  Serine carboxypeptidase II-3                            280   1e-83    
ref|NP_567854.1|  serine carboxypeptidase-like 29                       281   1e-83    
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     281   1e-83    
ref|XP_006473888.1|  PREDICTED: serine carboxypeptidase-like 40-like    281   1e-83    
gb|KHF97371.1|  Serine carboxypeptidase-like 42                         281   1e-83    
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    280   2e-83    
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             280   2e-83    
ref|XP_006472927.1|  PREDICTED: serine carboxypeptidase-like 42-like    280   2e-83    
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         280   2e-83    
ref|XP_002891272.1|  predicted protein                                  280   2e-83    
ref|XP_011025504.1|  PREDICTED: serine carboxypeptidase-like 40 i...    281   2e-83    
emb|CDY23258.1|  BnaA08g12880D                                          280   2e-83    
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179             280   2e-83    
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         280   3e-83    
ref|XP_003544446.1|  PREDICTED: serine carboxypeptidase II-3-like...    280   3e-83    
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       280   3e-83    
gb|ABR16596.1|  unknown                                                 281   4e-83    
ref|XP_010055727.1|  PREDICTED: serine carboxypeptidase-like 45         279   4e-83    
ref|XP_010067792.1|  PREDICTED: serine carboxypeptidase-like 40         280   4e-83    
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          279   5e-83    
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              279   5e-83    
ref|XP_007137531.1|  hypothetical protein PHAVU_009G134900g             279   5e-83    
ref|XP_010530237.1|  PREDICTED: serine carboxypeptidase-like 42         279   5e-83    
emb|CDX68695.1|  BnaC01g07580D                                          279   5e-83    
dbj|BAJ85578.1|  predicted protein                                      279   5e-83    
ref|NP_001150705.1|  LOC100284338 precursor                             279   5e-83    
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       279   5e-83    
gb|KCW90013.1|  hypothetical protein EUGRSUZ_A02209                     279   5e-83    
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       280   6e-83    
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    279   7e-83    
gb|KCW90021.1|  hypothetical protein EUGRSUZ_A02221                     279   7e-83    
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         278   7e-83    
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         278   8e-83    
dbj|BAJ92218.1|  predicted protein                                      280   8e-83    
ref|XP_004959517.1|  PREDICTED: serine carboxypeptidase II-3-like       279   8e-83    
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             279   9e-83    
ref|XP_007017345.1|  Serine carboxypeptidase 40, putative               281   1e-82    
ref|XP_010694765.1|  PREDICTED: serine carboxypeptidase-like 40         279   1e-82    
ref|XP_011091773.1|  PREDICTED: serine carboxypeptidase-like 40         278   1e-82    
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    278   1e-82    
ref|XP_004303115.1|  PREDICTED: serine carboxypeptidase-like 40-like    279   1e-82    
emb|CBI29056.3|  unnamed protein product                                278   1e-82    
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             277   1e-82    
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            278   1e-82    
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            278   2e-82    
ref|XP_007224802.1|  hypothetical protein PRUPE_ppa023729mg             278   2e-82    
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             278   2e-82    
ref|XP_004231124.2|  PREDICTED: serine carboxypeptidase-like 40         279   2e-82    
emb|CDY28216.1|  BnaA01g06330D                                          278   2e-82    
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg             276   2e-82    
ref|XP_009377699.1|  PREDICTED: serine carboxypeptidase-like 42         277   2e-82    
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    278   2e-82    
ref|XP_003577714.1|  PREDICTED: serine carboxypeptidase-like 42         277   2e-82    
gb|AES71590.2|  serine carboxypeptidase-like protein                    278   2e-82    
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         276   2e-82    
ref|XP_007219043.1|  hypothetical protein PRUPE_ppa004618mg             278   2e-82    
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         278   2e-82    
ref|XP_007052442.1|  Serine carboxypeptidase-like 40                    279   2e-82    
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    277   3e-82    
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         277   3e-82    
ref|XP_002463311.1|  hypothetical protein SORBIDRAFT_02g041610          278   3e-82    
ref|XP_010519388.1|  PREDICTED: serine carboxypeptidase-like 42         277   3e-82    
gb|KFK35499.1|  hypothetical protein AALP_AA5G292700                    278   3e-82    
ref|XP_010062160.1|  PREDICTED: serine carboxypeptidase-like 42         277   3e-82    
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         276   3e-82    
gb|AAD28662.1|  putative serine carboxypeptidase II                     276   3e-82    
ref|XP_004229673.1|  PREDICTED: serine carboxypeptidase-like 40         278   3e-82    
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    276   3e-82    
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               276   4e-82    
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         276   4e-82    
ref|XP_004979109.1|  PREDICTED: serine carboxypeptidase-like 42-like    276   5e-82    
ref|XP_002300939.1|  serine carboxypeptidase S10 family protein         276   5e-82    
emb|CBI36578.3|  unnamed protein product                                276   5e-82    
ref|XP_001751694.1|  predicted protein                                  276   5e-82    
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         276   5e-82    
ref|XP_004290564.1|  PREDICTED: serine carboxypeptidase-like 42-like    276   6e-82    
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    276   6e-82    
emb|CBI21207.3|  unnamed protein product                                276   6e-82    
ref|NP_001242872.1|  uncharacterized protein LOC100820473 precursor     276   6e-82    
ref|XP_002528403.1|  serine carboxypeptidase, putative                  276   7e-82    
ref|XP_008786550.1|  PREDICTED: serine carboxypeptidase-like 42         276   8e-82    
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       276   8e-82    
emb|CDP16358.1|  unnamed protein product                                276   9e-82    
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            275   9e-82    
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         275   9e-82    
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    276   9e-82    
ref|XP_006470494.1|  PREDICTED: serine carboxypeptidase-like 40-like    276   1e-81    
ref|NP_179978.2|  serine carboxypeptidase-like 22                       275   1e-81    
ref|NP_178642.1|  serine carboxypeptidase-like 38                       276   1e-81    
ref|XP_010472396.1|  PREDICTED: serine carboxypeptidase-like 22         275   1e-81    
gb|KHN05141.1|  Serine carboxypeptidase II-3                            276   1e-81    
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          277   1e-81    
gb|KEH17668.1|  serine carboxypeptidase-like protein                    276   1e-81    
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40-like    276   1e-81    
gb|KHN05260.1|  Serine carboxypeptidase-like 42                         275   1e-81    
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    276   1e-81    
gb|AFK37459.1|  unknown                                                 275   1e-81    
ref|XP_003544740.2|  PREDICTED: serine carboxypeptidase-like 42-l...    275   1e-81    
gb|KDP43605.1|  hypothetical protein JCGZ_16892                         276   1e-81    
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            276   1e-81    
ref|XP_002876724.1|  hypothetical protein ARALYDRAFT_486857             276   2e-81    
tpg|DAA61817.1|  TPA: hypothetical protein ZEAMMB73_814931              276   2e-81    
emb|CDP16360.1|  unnamed protein product                                275   2e-81    
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           275   2e-81    
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    275   2e-81    
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         275   2e-81    
dbj|BAD33942.1|  putative serine carboxypeptidase precursor             275   2e-81    
ref|XP_011074776.1|  PREDICTED: serine carboxypeptidase-like 42         275   2e-81    
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             275   2e-81    
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             275   2e-81    
ref|XP_010512774.1|  PREDICTED: serine carboxypeptidase-like 40 i...    275   2e-81    
gb|KHN30516.1|  Serine carboxypeptidase-like 40                         275   2e-81    
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       275   2e-81    
ref|XP_008237677.1|  PREDICTED: serine carboxypeptidase-like 42         274   2e-81    
ref|XP_010068958.1|  PREDICTED: serine carboxypeptidase-like 40         275   2e-81    
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    274   3e-81    
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         275   3e-81    
gb|KEH21654.1|  serine carboxypeptidase-like protein                    274   3e-81    
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    274   3e-81    
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            274   3e-81    
ref|NP_194790.1|  serine carboxypeptidase 24                            274   3e-81    
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    274   3e-81    
ref|XP_010468839.1|  PREDICTED: serine carboxypeptidase-like 40         275   3e-81    
ref|XP_004306277.1|  PREDICTED: serine carboxypeptidase II-3-like       274   4e-81    
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       275   4e-81    
ref|XP_009592794.1|  PREDICTED: serine carboxypeptidase-like 40         275   4e-81    
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    274   4e-81    
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         274   4e-81    
ref|XP_009600050.1|  PREDICTED: serine carboxypeptidase-like 42         274   4e-81    
ref|XP_002865546.1|  hypothetical protein ARALYDRAFT_494806             274   4e-81    
ref|XP_007159282.1|  hypothetical protein PHAVU_002G224800g             274   4e-81    
ref|XP_010429353.1|  PREDICTED: serine carboxypeptidase-like 22         273   4e-81    



>gb|KDO72510.1| hypothetical protein CISIN_1g039529mg [Citrus sinensis]
Length=477

 Score =   467 bits (1202),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 318/459 (69%), Gaps = 18/459 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQPS+V FNQYSGYIVT    GRALFYYFAEAQS D  S+PLTLWL GG  C
Sbjct  19    AELIKALPGQPSNVSFNQYSGYIVTDAEHGRALFYYFAEAQSPDHLSLPLTLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G+F E+GPF+P E+G+L+KN++SWNL SNMLYVD+PIGV +SYSNTSSDYK+W+D
Sbjct  79    SSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVDSPIGVGYSYSNTSSDYKLWND  138

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
               TA +NL+F+  WF EF +Y+D +F++AGDSY GH  PQLA LI++YN++P ++RPIKL
Sbjct  139   AATAEDNLRFIVNWFKEFPQYKDSEFFLAGDSYAGHYVPQLATLIMKYNKQP-NIRPIKL  197

Query  657   KGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSG-EMSEDCS  830
             +GIALGNPLL+  + +   E+LW +G IS E   L+K  C+ ++ ++E + G   S+ C+
Sbjct  198   RGIALGNPLLDLDISVLGGEYLWSHGAISDETLMLEKTVCNDSKYLREFVHGNNHSQGCN  257

Query  831   DINVMISEEIGDDMHKDNLLFQSC-----QTDQYSSSQRHCLGTET------AKADPCLL  977
              +   ISEE+G D+ + +LL   C      T+Q+    +H    +T      +  DPC+ 
Sbjct  258   QVFDRISEEVGADIDRQDLLSPFCIPISTSTEQFKPIDKHGKIHKTMARRGASTGDPCIY  317

Query  978   TWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLL  1145
               +  YL++P+VQ+ALHAN +     WD           +  ++I+P +S LLK GIP+L
Sbjct  318   GRIFTYLNKPKVQKALHANTTHLPFHWDFCDGPLVYQFEDFELNIIPLVSELLKEGIPIL  377

Query  1146  IYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVA  1325
             +YSGD+D +IP++ TR +AN LA  L L  +    PWY+ KQ+GGWSQ+FG    G+ V 
Sbjct  378   LYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTTYGPWYNDKQVGGWSQSFGAFRDGKNVT  437

Query  1326  NLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1442
             NLTFATVRGG+H VP +SPS+ALTLF++ L GSP P  H
Sbjct  438   NLTFATVRGGAHEVPFTSPSEALTLFRSLLTGSPLPRPH  476



>ref|XP_004228838.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=482

 Score =   467 bits (1202),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 231/463 (50%), Positives = 317/463 (68%), Gaps = 18/463 (4%)
 Frame = +3

Query  93    YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTL  272
             Y +  + + E+I SLPGQP ++ F QYSGYIVT+   GRALFYYF EA SE+  S+PLT+
Sbjct  13    YLLFYKSSCELITSLPGQPPNIFFKQYSGYIVTNSQHGRALFYYFVEADSENAASLPLTI  72

Query  273   WLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTS  452
             WL G   CSS   G F E+GPF+P +DG L+KN FSWNL SNMLYVD+PIGV FSYSNTS
Sbjct  73    WLNGAPGCSSLGYGAFMEHGPFQPGKDGRLIKNNFSWNLESNMLYVDSPIGVGFSYSNTS  132

Query  453   SDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKP  632
             SD   W DT TA+ENL+F+ KWF +F +YR+ D Y+ G+SY GH  PQ A L+L+YNR P
Sbjct  133   SDNINWDDTATAKENLQFILKWFKKFPQYRNSDVYLTGESYAGHYIPQFAVLLLDYNRTP  192

Query  633   VHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSG  809
              +V+PIKLK IALGNPLL+ ++ + + E+LW +G+IS EL  + K  C+ TR V E +  
Sbjct  193   -NVKPIKLKSIALGNPLLDIEISVKSAEYLWAHGVISDELLDMHKTICNETRYVMEFVHN  251

Query  810   EMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA-----------  956
             E S +C+ +  + +EE+G+D+ K ++L   C +   ++ +   LG  T            
Sbjct  252   ETSNECAKVIELRTEEMGNDIVKYDVLLPKCVSSS-AAGRLKALGNLTTVHGKFDKKVGK  310

Query  957   KADPCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALL  1124
              ADPCL  W++ YL++PEVQ+ALHAN +    +W+         + + AIDI+P LS +L
Sbjct  311   VADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCSGPLQYKMEDAAIDIIPLLSNIL  370

Query  1125  KRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNS  1304
             K+ IP+L++SGD+D  +P++ TR++A +LA  L L  ++   PWYDG QIGGWSQ++G  
Sbjct  371   KQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYGGV  430

Query  1305  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
               G+ +  LTFATVRG +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  431   REGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  473



>ref|XP_006431097.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
 gb|ESR44337.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
Length=477

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 233/459 (51%), Positives = 318/459 (69%), Gaps = 18/459 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQPS+V FNQYSGYIVT    GRALFYYFAEAQS D  S+PLTLWL GG  C
Sbjct  19    AELIKALPGQPSNVSFNQYSGYIVTDAEHGRALFYYFAEAQSPDHLSLPLTLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G+F E+GPF+P E+G+L+KN++SWNL SNMLYVD+PIGV +SYSNTSSDYK+W+D
Sbjct  79    SSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVDSPIGVGYSYSNTSSDYKLWND  138

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
               TA +NL+F+  WF EF +Y+D +F++AGDSY GH  PQLA LI++YN++P ++RPIKL
Sbjct  139   AATAEDNLRFIVNWFKEFPQYKDSEFFLAGDSYAGHYVPQLATLIMKYNKQP-NIRPIKL  197

Query  657   KGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSG-EMSEDCS  830
             +GIALGNPLL+  + +   E+LW +G IS E   L+K  C++++ ++E + G   S+ C+
Sbjct  198   RGIALGNPLLDLDISVLGGEYLWSHGAISDETLMLEKTVCNNSKYLREFVHGNNHSQGCN  257

Query  831   DINVMISEEIGDDMHKDNLLFQSC-----QTDQYSSSQRHCLGTET------AKADPCLL  977
              +   ISEE+G D+ + +LL   C      T+Q+    +H    +T      +  DPC+ 
Sbjct  258   QVFDRISEEVGADIDRQDLLSPFCIPISTSTEQFKPIDKHGKIHKTMARRGASTGDPCIY  317

Query  978   TWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLL  1145
               +  YL++P+VQ+ALHAN +     WD           +  ++I+P +S LLK GIP+L
Sbjct  318   GRIFTYLNKPKVQKALHANTTHLPFHWDFCDGPLVYQFEDFELNIIPLVSELLKEGIPIL  377

Query  1146  IYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVA  1325
             +YSGD+D +IP++ TR +AN LA  L L  +    PWY+ KQ+GGWSQ+FG    G+ V 
Sbjct  378   LYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTTYGPWYNDKQVGGWSQSFGAFRDGKNVT  437

Query  1326  NLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1442
             NLTFAT RGG+H VP +SPS+ALTLF++ L GSP P  H
Sbjct  438   NLTFATARGGAHEVPFTSPSEALTLFRSLLTGSPLPRPH  476



>ref|XP_006363923.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=480

 Score =   465 bits (1197),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 232/470 (49%), Positives = 319/470 (68%), Gaps = 18/470 (4%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             +L +   Y +  + + E+I SLPGQP ++ F QYSGYIVT+   GR+LFYYF EA SE+ 
Sbjct  4     WLCIFVSYLLFYKSSCELITSLPGQPPNIFFKQYSGYIVTNSQHGRSLFYYFVEADSENA  63

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S+PLTLWL GG  CSS   G F E+GPFRP +DG L+KN FSWNL SNMLYVD+PIGV 
Sbjct  64    ASLPLTLWLNGGPGCSSVGYGAFMEHGPFRPGKDGSLIKNNFSWNLESNMLYVDSPIGVG  123

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYSNTSSD+  W DT TA+ENL+F+ KWF +F  YR+ D Y+ G+SY GH  PQ A L+
Sbjct  124   FSYSNTSSDHINWDDTATAKENLQFILKWFKKFPRYRNSDVYLTGESYAGHYIPQFAVLL  183

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRM  788
             L+YNR P +V+PIKLK IALGNPLL+  + + + E+LW +G+IS EL  + K  C+ T+ 
Sbjct  184   LDYNRTP-NVKPIKLKSIALGNPLLDIDISVKSAEYLWAHGVISDELLDMHKTICNETKF  242

Query  789   VQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT-------  947
             + E    E S +C+ +    +EE+G+D+ + ++L   C +   ++ Q   LG        
Sbjct  243   MIEYTHNETSNECAKVMEHKTEEMGNDIVRYDILLPKCVSSS-AAGQLKALGNLATVHEK  301

Query  948   ---ETAK-ADPCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDIL  1103
                +  K ADPCL  W++ YL++PEVQ+ALHAN +    +W+         + ++A DI+
Sbjct  302   FDKKVGKVADPCLKEWINLYLNKPEVQKALHANTTNLPYSWEVCSGPLQYKMEDVATDII  361

Query  1104  PTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGW  1283
             P LS +LK+ IP+L++SGD+D  +P++ TR++A +LA  L L  ++   PWYDG QIGGW
Sbjct  362   PLLSNILKQHIPILLFSGDQDSILPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGW  421

Query  1284  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             SQ++G    G+ V  LTFATVRG +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  422   SQSYGGVREGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  471



>ref|XP_006482672.1| PREDICTED: serine carboxypeptidase-like 46-like [Citrus sinensis]
Length=477

 Score =   464 bits (1194),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 232/459 (51%), Positives = 318/459 (69%), Gaps = 18/459 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQPS+V FNQYSGYIVT    GRALFYYFAEAQS D  S+PLTLWL GG  C
Sbjct  19    AELIKALPGQPSNVSFNQYSGYIVTDAEHGRALFYYFAEAQSPDHLSLPLTLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G+F E+GPF+P E+G+L+KN++SWNL SNMLYVD+PIGV +SYSNTSSDYK+W+D
Sbjct  79    SSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVDSPIGVGYSYSNTSSDYKLWND  138

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
               TA +NL+F+  WF EF +Y+D +F++AGDSY GH  PQLA LI++YN++P ++RPIKL
Sbjct  139   AATAEDNLRFIVNWFKEFPQYKDSEFFLAGDSYAGHYVPQLATLIMKYNKQP-NIRPIKL  197

Query  657   KGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSG-EMSEDCS  830
             +GIALGNPLL+  + +   E+LW +G IS E   L++  C+ ++ ++E + G   S+ C+
Sbjct  198   RGIALGNPLLDLDISVLGGEYLWSHGAISDETLMLERTVCNDSKYLREFVHGNNHSQGCN  257

Query  831   DINVMISEEIGDDMHKDNLLFQSC-----QTDQYSSSQRHCLGTET------AKADPCLL  977
              +   ISEE+G D+ + +LL   C      T+Q+    +H    +T      +  DPC+ 
Sbjct  258   QVFDRISEEVGADIDRQDLLSPFCVPISTSTEQFKPIDKHGKIHKTMARRGASTGDPCIY  317

Query  978   TWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLL  1145
               +  YL++P+VQ+ALHAN +     WD           +  ++I+P +S LLK GIP+L
Sbjct  318   GRIFTYLNKPKVQKALHANTTHLPFHWDFCDGPLVYQFEDFELNIIPLVSELLKEGIPIL  377

Query  1146  IYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVA  1325
             +YSGD+D +IP++ TR +AN LA  L L  + +  PWY+ KQ+GGWSQ+FG    G+ V 
Sbjct  378   LYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTIYGPWYNDKQVGGWSQSFGAFRDGKNVT  437

Query  1326  NLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1442
             NLTFATVRGG+H VP +SPS+ALTLF++ L  SP P  H
Sbjct  438   NLTFATVRGGAHEVPFTSPSEALTLFRSLLTRSPLPRPH  476



>ref|XP_009762845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=486

 Score =   456 bits (1173),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 228/470 (49%), Positives = 315/470 (67%), Gaps = 17/470 (4%)
 Frame = +3

Query  69    WFLLVNTLYSI-SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             WF ++    S    + + E+I SLPGQP ++ F QYSGYIVT+   GRALFYYF EA SE
Sbjct  4     WFYVITIFSSFFYYKSSAELITSLPGQPPNIFFKQYSGYIVTNSQHGRALFYYFVEADSE  63

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             +  S+PLTLWL GG  CSS   G F E+GPF+P  DG L+KN++SWNL SNMLYV++PIG
Sbjct  64    NAASLPLTLWLNGGPGCSSVGFGAFMEHGPFQPGIDGNLMKNKYSWNLVSNMLYVESPIG  123

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAE  605
             V FSYSNTSSDY  W DT TA+ENL+F+  WF +F +YR+ D Y+AG+SY GH  PQL  
Sbjct  124   VGFSYSNTSSDYINWDDTATAKENLQFILNWFKKFPQYRNSDVYLAGESYAGHYIPQLTV  183

Query  606   LILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDST  782
             L+L+YNRKP +V PI LK IALGNPLL+ ++ + + ++LW +G IS EL  +++  C+ T
Sbjct  184   LLLDYNRKP-NVEPINLKSIALGNPLLDLEISVKSAQYLWSHGAISDELLTMKRTICNET  242

Query  783   RMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK-  959
             R + E +   +S +C  ++ +  EE+G D+   +LL  +C +   ++ Q   L T   K 
Sbjct  243   RFLLESIHNNLSNECKKVSELTDEEMGSDIDMGDLLAPTCVSSG-TAKQLGALATIHGKF  301

Query  960   --------ADPCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDIL  1103
                     ADPCL   ++ YL++PEVQ+ALHAN +     WD      +    +LA++ +
Sbjct  302   VKKAVGEVADPCLTDRINLYLNKPEVQKALHANTTYLPYAWDFCLGNLHYRREDLAVNTI  361

Query  1104  PTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGW  1283
             P LS +LK  I +L++SGD+D +IP++ TR++A +LA  + L  ++    WYDG QIGGW
Sbjct  362   PLLSNILKENIQVLLFSGDQDSKIPLTQTRKIAKLLARDVKLVALDKYGSWYDGLQIGGW  421

Query  1284  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             SQ+FG    G+ +  LTFATVRG +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  422   SQSFGGLREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGHPPP  471



>ref|XP_006363922.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=496

 Score =   454 bits (1168),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 228/468 (49%), Positives = 318/468 (68%), Gaps = 17/468 (4%)
 Frame = +3

Query  72    FLLVNTLYS--ISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L + T++S  +  + + E+I SLPGQP ++ F QYSGYI+T+   GR+LFYYF EA SE
Sbjct  5     WLCIFTIFSSFLFYKTSCELITSLPGQPPNIIFKQYSGYIITNSQHGRSLFYYFVEADSE  64

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             +  S+PLTLWL GG  CSS   G F E+GPF+P +DG L+KN++SWNL SNMLYV++PIG
Sbjct  65    NATSLPLTLWLNGGPGCSSVGFGAFMEHGPFQPGKDGRLIKNKYSWNLESNMLYVESPIG  124

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAE  605
             V FSYSNTSSDY  W D  TA+ENL+F+  W  +F EY++ + ++AG+SY GH  PQL  
Sbjct  125   VGFSYSNTSSDYTNWDDVATAKENLQFILNWLEKFPEYKNSELFLAGESYAGHYIPQLTI  184

Query  606   LILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDST  782
             L+L+YNRKP +V+PIKLK IALGNPLL+ ++ + + E+LW +G IS EL  +++  C+ T
Sbjct  185   LLLDYNRKP-NVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELLTMKRTICNET  243

Query  783   RMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA--  956
             R++ E +   MS +CS++  + +EE+G D    +LL   C +   ++ Q   LGT     
Sbjct  244   RLLLESIHNNMSNECSEVWELTNEEMGSDTDMGDLLAPICVSSG-AAGQLGVLGTLATIH  302

Query  957   ------KADPCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILP  1106
                     DPCL   ++ YL++PEVQ+ALHAN +     WD           +LAI+++P
Sbjct  303   KKDVRKIGDPCLTDRINMYLNKPEVQKALHANTTHLPYAWDFCLGHLQYQRGDLAINVIP  362

Query  1107  TLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWS  1286
              LS +LK  I +L+YSGD+D +IP++ TR++A +LA  L L  ++   PWYD  QIGGWS
Sbjct  363   LLSNILKENIQVLLYSGDQDTKIPLTQTRKIAKLLARDLKLVALDKYGPWYDDMQIGGWS  422

Query  1287  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPP  1430
             Q++G    G+ V  LTFATVRG +H VP +SPS+ALTLF+AFLKG PP
Sbjct  423   QSYGGVIEGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLKGQPP  470



>ref|XP_004228389.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=490

 Score =   453 bits (1165),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 229/459 (50%), Positives = 310/459 (68%), Gaps = 15/459 (3%)
 Frame = +3

Query  93    YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTL  272
             Y +  + + E+I SLPGQP ++ F Q+SGYIVT+   GRALFYYF EA SE+  S+PLTL
Sbjct  11    YLLFYKSSCELITSLPGQPPNIFFKQHSGYIVTNSQNGRALFYYFVEADSENATSLPLTL  70

Query  273   WLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTS  452
             WL GG  CSS   G+F E+GPF+P +DG L+KN++SWNL SNMLYV++PIGV FSYSNTS
Sbjct  71    WLNGGPGCSSVGFGVFMEHGPFQPGKDGRLIKNKYSWNLESNMLYVESPIGVGFSYSNTS  130

Query  453   SDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKP  632
             SDY  W D  TA+ENL+FL  W  +F EYR+LD ++AG+SY GH  PQL  L+L+YNRKP
Sbjct  131   SDYVNWDDVATAKENLQFLLNWLEKFPEYRNLDLFLAGESYAGHYIPQLTVLLLDYNRKP  190

Query  633   VHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSG  809
              +V+PIKLK IALGNPLL+ ++ + + E+LW +G IS EL  +++  C+ TR++ E +  
Sbjct  191   -NVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELLTMKRTICNETRLLLESIHH  249

Query  810   EMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA--------KAD  965
              MS +CS +  + +EE+G D    +LL   C +    + Q   LG   +          D
Sbjct  250   NMSNECSKVWDLTNEEMGSDTDTGDLLAPICVSSGV-AGQLGVLGKLASIHEKDVREIGD  308

Query  966   PCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRG  1133
             PCL   +  YL++PEVQ+ALHAN +     WD           +LAI+++P LS +LK  
Sbjct  309   PCLTDRIYMYLNKPEVQKALHANTTHLPYAWDFCLGHLQYQRGDLAINVIPLLSNILKEN  368

Query  1134  IPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGG  1313
             I +L+YSGD+D +IP++ TR++A +LA  L L  ++   PWYDG QIGGWSQ+FG    G
Sbjct  369   IQVLLYSGDQDTKIPLTQTRKIAKLLARDLKLVALDKYGPWYDGLQIGGWSQSFGGVREG  428

Query  1314  EKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPP  1430
             + V  LTFAT+RG +H VP +SPS+ALTLF+ FLKG  P
Sbjct  429   KNVTYLTFATIRGAAHEVPYTSPSQALTLFRTFLKGQSP  467



>ref|XP_006363924.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=493

 Score =   451 bits (1161),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 226/460 (49%), Positives = 310/460 (67%), Gaps = 15/460 (3%)
 Frame = +3

Query  93    YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTL  272
             Y +  + + E+I SLPGQP ++ F QYSGYIVT+   GR+LFYYF EA SE+  S+PLTL
Sbjct  11    YLLFYKSSCELITSLPGQPPNIFFKQYSGYIVTNSQHGRSLFYYFVEADSENATSLPLTL  70

Query  273   WLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTS  452
             WL GG  CSS   G F E+GPF+P +DG L+KN++SWNL SNMLY+++PI V FSYSNTS
Sbjct  71    WLNGGPGCSSVGFGAFKEHGPFQPGKDGRLIKNKYSWNLESNMLYIESPIRVGFSYSNTS  130

Query  453   SDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKP  632
             SDY  W D  TA+ENL+F+  W  +F EY++ + ++AG+SY GH  PQL  L+++YNRKP
Sbjct  131   SDYTNWDDVATAKENLQFILNWLEKFPEYKNSELFLAGESYAGHYIPQLTILLIDYNRKP  190

Query  633   VHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSG  809
              +V+PIKLK IALGNPLL+ ++ + + E+LW +G IS EL  +++  C+ TR++ E +  
Sbjct  191   -NVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELLTMKRTICNETRLLLESIHN  249

Query  810   EMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA--------KAD  965
              MS DCS++  + +EE+G D    +LL   C +   ++ Q   LG              D
Sbjct  250   NMSNDCSEVWELTNEEMGSDTDMGDLLAPICVSSG-AAGQLGVLGKLATIHEKDVRKSGD  308

Query  966   PCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRG  1133
             PCL   +  YL++PEVQ+ALHAN +     WD           +LAI+++P LS +LK  
Sbjct  309   PCLTDRIYMYLNKPEVQKALHANTTHLPYAWDFCLGHLQYQRGDLAINVIPLLSNILKEN  368

Query  1134  IPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGG  1313
             I +L+YSGD+D +IPV+ TR++A +LA  L L  ++   PWYD  QIGGWSQ++G    G
Sbjct  369   IQVLLYSGDQDTKIPVTQTRKIAKLLARDLKLVALDKYGPWYDDLQIGGWSQSYGGVREG  428

Query  1314  EKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             + V  LTFATVRG +H VP +SPS+ALTLF+AFLKG PPP
Sbjct  429   KNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLKGQPPP  468



>ref|XP_009627244.1| PREDICTED: serine carboxypeptidase-like 46 [Nicotiana tomentosiformis]
Length=479

 Score =   446 bits (1147),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 223/449 (50%), Positives = 307/449 (68%), Gaps = 16/449 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I SLPGQP ++ F QYSGYIVT+   GRALFYYF +A SE+  S+PLT+WL GG  C
Sbjct  21    AELITSLPGQPPNIFFKQYSGYIVTNAQHGRALFYYFVDADSENAASLPLTVWLNGGPGC  80

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F E+GPF+P  DG L+KN++SWNL SNMLYV++PIGV FSYSNTSSDY  W D
Sbjct  81    SSVGFGAFMEHGPFQPRIDGSLIKNKYSWNLVSNMLYVESPIGVGFSYSNTSSDYTNWDD  140

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
             T TA+ENL+F+  WF +F +YR+ D Y+AG+SY GH  PQL  L+L+YNRKP +V+PIKL
Sbjct  141   TATAKENLQFILNWFKKFPQYRNSDVYLAGESYAGHYIPQLTVLLLDYNRKP-NVKPIKL  199

Query  657   KGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             K IALGNPLL+ ++ + + E+LW +G IS EL  ++++ C+ TR + E +   +S +C+ 
Sbjct  200   KSIALGNPLLDLEISVKSSEYLWSHGAISDELLTMRRKICNETRFLLESIHNNVSNECTK  259

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK---------ADPCLLTWV  986
             +  +  EE+G D+   +LL  +C +   ++ Q   L T   K         A+ CL   +
Sbjct  260   VWELTDEEMGSDIDMGDLLAPTCVSSG-TARQLGALATIHGKFVKHEVGKVAETCLTDRI  318

Query  987   DDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYS  1154
             + YL++PEVQ+ALHAN +     WD      +    +LA++ +P LS +LK  I +L +S
Sbjct  319   NLYLNKPEVQKALHANTTYLPYAWDFCLGYLHYRREDLAVNTIPLLSNILKENIQVLFFS  378

Query  1155  GDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLT  1334
             GD+D +IP++ TR++A +LA  L L  ++   PWYDG QIGGWSQ+FG    G+ V  LT
Sbjct  379   GDQDSKIPLTQTRKIAKLLARDLKLVALDKYGPWYDGLQIGGWSQSFGGLREGKNVTYLT  438

Query  1335  FATVRGGSHFVPNSSPSKALTLFKAFLKG  1421
             FATVRG +H VP +SPS+ALTLF+AFL+G
Sbjct  439   FATVRGAAHEVPFTSPSQALTLFRAFLRG  467



>ref|XP_010265020.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=474

 Score =   443 bits (1139),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 297/441 (67%), Gaps = 9/441 (2%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             + +LPGQP+ V F QYSGYIVT    GRALFYY  EA S    S PLTLWL GG  CSS 
Sbjct  27    VTTLPGQPTHVSFKQYSGYIVTDAAHGRALFYYLVEADSAHPLSRPLTLWLNGGPGCSSV  86

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G+  E+GPF+P ++  L KN++SWNL SNMLYVD+PIGV FSYSNTSSDY  ++DT T
Sbjct  87    GFGVLMEHGPFQPKDNRLLAKNKYSWNLESNMLYVDSPIGVGFSYSNTSSDYTSYNDTTT  146

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A +NLKFL  W  +F +Y++ D Y+AG+SY GH  PQLA L+LEYN+KP ++RPIKLKG+
Sbjct  147   AEDNLKFLLNWLEKFPKYKNSDLYLAGESYAGHFIPQLASLLLEYNKKP-NIRPIKLKGV  205

Query  666   ALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDINV  842
             ALGNPLL+  + ++  E+LW +G IS E   L+K  C  +R  +E +   +S++CSD+  
Sbjct  206   ALGNPLLDLDISIAFAENLWSHGAISDETLMLEKTVCKISRYFKEFVHNNLSKECSDVFD  265

Query  843   MISEEIGDDMHKDNLLFQSC----QTDQYSSSQ---RHCLGTETAKADPCLLTWVDDYLS  1001
              I++E+GD++ +++LL   C    + +Q+ +++      +G      DPCL   +  YL+
Sbjct  266   RINKEVGDELDRNDLLSLQCLPSTEAEQFRAAKAIMHSNIGLLRGAGDPCLPDRILAYLN  325

Query  1002  RPEVQEALHANASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             +P VQ+ALHA  + W          + +LA +++P +S LLK  IP++ YSGD+D +IP+
Sbjct  326   KPVVQKALHAVPTNWSFCAGPLQYQMESLATNMIPIISDLLKSDIPIMFYSGDQDTKIPL  385

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + TR +AN +A  L L  +    PWYD KQ+GGW+Q+FG    G+ V  LTFATVRGGSH
Sbjct  386   TQTRIIANAMAKSLKLVPLTSYGPWYDNKQVGGWAQSFGKQREGKNVTYLTFATVRGGSH  445

Query  1362  FVPNSSPSKALTLFKAFLKGS  1424
              VP +SPS+ LTLF+ FL GS
Sbjct  446   EVPYTSPSQTLTLFRVFLSGS  466



>ref|XP_003633850.1| PREDICTED: serine carboxypeptidase-like 46 [Vitis vinifera]
 emb|CBI22165.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   437 bits (1125),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 226/488 (46%), Positives = 314/488 (64%), Gaps = 30/488 (6%)
 Frame = +3

Query  27    FIIDII*KIMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRG  206
             FI+++I  + +F L+F           +   E+I SLPGQP++V F QY+GYIVT    G
Sbjct  5     FILEVI-SLFLFFLYF-----------KSFAELITSLPGQPANVSFKQYAGYIVTDARHG  52

Query  207   RALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWN  386
             RALFYYF EA++ D  S PLTLW  GG  CSS   G F ENGPF+P E+G LVKN+ SWN
Sbjct  53    RALFYYFVEAKTADPLSRPLTLWFNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWN  112

Query  387   LASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAG  566
             L SNMLYV++PIGV FSYSNTSSDY  W+DT TA +NL+F+  W  EF  Y+D + ++ G
Sbjct  113   LESNMLYVESPIGVGFSYSNTSSDY-FWNDTRTAEDNLRFVINWLEEFPNYKDSELFLTG  171

Query  567   DSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIIST  743
             +SY GH  PQLA LI+EYN+KP ++RPIKLK IALGNPLL+  + +   ++LW +G IS 
Sbjct  172   ESYAGHYIPQLAALIVEYNQKP-NIRPIKLKSIALGNPLLDLDISVLAADYLWAHGAISD  230

Query  744   ELYHLQKRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSS  923
                 L+K  C+ ++ ++E + G++SE C+++   +  EIG+D+ +D+LL   C +   + 
Sbjct  231   HTLMLEKTVCNYSKFLREYIHGQLSEGCNNVYNRVVNEIGNDVRQDDLLLPICLSSNSAQ  290

Query  924   S-----QRHCLGTETAK------ADPCLLTWVDDYLSRPEVQEALHANAS----TWDSIF  1058
                   QR  +    A+       DPCL   +  YL+ P+VQ+ALHAN +     W    
Sbjct  291   QFKLKGQRGTIHAAIARRTRETIPDPCLSDRILTYLNNPQVQKALHANTTHLPYHWGFCA  350

Query  1059  HGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTM  1238
                   ++NL ++++P +  L+K GIP+L++SGD+D  IP++ TR +AN +A  L L   
Sbjct  351   GPLEYQIDNLDMNLIPLIEHLIKEGIPILLFSGDQDAIIPLTQTRIIANNVAKDLKLVPF  410

Query  1239  EMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLK  1418
                  WYD KQ+GGW+Q+FG    G+ V  LTFATVRG +H VP +SPS+ALT+FK+FL 
Sbjct  411   TEYGTWYDKKQVGGWTQSFGGLREGKNVTLLTFATVRGAAHEVPFTSPSQALTMFKSFLS  470

Query  1419  GSPPPNTH  1442
             GSP P  H
Sbjct  471   GSPLPRPH  478



>ref|XP_007046208.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
 gb|EOY02040.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
Length=488

 Score =   437 bits (1124),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 233/481 (48%), Positives = 312/481 (65%), Gaps = 22/481 (5%)
 Frame = +3

Query  48    KIMVFLLWFLLVNTLYSIS--IRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFY  221
             K M FLL F +++  +        + E+I +LPGQP++V F QYSGYIVT    GRALFY
Sbjct  3     KRMRFLLAFRVISCFFLFFFFCSASAELIKALPGQPANVTFKQYSGYIVTEPKHGRALFY  62

Query  222   YFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNM  401
             YF E  S +    PLTLWL GG  CSS   G F E+GPF+P E+G L+KN++SWNL SNM
Sbjct  63    YFVEVDSANPGLHPLTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNLESNM  122

Query  402   LYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGG  581
             LY+++PIGV FSYSNTSSDY   +DT+TA ENL F+  WF +F +YRD D Y++G+SY G
Sbjct  123   LYLESPIGVGFSYSNTSSDYLGVNDTITAGENLIFILNWFKKFPQYRDSDLYLSGESYAG  182

Query  582   HLAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHL  758
             H  PQLA LIL YN++    RPIKLK IALGNPLL+ ++ ++N E LW +G+IS E+  L
Sbjct  183   HYIPQLAALILSYNKR-FSGRPIKLKAIALGNPLLDLEISVNNAEFLWSHGVISDEMLML  241

Query  759   QKRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC-------QTDQY  917
             +K  C  +R ++E L   +S+ C D+     EEIG      +L+   C       QT   
Sbjct  242   RKTVCSESRSLKESLHRNLSKQCIDVLNKEQEEIGSYTDPGDLILPICLSSTVLGQTVYQ  301

Query  918   SSSQR---HCLGTETAKADPCLLTWVDDYLSRPEVQEALHANA----STWDSIFHGRNMI  1076
              +  R       T    +DPCL   +  YL+ P+VQEALHAN     S W+  F G +++
Sbjct  302   GALNRLHAKLAMTSAVASDPCLGDRIYQYLNTPKVQEALHANTTHLPSDWE--FCGGHLV  359

Query  1077  LN--NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNE  1250
                 +L I+I+P LS LL+R IP+L+++GD+D +IP++ TR +AN+LA  L L       
Sbjct  360   YQRESLEINIIPLLSKLLRRSIPILLFNGDQDSKIPLTQTRIIANMLAEELKLVPFGSYA  419

Query  1251  PWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPP  1430
             PWYD  Q+GGW+Q+FG +  G+ V  LTFATVRG +H VP +SPS+ALTLF+AFL+GSP 
Sbjct  420   PWYDKTQVGGWTQSFGQARKGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGSPL  479

Query  1431  P  1433
             P
Sbjct  480   P  480



>ref|XP_010256545.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=471

 Score =   436 bits (1120),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 224/467 (48%), Positives = 300/467 (64%), Gaps = 14/467 (3%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             I++ +++F  +   +       GE+   LPGQP+ V F QYSGYIVT    GRALFYYF 
Sbjct  8     IVISIIYFFFLTKSF-------GELATILPGQPTHVSFKQYSGYIVTDAAHGRALFYYFV  60

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA S    S PLTLWL GG  CSS   G F ENGPF+  + G L KN +SWNL SNMLYV
Sbjct  61    EADSAHPLSRPLTLWLSGGPGCSSLGEGAFTENGPFQSKDSGHLAKNIYSWNLESNMLYV  120

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYSNTS DY  W+DT TA +NLKFL  W  +F +Y+  D Y+AGDSY GH  
Sbjct  121   ESPIGVGFSYSNTSLDYISWNDTTTAEDNLKFLLNWLEKFPKYKHSDLYLAGDSYAGHYV  180

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKR  767
             PQLA L+LEYNRKP  +RPIKLKG+ALG+PLL   + + + + LW +G IS E   L+K 
Sbjct  181   PQLASLLLEYNRKP-DIRPIKLKGVALGSPLLNLDISMESADDLWSHGAISDETLMLEKT  239

Query  768   QCDSTRMVQEI-LSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC----QTDQYSSSQR  932
              C      +E+ +   +S++C D+   I+ EIGDD+ +++LL   C    + +Q+ +   
Sbjct  240   ICKIPTYYKELFVYKNLSKECIDVFDRINGEIGDDLDRNDLLSFKCLPSSRAEQFRARAT  299

Query  933   HCLGTETAKADPCLLTWVDDYLSRPEVQEALHANASTWDSIFHGRNMILNNLAIDILPTL  1112
             + +   T+ ADPCL   V  YL+RP+VQ+ALHA    W          ++N+ I+I+P +
Sbjct  300   NPMAKGTSAADPCLSDRVLAYLNRPKVQKALHAIPVNWSFCSGPLQYQMDNVDINIIPVV  359

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
             S LLK  I +++Y+GD+D ++ +S TR +AN +A  L L  +    PWYD KQ+GGW+Q+
Sbjct  360   SDLLKSNISIMLYNGDQDAKVSLSQTRIIANTIAKSLKLVPLTSYGPWYDNKQVGGWAQS  419

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             FG    G+ V  LTFATVRGGSH  P +SPS+ALTLF+AFL  S  P
Sbjct  420   FGKLRYGKNVTYLTFATVRGGSHGAPYTSPSQALTLFRAFLSASSLP  466



>ref|XP_010068795.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   429 bits (1104),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 220/482 (46%), Positives = 310/482 (64%), Gaps = 25/482 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSI--SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             M+   + ++VN +  +  S     E+I  LPGQP  V F Q+SGYIVT   RG ALFYYF
Sbjct  1     MMIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYF  60

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLY
Sbjct  61    VEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLY  120

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             V++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH 
Sbjct  121   VESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHY  180

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQK  764
              PQLA L+L+YN++  H +PIKLK IALGNPLL+ ++ +     LW +G+IS E   L++
Sbjct  181   VPQLAALVLDYNKQS-HGKPIKLKAIALGNPLLDLRISVDGATFLWSHGVISDETLKLKE  239

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQT------------  908
               C+ +R   E++  ++S++C+ +     EE+G+     ++L  +C +            
Sbjct  240   TVCNDSRYRTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPNCFSGTAAMQSASSSA  299

Query  909   -DQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQEALHANASTWDSIFHGRNMILN-  1082
              D Y +     L       DPCL  ++  YL+ P VQ+ALHAN +   S++   + +L+ 
Sbjct  300   WDAYHAK----LARRMVLTDPCLWEYIFSYLNNPRVQKALHANTTKLPSVWQFCSGLLSY  355

Query  1083  ---NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEP  1253
                ++ IDI P LSAL+K+ + +L++SGD+D +IP++ TR +A+++A  L  T++    P
Sbjct  356   HDVDIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRMIASMIARYLKFTSLGKYAP  415

Query  1254  WYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             WYD  Q+GGW+Q+FG+S  G+ V +LTFATVRG +H VP +SPS+ALTLFKAFL+GS PP
Sbjct  416   WYDNMQVGGWTQSFGSSREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSPP  475

Query  1434  NT  1439
               
Sbjct  476   KV  477



>gb|KCW64994.1| hypothetical protein EUGRSUZ_G02536 [Eucalyptus grandis]
Length=480

 Score =   429 bits (1104),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 219/481 (46%), Positives = 309/481 (64%), Gaps = 27/481 (6%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRIN----GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++W+ +V     I +  +     E+I  LPGQP  V F Q+SGYIVT   RG ALFYYF 
Sbjct  1     MIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYFV  60

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLYV
Sbjct  61    EADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYV  120

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH  
Sbjct  121   ESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHYV  180

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKR  767
             PQLA L+L+YN++  H +PIKLK IALGNPLL+ ++ +     LW +G+IS E   L++ 
Sbjct  181   PQLAALVLDYNKQS-HGKPIKLKAIALGNPLLDLRISVDGATFLWSHGVISDETLKLKET  239

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQT-------------  908
              C+ +R   E++  ++S++C+ +     EE+G+     ++L  +C +             
Sbjct  240   VCNDSRYRTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPNCFSGTAAMQSASSSAW  299

Query  909   DQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQEALHANASTWDSIFHGRNMILN--  1082
             D Y +     L       DPCL  ++  YL+ P VQ+ALHAN +   S++   + +L+  
Sbjct  300   DAYHAK----LARRMVLTDPCLWEYIFSYLNNPRVQKALHANTTKLPSVWQFCSGLLSYH  355

Query  1083  --NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPW  1256
               ++ IDI P LSAL+K+ + +L++SGD+D +IP++ TR +A+++A  L  T++    PW
Sbjct  356   DVDIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRMIASMIARYLKFTSLGKYAPW  415

Query  1257  YDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1436
             YD  Q+GGW+Q+FG+S  G+ V +LTFATVRG +H VP +SPS+ALTLFKAFL+GS PP 
Sbjct  416   YDNMQVGGWTQSFGSSREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSPPK  475

Query  1437  T  1439
              
Sbjct  476   V  476



>ref|XP_006431096.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
 gb|ESR44336.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
Length=473

 Score =   429 bits (1102),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 215/460 (47%), Positives = 306/460 (67%), Gaps = 19/460 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQP++V F QYSGYI+T    GRALFYYF EAQS +  S+PLTLWL GG  C
Sbjct  18    AELISALPGQPNNVPFKQYSGYILTDANHGRALFYYFVEAQSTNPLSLPLTLWLNGGPGC  77

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F E+GPF+P E+G+L+KN++SWNLASNMLYV++PIGV FSYSNTSSDY +W+D
Sbjct  78    SSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVESPIGVGFSYSNTSSDYNLWND  137

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
             + TA +NL+F+  W  EF +Y+D +F++ G+SY GH  PQLA L+L+YN++P +V+PIKL
Sbjct  138   SNTAGDNLRFIVNWLEEFPQYKDSEFFLTGESYAGHYVPQLATLVLQYNKQP-NVKPIKL  196

Query  657   KGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             K IALGNPLL+  + +   + +W +G IS E   L+K  C+ +  ++E+++ + S+ C+D
Sbjct  197   KSIALGNPLLDLDISVLTGDFMWSHGAISDETLMLEKTVCNGSTYLRELVNNQESKGCND  256

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTE----------TAKADPCLLTW  983
             +   ++EE G D+   +LL  SC T   S+ Q    G             A  DPC+   
Sbjct  257   VFNRVNEEFG-DIDSGDLLLPSCLTST-SAQQFKLFGKHGKIPNMMVNFGASGDPCIGDR  314

Query  984   VDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIY  1151
             +  YL+ P+VQEALHAN +     W+      +    +  ++I+P ++ L+  G+P+L++
Sbjct  315   IFTYLNSPQVQEALHANTTHLPFPWEFCGGPLDYQYKDFELNIIPQIADLIMEGVPILLF  374

Query  1152  SGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANL  1331
             SGD+D +IP++ TR +A  LA  L L        WYD +Q+GGWSQ+FG    G+ +  L
Sbjct  375   SGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFGAFRDGKNITYL  434

Query  1332  TFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTHPDH  1451
             T+ATVRG +H VP ++PS ALTLF++FL GSP PN  P H
Sbjct  435   TYATVRGAAHEVPYTTPSPALTLFQSFLTGSPLPN-RPKH  473



>ref|XP_002277201.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Vitis 
vinifera]
Length=479

 Score =   428 bits (1100),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 223/470 (47%), Positives = 303/470 (64%), Gaps = 27/470 (6%)
 Frame = +3

Query  90    LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLT  269
             LYS S     E+I +LPGQP++V F QYSGYI T    GRALFYYF EA++    S PLT
Sbjct  17    LYSKSF---AELITALPGQPANVSFKQYSGYIATDDQHGRALFYYFVEAETAHPLSRPLT  73

Query  270   LWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNT  449
             LWL GG  CSS   G F ENGPF+P E+G LVKN+ SWN+ SNMLYV++PIGV FSYSNT
Sbjct  74    LWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVESPIGVGFSYSNT  133

Query  450   SSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRK  629
             SS+Y  W+DT TA +NL+F+  WF EF  Y+D + ++ G+SY GH  PQLA L++EYN++
Sbjct  134   SSNY-FWNDTRTAEDNLRFIVNWFEEFPYYKDSELFLTGESYAGHYIPQLAALLVEYNKR  192

Query  630   PVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILS  806
             P ++RPIKLK IALGNPLL+  + +   ++LW +G IS +   L+K  C+ ++ ++E   
Sbjct  193   P-NIRPIKLKAIALGNPLLDLDISVLAGDYLWSHGAISDDTLLLEKTVCNDSKYLREYYH  251

Query  807   GEMSEDCSDINVMISEEIGDDMHKDNLLFQSC--------------QTDQYSSSQRHCLG  944
             G++S++C D+   + +EI  D+ K +LL   C              Q   Y+   R   G
Sbjct  252   GQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFRLKGLQGKIYAEIDRRTRG  311

Query  945   TETAKADPCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTL  1112
             T     DPCL   +  YL+ P+VQ+ALHAN +     WD         ++NL +D+LP +
Sbjct  312   T---IPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGPLVYQVDNLDMDLLPLI  368

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
             + LL++ I +L+YSGD+D ++P++ TR + N LA  L L        WYD +Q+GGWSQ+
Sbjct  369   AYLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVGGWSQS  428

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1442
             FG    G  +  LTFATVRG +H VP +SPS+ALTLFK+FL GSPPP  H
Sbjct  429   FGRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPPRLH  478



>gb|KDO72509.1| hypothetical protein CISIN_1g037032mg [Citrus sinensis]
Length=473

 Score =   426 bits (1096),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 215/460 (47%), Positives = 305/460 (66%), Gaps = 19/460 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQP++V   QYSGYI+T    GRALFYYF EAQS +  S+PLTLWL GG  C
Sbjct  18    AELISALPGQPNNVPVKQYSGYILTDANHGRALFYYFVEAQSTNPLSLPLTLWLNGGPGC  77

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F E+GPF+P E+G+L+KN++SWNLASNMLYV++PIGV FSYSNTSSDY +W+D
Sbjct  78    SSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVESPIGVGFSYSNTSSDYNLWND  137

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
             + TA +NL+F+  W  EF +Y+D +F++ G+SY GH  PQLA LIL+YN++P +V+PIKL
Sbjct  138   SNTAGDNLRFIVNWLEEFPQYKDSEFFLTGESYAGHYVPQLATLILQYNKQP-NVKPIKL  196

Query  657   KGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             K IALGNPLL+  + +   + +W +G IS E   L+K  C+ +  ++E+++ + S+ C+D
Sbjct  197   KSIALGNPLLDLDISVLTGDFMWSHGAISDETLMLEKTVCNGSTYLRELVNNQESKGCND  256

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTE----------TAKADPCLLTW  983
             +   ++EE G D+   +LL  SC T   S+ Q    G             A  DPC+   
Sbjct  257   VFNRVNEEFG-DIDSGDLLLPSCLTST-SAQQFKLFGKHGKIPNMMVNFGASGDPCIGDR  314

Query  984   VDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIY  1151
             +  YL+ P+VQEALHAN +     W+      +    +  ++I+P ++ L+  G+P+L++
Sbjct  315   IFTYLNSPQVQEALHANTTHLPFPWEFCGGPLDYQYKDFELNIIPQIADLIMEGVPILLF  374

Query  1152  SGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANL  1331
             SGD+D +IP++ TR +A  LA  L L        WYD +Q+GGWSQ+FG    G+ +  L
Sbjct  375   SGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFGAFRDGKNITYL  434

Query  1332  TFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTHPDH  1451
             T+ATVRG +H VP ++PS ALTLF++FL GSP PN  P H
Sbjct  435   TYATVRGAAHEVPYTTPSPALTLFQSFLTGSPLPN-RPKH  473



>emb|CBI22166.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   429 bits (1103),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 223/470 (47%), Positives = 303/470 (64%), Gaps = 27/470 (6%)
 Frame = +3

Query  90    LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLT  269
             LYS S     E+I +LPGQP++V F QYSGYI T    GRALFYYF EA++    S PLT
Sbjct  88    LYSKSF---AELITALPGQPANVSFKQYSGYIATDDQHGRALFYYFVEAETAHPLSRPLT  144

Query  270   LWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNT  449
             LWL GG  CSS   G F ENGPF+P E+G LVKN+ SWN+ SNMLYV++PIGV FSYSNT
Sbjct  145   LWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVESPIGVGFSYSNT  204

Query  450   SSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRK  629
             SS+Y  W+DT TA +NL+F+  WF EF  Y+D + ++ G+SY GH  PQLA L++EYN++
Sbjct  205   SSNY-FWNDTRTAEDNLRFIVNWFEEFPYYKDSELFLTGESYAGHYIPQLAALLVEYNKR  263

Query  630   PVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILS  806
             P ++RPIKLK IALGNPLL+  + +   ++LW +G IS +   L+K  C+ ++ ++E   
Sbjct  264   P-NIRPIKLKAIALGNPLLDLDISVLAGDYLWSHGAISDDTLLLEKTVCNDSKYLREYYH  322

Query  807   GEMSEDCSDINVMISEEIGDDMHKDNLLFQSC--------------QTDQYSSSQRHCLG  944
             G++S++C D+   + +EI  D+ K +LL   C              Q   Y+   R   G
Sbjct  323   GQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFRLKGLQGKIYAEIDRRTRG  382

Query  945   TETAKADPCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTL  1112
             T     DPCL   +  YL+ P+VQ+ALHAN +     WD         ++NL +D+LP +
Sbjct  383   T---IPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGPLVYQVDNLDMDLLPLI  439

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
             + LL++ I +L+YSGD+D ++P++ TR + N LA  L L        WYD +Q+GGWSQ+
Sbjct  440   AYLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVGGWSQS  499

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1442
             FG    G  +  LTFATVRG +H VP +SPS+ALTLFK+FL GSPPP  H
Sbjct  500   FGRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPPRLH  549



>ref|XP_010068798.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   424 bits (1090),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 218/482 (45%), Positives = 307/482 (64%), Gaps = 25/482 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSI--SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             M+   + ++VN +  +  S     E+I  LPGQP  V F Q+SGYIVT   RG ALFYYF
Sbjct  1     MMIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYF  60

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLY
Sbjct  61    VEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLY  120

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             V++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH 
Sbjct  121   VESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHY  180

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQK  764
              PQLA L+L+YN++  H +PIKLK IALGNPLL+ ++ +     LW +G+IS E   L++
Sbjct  181   VPQLAALVLDYNKQS-HGKPIKLKAIALGNPLLDLRLSVEGATFLWSHGVISDETLKLKE  239

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQT------------  908
               C+ +R   E++  ++S++C+ +     EE+G+     ++L   C +            
Sbjct  240   TVCNDSRHWTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPYCFSGTAAMQSASSSA  299

Query  909   -DQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQEALHANASTWDSIFHGRNMILN-  1082
              D Y +     L       DPCL  ++  YL+ P+VQ+ALHAN +   S++   + +L+ 
Sbjct  300   WDAYHAK----LARRMVLTDPCLGDYIFSYLNNPQVQKALHANTTKLPSVWQFCSGLLSY  355

Query  1083  ---NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEP  1253
                ++ IDI P LSAL+K+ + +L++SGD+D +IP++ TR +AN++A  L  T++    P
Sbjct  356   HDVDIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRIIANMIARELKFTSLGKYAP  415

Query  1254  WYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             WY+ KQ+GGW+++FG S  G+   +LTFATVRG +H VP +SP +ALTLFKAFLKGS  P
Sbjct  416   WYNKKQVGGWTESFGRSRKGKNATHLTFATVRGAAHEVPYTSPEQALTLFKAFLKGSSLP  475

Query  1434  NT  1439
               
Sbjct  476   KV  477



>gb|KCW64996.1| hypothetical protein EUGRSUZ_G02538 [Eucalyptus grandis]
Length=480

 Score =   424 bits (1090),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 218/481 (45%), Positives = 308/481 (64%), Gaps = 27/481 (6%)
 Frame = +3

Query  63    LLWF--LLVNTLYSI--SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++W+  ++VN +  +  S     E+I  LPGQP  V F Q+SGYIVT   RG ALFYYF 
Sbjct  1     MIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYFV  60

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLYV
Sbjct  61    EADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYV  120

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH  
Sbjct  121   ESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHYV  180

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKR  767
             PQLA L+L+YN++  H +PIKLK IALGNPLL+ ++ +     LW +G+IS E   L++ 
Sbjct  181   PQLAALVLDYNKQS-HGKPIKLKAIALGNPLLDLRLSVEGATFLWSHGVISDETLKLKET  239

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQT-------------  908
              C+ +R   E++  ++S++C+ +     EE+G+     ++L   C +             
Sbjct  240   VCNDSRHWTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPYCFSGTAAMQSASSSAW  299

Query  909   DQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQEALHANASTWDSIFHGRNMILN--  1082
             D Y +     L       DPCL  ++  YL+ P+VQ+ALHAN +   S++   + +L+  
Sbjct  300   DAYHAK----LARRMVLTDPCLGDYIFSYLNNPQVQKALHANTTKLPSVWQFCSGLLSYH  355

Query  1083  --NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPW  1256
               ++ IDI P LSAL+K+ + +L++SGD+D +IP++ TR +AN++A  L  T++    PW
Sbjct  356   DVDIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRIIANMIARELKFTSLGKYAPW  415

Query  1257  YDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1436
             Y+ KQ+GGW+++FG S  G+   +LTFATVRG +H VP +SP +ALTLFKAFLKGS  P 
Sbjct  416   YNKKQVGGWTESFGRSRKGKNATHLTFATVRGAAHEVPYTSPEQALTLFKAFLKGSSLPK  475

Query  1437  T  1439
              
Sbjct  476   V  476



>gb|KHG07552.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=476

 Score =   424 bits (1089),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 220/453 (49%), Positives = 303/453 (67%), Gaps = 16/453 (4%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             E+I +LPGQP++V F QYSGYI+     GRALFYYF EA S +  + PLTLWL GG  CS
Sbjct  21    EVIKALPGQPANVGFKQYSGYILVQPQHGRALFYYFVEADSANPLANPLTLWLNGGPGCS  80

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S   G F E+GPF+P EDG LVKNQ+SWNL SNMLY+++PIGV FSYSNTSSDY   +D 
Sbjct  81    SLGFGAFMEHGPFQPREDGHLVKNQYSWNLESNMLYLESPIGVGFSYSNTSSDYLGLNDA  140

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLK  659
              TA++N++FL  WF EF +YR+ D Y++G+SY GH  PQLA+LIL+YN++    RPIKLK
Sbjct  141   TTAKDNMQFLLNWFEEFPQYRNSDLYLSGESYAGHYIPQLADLILDYNKR-FSGRPIKLK  199

Query  660   GIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
              IALGNPLL+  + + N E LW +G+IS E   L K  C+++R ++E +   +S++C  +
Sbjct  200   AIALGNPLLDPDISVINAEFLWSHGVISDETLLLSKTVCNASRHLKESIHQNLSKECIHV  259

Query  837   NVMISEEIGDDMHKDNLLFQSCQTD--------QYSSSQRH-CLGTETAKA-DPCLLTWV  986
                + EE+G      +L+   C +         Q + ++ H  L   +A A DPC +  +
Sbjct  260   LNKLEEEMGSYTDPGDLILPICFSPTLLGQTFFQGTHNRLHWKLAMSSAVATDPCRVDEI  319

Query  987   DDYLSRPEVQEALHANASTWDSI--FHGRNMILN--NLAIDILPTLSALLKRGIPLLIYS  1154
               YL+ P+VQEALHAN +   S+  F G ++     ++ I+I+P LS LLKR IP+L+++
Sbjct  320   RQYLNTPKVQEALHANTTHLSSVWEFCGGHLSYQRESIGINIIPLLSKLLKRSIPVLLFN  379

Query  1155  GDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLT  1334
             GD+D +IP++ TR +AN+LA  L L       PWYD KQ+GGW+Q+FG    G+ +  LT
Sbjct  380   GDQDSKIPLTQTRIIANMLAKELKLVPFGSYAPWYDKKQVGGWTQSFGKVRRGQNLTFLT  439

Query  1335  FATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             FATVRG +H VP +SP +ALTLF+AFL+ S  P
Sbjct  440   FATVRGAAHEVPYTSPFQALTLFQAFLRRSLLP  472



>ref|XP_010661029.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Vitis 
vinifera]
Length=481

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 223/472 (47%), Positives = 303/472 (64%), Gaps = 29/472 (6%)
 Frame = +3

Query  90    LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLT  269
             LYS S     E+I +LPGQP++V F QYSGYI T    GRALFYYF EA++    S PLT
Sbjct  17    LYSKSF---AELITALPGQPANVSFKQYSGYIATDDQHGRALFYYFVEAETAHPLSRPLT  73

Query  270   LWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNT  449
             LWL GG  CSS   G F ENGPF+P E+G LVKN+ SWN+ SNMLYV++PIGV FSYSNT
Sbjct  74    LWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVESPIGVGFSYSNT  133

Query  450   SSDYKIWSDTMT--ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYN  623
             SS+Y  W+DT T  A +NL+F+  WF EF  Y+D + ++ G+SY GH  PQLA L++EYN
Sbjct  134   SSNY-FWNDTRTVAAEDNLRFIVNWFEEFPYYKDSELFLTGESYAGHYIPQLAALLVEYN  192

Query  624   RKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEI  800
             ++P ++RPIKLK IALGNPLL+  + +   ++LW +G IS +   L+K  C+ ++ ++E 
Sbjct  193   KRP-NIRPIKLKAIALGNPLLDLDISVLAGDYLWSHGAISDDTLLLEKTVCNDSKYLREY  251

Query  801   LSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC--------------QTDQYSSSQRHC  938
               G++S++C D+   + +EI  D+ K +LL   C              Q   Y+   R  
Sbjct  252   YHGQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFRLKGLQGKIYAEIDRRT  311

Query  939   LGTETAKADPCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILP  1106
              GT     DPCL   +  YL+ P+VQ+ALHAN +     WD         ++NL +D+LP
Sbjct  312   RGT---IPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGPLVYQVDNLDMDLLP  368

Query  1107  TLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWS  1286
              ++ LL++ I +L+YSGD+D ++P++ TR + N LA  L L        WYD +Q+GGWS
Sbjct  369   LIAYLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVGGWS  428

Query  1287  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1442
             Q+FG    G  +  LTFATVRG +H VP +SPS+ALTLFK+FL GSPPP  H
Sbjct  429   QSFGRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPPRLH  480



>ref|XP_010068797.1| PREDICTED: serine carboxypeptidase-like 46 [Eucalyptus grandis]
Length=481

 Score =   422 bits (1084),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 218/478 (46%), Positives = 309/478 (65%), Gaps = 21/478 (4%)
 Frame = +3

Query  63    LLWFLLVNT-----LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             ++W+ +V       L+S S     E+I  LPGQP  V F Q+SGYI T   RG ALFYYF
Sbjct  2     MIWYFIVIVNGVIPLFS-SCTSTAELIKKLPGQPDGVSFKQHSGYITTDPRRGHALFYYF  60

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLY
Sbjct  61    VEADARDPLSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLY  120

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             V++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH 
Sbjct  121   VESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHY  180

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQK  764
              PQLA L+L+YN++    + IKL+ IALGNPLL+ ++ +     LW +G+IS E   L++
Sbjct  181   VPQLAALLLDYNKQS-RGKLIKLRAIALGNPLLDIQISVDAATFLWSHGVISDETLKLKE  239

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC--QTDQYSSSQRHC  938
               C+ +R + + +  ++S +C+++     EE+G+    D++L   C   T    S+ R  
Sbjct  240   TVCNDSRYLTQQIHNKISMECAEVFQKQVEEMGNFTDPDDVLEPYCFSGTAVVQSASRSM  299

Query  939   LGTETAK-------ADPCLLTWVDDYLSRPEVQEALHANASTWDSIFHGRNMILN----N  1085
                  AK        DPCL  ++  YL+ P+VQ+ALHAN +   S+++  +  L+    +
Sbjct  300   WDAYHAKLARRMVLTDPCLGDFIFSYLNNPQVQKALHANITKLPSVWNFCSGPLSYHDVD  359

Query  1086  LAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDG  1265
             + IDI+P LSAL+++ + +L++SGD+D ++P+  TR +AN++A  L  T++    PWYD 
Sbjct  360   IGIDIIPLLSALIEKHLRVLLFSGDQDSKVPLMQTRMIANMIAQDLKFTSLGKYAPWYDK  419

Query  1266  KQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              Q+GGW+Q+FG+S  G+ V +LTFATVRG +H VP +SPS+ALTLFKAFL+GS PP  
Sbjct  420   MQVGGWTQSFGSSREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSPPKV  477



>ref|XP_007046207.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY02039.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=478

 Score =   416 bits (1069),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 219/464 (47%), Positives = 294/464 (63%), Gaps = 22/464 (5%)
 Frame = +3

Query  108   RINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGG  287
             + + E+I  LP QP++V F QYSGYIVT    GRALFYYF E  + D    PLTLWL GG
Sbjct  14    KASAELITRLPSQPANVGFKQYSGYIVTDAKHGRALFYYFVEVDAADPLLHPLTLWLNGG  73

Query  288   HDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKI  467
               CSS   G F E+GPF+P EDG LVKNQ+SWNL SNMLYV++PIGV FSYSNTSSDY  
Sbjct  74    PGCSSLGYGAFMEHGPFQPGEDGFLVKNQYSWNLESNMLYVESPIGVGFSYSNTSSDYIG  133

Query  468   WSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRP  647
              +DT TA ENL+FL  WF EF +YR+ D Y+ G+SY GH  PQLA L+L+YN K  + +P
Sbjct  134   VNDTFTAEENLQFLVNWFKEFPQYRNSDLYLTGESYAGHYIPQLAALVLDYN-KHSNGKP  192

Query  648   IKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSED  824
             I+LK +ALGNPLL+ ++ + N E  W +G+IS E+  L+K  C   R   E L   +S++
Sbjct  193   IRLKAVALGNPLLDWEISIDNTEFFWSHGLISDEMLMLRKTVCSRPRDAIESLHNNLSKE  252

Query  825   CSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA----------DPCL  974
             C+D+      EIG      ++    C +        +    +T  A          DPC+
Sbjct  253   CTDVIHKQRAEIGSYTQYGDVTLPICTSRSLFGQTVYLRNFDTLDAELPMRSVIPGDPCI  312

Query  975   LTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMIL--NNLAIDILPTLSALLKRGI  1136
                +  YL++PEVQEALHAN +     W+    G +++    NL  +I+P L  LL+ GI
Sbjct  313   EDRIHKYLNKPEVQEALHANTTHLPYRWE-FCTGTDLVYERKNLETNIIPLLLNLLRSGI  371

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLT---TMEMNEPWYDGKQIGGWSQTFGNSG  1307
             P+L+Y+GD+D +IP++ TR +AN+LA  +NL          PW+D  Q+GGW+Q+FG + 
Sbjct  372   PILLYNGDQDAKIPLTQTRIIANMLAKEMNLVPFGNFGNYAPWFDNMQVGGWTQSFGQAK  431

Query  1308  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              G+ +  LT+ATVRGG+H VP +SPS  LTLF+AF+KGSP P T
Sbjct  432   EGKNITFLTYATVRGGAHEVPYTSPSPGLTLFRAFVKGSPLPRT  475



>ref|XP_010322533.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Solanum 
lycopersicum]
Length=447

 Score =   406 bits (1043),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 211/463 (46%), Positives = 293/463 (63%), Gaps = 53/463 (11%)
 Frame = +3

Query  93    YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTL  272
             Y +  + + E+I SLPGQP ++ F QYSGYIVT+   GRALFYYF EA SE+  S+PLT+
Sbjct  13    YLLFYKSSCELITSLPGQPPNIFFKQYSGYIVTNSQHGRALFYYFVEADSENAASLPLTI  72

Query  273   WLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTS  452
             WL G                                    SNMLYVD+PIGV FSYSNTS
Sbjct  73    WLNG-----------------------------------ESNMLYVDSPIGVGFSYSNTS  97

Query  453   SDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKP  632
             SD   W DT TA+ENL+F+ KWF +F +YR+ D Y+ G+SY GH  PQ A L+L+YNR P
Sbjct  98    SDNINWDDTATAKENLQFILKWFKKFPQYRNSDVYLTGESYAGHYIPQFAVLLLDYNRTP  157

Query  633   VHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSG  809
              +V+PIKLK IALGNPLL+ ++ + + E+LW +G+IS EL  + K  C+ TR V E +  
Sbjct  158   -NVKPIKLKSIALGNPLLDIEISVKSAEYLWAHGVISDELLDMHKTICNETRYVMEFVHN  216

Query  810   EMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK----------  959
             E S +C+ +  + +EE+G+D+ K ++L   C +   ++ +   LG  T            
Sbjct  217   ETSNECAKVIELRTEEMGNDIVKYDVLLPKCVSSS-AAGRLKALGNLTTVHGKFDKKVGK  275

Query  960   -ADPCLLTWVDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALL  1124
              ADPCL  W++ YL++PEVQ+ALHAN +    +W+         + + AIDI+P LS +L
Sbjct  276   VADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCSGPLQYKMEDAAIDIIPLLSNIL  335

Query  1125  KRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNS  1304
             K+ IP+L++SGD+D  +P++ TR++A +LA  L L  ++   PWYDG QIGGWSQ++G  
Sbjct  336   KQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYGGV  395

Query  1305  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
               G+ +  LTFATVRG +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  396   REGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  438



>ref|XP_006482671.1| PREDICTED: serine carboxypeptidase-like 44-like [Citrus sinensis]
Length=552

 Score =   408 bits (1048),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 204/446 (46%), Positives = 292/446 (65%), Gaps = 18/446 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQP++V   QYSGYI+T    GRALFYYF EAQS +  S+PLTLWL GG  C
Sbjct  18    AELISALPGQPNNVPVKQYSGYILTDANHGRALFYYFVEAQSTNPLSLPLTLWLNGGPGC  77

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F E+GPF+P E+G+L+KN++SWNLASNMLYV++PIGV FSYSNTSSDY +W+D
Sbjct  78    SSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVESPIGVGFSYSNTSSDYNLWND  137

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
             + TA +NL+F+  W  EF +Y+D +F++ G+SY GH  PQLA LIL+YN++P +V+PIKL
Sbjct  138   SNTAGDNLRFIVNWLEEFPQYKDSEFFLTGESYAGHYVPQLATLILQYNKQP-NVKPIKL  196

Query  657   KGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             K IALGNPLL+  + +   + +W +G IS E   L+K  C+ +  ++E+++ + S+ C+D
Sbjct  197   KSIALGNPLLDLDISVLTGDFMWSHGAISDETLMLEKTVCNGSTYLRELVNNQESKGCND  256

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTE----------TAKADPCLLTW  983
             +   ++EE G D+   +LL  SC T   S+ Q    G             A  DPC+   
Sbjct  257   VFNRVNEEFG-DIDSGDLLLPSCLTST-SAQQFKLFGKHGKMPNMMVNFGASGDPCIGDR  314

Query  984   VDDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIY  1151
             +  YL+ P+VQEALHAN +     W+      +    +  ++I+P ++ L+  G+P+L++
Sbjct  315   IFTYLNSPQVQEALHANTTHLPFPWEFCGGPLDYQYKDFELNIIPQIADLIMEGVPILLF  374

Query  1152  SGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANL  1331
             SGD+D +IP++ TR +A  LA  L L        WYD +Q+GGWSQ+FG    G+ +  L
Sbjct  375   SGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFGAFRDGKNITYL  434

Query  1332  TFATVRGGSHFVPNSSPSKALTLFKA  1409
             T+ATVRG +H VP ++PS ALT    
Sbjct  435   TYATVRGAAHEVPYTTPSPALTFLSG  460



>ref|XP_007099702.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY20317.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=475

 Score =   400 bits (1028),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 292/454 (64%), Gaps = 17/454 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I  LPGQ  +V FNQYSGYIVT    GRALFYYF EA S      PLTLWL GG  C
Sbjct  19    AELIHFLPGQHKNVSFNQYSGYIVTDARHGRALFYYFVEADSNTDELKPLTLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F E+GPF+P EDG L+KN++SWNL SNMLYV++PIGV FSYSNTS +Y +W+D
Sbjct  79    SSLGFGAFMEHGPFQPGEDGTLIKNEYSWNLESNMLYVESPIGVGFSYSNTSKNY-LWND  137

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
             T TA++NL F+  W  EF +Y++ DF++AG+SY GH  PQLA L++E+N+KP ++ P+ L
Sbjct  138   TQTAQDNLMFILNWLEEFPQYKESDFFLAGESYAGHYIPQLAALLVEHNKKP-NIEPVNL  196

Query  657   KGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             K IALGNPLL+  + +   + LW +G IS E   L+K  C+ ++ ++E +  + SE C+D
Sbjct  197   KAIALGNPLLDLDISVLAGDFLWSHGAISDETLFLEKTVCNDSKYLREYVHDKWSEGCND  256

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR---------HCLGTETAKADPCLLTWV  986
             +   + +E+G D+  D+LL  +C +  Y+   +           +     K DPCL   +
Sbjct  257   VFNRVEDEVGVDVGLDDLLLPTCLSSSYAEQLKLKGKLGKIHSAVAKRAKKGDPCLEGRI  316

Query  987   DDYLSRPEVQEALHANA----STWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYS  1154
               YL+R EVQ+ALH +     S W           +NL ++++P +S L+K  IP+L+Y+
Sbjct  317   LTYLNRREVQKALHVSTTHHPSHWAFCEGPLVYQEDNLDMNLIPLVSDLIKEAIPVLLYN  376

Query  1155  GDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVAN-L  1331
             GD+D +IP++ TR +AN +A  L L  +     WYD KQ+GGW+++FG +   +  A  L
Sbjct  377   GDQDAKIPLTQTRIIANNIAKDLKLVPLTEYGTWYDNKQVGGWTKSFGATEDRKNYATYL  436

Query  1332  TFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             TFATVRG +H VP +S S+ALTLF +F+ G P P
Sbjct  437   TFATVRGAAHEVPFTSHSQALTLFHSFVNGIPLP  470



>ref|XP_006838780.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
 gb|ERN01349.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
Length=478

 Score =   399 bits (1026),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 215/455 (47%), Positives = 286/455 (63%), Gaps = 20/455 (4%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             ++I  LPGQP +  FNQYSGYIVT    GRALFYYF EA +  + S PLTLWL GG  CS
Sbjct  29    DLIKRLPGQPPNPSFNQYSGYIVTDTHHGRALFYYFVEADTHHRASRPLTLWLNGGPGCS  88

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  IG   E+GP+   ++  LV N++SWNLASNMLYV++PIGV FSYSNTSSDY  W+DT
Sbjct  89    SLGIGALMEHGPYLVHDNSSLVNNKYSWNLASNMLYVESPIGVGFSYSNTSSDYINWNDT  148

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLK  659
              TA +NL+FL  WF +F  YR  D Y+ G+SY GH  PQLA L++ YN+K      IKLK
Sbjct  149   KTAEDNLRFLINWFEKFPAYRGSDLYLTGESYAGHYIPQLAALLMAYNKKHT-TGAIKLK  207

Query  660   GIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
              IALGNP ++  + +++ E+LW +G+IS + + L+K  C+ +  ++    GE SE C   
Sbjct  208   AIALGNPFVDMDISVNSGEYLWAHGLISDQTFELEKTLCNDSSYMRAFYRGEYSEPCIYT  267

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYS--SSQRHCLGTETAK--------ADPCLLTWV  986
               M++EE+G ++ + ++L   C T   S  +  R   G   AK         D C    +
Sbjct  268   FKMVAEEMGVNVDEGDILLPKCLTSVPSMQAVSRGLNGKIHAKISLSRMGSGDLCSWERI  327

Query  987   DDYLSRPEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYS  1154
               YL+R +VQ A HANA+     WDS         +N  IDI P + +LLK  IP+ +YS
Sbjct  328   FKYLNRADVQRAFHANATGLPYNWDSCSGPLVYQDDNSEIDIRPLILSLLKEDIPIFLYS  387

Query  1155  GDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLT  1334
             GD+D +IP++ TR +AN LA RL L+ +    PWYD KQ+GGW Q FG    G +   LT
Sbjct  388   GDQDSKIPLTQTRIIANQLAKRLKLSPITKYAPWYDKKQVGGWVQAFGR---GNRTL-LT  443

Query  1335  FATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             FATVRG +H VP +SPS+ALTLF+AF+ GSP P +
Sbjct  444   FATVRGAAHEVPFTSPSQALTLFRAFITGSPLPTS  478



>ref|XP_010322561.1| PREDICTED: serine carboxypeptidase-like 46 isoform X3 [Solanum 
lycopersicum]
Length=394

 Score =   383 bits (984),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 189/386 (49%), Positives = 265/386 (69%), Gaps = 18/386 (5%)
 Frame = +3

Query  324   ENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLK  503
             E+GPF+P +DG L+KN FSWNL SNMLYVD+PIGV FSYSNTSSD   W DT TA+ENL+
Sbjct  2     EHGPFQPGKDGRLIKNNFSWNLESNMLYVDSPIGVGFSYSNTSSDNINWDDTATAKENLQ  61

Query  504   FLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALGNPL  683
             F+ KWF +F +YR+ D Y+ G+SY GH  PQ A L+L+YNR P +V+PIKLK IALGNPL
Sbjct  62    FILKWFKKFPQYRNSDVYLTGESYAGHYIPQFAVLLLDYNRTP-NVKPIKLKSIALGNPL  120

Query  684   LE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDINVMISEEI  860
             L+ ++ + + E+LW +G+IS EL  + K  C+ TR V E +  E S +C+ +  + +EE+
Sbjct  121   LDIEISVKSAEYLWAHGVISDELLDMHKTICNETRYVMEFVHNETSNECAKVIELRTEEM  180

Query  861   GDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA-----------KADPCLLTWVDDYLSRP  1007
             G+D+ K ++L   C +   ++ +   LG  T             ADPCL  W++ YL++P
Sbjct  181   GNDIVKYDVLLPKCVSSS-AAGRLKALGNLTTVHGKFDKKVGKVADPCLNEWINLYLNKP  239

Query  1008  EVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRI  1175
             EVQ+ALHAN +    +W+         + + AIDI+P LS +LK+ IP+L++SGD+D  +
Sbjct  240   EVQKALHANTTYLPYSWEVCSGPLQYKMEDAAIDIIPLLSNILKQHIPILLFSGDQDSVL  299

Query  1176  PVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGG  1355
             P++ TR++A +LA  L L  ++   PWYDG QIGGWSQ++G    G+ +  LTFATVRG 
Sbjct  300   PLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYGGVREGKNITYLTFATVRGA  359

Query  1356  SHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  360   AHEVPYTSPSQALTLFRAFLRGYPPP  385



>ref|XP_007162064.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
 gb|ESW34058.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
Length=459

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 195/469 (42%), Positives = 281/469 (60%), Gaps = 25/469 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  +  +LV TL S+S     + I SLPGQP  V F QYSGYI       RALFYYF E
Sbjct  8     MIATIIIVLVQTLVSVSSLPEADKISSLPGQP-HVKFQQYSGYITVDDQHQRALFYYFVE  66

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             AQ +D  S P+ LWL GG  CSS  +G   E+GPF+P +   LVKN +SWN  +N+LY++
Sbjct  67    AQ-KDPTSKPVVLWLNGGPGCSSIGVGALIEHGPFKPRDSNVLVKNHYSWNKVANVLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+ +S Y + +D +TAR+NL FL++WFIEF EY + DF+I G+SY GH AP
Sbjct  126   SPAGVGFSYSSNTSFYTLVTDEITARDNLVFLQRWFIEFPEYSNNDFFITGESYAGHYAP  185

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGL-SNVEHLWHYGIISTELYHLQKR  767
             QLA+LI++          I LKGIA+GNPL+E    L S  E LW +G+IS   Y L  R
Sbjct  186   QLAQLIVQTKTN------INLKGIAIGNPLMEFDTDLNSKAEFLWSHGLISDSTYGLFTR  239

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG-  944
              C+ + + ++++SG +SE C +IN ++  E+ + + + ++    C +   ++ Q + L  
Sbjct  240   VCNYSTIRRQMISGNLSEICDNINTLVFTELSNYIDQYDVTLDVCLSS--ANQQAYVLNQ  297

Query  945   -TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
               +  K D C+     +YL+R +VQ+ALHA     S W +     +    NL I  +  L
Sbjct  298   MQKIQKIDVCVDDKAVNYLNRKDVQKALHAKLVGVSKWLTCSRVLHYDRTNLEIPTISIL  357

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+   I +L+YSGD+D  IP+  +R L N LA  L L T      W++GKQ+GGW+Q 
Sbjct  358   GSLVNSKIRVLVYSGDQDSVIPLMGSRSLVNGLAKELGLNTTVAYRAWFEGKQVGGWTQV  417

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             +G+         L++AT+RG SH  P + P ++L L KAFL+G P P+ 
Sbjct  418   YGDI--------LSYATIRGASHEAPFNQPRRSLGLLKAFLEGKPLPDV  458



>gb|ABR16719.1| unknown [Picea sitchensis]
Length=460

 Score =   355 bits (910),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 196/470 (42%), Positives = 274/470 (58%), Gaps = 27/470 (6%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             ++ +L FL +  L +      G +++ LPGQP+ V F QY+GYI  ++   RALFYYF E
Sbjct  6     LLIILAFLFIKVLSAPE----GHVVNRLPGQPA-VTFKQYAGYITVNEKSDRALFYYFVE  60

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A++E     PL +WL GG  CSS  +G   ENGPF P + G+L++N  SWN  +NMLY++
Sbjct  61    AETEPDLK-PLVVWLNGGPGCSSFGVGALSENGPFYP-KAGKLIRNSCSWNKEANMLYLE  118

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYSN  S Y   +D+ TA +NL FL  WF +F EY+  + Y+ G+SY GH  P
Sbjct  119   SPAGVGFSYSNDPSYYMGANDSKTAVDNLLFLHGWFNKFPEYKTRELYLTGESYAGHYIP  178

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSN--VEHLWHYGIISTELYHLQKR  767
             QLAELI+E NRK    +   LKGI++GNPLL+ +   N   E LW +G++S   Y++ K 
Sbjct  179   QLAELIVEENRKK---KSFNLKGISIGNPLLDFITDLNARAEFLWSHGLVSDPTYNMMKT  235

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG-  944
              C+ +R++ E   G +S  C  I + +S EI   + K ++  +SC +       +  +G 
Sbjct  236   GCNYSRLLDEAFRGGVSSTCEHIYLTVSMEISKFIDKYDVTLESCLSSLLMQKSKMMIGV  295

Query  945   --TETAKADPCLLTWVDDYLSRPEVQEALHA----NASTWDSIFHGRNMILNNLAIDILP  1106
               T T K D C+      YL+  +VQ+A HA    N  TW++          N  I  +P
Sbjct  296   TRTATVKPDVCVQDEATSYLNMADVQKAFHARLVGNVKTWEACSDVLEYDDLNWEIPTIP  355

Query  1107  TLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWS  1286
              L  L+K GI +LIYSGD+D  IP++ TR L N LA  L L T      W+ GKQ+ GW 
Sbjct  356   LLGKLVKAGIRVLIYSGDQDSIIPLTGTRTLVNNLAASLQLNTTVPYRVWFQGKQVAGWV  415

Query  1287  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1436
             Q +GN+        L+FATVRG  H VP S P ++L LFKAFL+G PPP+
Sbjct  416   QVYGNT--------LSFATVRGAGHEVPFSQPERSLVLFKAFLQGQPPPS  457



>ref|XP_010044871.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW86989.1| hypothetical protein EUGRSUZ_B03549 [Eucalyptus grandis]
Length=473

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 191/443 (43%), Positives = 263/443 (59%), Gaps = 19/443 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  44    IPRLPGQPP-VGFRQYSGYVTVDEKQQRALFYYFAEAEL-DPASKPLVLWLNGGPGCSSL  101

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ D  LV+N++SWN  +NMLY++ PIGV FSYS  +S Y+  +D +T
Sbjct  102   GVGAFSENGPFRPSGDA-LVRNEYSWNREANMLYLEAPIGVGFSYSTDTSSYEAVNDKIT  160

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WF++F +Y++ + +I G+SY GH  PQLAEL+L+ NRK    +   LKGI
Sbjct  161   ARDNLVFLQGWFVKFPQYKNSNLFITGESYAGHYVPQLAELMLQINRKE---KMFNLKGI  217

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +R V+E   G +S  CS + 
Sbjct  218   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSICNYSRYVREYAEGSVSPICSRVM  277

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +++E    +   ++    C     S S+R      T   D C+     +YL+R +VQ+
Sbjct  278   SQVNKETSKFVDNYDVTLDVCIASVMSQSRRLSPQQVTDTIDVCVEDETVNYLNRQDVQK  337

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W       +  L NL I  +  L  L+K GIP+L+YSGD+D  IP++ +
Sbjct  338   ALHARLVGVRKWAVCSDVLDYDLTNLEIPTITILGKLIKAGIPVLVYSGDQDSVIPLTGS  397

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W+ G+Q+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  398   RRLVHGLAEKLGLNTTIPYRVWFQGQQVGGWTQVYGNV--------LSFATIRGASHEAP  449

Query  1371  NSSPSKALTLFKAFLKGSPPPNT  1439
              S P ++L LFK+FL+G P P  
Sbjct  450   FSQPQRSLVLFKSFLQGQPLPEV  472



>ref|XP_007139316.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
 gb|ESW11310.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
Length=461

 Score =   353 bits (905),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 188/442 (43%), Positives = 266/442 (60%), Gaps = 19/442 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F Q+SGY+       +ALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITHLPGQP-QVEFQQFSGYVTVDDRNQQALFFYFAEAE-KDAASKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +  LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+  +D +T
Sbjct  90    GVGAFSENGPFRPKGEA-LVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYEGVNDEIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WFI+F EYR+   +I G+SY GH  PQLAEL+L++N+K    +   LKGI
Sbjct  149   ARDNLVFLKNWFIKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  205

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +R V+E  +G +S  CS + 
Sbjct  206   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKVFTSVCNYSRYVREYYNGAVSPVCSSVM  265

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C +  +S ++       T   D C+     +YL+R +VQ 
Sbjct  266   SQVSTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  325

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W +  +  +  L +L I  +  +  L++ GIP+L+YSGD+D  IP++ +
Sbjct  326   ALHARLVGVQRWSACSNVLDYELRDLEIPTITVVGKLVQEGIPVLVYSGDQDSVIPLTGS  385

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W++ +Q+GGW+Q +G+         L+FAT+RG SH  P
Sbjct  386   RTLVHKLAKKLGLKTTVPYRVWFEKQQVGGWTQVYGDI--------LSFATIRGASHEAP  437

Query  1371  NSSPSKALTLFKAFLKGSPPPN  1436
              S P +AL LFK+FL+G P P 
Sbjct  438   FSQPERALVLFKSFLEGRPMPQ  459



>ref|XP_002268172.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI35664.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   352 bits (902),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 193/452 (43%), Positives = 271/452 (60%), Gaps = 22/452 (5%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             S+ ++ +I++ LPGQP  V F QYSGY+   + + RALFYYFAEA++ D    PL LWL 
Sbjct  27    SLSLSDKILE-LPGQP-QVGFQQYSGYVAVDEKQQRALFYYFAEAET-DPAIKPLVLWLN  83

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGEL-VKNQFSWNLASNMLYVDTPIGVAFSYSNTSSD  458
             GG  CSS  +G F ENGPFRP+  GEL V+N++SWN  +NMLY++TPIGV FSYS  SS 
Sbjct  84    GGPGCSSLGVGAFSENGPFRPS--GELLVRNEYSWNREANMLYLETPIGVGFSYSTDSSS  141

Query  459   YKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVH  638
             Y   +D +TAR+NL FL+KW ++F +Y++ D +I G+SY GH  PQLAEL+L++N+K   
Sbjct  142   YAAVNDKITARDNLVFLQKWLLKFPQYKNRDLFITGESYAGHYVPQLAELMLQFNKKE--  199

Query  639   VRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGE  812
              +   LKGIALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G 
Sbjct  200   -KLFNLKGIALGNPVLEFATDLNSRAEFFWSHGLISDSTYKMFTSFCNYSRYVSEYYRGS  258

Query  813   MSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDD  992
             +S  CS +   +  E    + K ++    C +   S S+       T   D C+    + 
Sbjct  259   VSSICSRVMSQVGRETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTETIDVCVEDETES  318

Query  993   YLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDE  1163
             YL+R +VQ+ALHA     + W    +  +  L +L I  +  +  L+K GIP+L+YSGD+
Sbjct  319   YLNRRDVQKALHARLVGVNKWSVCSNILDYELLDLEIPTISIVGKLIKAGIPVLVYSGDQ  378

Query  1164  DLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFAT  1343
             D  IP++ +R L + LA  L L T      W++GKQ+GGW+Q +GN         L+FAT
Sbjct  379   DSVIPLTGSRTLVHGLAEELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LSFAT  430

Query  1344  VRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             +RG SH  P S P ++L LF+AFL G P P  
Sbjct  431   IRGASHEAPFSQPERSLVLFRAFLGGRPLPQA  462



>ref|XP_003531913.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   352 bits (902),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 188/442 (43%), Positives = 265/442 (60%), Gaps = 19/442 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F+Q+SGY+       RALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP   G LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+  +D +T
Sbjct  90    GVGAFSENGPFRPKGKG-LVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYEGVNDKIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WFI+F EYR+   +I G+SY GH  PQLAEL+L++N+K    +   LKGI
Sbjct  149   ARDNLVFLQSWFIKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  205

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +  V+E  +G +S  CS + 
Sbjct  206   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPICSSVM  265

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +  +S ++       T   D C+     +YL+R +VQ 
Sbjct  266   SQVTTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  325

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             A+HA+      W +  +  +  L +L I  +  +  L+K GIP+L+YSGD+D  IP++ +
Sbjct  326   AMHAHLVGVQRWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQDSVIPLTGS  385

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA  L L T      W++ +Q+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  386   RTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI--------LSFATIRGASHEAP  437

Query  1371  NSSPSKALTLFKAFLKGSPPPN  1436
              S P ++L LFK+FL+G P P 
Sbjct  438   FSQPERSLVLFKSFLEGGPLPQ  459



>ref|XP_007145476.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
 gb|ESW17470.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
Length=465

 Score =   351 bits (900),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 196/465 (42%), Positives = 273/465 (59%), Gaps = 27/465 (6%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             L F++  ++  ++     + I +LPGQP  V F QY+GYI   + + RALFYYF EA+ E
Sbjct  13    LLFVIAQSVVGVNSASQADKITTLPGQPP-VKFQQYAGYITVDEKQKRALFYYFVEAEVE  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
                S PL LWL GG  CSS   G F E+GPF+P+E+G L+KN+FSWN  +NMLY+++P G
Sbjct  72    PA-SKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEFSWNKEANMLYLESPAG  129

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAE  605
             V FSYS   S Y   +D MTAR+NL FL++WF +F E+++ DF+I G+SY GH  PQLA+
Sbjct  130   VGFSYSANKSFYDYVNDEMTARDNLVFLQRWFTKFPEFKNSDFFITGESYAGHYVPQLAQ  189

Query  606   LILEYNRKPVHVRPIKLKGIALGNPLLE--KMGLSNVEHLWHYGIISTELYHLQKRQCDS  779
             LI++   K        LKGIALGNPLLE      S  E  W +G+IS   Y +  + C+ 
Sbjct  190   LIVQTKTK------FNLKGIALGNPLLEFNTDFNSRAEFFWSHGLISDSTYEIFTKVCNY  243

Query  780   TRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC--QTDQ--YSSSQRHCLGT  947
             +++ ++  SG+++  CS +N ++S E+   +   ++    C    DQ  Y  +Q   L  
Sbjct  244   SQIRRQHQSGKLTPICSGVNKLVSTEVSRYVDTYDVTLDVCLSSVDQQAYVLNQLTQL-Q  302

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
             E  K D C+      YL+R +VQEALHA     ++W          L NL I  +P L A
Sbjct  303   EGGKIDVCVEDETTAYLNRKDVQEALHAKLEGITSWSVCSDTLGYDLQNLEIPTIPILGA  362

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L K GI +L+YSGD+D  IP+  TR L N LA    L T      W++GKQ+ GW+Q +G
Sbjct  363   LAKSGIRVLVYSGDQDSVIPLIGTRSLVNGLAKDFGLNTTVSYRTWFEGKQVAGWTQEYG  422

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +         L+FATVRG +H  P S P ++L L KAFL+G P P
Sbjct  423   DI--------LSFATVRGAAHEAPFSQPERSLVLLKAFLEGKPLP  459



>ref|XP_007043816.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 ref|XP_007043817.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99647.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99648.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   351 bits (900),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 193/466 (41%), Positives = 273/466 (59%), Gaps = 26/466 (6%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEA  236
             L F+++   + + +  +  + D    LPGQP  V F QYSGY+   + + RALFYYFAEA
Sbjct  11    LGFIVLEVWFCVQVECSLALFDRITQLPGQPK-VGFQQYSGYVTVDEKKQRALFYYFAEA  69

Query  237   QSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVD  413
             +  D  S PL LWL GG  CSS  +G F ENGPFRP+  GE LVKN++SWN  +NMLY++
Sbjct  70    EV-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPS--GEVLVKNEYSWNREANMLYLE  126

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
              PIGV FSYS  +S Y+   D +TAR+NL F++ WF++F +YR+   +I G+SY GH  P
Sbjct  127   APIGVGFSYSTDASSYEAVDDKITARDNLVFMQNWFLKFPQYRNRSLFITGESYAGHYIP  186

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGL---SNVEHLWHYGIISTELYHLQK  764
             QLAEL+L++NRK    +   LKGIALGNP+LE   +   S  E  W +G+IS   Y +  
Sbjct  187   QLAELMLQFNRKD---KLFNLKGIALGNPVLE-FAIDFNSRAEFFWSHGLISDSTYKMFT  242

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG  944
               C+ +R V E     +S  CS +   +S E    + K ++    C +   S S+     
Sbjct  243   TSCNYSRYVSEYYRDAVSPICSRVMRQVSTETSRFVDKYDVTLDVCISSMLSQSKVLTPQ  302

Query  945   TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLS  1115
                   D C+     +YL+R +VQ+ALHA       W    +  +  L +L I  +  + 
Sbjct  303   QVGETIDVCVEDETANYLNRQDVQKALHARLVGVRKWAVCSNVLDYELLDLEIPTITIVG  362

Query  1116  ALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTF  1295
             +L+K GIP+++YSGD+D  IP++ +R L N LA  L L T      W++G+Q+GGW+Q +
Sbjct  363   SLVKAGIPVMVYSGDQDSVIPLTGSRTLVNRLAKELGLKTTVTYRVWFEGQQVGGWTQVY  422

Query  1296  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             GN         L+FAT+RG SH  P S P ++L LFKAFL+G P P
Sbjct  423   GNI--------LSFATIRGASHEAPFSQPERSLVLFKAFLEGRPLP  460



>ref|XP_003551804.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   350 bits (899),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 189/442 (43%), Positives = 264/442 (60%), Gaps = 19/442 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F+Q+SGY+       RALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +G LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+  +D +T
Sbjct  90    GVGAFSENGPFRPKGEG-LVRNQFSWNKEANMLYLETPIGVGFSYSTDTSSYEGVNDKIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A +NL FL+ WF++F EYR+   +I G+SY GH  PQLAEL+L +NRK    +   LKGI
Sbjct  149   AGDNLVFLQNWFMKFPEYRNRSLFIVGESYAGHYVPQLAELMLRFNRKE---KLFNLKGI  205

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +  V+E  +G +S  CS + 
Sbjct  206   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPICSSVM  265

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C +  +S ++       T   D C+     +YL+R +VQ 
Sbjct  266   SQVSTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  325

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA+      W +  +  +  L +L I  +  +  L+K GIP+L+YSGD+D  IP++ +
Sbjct  326   ALHAHLVGVQRWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQDSVIPLTGS  385

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA  L L T      W++ +Q+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  386   RTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI--------LSFATIRGASHEAP  437

Query  1371  NSSPSKALTLFKAFLKGSPPPN  1436
              S P ++L LFK+FL+G P P 
Sbjct  438   FSQPERSLVLFKSFLEGGPLPQ  459



>gb|AES77859.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=460

 Score =   350 bits (898),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 189/441 (43%), Positives = 266/441 (60%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  VDF+Q+SGY+       +ALF+YF EA++ D  S PL LWL GG  CSS 
Sbjct  31    ITNLPGQP-HVDFHQFSGYVNVDDQNKKALFFYFVEAKN-DAVSKPLVLWLNGGPGCSSL  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +  LVKNQFSWN  +NMLY+++PIGV FSYS  +S Y+  +D +T
Sbjct  89    GVGAFSENGPFRPKGEA-LVKNQFSWNTEANMLYLESPIGVGFSYSTDTSSYEGVNDKIT  147

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WF++F EYR+   +I G+SY GH  PQLAEL+L++N+K    +   LKGI
Sbjct  148   ARDNLIFLQNWFVKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  204

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   + +    C+ +R V+E  +G +S  CS + 
Sbjct  205   ALGNPVLEFATDFNSRAEFFWSHGLISDLTFKMFTSVCNYSRYVREYYNGAVSPVCSSVM  264

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C +  +S +        T   D C+     +YL+R +VQ 
Sbjct  265   SQVSTETSRFVDKYDVTLDVCISSVFSQTNVLNPQQVTETIDVCVEDETVNYLNRKDVQS  324

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA+      W       +  L +L I  +  +  L+K GIP+L+YSGD+D  IP++ +
Sbjct  325   ALHAHLIGVHRWSPCSSVLDYELRDLEIPTITVVGKLVKAGIPVLVYSGDQDSVIPLTGS  384

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L + T      W+ G+Q+GGW+Q +GN         L+FATVRG SH VP
Sbjct  385   RTLVHQLAKQLRMNTTVPYRVWFAGQQVGGWTQVYGNI--------LSFATVRGASHEVP  436

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFK+FL+G P P
Sbjct  437   FSQPERSLVLFKSFLEGRPLP  457



>ref|XP_009378815.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 193/444 (43%), Positives = 261/444 (59%), Gaps = 23/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+     + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  35    ITGLPGQPP-VGFQQYSGYVTVDAKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  93    GVGAFSENGPFRP--KGEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVADHI  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL+KWF +F +YR+   YI G+SY GH  PQLAEL+L++           LKG
Sbjct  151   TARDNLLFLQKWFEKFPQYRNRSLYITGESYAGHFVPQLAELMLQFKE-----HHFNLKG  205

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS +
Sbjct  206   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYKMFSSVCNYSRFVSEYYRGSVSPICSRV  265

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S E    + K ++    C +  +S S+           D C+   V +YL+RP+VQ
Sbjct  266   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKALLPQQVADSIDVCVEDEVVNYLNRPDVQ  325

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       W    +  +  + ++ I  +  +  L+K GIP+L+YSGD+D  IP++ 
Sbjct  326   KALHARLVGVRQWAVCSNILDYQVLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVIPLTG  385

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA +L L T      W++G+Q+GGW+Q +GN         L+FATVRG SH  
Sbjct  386   SRTLVHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATVRGASHEA  437

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LFK+FLKG P P  
Sbjct  438   PFSQPERSLVLFKSFLKGRPLPEV  461



>ref|XP_006829355.1| hypothetical protein AMTR_s02986p00003470, partial [Amborella 
trichopoda]
 gb|ERM96771.1| hypothetical protein AMTR_s02986p00003470, partial [Amborella 
trichopoda]
Length=442

 Score =   349 bits (896),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 265/426 (62%), Gaps = 39/426 (9%)
 Frame = +3

Query  105   IRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGG  284
             I  N ++I  LPGQP +  F QYSGY++T    GRALFYYF EA + D  S PLTLWL G
Sbjct  19    IPFNSDLITQLPGQPPNSSFKQYSGYVLTDTNHGRALFYYFVEADAHDSISRPLTLWLNG  78

Query  285   GHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYK  464
             G  CSS   G F E+GPF+P ++  L+ N++SWNL SN+LYV++PIGV FSYSNTSSDY 
Sbjct  79    GPGCSSLGFGAFMEHGPFQPGDNFTLIHNKYSWNLESNVLYVESPIGVGFSYSNTSSDYI  138

Query  465   IWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVR  644
              W+DT TA++NL+FL  WF +F  YRD D Y+ G+SY GH  PQLA L+++YN++P ++R
Sbjct  139   HWNDTTTAKDNLRFLINWFEKFPAYRDSDLYLTGESYAGHYIPQLATLLVDYNKQP-NIR  197

Query  645   PIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSE  821
             PIKLK IALGNPLL+  + +++ + LW +G+IS     LQK  C+ +  ++  +  + S+
Sbjct  198   PIKLKAIALGNPLLDLDISVNSEDFLWAHGVISDSALKLQKTVCNISTYLRFYVHDQYSQ  257

Query  822   DCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQ----RHCLGTETAK-------ADP  968
              C+D+  ++++E+G D  + ++L   C ++  SS Q    +   G   AK        DP
Sbjct  258   ACNDVFNIVNDELGPDTDRGDILLPICLSNG-SSLQGVFPKGIHGKIQAKRSLSIRSGDP  316

Query  969   CLLTWVDDYLSRPEVQEALHANAS----TWDS-----------------IFHGRNMIL--  1079
             CL   V  YL++PEVQ+ALHAN +     WD                  IF  +   L  
Sbjct  317   CLGDRVFAYLNKPEVQKALHANITHLPFHWDFCSGSLSLSYKKSLPGELIFLSKFRPLVY  376

Query  1080  --NNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEP  1253
               +NL +D++P +  LL   IP+L+YSGD+D +IP++ TR +AN LA  L L ++    P
Sbjct  377   QEDNLDMDVMPLMVHLLNENIPVLLYSGDQDAKIPLTQTRIIANQLANTLKLFSITKYAP  436

Query  1254  WYDGKQ  1271
             WYD KQ
Sbjct  437   WYDKKQ  442



>ref|XP_004492026.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 192/459 (42%), Positives = 272/459 (59%), Gaps = 20/459 (4%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             FLL    + +S+     II  LPGQP +V+FN +SGY+       +ALF+YF EAQ +D 
Sbjct  16    FLLQLRSFGVSLSHPYRIIH-LPGQP-NVEFNHFSGYVNVDDKNNKALFFYFVEAQ-QDS  72

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP  +G LV+NQFSWN  +NMLY+++PIGV 
Sbjct  73    VSKPLVLWLNGGPGCSSIGVGAFSENGPFRPKGEG-LVRNQFSWNTEANMLYLESPIGVG  131

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYS  +S Y   +D +TAR+NL FL+ WF++F +YR+   +I G+SY GH  PQLAEL+
Sbjct  132   FSYSTDTSSYGGVNDKITARDNLIFLQNWFVQFPQYRNRSLFIVGESYAGHYVPQLAELM  191

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTR  785
             L++N+K    +   LKGIALGNP+LE      S  E  W +G+IS   Y +    C+ +R
Sbjct  192   LQFNKKE---KLFNLKGIALGNPVLEFSADFNSRAEFFWSHGLISDLTYKMFTSVCNYSR  248

Query  786   MVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKAD  965
              V+E  +G +S  CS +   +S E    + K ++    C +  +S ++       T   D
Sbjct  249   YVREYYNGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTKILNPKQVTETID  308

Query  966   PCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGI  1136
              C+     +YL+R +VQ ALHA       W    +  +  L++L I  +  +  L+K GI
Sbjct  309   VCVEDETVNYLNRKDVQSALHARLVGVQRWTPCSNVLDYDLHDLEIPTITVVGKLVKAGI  368

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGE  1316
             P+L+YSGD+D  IP++ +R L + LA  L + T      W+  +Q+GGW+Q +GN     
Sbjct  369   PVLVYSGDQDSVIPLTGSRTLVHQLAKELRMNTTVPYRVWFQKQQVGGWTQVYGNI----  424

Query  1317  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                 L+FATVRG SH  P S P ++L LFK+FL+G P P
Sbjct  425   ----LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  459



>ref|XP_009334311.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=459

 Score =   350 bits (897),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 264/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F  +SGYI       +ALFYYFAEA+     S PL LWL GG  CSS 
Sbjct  30    ITSLPGQPP-VGFQHFSGYITVDDHNHKALFYYFAEAEITPA-SKPLVLWLNGGPGCSSL  87

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  DGE LV+N++SWN  +NMLY++TP+GV FSY+ +SS Y    D  
Sbjct  88    GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYAKSSSSYIAVDDEA  145

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF +F +Y+  D ++ G+SY GH  PQLA+L++E NRK    +   LKG
Sbjct  146   TARDNLVFLQRWFNKFPQYKQRDLFLTGESYAGHYIPQLAKLMIEINRKE---KSFNLKG  202

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E     MS  CS +
Sbjct  203   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYNMFTSVCNYSRYVSEYYRDSMSPVCSRV  262

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S+E    + K ++    C +   S S+       T + D C+     +YL+R +VQ
Sbjct  263   MSQVSKETSKFVDKYDVTIDVCISSVLSQSKVISPNQMTERIDVCVEDKTVNYLNRKDVQ  322

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       WD   +  +  + NL I  +  + +L+K+GIP+L+YSGD+D  IP++ 
Sbjct  323   KALHARLVGVRRWDVCSNILDYQVLNLEIPTISLVGSLVKQGIPVLVYSGDQDSVIPLTG  382

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L   LAT L L T      W++GKQ+GGW+Q +GN         L+FAT+RG SH  
Sbjct  383   SRSLVYRLATELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LSFATIRGASHEA  434

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LFK+FL+G P P  
Sbjct  435   PFSQPGRSLRLFKSFLEGRPLPEV  458



>gb|KDP23272.1| hypothetical protein JCGZ_23105 [Jatropha curcas]
Length=463

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 194/442 (44%), Positives = 263/442 (60%), Gaps = 21/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY++      RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  34    ITQLPGQP-QVGFQQYSGYVIVDNKEQRALFYYFAEAET-DPASKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LVKNQ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  92    GVGAFSENGPFRPS--GEVLVKNQHSWNREANMLYLETPIGVGFSYSTDTSSYETVNDKI  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL+KWFI+F +YR+   +I+G+SY GH  PQLAEL+LE+N+K    +   LKG
Sbjct  150   TARDNLVFLQKWFIKFPQYRNRSLFISGESYAGHYVPQLAELMLEFNKKH---KLFNLKG  206

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+L+      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS +
Sbjct  207   IALGNPVLDFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSRYVNEYYRGSVSPICSRV  266

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S E    + K ++    C +   + S            D C+     +YL+R +VQ
Sbjct  267   MGQVSRETSRFVDKYDVTLDVCISSVLAQSNALSPKQVGDNIDVCVEDETVNYLNRQDVQ  326

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       W    +  +  L +L I  +  +  L++ GIP+L+YSGD+D  IP++ 
Sbjct  327   KALHARLVGVRRWTVCSNILDYELLDLEIPTIAIVGRLIRAGIPVLVYSGDQDSVIPLTG  386

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L   LA +L L T      W+ G+Q+GGW+Q +GN         L+FAT+RG SH  
Sbjct  387   SRTLVRGLAEKLGLKTSVPYRVWFGGQQVGGWTQVYGNI--------LSFATIRGASHEA  438

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LFKAFL+G P P
Sbjct  439   PFSQPERSLVLFKAFLEGRPLP  460



>ref|XP_009368797.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=467

 Score =   349 bits (896),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 265/444 (60%), Gaps = 22/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI       +ALFYYFAEA+  +  S PL LWL GG  CSS 
Sbjct  39    ITSLPGQP-HVGFQQFSGYITVDDHNHKALFYYFAEAEI-NPASKPLVLWLNGGPGCSSL  96

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  DGE LV+N++SWN  +NMLY++TP+GV FSYS ++S Y    D  
Sbjct  97    GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYSKSNSSYMAVDDEA  154

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF +F +YR +D ++AG+SY GH  PQLA+LI+E NRK        LKG
Sbjct  155   TARDNLVFLQRWFNKFPQYRHMDLFLAGESYAGHYIPQLAKLIVEINRK----EKFNLKG  210

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E LW +G+IS   Y++    C+ +R V E     +S  CS +
Sbjct  211   IALGNPVLEFATDLNSQAEFLWSHGLISDSTYNMFTSVCNYSRYVSEYYRHSVSPVCSRV  270

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +++E    + K ++    C +   S S+       T + D C+     +YL+R +VQ
Sbjct  271   MSQVTKETSQFVDKYDVTLDVCISSVLSQSKFISPNQMTERIDVCVEDKTVNYLNRKDVQ  330

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       WD         + NL +  +  + +L+K+GI +L+YSGD+D  IP++ 
Sbjct  331   KALHARLVGVRRWDVCSSILEYQMLNLEVPTISLVGSLVKQGIQVLVYSGDQDSVIPLTG  390

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA  L L T      W++GKQ+GGW+Q +GN         L+FAT+RG SH  
Sbjct  391   SRRLVSRLARELELNTTVPYRVWFEGKQVGGWTQVYGNI--------LSFATIRGASHEA  442

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LFK+FL+G P P  
Sbjct  443   PFSQPERSLRLFKSFLEGRPLPEV  466



>ref|XP_010250555.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=498

 Score =   350 bits (897),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 272/465 (58%), Gaps = 26/465 (6%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             L  F+ +    S+S RI       LPGQP  V F Q+SGY+     R R LFYYFAEA+ 
Sbjct  53    LFQFMGIAASLSLSDRIT-----ELPGQP-QVSFQQFSGYVTVDDKRRRDLFYYFAEAEI  106

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTP  419
              D  S PL LWL GG  CSS  +G F ENGPFRP+  GE LV+N++SWN  +NMLY++TP
Sbjct  107   -DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPS--GEVLVRNEYSWNREANMLYLETP  163

Query  420   IGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQL  599
             +GV FSYS  +S Y    D +TAR+NL FL++WF++F +Y+  D +I G+SY GH  PQL
Sbjct  164   VGVGFSYSTDTSSYVAVDDKITARDNLVFLQRWFLKFPQYKHKDLFITGESYAGHYVPQL  223

Query  600   AELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQC  773
             AELI+++N+K    +   LKGIALGNP+LE      S  E  W +G+IS   Y L    C
Sbjct  224   AELIIQFNKKE---KLFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDSTYKLFTSAC  280

Query  774   DSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTET  953
             + +R V E   G +S  CS +   +S+E    + K ++    C +   S S+       T
Sbjct  281   NYSRYVGEYYRGSISSVCSRVMSRVSKETSRFVDKYDVTLDVCISSVLSQSKVLNPQQVT  340

Query  954   AKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALL  1124
              + D C+     +YL+R +VQ+ALHA       W    +  +  L NL I  +  + +L+
Sbjct  341   ERIDVCVEDETVNYLNRRDVQKALHARLVGVRRWAVCSNILDYELLNLEIPTISIVGSLV  400

Query  1125  KRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNS  1304
             K GIP+L+YSGD+D  IP++ +R L + LA  L L T      W+ G+Q+GGW+Q +GN 
Sbjct  401   KAGIPVLVYSGDQDSVIPLTGSRTLVHELAMELGLNTTVPYRVWFAGQQVGGWTQDYGNI  460

Query  1305  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
                     L+FAT+RG SH  P S P ++L LFK+FL+G P P  
Sbjct  461   --------LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLPEV  497



>ref|XP_008777393.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Phoenix 
dactylifera]
Length=463

 Score =   348 bits (894),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 189/443 (43%), Positives = 259/443 (58%), Gaps = 19/443 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  VDF Q+SGYI     + RALFYYF EA+  D  + PL LWL GG  CSS 
Sbjct  34    ISKLPGQP-QVDFQQFSGYITVDDRKQRALFYYFTEAEL-DPSAKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+E   LV+N++SWN  +NMLY++TP GV FSY+N +S Y+   D MT
Sbjct  92    GVGAFSENGPFRPSEQ-VLVRNEYSWNKEANMLYLETPAGVGFSYANDTSCYEGVDDKMT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL +WF +F +Y+  D YI G+SY GH  PQLAEL++++N+K        LKG 
Sbjct  151   ARDNLVFLLRWFSKFPQYKVRDLYITGESYAGHYVPQLAELMVKFNKKK---NIFNLKGA  207

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  C+ + 
Sbjct  208   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTLACNYSRYVSEYYRGSLSAVCARVM  267

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +++E    + K ++    C +   S S+       T   D C+     +YL+R +VQ+
Sbjct  268   GQVTQETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDETVNYLNRKDVQD  327

Query  1020  ALHANAS---TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA  +    W          L NL I  +  + +L++ GIP+L+YSGD+D  IP++ +
Sbjct  328   ALHARLAGVPKWSVCSSVLEYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDSVIPLTGS  387

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L   LA  L L T      W+ GKQ+GGW+Q +G+         LTFAT+RG SH  P
Sbjct  388   RTLVQRLAKELKLKTTVPYRVWFAGKQVGGWTQVYGDI--------LTFATIRGASHEAP  439

Query  1371  NSSPSKALTLFKAFLKGSPPPNT  1439
              S P ++L LF+AFL+G P P T
Sbjct  440   FSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_011036160.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=462

 Score =   348 bits (893),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 191/441 (43%), Positives = 261/441 (59%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+       +ALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  33    ITQLPGQPP-VWFQQYSGYVTVDDKNQKALFYYFAEAEI-DCASKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +G LVKNQ+SWN  +NMLY++TPIGV FSYS  +S Y+   D +T
Sbjct  91    GVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLETPIGVGFSYSTNTSSYEGVDDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F +Y+    +I G+SY GH  PQLAEL+L++N+K    +   LKGI
Sbjct  150   ARDNLVFLQRWFVKFPQYKSRSLFITGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  206

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E LW +G+IS   Y +    C+ +R V E   G +S  CS + 
Sbjct  207   ALGNPVLEYSTDFNSRAEFLWSHGLISDTTYKMFTTVCNYSRYVSEYYRGSVSPQCSRVM  266

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +   S S+           D C+     +YL+RP+VQ 
Sbjct  267   NQVTRETSRFVDKYDVTLDVCISSVLSQSKVLTPQQVGDNVDVCVEDETVNYLNRPDVQM  326

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W    +  +  L +L I  +  +  L+K GIP+L+YSGD+D  IP++ +
Sbjct  327   ALHARLVGVRRWAVCSNILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDSVIPLTGS  386

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + L+  L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  387   RILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGASHEAP  438

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAFL G P P
Sbjct  439   FSQPERSLVLFKAFLGGQPLP  459



>ref|XP_008222371.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Prunus 
mume]
Length=464

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 191/446 (43%), Positives = 266/446 (60%), Gaps = 23/446 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             +II  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CS
Sbjct  35    DIIALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCS  92

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S  +G F ENGPFRP+  GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D
Sbjct  93    SLGVGAFSENGPFRPS--GEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVND  150

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
              +TAR+NL FL+KW  +F +Y++   +I G+SY GH  PQLAEL+L+Y     +     L
Sbjct  151   HITARDNLLFLQKWLEKFPQYKNRSLFITGESYAGHYVPQLAELMLQYKDYQFN-----L  205

Query  657   KGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KGIALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS
Sbjct  206   KGIALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICS  265

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPE  1010
              +   +S E    + K ++    C +  +S S+       T   D C+   + +YL+RP+
Sbjct  266   RVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQVTEAIDVCVEDEIVNYLNRPD  325

Query  1011  VQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQ+ALHA       W    +  +  L ++ I  +  +  L+K GIP+L+YSGD+D  IP+
Sbjct  326   VQKALHARLVGVRQWAVCSNILDYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVIPL  385

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + +R L + LA +L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH
Sbjct  386   TGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNM--------LSFATIRGASH  437

Query  1362  FVPNSSPSKALTLFKAFLKGSPPPNT  1439
               P S P ++L LFK+FL+G P P  
Sbjct  438   EAPFSQPERSLVLFKSFLEGQPLPEV  463



>ref|XP_010249188.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=494

 Score =   349 bits (895),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 190/444 (43%), Positives = 266/444 (60%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  V F Q+SGY+   + + RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  65    IIALPGQP-QVGFQQFSGYVTVDEKKERALFYYFVEAEI-DPSSKPLVLWLNGGPGCSSL  122

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LV+N++SWN  +NMLY++TP+GV FSYS  +S Y    D +
Sbjct  123   GVGAFSENGPFRPS--GEVLVRNEYSWNSEANMLYLETPVGVGFSYSTDTSSYVAVDDKI  180

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF++F +Y+  D +I G+SY GH  PQLA+L++++N+K    +   LKG
Sbjct  181   TARDNLVFLQRWFLKFPQYKHRDLFITGESYAGHYIPQLADLMIQFNKKE---KLFNLKG  237

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y L    C+ +R V E   G +S  CS +
Sbjct  238   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYRLFTSACNYSRYVSEYYRGSVSSVCSKV  297

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S+E    + K ++    C +   S S+       T + D C+     +YL+R +VQ
Sbjct  298   MNQVSKETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTERIDVCVEDETVNYLNRRDVQ  357

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       W    +  N  L NL I  +  + +L+K GIP+L+YSGD+D  IP++ 
Sbjct  358   KALHARLVGVRRWAVCSNILNYELLNLEIPTISIVGSLVKAGIPVLVYSGDQDSVIPLTG  417

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA  L L T      W+ G+Q+GGW+Q +GN         L+FAT+RG SH  
Sbjct  418   SRTLVHGLAKDLGLNTTVPYRVWFAGQQVGGWTQVYGNV--------LSFATIRGASHEA  469

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LFK+FL+G P P  
Sbjct  470   PFSQPERSLVLFKSFLEGRPLPEV  493



>ref|XP_002512656.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF50108.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/470 (41%), Positives = 275/470 (59%), Gaps = 24/470 (5%)
 Frame = +3

Query  48    KIMVFLLWFLLVNTLYSISIRINGEIIDS---LPGQPSDVDFNQYSGYIVTHKFRGRALF  218
             +IM F +  +L+   + + +  N  + D    LPGQP  + F+QYSGY+   + + RALF
Sbjct  2     EIMAFAV--VLLQICFLMGVNSNPSLFDKIVKLPGQP-QIGFHQYSGYVTVDEKKQRALF  58

Query  219   YYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASN  398
             YYFAEA++ D  S PL LWL GG  CSS  +G F ENGPFRP+    LVKNQ+SWN  +N
Sbjct  59    YYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNQYSWNREAN  116

Query  399   MLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYG  578
             MLY+++PIGV FSYS  +S Y+  +D  TAR+NL FL+KWF++F +YR+   +I G+SY 
Sbjct  117   MLYLESPIGVGFSYSVDTSFYEAVNDKTTARDNLVFLQKWFVKFPQYRNRSLFITGESYA  176

Query  579   GHLAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELY  752
             GH  PQLA+L+LE+N+K    +   LKG+ALGNP+LE      S  E  W +G+IS   Y
Sbjct  177   GHYVPQLAQLMLEFNKKQ---KLFNLKGVALGNPVLEFATDFNSRAEFFWSHGLISDTTY  233

Query  753   HLQKRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR  932
              L    C+ +R V E   G +S  CS +   +S E    + K ++    C +   S S+ 
Sbjct  234   KLFTSVCNYSRYVSEYYRGSVSPLCSRVMGQVSRETSKFVDKYDVTLDVCISSVLSQSKI  293

Query  933   HCLGTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDIL  1103
                       D C+     +YL+R +VQ ALHA       W       +  L +L I  +
Sbjct  294   LSPHVIADNVDVCVEDETVNYLNRLDVQMALHARLVGVHQWTVCSSILDYELLDLEIPTI  353

Query  1104  PTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGW  1283
               +  L++ G+P+L+YSGD+D  IP++ +R L + LA  L L T      W++G+Q+GGW
Sbjct  354   SIVGKLIEAGVPVLVYSGDQDSVIPLTGSRTLVHGLAEELGLKTTVPYRVWFEGQQVGGW  413

Query  1284  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +Q +GN         L+FAT+RG SH  P S P ++L LFKAFL+G P P
Sbjct  414   TQVYGNI--------LSFATIRGASHEAPFSQPERSLVLFKAFLEGQPLP  455



>ref|XP_009337518.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=468

 Score =   348 bits (892),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 191/442 (43%), Positives = 264/442 (60%), Gaps = 21/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F  +SGYI       ++LFYYFAEA+     S PL LWL GG  CSS 
Sbjct  39    ITSLPGQPP-VRFQHFSGYITVDDHNHKSLFYYFAEAEITPA-SKPLVLWLNGGPGCSSL  96

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  DGE LV+N++SWN  +NMLY++TP+GV FSY+ +SS Y    D  
Sbjct  97    GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYAKSSSSYIAVDDEA  154

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF +F +Y+  D ++ G+SY GH  PQLA+L++E NRK    +   LKG
Sbjct  155   TARDNLVFLQRWFNKFPQYKHRDLFLTGESYAGHYIPQLAKLMIEINRKE---KSFNLKG  211

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E     MS  CS +
Sbjct  212   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYNMFTSVCNYSRYVSEYYRDSMSPVCSRV  271

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S+E    + K ++    C +   S S+       T + D C+     +YL+R +VQ
Sbjct  272   MSQVSKETSKFVDKYDVTLDVCISSVLSQSKVISPNQMTERIDVCVEDKTVNYLNRKDVQ  331

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       WD   +  +  + NL I  +  + +L+K+GIP+L+YSGD+D  IP++ 
Sbjct  332   KALHARLVGVRRWDVCSNILDYQVLNLEIPTISLVGSLVKQGIPVLVYSGDQDSVIPLTG  391

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L   LAT L L T      W++GKQ+GGW+Q +GN         L+FAT+RG SH  
Sbjct  392   SRSLVYRLATELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LSFATIRGASHEA  443

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LFK+FL+G P P
Sbjct  444   PFSQPGRSLRLFKSFLEGRPLP  465



>gb|KHN31265.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   347 bits (890),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 269/450 (60%), Gaps = 23/450 (5%)
 Frame = +3

Query  114   NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHD  293
             + + I +LPGQP  V F Q+SGY+     + ++LFYYFAEA++ D  S PL LWL GG  
Sbjct  22    HADTIAALPGQP-HVGFQQFSGYVTVDDKKQKSLFYYFAEAET-DPASKPLVLWLNGGPG  79

Query  294   CSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
             CSS  +G F ENGPFRP  +GE L+KN +SWN  +NMLY++TP+GV FSY+  SS Y   
Sbjct  80    CSSLGVGAFSENGPFRP--NGEFLIKNYYSWNKEANMLYLETPVGVGFSYAKGSSSYMTV  137

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPI  650
             +D  TAR+NL FL +WF +F +YR  D ++ G+SY GH  PQLA+LI+E N K    +  
Sbjct  138   NDEATARDNLIFLLRWFNKFPQYRSRDLFLTGESYAGHYVPQLAKLIIEMNTKN---KIF  194

Query  651   KLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSED  824
              LKGIALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E     +S  
Sbjct  195   NLKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYYRDSVSPL  254

Query  825   CSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA--KADPCLLTWVDDYL  998
             CS +   +S E    + K ++    C +   S S+  C  ++ A    D C+   V +YL
Sbjct  255   CSKVMGQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYL  314

Query  999   SRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDL  1169
             +R +VQEALHA       WD   +  +  + NL +  LP + +L+K G+ +LIYSGD+D 
Sbjct  315   NRRDVQEALHAKLVGIRKWDVCSNILDYDMLNLEVPTLPVVGSLIKAGVKVLIYSGDQDS  374

Query  1170  RIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVR  1349
              IP++ +R L   LA +L L +      W++G+Q+GGW+Q +GN         L+FATVR
Sbjct  375   VIPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQVYGNI--------LSFATVR  426

Query  1350  GGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             G SH  P S P ++L LFK+FL+G P P+ 
Sbjct  427   GASHEAPFSQPERSLVLFKSFLEGRPLPDA  456



>ref|XP_002297872.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE82677.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=454

 Score =   347 bits (890),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 191/441 (43%), Positives = 260/441 (59%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+       +ALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  25    ITQLPGQPP-VWFQQYSGYVTVDDKNQKALFYYFAEAEI-DCASKPLVLWLNGGPGCSSL  82

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +G LVKNQ+SWN  +NMLY++TPIGV FSYS  +S Y+   D +T
Sbjct  83    GVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLETPIGVGFSYSTNTSSYEGVDDKIT  141

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F +YR    +I G+SY GH  PQLAEL+L++N+K    +   LKGI
Sbjct  142   ARDNLVFLQRWFVKFPQYRSRSLFITGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  198

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS + 
Sbjct  199   ALGNPVLEYSTDFNSRAEFFWSHGLISDTTYKMFTSVCNYSRYVSEYYRGSVSPLCSRVM  258

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +   S S+           D C+     +YL+RP+VQ 
Sbjct  259   SQVTRETSRFVDKYDVTLDVCISSVLSQSKVLTPQQVGDNVDVCVEDETVNYLNRPDVQM  318

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W    +  +  L +L I  +  +  L+K GIP+L+YSGD+D  IP++ +
Sbjct  319   ALHARLVGVRRWAVCSNILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDSVIPLTGS  378

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + L+  L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  379   RILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGASHEAP  430

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAFL G P P
Sbjct  431   FSQPERSLVLFKAFLGGQPLP  451



>ref|XP_009143848.1| PREDICTED: serine carboxypeptidase-like 46 [Brassica rapa]
 emb|CDY17183.1| BnaA05g10050D [Brassica napus]
Length=462

 Score =   347 bits (890),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 194/465 (42%), Positives = 273/465 (59%), Gaps = 19/465 (4%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             MV  L  L   TL S ++    + I SLPGQP  V F QYSGY+   + + RALFYY AE
Sbjct  9     MVTCLILLQALTLVSSTVMSRADRITSLPGQP-KVVFQQYSGYVSIDEKKQRALFYYLAE  67

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+++   S PL LWL GG  CSS  +G F ENGPFRP +   LV+NQ SWN  +NMLY++
Sbjct  68    AETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHEANMLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP+GV FSY+  SS Y+  +D +TA++NL FL+KWF  F +Y +   +I G+SY GH  P
Sbjct  126   TPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITGESYAGHYVP  185

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKR  767
             QLA+L+++YN+K  H+    LKGIALGNP+LE      S  E+ W +G+IS   Y +   
Sbjct  186   QLAQLMIQYNKKH-HL--FNLKGIALGNPVLEFSTDFNSRAEYFWSHGLISDPTYKMFTS  242

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT  947
              C+ +R V E   GE+S  CS +   +S E    + K ++    C     S S+      
Sbjct  243   YCNYSRFVSEYYRGEVSSMCSKVMSQVSTETSRFVDKYDVTLDLCIPSVLSQSKVVSPQQ  302

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
                  D C+     +YL+R +VQ+ALHA       W    +  +  L ++ +  +  + +
Sbjct  303   VGETVDVCVEDETVNYLNRRDVQKALHARLVGTRKWAVCSNVLDYELLDVEVPTINVVGS  362

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+K G+P+L+YSGD+D  IP++ +R L   LA +L L+T      W+ G+Q+GGW+Q +G
Sbjct  363   LIKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAQQLGLSTTVPYRVWFAGQQVGGWTQVYG  422

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             N         L FATVRG +H VP S P ++L LFKAFL G+P P
Sbjct  423   NV--------LAFATVRGAAHEVPFSQPERSLVLFKAFLGGNPLP  459



>ref|XP_006578724.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=469

 Score =   347 bits (890),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 269/450 (60%), Gaps = 23/450 (5%)
 Frame = +3

Query  114   NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHD  293
             + + I +LPGQP  V F Q+SGY+     + ++LFYYFAEA++ D  S PL LWL GG  
Sbjct  34    HADTIAALPGQP-HVGFQQFSGYVTVDDKKQKSLFYYFAEAET-DPASKPLVLWLNGGPG  91

Query  294   CSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
             CSS  +G F ENGPFRP  +GE L+KN +SWN  +NMLY++TP+GV FSY+  SS Y   
Sbjct  92    CSSLGVGAFSENGPFRP--NGEFLIKNYYSWNKEANMLYLETPVGVGFSYAKGSSSYMTV  149

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPI  650
             +D  TAR+NL FL +WF +F +YR  D ++ G+SY GH  PQLA+LI+E N K    +  
Sbjct  150   NDEATARDNLIFLLRWFNKFPQYRSRDLFLTGESYAGHYVPQLAKLIIEMNTKN---KIF  206

Query  651   KLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSED  824
              LKGIALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E     +S  
Sbjct  207   NLKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYYRDSVSPL  266

Query  825   CSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA--DPCLLTWVDDYL  998
             CS +   +S E    + K ++    C +   S S+  C  ++ A    D C+   V +YL
Sbjct  267   CSKVMGQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYL  326

Query  999   SRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDL  1169
             +R +VQEALHA       WD   +  +  + NL +  LP + +L+K G+ +LIYSGD+D 
Sbjct  327   NRRDVQEALHAKLVGIRKWDVCSNILDYDMLNLEVPTLPVVGSLIKAGVKVLIYSGDQDS  386

Query  1170  RIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVR  1349
              IP++ +R L   LA +L L +      W++G+Q+GGW+Q +GN         L+FATVR
Sbjct  387   VIPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQVYGNI--------LSFATVR  438

Query  1350  GGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             G SH  P S P ++L LFK+FL+G P P+ 
Sbjct  439   GASHEAPFSQPERSLVLFKSFLEGRPLPDA  468



>ref|XP_011036159.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=463

 Score =   347 bits (889),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 191/442 (43%), Positives = 262/442 (59%), Gaps = 20/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+       +ALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  33    ITQLPGQPP-VWFQQYSGYVTVDDKNQKALFYYFAEAEI-DCASKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +G LVKNQ+SWN  +NMLY++TPIGV FSYS  +S Y+   D +T
Sbjct  91    GVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLETPIGVGFSYSTNTSSYEGVDDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F +Y+    +I G+SY GH  PQLAEL+L++N+K    +   LKGI
Sbjct  150   ARDNLVFLQRWFVKFPQYKSRSLFITGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  206

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E LW +G+IS   Y +    C+ +R V E   G +S  CS + 
Sbjct  207   ALGNPVLEYSTDFNSRAEFLWSHGLISDTTYKMFTTVCNYSRYVSEYYRGSVSPQCSRVM  266

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA-KADPCLLTWVDDYLSRPEVQ  1016
               ++ E    + K ++    C +   S S+      +     D C+     +YL+RP+VQ
Sbjct  267   NQVTRETSRFVDKYDVTLDVCISSVLSQSKVLTPQQQVGDNVDVCVEDETVNYLNRPDVQ  326

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
              ALHA       W    +  +  L +L I  +  +  L+K GIP+L+YSGD+D  IP++ 
Sbjct  327   MALHARLVGVRRWAVCSNILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDSVIPLTG  386

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + L+  L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  
Sbjct  387   SRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGASHEA  438

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LFKAFL G P P
Sbjct  439   PFSQPERSLVLFKAFLGGQPLP  460



>gb|KHG09716.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=462

 Score =   346 bits (888),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 189/467 (40%), Positives = 273/467 (58%), Gaps = 26/467 (6%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             +++  LWF + +++       + + I  LPGQP  + F Q+SGY+     + +ALFYYF 
Sbjct  13    LLLIELWFTIESSV------AHPDKIVKLPGQPPRLSFQQFSGYVTVDYKKHKALFYYFV  66

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             EA++ D  S PL LWL GG  CSS  +G F ENGPFRP  +GE LVKN +SWN  +NMLY
Sbjct  67    EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGEFLVKNDYSWNREANMLY  123

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TPIGV FSYS  +S Y+   D +TAR+NL FL+ W+ +F  YR  D YI G+SY GH 
Sbjct  124   LETPIGVGFSYSTNTSSYEAVDDEITARDNLVFLQNWYNKFPNYRHRDLYITGESYAGHY  183

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQ  761
              PQLA+L++E+N+K        LKGIALGNP++E      S  E+ W +G+IS   Y + 
Sbjct  184   IPQLAKLMVEFNKKQ---NLFNLKGIALGNPVMEFATDFNSRAEYFWSHGLISDSTYKMF  240

Query  762   KRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCL  941
                C+ +R V E     +S  CS +   +S E    + K ++    C +   S S     
Sbjct  241   TSVCNYSRYVSEYYRDSVSPSCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSMAINP  300

Query  942   GTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
                + + D C+   + +YL++ +VQ+ALHA       W    +  +  L NL +  +  +
Sbjct  301   QQVSERVDVCVEDKIVNYLNQKDVQKALHARLVGVRRWTVCSNILDYQLLNLEMPTISIV  360

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+K GIP+L+YSGD+D  IP++ +R L + LA  L L T      W++GKQ+GGW+Q 
Sbjct  361   GSLIKSGIPVLVYSGDQDSVIPLTGSRSLVSRLAKELELETTVPYRVWFEGKQVGGWTQV  420

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +GN         L+FAT+RG SH  P S P ++L LFK+FL+G P P
Sbjct  421   YGNI--------LSFATIRGASHEAPFSQPERSLMLFKSFLEGKPLP  459



>ref|XP_008222370.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Prunus 
mume]
Length=465

 Score =   346 bits (888),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 191/447 (43%), Positives = 268/447 (60%), Gaps = 24/447 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             +II  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CS
Sbjct  35    DIIALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCS  92

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S  +G F ENGPFRP+  GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D
Sbjct  93    SLGVGAFSENGPFRPS--GEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVND  150

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
              +TAR+NL FL+KW  +F +Y++   +I G+SY GH  PQLAEL+L+Y     +     L
Sbjct  151   HITARDNLLFLQKWLEKFPQYKNRSLFITGESYAGHYVPQLAELMLQYKDYQFN-----L  205

Query  657   KGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KGIALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS
Sbjct  206   KGIALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICS  265

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA-DPCLLTWVDDYLSRP  1007
              +   +S E    + K ++    C +  +S S+      +  +A D C+   + +YL+RP
Sbjct  266   RVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQQVTEAIDVCVEDEIVNYLNRP  325

Query  1008  EVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIP  1178
             +VQ+ALHA       W    +  +  L ++ I  +  +  L+K GIP+L+YSGD+D  IP
Sbjct  326   DVQKALHARLVGVRQWAVCSNILDYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVIP  385

Query  1179  VSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGS  1358
             ++ +R L + LA +L L T      W++G+Q+GGW+Q +GN         L+FAT+RG S
Sbjct  386   LTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNM--------LSFATIRGAS  437

Query  1359  HFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             H  P S P ++L LFK+FL+G P P  
Sbjct  438   HEAPFSQPERSLVLFKSFLEGQPLPEV  464



>gb|KHN08898.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=453

 Score =   346 bits (887),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 187/468 (40%), Positives = 274/468 (59%), Gaps = 25/468 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++  ++  +L  TL  +      + I +LPGQP  V+F QYSGY+       RALFYYF 
Sbjct  1     MIATIIIIVLAQTLVGVISLPEADKISNLPGQP-QVEFQQYSGYVTVDDQHQRALFYYFV  59

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA+ ED  S PL LWL GG  CSS  +G F E+GPFRP+++  L +N +SWN  +N+LY+
Sbjct  60    EAE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDYSWNKVANVLYL  118

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++P GV FSYS+  S Y   +D +TAR+NL FL++WF +F EY + DF+I G+SYGGH  
Sbjct  119   ESPAGVGFSYSSNKSFYASVTDEITARDNLVFLQRWFTKFPEYSNNDFFITGESYGGHYV  178

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQK  764
             PQL++LI++            LKGIA+GNPLLE      S  E+ W +G+IS   Y +  
Sbjct  179   PQLSQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYFWSHGLISDSTYEVLT  232

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG  944
             R C+ + + ++I +G +   C   N +++ EI + + K ++    C +    + Q + L 
Sbjct  233   RVCNFSSIRRQIQNGNLRGVCVKANKLLNTEISNFIDKYDVTLDVCLSS--VNQQAYVLN  290

Query  945   --TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPT  1109
                ET K D C+      YL+R +VQ+ALHAN    + W +     +    NL I  +P 
Sbjct  291   QLQETQKIDVCIGDKTTTYLNRKQVQKALHANLVGVTKWSTCSSVLHYDYQNLEIPTIPI  350

Query  1110  LSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQ  1289
             L +L+K GI +L+YSGD+D  IP+  +R L N LA  + L T      W++GKQ+ GW++
Sbjct  351   LGSLVKSGIKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLDTTVAYRAWFEGKQVAGWTK  410

Query  1290  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              +GN         L++AT+RG SH  P S P ++L L KAFL+G P P
Sbjct  411   VYGNI--------LSYATIRGASHEAPFSQPQRSLLLLKAFLEGKPLP  450



>ref|XP_006304410.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
 gb|EOA37308.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
Length=459

 Score =   346 bits (887),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 192/459 (42%), Positives = 270/459 (59%), Gaps = 19/459 (4%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             F L+  L S ++  + + +  LPGQP  V F QYSGY+     + RALFYYFAEA++ D 
Sbjct  12    FALILFLSSSTVLSHSDRVTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAET-DP  69

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV 
Sbjct  70    TSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLETPVGVG  128

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYS  SS Y+  +D +TAR+NL FL++WF++F  Y +   +I G+SY GH  PQLA+L+
Sbjct  129   FSYSTQSSSYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLM  188

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTR  785
             ++YN+K  H+    L+GIA+GNP+LE      S  E+ W +G+IS   Y +    C+ +R
Sbjct  189   IQYNKKH-HL--FNLRGIAIGNPVLEFETDFNSRAEYFWSHGLISDSTYKMFTSYCNYSR  245

Query  786   MVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKAD  965
              V E   G MS  CS +   +S E    + K ++    C     S S+           D
Sbjct  246   YVSEYYRGSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVD  305

Query  966   PCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGI  1136
              C+      YL+R +VQEALHA       W    +  +  L ++ I  +  + +L++ G+
Sbjct  306   VCVEDETVKYLNRRDVQEALHARLIGVREWTVCSNVLDYQLLDVEIPTINIVGSLVRAGV  365

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGE  1316
             P+L+YSGD+D  IP++ +R L + LA +L L T      W+ G+Q+GGW+Q +GN     
Sbjct  366   PVLVYSGDQDSVIPLTGSRTLVSRLAKQLGLRTTVPYRVWFAGQQVGGWTQVYGNV----  421

Query  1317  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                 L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  422   ----LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  456



>ref|XP_003554110.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   346 bits (888),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 194/479 (41%), Positives = 278/479 (58%), Gaps = 33/479 (7%)
 Frame = +3

Query  18    AFTFIIDII*KIMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHK  197
             +FT I  II  I+V      L  TL  +      + I +LPGQP  V+F QYSGY+    
Sbjct  7     SFTMIATII--IIV------LAQTLVGVISLPEADKISNLPGQP-QVEFQQYSGYVTVDD  57

Query  198   FRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQF  377
                RALFYYF EA+ ED  S PL LWL GG  CSS  +G F E+GPFRP+++  L +N +
Sbjct  58    QHQRALFYYFVEAE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDY  116

Query  378   SWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFY  557
             SWN  +N+LY+++P GV FSYS+  S Y   +D +TAR+NL FL++WF +F EY + DF+
Sbjct  117   SWNKVANVLYLESPAGVGFSYSSNKSFYASVTDEITARDNLVFLQRWFTKFPEYSNNDFF  176

Query  558   IAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYG  731
             I G+SYGGH  PQL++LI++            LKGIA+GNPLLE      S  E+ W +G
Sbjct  177   ITGESYGGHYVPQLSQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYFWSHG  230

Query  732   IISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTD  911
             +IS   Y +  R C+ + + ++I +G +   C   N +++ EI + + K ++    C + 
Sbjct  231   LISDSTYEVLTRVCNFSSIRRQIQNGNLRGVCVKANKLLNTEISNFIDKYDVTLDVCLSS  290

Query  912   QYSSSQRHCLG--TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMI  1076
                + Q + L    ET K D C+      YL+R +VQ+ALHAN    + W +     +  
Sbjct  291   --VNQQAYVLNQLQETQKIDVCIGDKTTTYLNRKQVQKALHANLVGVTKWSTCSSVLHYD  348

Query  1077  LNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPW  1256
               NL I  +P L +L+K GI +L+YSGD+D  IP+  +R L N LA  + L T      W
Sbjct  349   YQNLEIPTIPILGSLVKSGIKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLDTTVAYRAW  408

Query  1257  YDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             ++GKQ+ GW++ +GN         L++AT+RG SH  P S P ++L L KAFL+G P P
Sbjct  409   FEGKQVAGWTKVYGNI--------LSYATIRGASHEAPFSQPQRSLLLLKAFLEGKPLP  459



>ref|XP_006483005.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=464

 Score =   346 bits (887),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 193/465 (42%), Positives = 276/465 (59%), Gaps = 29/465 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L++    I +     ++D   +LPGQP  V F QYSGY+   + + RALFYYFAEA++ 
Sbjct  14    ILIHICLRIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPI  422
             D  S PL LWL GG  CSS  +G F ENGPFRP  +G+ LV+N++SWN  +NML+++TPI
Sbjct  72    DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLETPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS  +S Y+   D +TAR+NL FL+ WF++F +YR+   +I G+SY GH  PQLA
Sbjct  130   GVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGESYAGHYIPQLA  189

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             +L+LE+N+K        LKGIALGNP+LE      S  E  W +G+IS   Y +    C+
Sbjct  190   DLMLEFNKKE---ELFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDATYTMFTSFCN  246

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR---HCLGT  947
              +R V E   G +S  CS +  ++S E    + K ++    C +   S S+      +G 
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGE  306

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
              T   D C+     +YL+R +VQ+ALHA      +W    +  +  L +L I  +  +  
Sbjct  307   TT--VDVCVEDETVNYLNRKDVQKALHARLVGVRSWAVCSNILDYELLDLEIPTITVVGK  364

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+K GIP+++YSGD+D  IP++ +R+L N LA  L L T      W++G+Q+GGW+Q +G
Sbjct  365   LVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPYRVWFEGQQVGGWTQVYG  424

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             N         L+FAT+RG SH  P S P ++L LFKAFL   P P
Sbjct  425   NI--------LSFATIRGASHEAPFSQPERSLVLFKAFLDSRPLP  461



>ref|XP_011073181.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=458

 Score =   346 bits (887),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 186/443 (42%), Positives = 268/443 (60%), Gaps = 21/443 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F  +SGY+   + + +ALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  29    ITQLPGQPP-VEFQHFSGYVTVDEKKEKALFYYFVEAEI-DPLSKPLVLWLNGGPGCSSI  86

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +G+ L++N++SWN  +NMLY+DTPIGV FSYS  +S Y   +D M
Sbjct  87    GVGAFSENGPFRP--NGQVLLRNEYSWNREANMLYLDTPIGVGFSYSTGASSYVTVNDEM  144

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TA++NL FL++WF++F +YR+   +I G+SY GH  PQLA+L++E N+K    + I LKG
Sbjct  145   TAKDNLVFLQRWFLKFPQYRNSSLFITGESYAGHYVPQLAKLVIELNKKR---KMINLKG  201

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNPLLE      S  E+ W +G+IS   Y+L    C+ +R V+E     +S  CS +
Sbjct  202   IALGNPLLEFTTDYNSRAEYFWSHGLISDSTYNLFTSVCNYSRYVREYYRDSLSVLCSRV  261

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
               +++ E    ++K ++    C     S S+       + + D C+      YL+R +VQ
Sbjct  262   MSLVNRESSRFVNKYDVTLDVCIPSVLSQSKIIAPQRNSERIDVCVEDETVSYLNRRDVQ  321

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       WD   +  +  + +L I  +  + +L+K GIP+LIYSGD+D  IP++ 
Sbjct  322   KALHARLVGVRRWDVCSNILDYDMLDLEIPTISIIGSLIKEGIPVLIYSGDQDSVIPLTG  381

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA +L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  
Sbjct  382   SRTLVHRLAKQLGLNTTVPYRVWFEGQQVGGWTQVYGNL--------LSFATIRGASHEA  433

Query  1368  PNSSPSKALTLFKAFLKGSPPPN  1436
             P S P ++  LFK+FL G P P 
Sbjct  434   PFSQPERSFVLFKSFLDGRPLPQ  456



>gb|KDO83181.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=464

 Score =   345 bits (886),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 193/465 (42%), Positives = 276/465 (59%), Gaps = 29/465 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L++    I +     ++D   +LPGQP  V F QYSGY+   + + RALFYYFAEA++ 
Sbjct  14    ILIHICLRIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPI  422
             D  S PL LWL GG  CSS  +G F ENGPFRP  +G+ LV+N++SWN  +NML+++TPI
Sbjct  72    DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLETPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS  +S Y+   D +TAR+NL FL+ WF++F +YR+   +I G+SY GH  PQLA
Sbjct  130   GVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGESYAGHYIPQLA  189

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             +L+LE+N+K        LKGIALGNP+LE      S  E  W +G+IS   Y +    C+
Sbjct  190   DLMLEFNKKE---ELFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDATYTMFTSFCN  246

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR---HCLGT  947
              +R V E   G +S  CS +  ++S E    + K ++    C +   S S+      +G 
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGE  306

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
              T   D C+     +YL+R +VQ+ALHA      +W    +  +  L +L I  +  +  
Sbjct  307   TT--VDVCVEDETVNYLNRKDVQKALHARLVGVRSWAVCSNILDYELLDLEIPTITIVGK  364

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+K GIP+++YSGD+D  IP++ +R+L N LA  L L T      W++G+Q+GGW+Q +G
Sbjct  365   LVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPYRVWFEGQQVGGWTQVYG  424

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             N         L+FAT+RG SH  P S P ++L LFKAFL   P P
Sbjct  425   NI--------LSFATIRGASHEAPFSQPERSLVLFKAFLDSRPLP  461



>ref|XP_006415698.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
 gb|ESQ34051.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
Length=463

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 194/461 (42%), Positives = 270/461 (59%), Gaps = 21/461 (5%)
 Frame = +3

Query  72    FLLVNTLYSISIRI--NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
              +L +TL S S  +  + + +  LPGQP  V F QYSGY+     + RALFYYFAEA+  
Sbjct  14    LILFHTLLSSSSTVLPHSDRVTRLPGQPR-VGFQQYSGYVTVDDRKQRALFYYFAEAEI-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+G
Sbjct  72    DPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLETPVG  130

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAE  605
             V FSYS  SS Y+  +D +TA++NL FL++WF++F  Y +   +I G+SY GH  PQLA+
Sbjct  131   VGFSYSTQSSSYEGVTDKITAKDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQ  190

Query  606   LILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDS  779
             L++EYN+K  H+    L+GIA+GNP+LE      S  E+ W +G+IS   Y +    C+ 
Sbjct  191   LMIEYNKKH-HL--FNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDPTYKMFTSYCNY  247

Query  780   TRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK  959
             +R V E   G MS  CS +   +S E    + K ++    C     S S+          
Sbjct  248   SRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGES  307

Query  960   ADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKR  1130
              D C+      YL+R +VQEALHA       W    +  +  L ++ I  +  + +L++ 
Sbjct  308   VDVCVEDETVKYLNRRDVQEALHARLIGVREWTVCSNVLDYQLLDVEIPTINIVGSLVQA  367

Query  1131  GIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGG  1310
             G+P+L+YSGD+D  IP++ +R L + LA RL L T      W+ G+Q+GGW+Q +GN   
Sbjct  368   GVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--  425

Query  1311  GEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                   L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  426   ------LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  460



>ref|XP_011086871.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=466

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 190/442 (43%), Positives = 265/442 (60%), Gaps = 20/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+   +   RALFYYF EA++ D  S PL LWL GG  CSS 
Sbjct  36    ISQLPGQPR-VSFQQFSGYVNVDEKEERALFYYFVEAET-DPASKPLVLWLNGGPGCSSL  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +N+LY+++PIGV FSYS  SS Y+  +D +T
Sbjct  94    GVGAFSENGPFRPSGNAALVRNEYSWNKEANILYLESPIGVGFSYSVNSSSYEGVNDKIT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WF++F +YR+   YI G+SY GH  PQLAEL+L +N+K    +   LKGI
Sbjct  154   ARDNLVFLQNWFLKFPQYRNRSLYITGESYAGHYIPQLAELMLHFNKKE---KIFNLKGI  210

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y L    C+ +R V E   G +S  CS + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKLFTSACNYSRYVSEYYRGSLSPICSKVM  270

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
              +++ E    + K ++    C +   S S+       T   D C+     +YL+R +V+ 
Sbjct  271   SLVTTETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDETVNYLNRRDVRN  330

Query  1020  ALHANASTWDSIFHGRNMILNNLAIDI-LPTLSA---LLKRGIPLLIYSGDEDLRIPVSH  1187
             ALHA     +      N IL+   +DI +PT++    +++ GIP+L+YSGD+D  IP++ 
Sbjct  331   ALHARLVGVNRWLVCSN-ILDYELLDIEIPTINVVGRIIEAGIPVLVYSGDQDSVIPLTG  389

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R+L + LA  L L T      W+ G Q+GGW+Q +GN         L+FATVRG SH  
Sbjct  390   SRKLVHRLARELKLRTTTPYRVWFAGMQVGGWTQVYGNI--------LSFATVRGASHEA  441

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LFKAFL+G P P
Sbjct  442   PFSQPERSLVLFKAFLEGRPLP  463



>ref|XP_006844530.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
 gb|ERN06205.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
Length=460

 Score =   344 bits (883),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 191/443 (43%), Positives = 264/443 (60%), Gaps = 20/443 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP+ ++F Q++GYI   + + RALFYYFAEA++ D    PL +WL GG  CSS 
Sbjct  31    ITSLPGQPT-INFQQFAGYITVDEAKPRALFYYFAEAET-DPVLKPLVIWLNGGPGCSSL  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LVKN +SWN  +NMLY++TP GV FSYS   S Y+   D  T
Sbjct  89    GVGAFSENGPFRPSGN-VLVKNHYSWNREANMLYIETPAGVGFSYSTDISFYEGVDDEKT  147

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WFI+F EYR  D +I G+SY GH  PQLAEL++E N+     +   LKGI
Sbjct  148   ARDNLVFLKRWFIKFPEYRTRDLFITGESYAGHYIPQLAELMIEANKGE---KLFNLKGI  204

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNPLL+      S  E  W +G+IS   Y +    C+ +R V E     +S  CS + 
Sbjct  205   ALGNPLLDFSTDFNSRAEFFWSHGLISDPAYRIFTSSCNYSRYVSEYYRENVSPICSRVM  264

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
              ++S E    + K ++    C +     S+       +   D C+     +YL+R +VQ 
Sbjct  265   SLVSRETSKFVDKYDVTLDVCISSILMQSKALRPMQVSEPIDVCVEDETVNYLNRKDVQR  324

Query  1020  ALHANAS---TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA  S   TW S+    N    NL I  +  L  ++K GIP+L+YSGD+D  IP++ +
Sbjct  325   ALHARLSGDETW-SVCSSMNYNRLNLEIPTISLLGLVVKSGIPVLVYSGDQDSVIPLTGS  383

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L+L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  384   RTLVHGLAAKLHLNTTVPYRVWFEGEQVGGWTQVYGNI--------LSFATIRGASHEAP  435

Query  1371  NSSPSKALTLFKAFLKGSPPPNT  1439
              S P ++L LF+AFL+G P P T
Sbjct  436   FSQPQRSLGLFRAFLQGRPLPET  458



>ref|XP_010929656.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 188/443 (42%), Positives = 256/443 (58%), Gaps = 19/443 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGYI     + RALFYYFAEA+  D ++ PL LWL GG  CSS 
Sbjct  34    ITKLPGQP-QVSFQQFSGYITVDDRKQRALFYYFAEAEL-DPYTKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+    LV+N+FSWN  +NMLY++TP GV FSY+  SS Y    D MT
Sbjct  92    GVGAFSENGPFRPSGQ-VLVRNEFSWNKEANMLYLETPAGVGFSYATDSSYYDGVDDKMT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL +WF +F +Y+D D YI G+SY GH  PQLAEL++ +N+K        LKGI
Sbjct  151   ARDNLVFLLRWFTKFPQYKDRDLYITGESYAGHYVPQLAELMVLFNKKK---NVFNLKGI  207

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  C+ + 
Sbjct  208   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTYACNYSRYVSEYYRGSLSPVCARVM  267

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +   S S+           D C+     +YL+R +VQ+
Sbjct  268   GQVTRETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVPEHIDVCVEDETVNYLNRKDVQD  327

Query  1020  ALHANAS---TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             A+HA  +    W          L NL I  +  + +L++ GIP+L+YSGD+D  IP++ +
Sbjct  328   AMHARLTGVPKWSVCSSVLEYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDSVIPLTGS  387

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L   LA  L L T      W++ KQ+GGW+Q +G+         LTFAT+RG SH  P
Sbjct  388   RTLVQRLAKELKLKTTVPYRVWFEDKQVGGWTQVYGDI--------LTFATIRGASHEAP  439

Query  1371  NSSPSKALTLFKAFLKGSPPPNT  1439
              S P ++L LF+AFL+G P P T
Sbjct  440   FSQPERSLVLFRAFLQGRPLPET  462



>gb|EYU21824.1| hypothetical protein MIMGU_mgv1a006099mg [Erythranthe guttata]
Length=457

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 186/441 (42%), Positives = 263/441 (60%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  VDF Q+SGY+   + R +ALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  28    IARLPGQPP-VDFQQFSGYVSVDEKREKALFYYFVEAEI-DPPSKPLVLWLNGGPGCSSI  85

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +  L++N++SWN  +NMLY+DTP+GV FSYS  +S Y+  +D +T
Sbjct  86    GVGAFSENGPFRPNVE-VLLRNEYSWNREANMLYLDTPVGVGFSYSTGASSYETVNDEIT  144

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A++NL FL+KWF++F +YR+   +I G+SY GH  PQLA LI++ N+K    + I L GI
Sbjct  145   AKDNLVFLQKWFLDFPQYRNSSLFITGESYAGHYVPQLANLIIQLNKKK---KIINLTGI  201

Query  666   ALGNPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNPLLE     N   E+ W +G+IS   Y++    C+ +R V E     +S  CS + 
Sbjct  202   ALGNPLLEFSTDYNSRAEYFWSHGLISDSTYNVFTSGCNYSRYVSEYYRDSVSVLCSRVM  261

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
              +++ E    + K ++    C     S S+       + + D C+   +  YL+R +VQ 
Sbjct  262   SLVNRESSRFVDKYDVTLDVCIPSVLSQSKIIAPHQNSERIDVCVEDEITKYLNRRDVQM  321

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       WD   +  +  + +L I  +  + +L+K GIP+LIYSGD+D  IP++ T
Sbjct  322   ALHARLVGVRKWDVCSNILDYDMLDLEIPTISIIGSLVKEGIPVLIYSGDQDSVIPLTGT  381

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W++G+Q+GGW+Q +GN         L+F TVRG SH  P
Sbjct  382   RTLVHKLAKQLGLNTTVTYRVWFEGQQVGGWTQVYGNI--------LSFGTVRGASHEAP  433

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++  LFK+FL G P P
Sbjct  434   FSQPERSFVLFKSFLSGKPLP  454



>ref|XP_011020860.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 193/445 (43%), Positives = 263/445 (59%), Gaps = 26/445 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + +ALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  33    ITQLPGQPP-VWFQQYSGYVTVDEKKQKALFYYFAEAEL-DCASKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+    LVKNQ+SWN  +NMLY++TPIGV FSYS  +S Y+  +D +T
Sbjct  91    GVGAFSENGPFRPSGQ-VLVKNQYSWNREANMLYLETPIGVGFSYSANASSYEGVNDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+KWF+ F  YR+   +I G+SY GH  PQLA+L+L++NRK    +   LKGI
Sbjct  150   ARDNLVFLQKWFVNFPHYRNRSLFITGESYAGHYVPQLADLMLQFNRKE---KLFNLKGI  206

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS + 
Sbjct  207   AMGNPVLEYSTDFNSRAEFFWSHGLISDTTYKMFTTVCNYSRYVSEYYRGSVSPQCSRVM  266

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQ----RHCLGTETAKADPCLLTWVDDYLSRP  1007
               ++ E    + K ++    C +   S S+    +  LG      D C+     +YL+RP
Sbjct  267   NQVTRETSRFVDKYDVTLDVCISSALSQSKILSPQQQLGDNI---DVCVEDETVNYLNRP  323

Query  1008  EVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIP  1178
             +VQ+ALHA       W    +  +  L +L I  +  +  L+K GIP+L+YSGD+D  IP
Sbjct  324   DVQKALHARLVGVRRWAVCSNILDYELLDLEIPTISIVGRLIKAGIPVLVYSGDQDSVIP  383

Query  1179  VSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGS  1358
             ++ +R L + LA  L L T      W+ G+Q+GGW+Q +GN         L+FAT+RG S
Sbjct  384   LTGSRTLVHGLAEELGLQTTVPYRVWFGGQQVGGWTQVYGNI--------LSFATIRGAS  435

Query  1359  HFVPNSSPSKALTLFKAFLKGSPPP  1433
             H  P S P ++L LFKAFL G P P
Sbjct  436   HEAPFSQPERSLVLFKAFLGGQPLP  460



>ref|NP_564298.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 ref|NP_973926.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 sp|Q93Y09.1|SCP45_ARATH RecName: Full=Serine carboxypeptidase-like 45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL24336.1| serine carboxypeptidase II, putative [Arabidopsis thaliana]
 gb|AAP49525.1| At1g28110 [Arabidopsis thaliana]
 gb|AEE30918.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 gb|AEE30919.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
Length=461

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/441 (43%), Positives = 261/441 (59%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++    S PL LWL GG  CSS 
Sbjct  32    VTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAETNPS-SKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  90    GVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVNDKIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLAEL+++YN+K  H+    L+GI
Sbjct  149   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAELMIQYNKKH-HL--FNLRGI  205

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G MS  CS + 
Sbjct  206   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSMCSKVM  265

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C     S S+           D C+     +YL+R +VQE
Sbjct  266   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQE  325

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W    +  +  L ++ I  +  + +L+K G+P+L+YSGD+D  IP++ +
Sbjct  326   ALHARLIGVREWTVCSNVLDYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGS  385

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W+ G+Q+GGW+Q +GN         L+FATVRG SH VP
Sbjct  386   RTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASHEVP  437

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAFL G P P
Sbjct  438   FSQPERSLVLFKAFLDGHPLP  458



>ref|XP_008390188.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score =   343 bits (881),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 190/444 (43%), Positives = 259/444 (58%), Gaps = 23/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F  YSGY+     + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  35    ITGLPGQPP-VGFQHYSGYVTVDAKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  93    GVGAFSENGPFRP--KGEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVTDHI  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL+KWF +F +YR+   YI G+SY GH  PQLAEL+L++           LKG
Sbjct  151   TARDNLLFLQKWFEKFPQYRNRSLYITGESYAGHYVPQLAELMLQFKE-----HHFNLKG  205

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS +
Sbjct  206   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYKMFSSVCNYSRFVSEYYRGSVSPICSRV  265

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S E    + K ++    C +  +S S+           D C+   V +YL+RP+VQ
Sbjct  266   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKALLPQQVADSIDVCVEDEVVNYLNRPDVQ  325

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       W    +     + ++ I  +  +  L+K GIP+L+YSGD+D  IP++ 
Sbjct  326   KALHARLVGVRHWAVCSNILGYQVLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVIPLTG  385

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA +L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  
Sbjct  386   SRTLIHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNM--------LSFATIRGASHEA  437

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LFK+FL+G P P  
Sbjct  438   PFSQPERSLVLFKSFLEGRPLPEV  461



>ref|XP_006438864.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52104.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=464

 Score =   343 bits (881),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 275/465 (59%), Gaps = 29/465 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L++    I +     ++D   +LPGQP  V F QYSGY+   + + RALFYYFAEA++ 
Sbjct  14    ILIHICLCIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPI  422
             D  S PL LWL GG  CSS  +G F ENGPFRP  +G+ LV+N++SWN  +NML+++TPI
Sbjct  72    DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLETPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS  +S Y+   D +TAR+NL FL+ WF++F +YR+   +I G+SY GH  PQLA
Sbjct  130   GVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGESYAGHYIPQLA  189

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             +L+LE+N+K        LKGIALGNP+LE      S  E  W +G+IS   Y +    C+
Sbjct  190   DLMLEFNKKE---ELFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDATYTMFTSFCN  246

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR---HCLGT  947
              +R V E   G +S  CS +  ++S E    + K ++    C +   S S+      +G 
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGE  306

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
              T   D C+     +YL+R +VQ+ALHA       W    +  +  L +L I  +  +  
Sbjct  307   TT--VDVCVEDETVNYLNRKDVQKALHARLVGVRGWAVCSNILDYELLDLEIPTITVVGK  364

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+K GIP+++YSGD+D  IP++ +R+L N LA  L L T      W++G+Q+GGW+Q +G
Sbjct  365   LVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLETTVPYRVWFEGQQVGGWTQVYG  424

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             N         L+FAT+RG SH  P S P ++L LF+AFL   P P
Sbjct  425   NI--------LSFATIRGASHEAPFSQPERSLVLFEAFLDSRPLP  461



>gb|KHN47533.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   343 bits (879),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 186/442 (42%), Positives = 261/442 (59%), Gaps = 26/442 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F+Q+SGY+       RALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP   G LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+       
Sbjct  90    GVGAFSENGPFRPKGKG-LVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYE-------  141

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WFI+F EYR+   +I G+SY GH  PQLAEL+L++N+K    +   LKGI
Sbjct  142   ARDNLVFLQSWFIKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  198

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +  V+E  +G +S  CS + 
Sbjct  199   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPICSSVM  258

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +  +S ++       T   D C+     +YL+R +VQ 
Sbjct  259   SQVTTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  318

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             A+HA+      W +  +  +  L +L I  +  +  L+K GIP+L+YSGD+D  IP++ +
Sbjct  319   AMHAHLVGVQRWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQDSVIPLTGS  378

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA  L L T      W++ +Q+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  379   RTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI--------LSFATIRGASHEAP  430

Query  1371  NSSPSKALTLFKAFLKGSPPPN  1436
              S P ++L LFK+FL+G P P 
Sbjct  431   FSQPERSLVLFKSFLEGGPLPQ  452



>ref|XP_003532390.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
 gb|KHN16877.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=466

 Score =   343 bits (880),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 187/444 (42%), Positives = 263/444 (59%), Gaps = 23/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP ++ F Q+SGY+     + +ALFYYF E+++ D  S PL LWL GG  CSS 
Sbjct  35    IVRLPGQP-NIGFQQFSGYVTVDDMKHKALFYYFVESET-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE L+KN++SWN  +NMLY++TP+GV FSY+   S Y   +D  
Sbjct  93    GVGAFSENGPFRP--NGEVLIKNEYSWNRETNMLYLETPVGVGFSYAKGGSSYDTVNDET  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF +F  YR  D ++AG+SY GH  PQLA+L++E N+K    +   LKG
Sbjct  151   TARDNLVFLQRWFNKFPHYRHTDLFLAGESYAGHYVPQLAKLMIEINKKE---KMFNLKG  207

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y L    C+ +R V E     +S  CS +
Sbjct  208   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYKLFTTGCNYSRYVSEYYRDSISPLCSKV  267

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK--ADPCLLTWVDDYLSRPE  1010
                +S E    + K ++    C +   S S+  C  ++      D C+   V +YL+R +
Sbjct  268   MKQVSRETSKFVDKYDVTLDVCISSVLSQSKAICPQSQQTNESIDVCVDDKVTNYLNRKD  327

Query  1011  VQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQEALHA       W+      +  + NL +  LP + +L+K G+ +LIYSGD+D  IP+
Sbjct  328   VQEALHAKLVGVQKWNVCSTILDYDMLNLEVPTLPIVGSLIKAGVRVLIYSGDQDSVIPL  387

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + +R L   LA +L L T      W++G+Q+GGW+Q +GN         L+FATVRG SH
Sbjct  388   TGSRTLVQKLARQLRLNTTIHYRVWFEGQQVGGWTQVYGNI--------LSFATVRGASH  439

Query  1362  FVPNSSPSKALTLFKAFLKGSPPP  1433
               P S P ++L LFK+FL+  P P
Sbjct  440   EAPFSQPERSLVLFKSFLEDRPLP  463



>ref|XP_010942380.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   343 bits (880),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 189/443 (43%), Positives = 263/443 (59%), Gaps = 19/443 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  VDF Q+SGY+     + RALFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  34    ISKLPGQP-QVDFQQFSGYVTIDDRKQRALFYYFAEAEL-DPPTKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+E   LV+N++SWN  +NMLY++TP GV FSY+N +S Y+  +D MT
Sbjct  92    GVGAFSENGPFRPSEQ-VLVRNEYSWNEEANMLYLETPAGVGFSYANDTSCYEGVNDKMT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL +WF +F +Y+D D YI G+SY GH  PQLA+L++++N+K        LKGI
Sbjct  151   ARDNLVFLLRWFTKFPQYKDRDLYITGESYAGHYVPQLADLMVKFNKKKKIF---NLKGI  207

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  C+ + 
Sbjct  208   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYKIFTLACNYSRYVSEYYRGSLSSVCARVM  267

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +++E    + K ++    C +   S S+       T   D C+     +YL+R +VQ+
Sbjct  268   GQVTKETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDETVNYLNRKDVQD  327

Query  1020  ALHANAS---TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA  +    W          L NL +  +  + +L++ GIP+L+YSGD+D  IP++ +
Sbjct  328   ALHARLTGVPKWTVCSSVLEYELLNLEVPTISVVGSLVRSGIPILVYSGDQDSVIPLTGS  387

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L   LA  L L T      W+ GKQ+GGW+Q +G+         LTFAT+RG SH  P
Sbjct  388   RTLVQRLAKELKLNTTVPYRVWFVGKQVGGWTQVYGDI--------LTFATIRGASHEAP  439

Query  1371  NSSPSKALTLFKAFLKGSPPPNT  1439
              S P ++L LF+AFL+G P P T
Sbjct  440   FSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_002893504.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69763.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   343 bits (880),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 189/441 (43%), Positives = 262/441 (59%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++    S PL LWL GG  CSS 
Sbjct  33    VTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAETNPS-SKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  91    GVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVNDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLA+L+++YN+K  H+    L+GI
Sbjct  150   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMIQYNKKH-HL--FNLRGI  206

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G MS  CS + 
Sbjct  207   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSMCSKVM  266

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C     S S+           D C+     +YL+R +VQE
Sbjct  267   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQE  326

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W    +  +  L ++ I  +  + +L+K G+P+L+YSGD+D  IP++ +
Sbjct  327   ALHARLIGVREWTVCSNVLDYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGS  386

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W+ G+Q+GGW+Q +GN         L+FATVRG SH VP
Sbjct  387   RILVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASHEVP  438

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P+++L LFKAFL G P P
Sbjct  439   FSQPARSLVLFKAFLDGHPLP  459



>ref|XP_007137891.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
 gb|ESW09885.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
Length=467

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 191/444 (43%), Positives = 264/444 (59%), Gaps = 23/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             ID LPGQP  V F Q+SGY+     + ++LFYYFAE+++ D  S PL LWL GG  CSS 
Sbjct  36    IDELPGQPY-VGFQQFSGYVTVDDKKHKSLFYYFAESET-DPASKPLVLWLNGGPGCSSL  93

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE L+KN++SWN  +NMLY++TP+GV FSY+  SS Y   +D  
Sbjct  94    GVGAFSENGPFRP--NGEFLIKNEYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVNDEA  151

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL +WF +F +YR  D ++ G+SY GH  PQLA+L+++ N K    +   LKG
Sbjct  152   TARDNLVFLLRWFNKFPQYRSRDLFLTGESYAGHYVPQLAKLMIKMNTKK---KIFNLKG  208

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E     +S  CS +
Sbjct  209   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYYRDSISPLCSKV  268

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA--KADPCLLTWVDDYLSRPE  1010
                +S E    + K ++    C +   S S      T+ A    D C+   V +YL+R +
Sbjct  269   MGQVSRETSKFVDKYDVTLDVCISSVLSQSNVISPKTQEASESIDVCVDDKVTNYLNRRD  328

Query  1011  VQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQEALHA       WD   +  N  + NL +  LP + +L+K G+ +LIYSGD+D  IP+
Sbjct  329   VQEALHAKLVGVRKWDVCSNVLNYDMLNLEVPTLPVVGSLIKAGVRVLIYSGDQDSVIPL  388

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + +R L   L  +L L T      W++G+Q+GGW+Q  GN+        L+FATVRG SH
Sbjct  389   TGSRTLVQKLGRQLGLNTTVPYRVWFEGQQVGGWTQVHGNT--------LSFATVRGASH  440

Query  1362  FVPNSSPSKALTLFKAFLKGSPPP  1433
              VP S P ++L LFK+FLKG   P
Sbjct  441   EVPFSQPRRSLVLFKSFLKGISLP  464



>ref|XP_010478165.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   343 bits (881),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 189/441 (43%), Positives = 261/441 (59%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             + SLPGQP  V F QYSGY+     + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  62    VTSLPGQP-QVGFQQYSGYVTVDDKKQRALFYYFAEAET-DPTSKPLVLWLNGGPGCSSL  119

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN  SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  120   GVGAFSENGPFRP-KGPILVKNHHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDKIT  178

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F  Y +   YI G+SY GH  PQLA+L+++YN+K  H+    L+GI
Sbjct  179   ARDNLVFLQRWFLKFPHYLNRSLYITGESYAGHYVPQLAQLMIQYNKKH-HL--FNLRGI  235

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G MS  CS + 
Sbjct  236   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSICSKVM  295

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C     S S+           D C+     +YL+R +VQE
Sbjct  296   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQE  355

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W    +  +  L ++    +  + +L++ G+P+L+YSGD+D  IP++ +
Sbjct  356   ALHARLIGVREWTVCSNVLDYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQDSVIPLTGS  415

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W+ G+Q+GGW+Q +GN         L+FATVRG SH VP
Sbjct  416   RTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASHEVP  467

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAFL G P P
Sbjct  468   FSQPERSLVLFKAFLGGHPLP  488



>ref|XP_006584695.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=468

 Score =   343 bits (879),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 190/448 (42%), Positives = 265/448 (59%), Gaps = 29/448 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP ++ F Q+SGY+     + +ALFYYF E+++ D  S PL LWL GG  CSS 
Sbjct  35    IVRLPGQP-NIGFQQFSGYVTVDDMKHKALFYYFVESET-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE L+KN++SWN  +NMLY++TP+GV FSY+   S Y   +D  
Sbjct  93    GVGAFSENGPFRP--NGEVLIKNEYSWNRETNMLYLETPVGVGFSYAKGGSSYDTVNDET  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF +F  YR  D ++AG+SY GH  PQLA+L++E N+K    +   LKG
Sbjct  151   TARDNLVFLQRWFNKFPHYRHTDLFLAGESYAGHYVPQLAKLMIEINKKE---KMFNLKG  207

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y L    C+ +R V E     +S  CS +
Sbjct  208   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYKLFTTGCNYSRYVSEYYRDSISPLCSKV  267

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK--ADPCLLTWVDDYLSRPE  1010
                +S E    + K ++    C +   S S+  C  ++      D C+   V +YL+R +
Sbjct  268   MKQVSRETSKFVDKYDVTLDVCISSVLSQSKAICPQSQQTNESIDVCVDDKVTNYLNRKD  327

Query  1011  VQEALHAN---ASTWDSIFHGRNMILN----NLAIDILPTLSALLKRGIPLLIYSGDEDL  1169
             VQEALHA       W+      N IL+    NL +  LP + +L+K G+ +LIYSGD+D 
Sbjct  328   VQEALHAKLVGVQKWNVC--STNSILDYDMLNLEVPTLPIVGSLIKAGVRVLIYSGDQDS  385

Query  1170  RIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVR  1349
              IP++ +R L   LA +L L T      W++G+Q+GGW+Q +GN         L+FATVR
Sbjct  386   VIPLTGSRTLVQKLARQLRLNTTIHYRVWFEGQQVGGWTQVYGNI--------LSFATVR  437

Query  1350  GGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             G SH  P S P ++L LFK+FL+  P P
Sbjct  438   GASHEAPFSQPERSLVLFKSFLEDRPLP  465



>emb|CDY19500.1| BnaC04g10990D [Brassica napus]
Length=463

 Score =   343 bits (879),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 191/465 (41%), Positives = 273/465 (59%), Gaps = 19/465 (4%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             +V  L  L   +L S ++    + I SLPGQP  V F QYSGY+   + + RALFYY AE
Sbjct  10    IVTALILLHALSLVSSTVMSRADRITSLPGQP-KVGFQQYSGYVSIDEKKQRALFYYLAE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+++   S PL LWL GG  CSS  +G F ENGPFRP +   LV+NQ SWN  +NMLY++
Sbjct  69    AEAK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHEANMLYLE  126

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP+GV FSY+  SS Y+  +D +TA++NL FL+KWF  F +Y +   +I G+SY GH  P
Sbjct  127   TPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITGESYAGHYVP  186

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKR  767
             QLA+L+++YN+K  H+    LKGIALGNP+LE      S  E+ W +G+IS   Y +   
Sbjct  187   QLAQLMIQYNKKH-HL--FNLKGIALGNPVLEFSTDFNSRAEYFWSHGLISDPTYRMFTS  243

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT  947
              C+ +R V E   G++S  CS +   +S E    + K ++    C     S S+      
Sbjct  244   YCNYSRFVSEYYRGDVSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPQQ  303

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
                  D C+     +YL+R +VQ+ALHA       W    +  +  L ++ +  +  + +
Sbjct  304   VGETVDVCVEDETVNYLNRRDVQKALHARLVGTRKWAVCSNVLDYELLDVEVPTINIVGS  363

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+K G+P+L+YSGD+D  IP++ +R L   LA +L L+T      W+ G+Q+GGW+Q +G
Sbjct  364   LIKAGVPVLVYSGDQDSVIPLTGSRTLVKQLAQQLGLSTTVPYRVWFAGQQVGGWTQVYG  423

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             N         L FATVRG +H VP S P ++L LFKAFL G+P P
Sbjct  424   NV--------LAFATVRGAAHEVPFSQPERSLVLFKAFLGGNPLP  460



>gb|KFK44682.1| hypothetical protein AALP_AA1G289900 [Arabis alpina]
Length=463

 Score =   342 bits (878),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/441 (42%), Positives = 260/441 (59%), Gaps = 18/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+   + + RALFYYFAEA++ +  S PL LWL GG  CSS 
Sbjct  33    VTRLPGQPL-VGFEQYSGYVTVDETKQRALFYYFAEAET-NPTSKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  91    GVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A++NL FL++WF++F  Y +   +I G+SY GH  PQLA+L+++YN+K  H+    L+GI
Sbjct  150   AKDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMIQYNKKHHHL--FNLRGI  207

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G MS  CS + 
Sbjct  208   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSMCSKVM  267

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C     S S+           D C+      YL+R +VQ 
Sbjct  268   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVSYLNRRDVQA  327

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W    +  +  L ++    +  + +L+K G+P+L+YSGD+D  IP++ +
Sbjct  328   ALHARLIGVREWTVCSNVLDYELLDVEKPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGS  387

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA RL L T      W+ G+Q+GGW+Q +GN         L+FATVRG SH VP
Sbjct  388   RTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASHEVP  439

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAFL G P P
Sbjct  440   FSQPERSLVLFKAFLDGHPLP  460



>gb|KEH35690.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=448

 Score =   342 bits (877),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/456 (41%), Positives = 271/456 (59%), Gaps = 21/456 (5%)
 Frame = +3

Query  90    LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLT  269
             ++  S   + + I +LPGQP ++ F Q+SGY+     + ++LFYYFAE+++ D  S PL 
Sbjct  3     VFCFSPHFHADKIVTLPGQPQNIAFQQFSGYVTVDNKKHKSLFYYFAESET-DPSSKPLV  61

Query  270   LWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNT  449
             LWL GG  CSS  +G F ENGPFRP  D  L+KN+ SWN  +NMLY++TP GV FSY   
Sbjct  62    LWLNGGPGCSSLGVGAFSENGPFRPNGDF-LIKNEHSWNKEANMLYLETPAGVGFSYVKG  120

Query  450   SSDYKIW-SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNR  626
             SS Y    +D  TAR+NL FL +WF +F +YR+ D ++ G+SY GH  PQLA+L++E N+
Sbjct  121   SSAYTTTVNDDETARDNLVFLERWFNKFPQYRNRDLFLTGESYAGHYVPQLAKLMIEMNK  180

Query  627   KPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEI  800
             +    +   LKGIALGNP+LE      S  E  W +G+IS   Y++  R C+ +R V E 
Sbjct  181   RN---KIFNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDATYNMFTRVCNYSRYVSEY  237

Query  801   LSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA--DPCL  974
                 +S  CS +  ++S+E    + K ++    C +   S S+      + A    D C+
Sbjct  238   NRDSVSPLCSKVMGLVSKETSRFVDKYDVTLDVCISSVLSQSKVISPQPQQANEMIDVCV  297

Query  975   LTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLL  1145
                V +YL+R +VQEALHA       WD   +  +  + NL +  LP + +L+K G+ +L
Sbjct  298   DDKVTNYLNRRDVQEALHAKLVGVRKWDVCSNVLDYDVLNLEVPTLPVVGSLIKAGVKVL  357

Query  1146  IYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVA  1325
             IYSGD+D  IP++ +R L   LA +L L T      W++G+Q+GGW+Q +GN        
Sbjct  358   IYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGNV-------  410

Query  1326  NLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              L+FATVRG +H  P S P ++L LFK+FL+G P P
Sbjct  411   -LSFATVRGAAHEAPFSQPERSLVLFKSFLEGRPLP  445



>emb|CDO98312.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   342 bits (878),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/445 (41%), Positives = 263/445 (59%), Gaps = 19/445 (4%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             ++I  LPGQP  V F Q+SGY+     +G+ALFYYF EA+  D  S PL LWL GG  CS
Sbjct  23    DMITQLPGQP-QVGFQQFSGYVTVDDKKGKALFYYFVEAEI-DCASKPLVLWLNGGPGCS  80

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G F ENGPFRP   G LV+N+ SWN  +N+LY++TP+GV FS+++ SS Y   SD 
Sbjct  81    SLGVGAFSENGPFRPNGQG-LVRNEHSWNREANVLYLETPVGVGFSFADDSSSYDAVSDA  139

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLK  659
             +TAR+NL FL++WF++F +YRD + +I G+SY GH  PQLAEL++++N+K    +   LK
Sbjct  140   ITARDNLVFLQRWFLQFPQYRDRNLFITGESYAGHYVPQLAELMIQFNKKE---KLFNLK  196

Query  660   GIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             GIALGNP+LE      S  E+ W +G+IS   Y L    C+ +R V E     +S  CS 
Sbjct  197   GIALGNPVLEYATDLNSRAEYFWSHGLISDSTYKLFTSFCNYSRYVSEYYRDAVSPICSK  256

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEV  1013
             +   +S E    + K ++    C +   S S+         + D C+     +YL+R +V
Sbjct  257   VMSQVSRETSRFVDKYDVTLDVCISSVLSQSRIISPQQNAERIDVCIEDETVNYLNRQDV  316

Query  1014  QEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVS  1184
             Q+ALHA       W       +  L ++ I  +  + +L+K GI +L+YSGD+D  IP++
Sbjct  317   QKALHARLVGVRRWLVCSDILDYQLLDIEIPTISIVGSLIKEGITVLVYSGDQDSVIPLT  376

Query  1185  HTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
              +R L + LA +L L        W+ G+Q+GGW+Q +GN         L+FAT+RG SH 
Sbjct  377   GSRSLVHGLAKQLRLNATTPYRVWFAGQQVGGWTQVYGNL--------LSFATIRGASHE  428

Query  1365  VPNSSPSKALTLFKAFLKGSPPPNT  1439
              P S P ++L LFK+FL+G P P  
Sbjct  429   APFSQPERSLVLFKSFLEGRPLPEV  453



>emb|CDY11750.1| BnaC03g58280D [Brassica napus]
Length=461

 Score =   342 bits (878),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 188/459 (41%), Positives = 270/459 (59%), Gaps = 19/459 (4%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             F L+  L S ++  + +++  LPGQP  V F QYSGY+   + +  ALFYYFAEA++E  
Sbjct  14    FALIFFLSSATVLSHSDLVTRLPGQP-QVGFKQYSGYVTVDEKKHSALFYYFAEAETEPT  72

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV 
Sbjct  73    -SKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYS  SS Y+  +D +TAR+NL FL +WF++F  Y +   +I G+SY GH  PQLA+L+
Sbjct  131   FSYSTQSSSYESVNDKITARDNLVFLERWFLKFPHYLNRSLFITGESYAGHYVPQLADLM  190

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTR  785
             ++YN+K  H+    L+GIA+GNP+LE      S  E+ W +G+IS   + L    C+ +R
Sbjct  191   IQYNKKH-HL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTFKLFTSYCNYSR  247

Query  786   MVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKAD  965
              V E   G MS  CS +   ++ E    + K ++    C +   S S+           D
Sbjct  248   YVSEYYRGSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSKVVSPNQVGESVD  307

Query  966   PCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGI  1136
              C+     +YL+R +VQEAL A       W    +  +  + ++    +  + +L++ G+
Sbjct  308   VCVEDETVNYLNRRDVQEALQARLVGVREWTVCSNVLDYQMLDVEKPTINIVGSLVEAGV  367

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGE  1316
             P+L+YSGD+D  IP++ +R L + LA RL L T      W+ G+Q+GGW+Q +GN     
Sbjct  368   PVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV----  423

Query  1317  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                 L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  424   ----LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  458



>ref|XP_003528093.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=470

 Score =   343 bits (879),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 187/449 (42%), Positives = 267/449 (59%), Gaps = 21/449 (5%)
 Frame = +3

Query  114   NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHD  293
             + + I  LPGQP  V F Q+SGY+     + ++LFYYFAEA++ D  S PL LWL GG  
Sbjct  35    HADTIALLPGQP-HVSFQQFSGYVTVDDKKHKSLFYYFAEAET-DPSSKPLVLWLNGGPG  92

Query  294   CSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWS  473
             CSS  +G F ENGPFRP E+  L+KN +SWN  +NMLY++TP+GV FSY+  SS Y   +
Sbjct  93    CSSLGVGAFSENGPFRPNEEF-LIKNDYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVN  151

Query  474   DTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIK  653
             D  TAR+NL FL +WF +F +Y+  D ++ G+SY GH  PQLA+L++E N K    +   
Sbjct  152   DEATARDNLVFLLRWFNKFPQYKSRDLFLTGESYAGHYVPQLAKLMVEMNTKN---KIFN  208

Query  654   LKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDC  827
             LKGIALGNP+LE      S  E  W +G+IS   Y++  R C+ +R V E     +S  C
Sbjct  209   LKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTRVCNYSRYVSEYYRDSVSPLC  268

Query  828   SDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA--DPCLLTWVDDYLS  1001
             S +   +S E    + K ++    C +   S S+  C  ++ A    D C+   V +YL+
Sbjct  269   SKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLN  328

Query  1002  RPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLR  1172
             R +VQEALHA       W+   +  +  + NL +  L  + +L+K G+ +LIYSGD+D  
Sbjct  329   RRDVQEALHAKLVGVRKWEVCSNILDYDMLNLEVPTLLVVGSLIKAGVKVLIYSGDQDSV  388

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             IP++ +R L   LA +L L +      W++G+Q+GGW+Q +GN         L+FATVRG
Sbjct  389   IPLTGSRTLVQKLARKLGLNSTVPYRVWFEGQQVGGWTQGYGNI--------LSFATVRG  440

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              SH  P S P ++L LFK+FL+G P P+ 
Sbjct  441   ASHEAPFSQPERSLVLFKSFLEGRPLPDA  469



>ref|XP_007223032.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24231.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=464

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 189/444 (43%), Positives = 262/444 (59%), Gaps = 23/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  37    IALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCSSL  94

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  95    GVGAFSENGPFRPS--GEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVNDHI  152

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL+ W  +F +Y++   +I G+SY GH  PQLAEL+L+Y     +     LKG
Sbjct  153   TARDNLLFLQNWLEKFPQYKNRSLFITGESYAGHYVPQLAELMLQYKEYQFN-----LKG  207

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS +
Sbjct  208   IALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICSRV  267

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S E    + K ++    C +  +S S+       T   D C+   + +YL+RP+VQ
Sbjct  268   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQVTEAIDVCVEDEIVNYLNRPDVQ  327

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       W    +  +  L ++ I     +  L+K GIP+L+YSGD+D  IP++ 
Sbjct  328   KALHARLVGVRQWAVCSNILDYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQDSVIPLTG  387

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA +L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  
Sbjct  388   SRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNI--------LSFATIRGASHEA  439

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LFK+FL+G P P  
Sbjct  440   PFSQPERSLVLFKSFLEGRPLPEV  463



>gb|ABK25202.1| unknown [Picea sitchensis]
Length=462

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 258/450 (57%), Gaps = 27/450 (6%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             +++D LPGQP+ V F QY+GY+   +  GRALFYYF EA+++     PL +WL GG  CS
Sbjct  24    DLVDRLPGQPA-VTFKQYAGYVTVDEKSGRALFYYFVEAETDSNLK-PLVVWLNGGPGCS  81

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G   ENGPF P   G+L  N++SWN  +NMLY++TP GV FSYSN ++ Y   +D 
Sbjct  82    SFGVGALSENGPFHP-RGGKLFGNEYSWNKEANMLYLETPAGVGFSYSNDTTYYLGANDA  140

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLK  659
              TA +NL+FL  WF +F EY+  D Y+ G+SY GH  PQ AELI+E NRK    +   LK
Sbjct  141   KTAEDNLQFLHGWFDKFPEYKTRDLYLTGESYAGHYIPQWAELIVEANRKE---KIFNLK  197

Query  660   GIALGNPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             GIA+GNPLL+     N   E+LW +G+IS   Y+  K  C+ TR V E   G +S  C D
Sbjct  198   GIAIGNPLLDFFTDFNARAEYLWSHGLISDPTYNNMKTGCNYTRYVDEYYRGTVSSTCED  257

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTET------AKADPCLLTWVDDY  995
             +   +S E+   + + ++    C +    + +   LG +T       + D C+      Y
Sbjct  258   VYSTVSMELSQYIDRYDVTLDICLS-SVGTQKSKMLGVKTIGTRLAVQPDVCVENEATAY  316

Query  996   LSRPEVQEALHA----NASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDE  1163
             L+  +VQ+A HA    N   WDS         +NL I  +P L  L   GI +LIYSGD+
Sbjct  317   LNMVDVQKAFHARLVGNVKRWDSCSDVLTYDHHNLEIPTVPLLGKLAMTGIRVLIYSGDQ  376

Query  1164  DLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFAT  1343
             D  IP++ TR L N LA  L L +      W+ GKQ+ GW Q +GN         L+FAT
Sbjct  377   DSVIPLTGTRTLVNNLAASLKLNSTVPYSVWFQGKQVAGWVQVYGNI--------LSFAT  428

Query  1344  VRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             VRG SH VP S P ++L LFKAFL+G  PP
Sbjct  429   VRGASHEVPFSQPERSLVLFKAFLQGQTPP  458



>ref|XP_003520484.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 191/467 (41%), Positives = 266/467 (57%), Gaps = 25/467 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  L  +L  TL  +S     + I +LPGQP  V F QYSGY+       RALFYYF E
Sbjct  10    MIATLIIVLAQTLVGVSSLPEADKIINLPGQPK-VKFQQYSGYVTVDDQHQRALFYYFVE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+ ED  S PL LWL GG  CSS   G F E+GPFRP+++  L KN +SWN A+NMLY++
Sbjct  69    AE-EDPSSKPLVLWLNGGPGCSSIGTGAFTEHGPFRPSDNNLLEKNDYSWNKAANMLYLE  127

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS   S Y + +D +TAR+NL FL++WF +F EY   DF+I G+SYGGH  P
Sbjct  128   SPAGVGFSYSRNKSFYALVTDEITARDNLLFLQRWFTKFPEYSKRDFFITGESYGGHYVP  187

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKR  767
             QLA+LI++            LKGIA+GNPLLE      S  E+ W +G+IS   Y +  R
Sbjct  188   QLAQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYFWSHGLISDPTYEVLTR  241

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG-  944
              C+ + + ++  +G +   C   N ++  E+   + + ++    C +    + Q + L  
Sbjct  242   DCNFSSIRRQWQNGNLRGVCEKANKLLDSEVSYYVDEYDVTLDVCLSP--VNQQAYVLNQ  299

Query  945   -TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
               ET K D C+      YL+  EVQEALHAN    + W +     +    NL +  +P L
Sbjct  300   LQETQKIDVCVGDKTTTYLNTKEVQEALHANLVGVAKWSTCSSVLHYDYQNLEVPTIPIL  359

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+K  I +L+YSGD+D  IP+  +R L N LA  + L T     PW+  KQ+ GW+Q 
Sbjct  360   GSLVKSSIRVLVYSGDQDSVIPLLGSRSLVNGLAKEIGLNTTVAYRPWFGEKQVAGWTQV  419

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +G+         L++ATVRG SH  P S P ++L L KAFL+G P P
Sbjct  420   YGDI--------LSYATVRGASHEAPFSQPQRSLVLLKAFLEGKPLP  458



>ref|XP_003521119.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 272/468 (58%), Gaps = 25/468 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++  L+   L  TL  +S     + I +LPGQP  V+F QYSGY+       RALFYYF 
Sbjct  10    MIATLIIIFLAQTLVGVSSLPEADKITNLPGQPR-VEFQQYSGYVTVDDQNQRALFYYFV  68

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA+ E+  S PL LWL GG  CSS  +G F E+GPFRP+++  L  N  SWN  +N+LY+
Sbjct  69    EAE-ENPSSKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEINDKSWNKVANVLYL  127

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++P GV FSYS+  S Y + +D +TAR+NL FL++WF +F EY + DF+I+G+SYGGH  
Sbjct  128   ESPAGVGFSYSSNESFYALVTDEITARDNLVFLQRWFTKFPEYSNNDFFISGESYGGHYV  187

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQK  764
             PQLA+LI++            LKGIA+GNPLLE      S  E+LW +G+IS   Y +  
Sbjct  188   PQLAQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYLWSHGLISDSTYEVLT  241

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG  944
             R C+ + + +++ +G +   C   N ++  EI + + + ++    C +    + Q + L 
Sbjct  242   RVCNFSSIRRQMQNGNLRGVCGKANKLLDSEISNYVDEYDVTLDVCLSS--VNQQAYVLN  299

Query  945   --TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPT  1109
                ET K D C+      YL+  EVQEALHAN    + W +     +    NL I  +P 
Sbjct  300   QLQETQKIDVCIGDKTTTYLNTKEVQEALHANLVGVAKWSTCSSVLHYDYQNLEIPTIPI  359

Query  1110  LSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQ  1289
             L +L+  GI +L+YSGD+D  +P+  +R L N LA  + L T      W++GKQ+ GW+Q
Sbjct  360   LGSLVNSGIRVLVYSGDQDSVLPLLGSRSLVNGLAKEIGLDTTVAYRAWFEGKQVAGWTQ  419

Query  1290  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              +GN         L++AT+RG SH  P S P ++L L KAFL+G P P
Sbjct  420   VYGNI--------LSYATIRGASHEAPFSQPQRSLGLLKAFLEGKPLP  459



>ref|XP_008374178.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=467

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 191/444 (43%), Positives = 260/444 (59%), Gaps = 22/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGYI       +ALFYYFAEA   +  S PL LWL GG  CSS 
Sbjct  39    ITRLPGQP-HVGFQQFSGYITVDDHNHKALFYYFAEADI-NPASKPLVLWLNGGPGCSSL  96

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  DGE LV+N++SWN  +NMLY++TP+GV FSYS ++S Y    D  
Sbjct  97    GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYSKSNSSYMAVDDEA  154

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR NL FL++W  +F +YR +D ++AG+SY GH  PQLA+LI+E NRK        LKG
Sbjct  155   TARXNLVFLQRWLNKFPQYRHMDLFLAGESYAGHYIPQLAKLIVEINRK----EKFNLKG  210

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E LW +G+IS   Y++    C+ +R V E     +S  CS +
Sbjct  211   IALGNPVLEFATDLNSQAEFLWSHGLISDSTYNMFTSVCNYSRYVSEYYRRSVSPVCSRV  270

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +++E    + K ++    C +   S S+       T + D C+      YL+R +VQ
Sbjct  271   VSQVTKETSQFVDKYDVTLDVCISSVLSQSKFISPNQMTERIDVCVEDKTVIYLNRKDVQ  330

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       WD         + NL I  +  + +L+K+GI +L+YSGD+D  IP++ 
Sbjct  331   KALHARLVGVRRWDVCSSILEYQMLNLEIPTISLVGSLVKQGIQVLVYSGDQDSVIPLTG  390

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA  L L T      W++GKQ+GGW+Q +GN         L+FAT+RG SH  
Sbjct  391   SRRLVSRLARELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LSFATIRGASHEA  442

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LFK+FL+G P P  
Sbjct  443   PFSQPERSLRLFKSFLEGRPLPEV  466



>gb|AAG51475.1|AC069471_6 serine carboxypeptidase II, putative [Arabidopsis thaliana]
Length=456

 Score =   342 bits (876),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 190/441 (43%), Positives = 262/441 (59%), Gaps = 24/441 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++    S PL LWL GG  CSS 
Sbjct  32    VTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAETNPS-SKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  90    GVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVNDKIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLAEL+++YN+K  H+    L+GI
Sbjct  149   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAELMIQYNKKH-HL--FNLRGI  205

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G MS  CS + 
Sbjct  206   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSMCSKVM  265

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C     S S++          D C+     +YL+R +VQE
Sbjct  266   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKQ-----VGESVDVCVEDETVNYLNRRDVQE  320

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W    +  +  L ++ I  +  + +L+K G+P+L+YSGD+D  IP++ +
Sbjct  321   ALHARLIGVREWTVCSNVLDYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGS  380

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W+ G+Q+GGW+Q +GN         L+FATVRG SH VP
Sbjct  381   RTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASHEVP  432

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAFL G P P
Sbjct  433   FSQPERSLVLFKAFLDGHPLP  453



>ref|XP_009359890.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 194/449 (43%), Positives = 270/449 (60%), Gaps = 32/449 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + R +A+FYY AEA+  D  S PL LWL GG  CSS 
Sbjct  35    ITGLPGQPP-VGFQQYSGYVTVDEKRQKAMFYYLAEAEI-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  93    GVGAFSENGPFRP--KGEVLVRNEHSWNTEANMLYLETPIGVGFSYSTDTSSYEGVTDRI  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL+KW  +F +YR+   YI G+SY GH  PQLAEL+L++ ++        LKG
Sbjct  151   TARDNLLFLQKWLEKFPQYRNRSLYITGESYAGHYVPQLAELMLQFKKE----YQFNLKG  206

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E   G +S  C+ +
Sbjct  207   IALGNPVLEFATDFNSRAEFFWSHGLISDATYNMFTSVCNYSRYVSEYYRGSLSPICAMV  266

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA-DPCLLTWVDDYLSRPEV  1013
                +S E    + K ++    C +   S S +  L  E A   D C+   + +YL+RP+V
Sbjct  267   MSQVSRETSKFVDKYDVTLDVCISSVVSQS-KALLPQEVADTIDVCVDDEIVNYLNRPDV  325

Query  1014  QEALHAN---ASTWDSIFHGRNMILNNLAIDI-LPTLS---ALLKRGIPLLIYSGDEDLR  1172
             Q+ALHA       W       + IL+   +D+ +PT++    L+K GIP+L+YSGD+D  
Sbjct  326   QKALHARLVGVRQWAVC----STILDYQQLDVEIPTITIVGKLIKAGIPVLVYSGDQDSV  381

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             IP++ +R+L N LA +L L+T      W+ G+Q+GGW+Q +GN         L+FAT+RG
Sbjct  382   IPLTGSRKLVNGLAEQLRLSTTVPYRVWFGGQQVGGWTQVYGNM--------LSFATIRG  433

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              SH  P S P ++L LFK+FL+G P P  
Sbjct  434   ASHEAPFSQPERSLVLFKSFLEGRPLPEV  462



>ref|XP_010239839.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=465

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 186/449 (41%), Positives = 263/449 (59%), Gaps = 28/449 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+     R R+LFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  32    IRGLPGQPP-VSFAQYSGYVAVDAARKRSLFYYFAEAEL-DPATKPLVLWLNGGPGCSSV  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +NMLY+++P GV FSYS   S Y    D+MT
Sbjct  90    GVGAFSENGPFRPSGNA-LVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYGGVGDSMT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NLKFL+ WF +F  Y+  D YI G+SY GH  PQLA+ I+E+N+K    +   LKGI
Sbjct  149   ARDNLKFLQGWFAKFPRYKGRDLYITGESYAGHYVPQLAQRIVEFNKKE---KLFNLKGI  205

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y++  R C+ +R V E   G +S  C  + 
Sbjct  206   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFSRVCNYSRYVSEYYHGSISPVCDRVM  265

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQR---HCLGTETAKADPCLLTWVDDYLSRPE  1010
               ++ E    + K ++    C +   + S+          + + D C+     +YL+R +
Sbjct  266   SQVTRETSRFVDKYDVTLDVCISSVLAQSKTLTPQSTQQLSRELDVCVEDETMNYLNRKD  325

Query  1011  VQEALHANA------STWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLR  1172
             VQ+A+HA        +   S+   + +   +L I  + T+  L+K GIP+L+YSGD+D  
Sbjct  326   VQQAMHARLNGVPKWTVCSSVLEYKQL---DLQIPTINTVGMLVKSGIPVLVYSGDQDSV  382

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             IP++ +R L + LA RL L        W++GKQ+GGW+Q FG++        L+FAT+RG
Sbjct  383   IPLTGSRTLVHRLAKRLRLNATVPYRVWFEGKQVGGWTQVFGDA--------LSFATIRG  434

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              SH  P S P ++L LF+AFL G P P +
Sbjct  435   ASHEAPFSQPERSLVLFRAFLAGRPLPES  463



>ref|XP_008369640.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=463

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 271/447 (61%), Gaps = 32/447 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + +ALFYY AEA+  D  S PL LWL GG  CSS 
Sbjct  35    ITGLPGQPP-VGFQQYSGYVTVDEKKQKALFYYLAEAEI-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  93    GVGAFSENGPFRP--QGEVLVRNEHSWNTEANMLYLETPIGVGFSYSTDTSSYEGVTDHI  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL+KW  +F +YR+   YI G+SY GH  PQLAEL+L++ ++        LKG
Sbjct  151   TARDNLLFLQKWLEKFPQYRNRSLYITGESYAGHYVPQLAELMLQFKKE----YQFNLKG  206

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E   G +S  C+ +
Sbjct  207   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYNMFTSVCNYSRYVSEYYRGSLSPICARV  266

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA-DPCLLTWVDDYLSRPEV  1013
                +S E    + K ++    C +  +S S +  L  E A   D C+   + +YL+RP+V
Sbjct  267   MSQVSTETSKFVDKYDVTLDVCISSVFSQS-KALLPQEVADTIDVCVEDEIVNYLNRPDV  325

Query  1014  QEALHAN---ASTWDSIFHGRNMILNNLAIDI-LPTLSA---LLKRGIPLLIYSGDEDLR  1172
             Q+ALHA       W       + IL+   +D+ +PT++    L+K GIP+L+YSGD+D  
Sbjct  326   QKALHARLVGVRQWAVC----STILDYQHLDVEIPTITIIGNLIKAGIPVLVYSGDQDSV  381

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             IP++ +R+L N LA +L L+T      W+ G+Q+GGW+Q +GN         L+FAT+RG
Sbjct  382   IPLTGSRKLVNGLAEQLRLSTTVPYRVWFGGQQVGGWTQVYGNM--------LSFATIRG  433

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              SH  P S P ++L LFK+FL+G P P
Sbjct  434   ASHEAPFSQPERSLVLFKSFLEGRPLP  460



>gb|KHN30341.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=459

 Score =   342 bits (876),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 191/467 (41%), Positives = 266/467 (57%), Gaps = 25/467 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  L  +L  TL  +S     + I +LPGQP  V F QYSGY+       RALFYYF E
Sbjct  8     MIATLIIVLAQTLVGVSSLPEADKIINLPGQPK-VKFLQYSGYVTVDDQHQRALFYYFVE  66

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+ ED  S PL LWL GG  CSS   G F E+GPFRP+++  L KN +SWN A+NMLY++
Sbjct  67    AE-EDPSSKPLVLWLNGGPGCSSIGTGAFTEHGPFRPSDNNLLEKNDYSWNKAANMLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS   S Y + +D +TAR+NL FL++WF +F EY   DF+I G+SYGGH  P
Sbjct  126   SPAGVGFSYSRNKSFYALVTDEITARDNLVFLQRWFTKFPEYSKRDFFITGESYGGHYVP  185

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKR  767
             QLA+LI++            LKGIA+GNPLLE      S  E+ W +G+IS   Y +  R
Sbjct  186   QLAQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYFWSHGLISDSTYEVLTR  239

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG-  944
              C+ + + ++  +G +   C   N ++  E+   + + ++    C +    + Q + L  
Sbjct  240   DCNFSSIRRQWQNGNLRGVCEKANKLLDSEVSYYVDEYDVTLDVCLSP--VNQQAYVLNQ  297

Query  945   -TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
               ET K D C+      YL+  EVQEALHAN    + W +     +    NL +  +P L
Sbjct  298   LQETQKIDVCVGDKTTTYLNTKEVQEALHANLVGVAKWSTCSSVLHYDYQNLEVPTIPIL  357

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+K  I +L+YSGD+D  IP+  +R L N LA  + L T     PW+  KQ+ GW+Q 
Sbjct  358   GSLVKSSIRVLVYSGDQDSVIPLLGSRSLVNGLAKEIGLNTTVAYRPWFGEKQVAGWTQV  417

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +G+         L++ATVRG SH  P S P ++L L KAFL+G P P
Sbjct  418   YGDI--------LSYATVRGASHEAPFSQPQRSLVLLKAFLEGKPLP  456



>gb|KHN30340.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=460

 Score =   342 bits (876),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 272/468 (58%), Gaps = 25/468 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++  L+   L  TL  +S     + I +LPGQP  V+F QYSGY+       RALFYYF 
Sbjct  8     MIATLIIIFLAQTLVGVSSLPEADKITNLPGQPR-VEFQQYSGYVTVDDQNQRALFYYFV  66

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA+ E+  S PL LWL GG  CSS  +G F E+GPFRP+++  L  N  SWN  +N+LY+
Sbjct  67    EAE-ENPSSKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEINDKSWNKVANVLYL  125

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++P GV FSYS+  S Y + +D +TAR+NL FL++WF +F EY + DF+I+G+SYGGH  
Sbjct  126   ESPAGVGFSYSSNESFYALVTDEITARDNLVFLQRWFTKFPEYSNNDFFISGESYGGHYV  185

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQK  764
             PQLA+LI++            LKGIA+GNPLLE      S  E+LW +G+IS   Y +  
Sbjct  186   PQLAQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYLWSHGLISDSTYEVLT  239

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG  944
             R C+ + + +++ +G +   C   N ++  EI + + + ++    C +    + Q + L 
Sbjct  240   RVCNFSSIRRQMQNGNLRGVCGKANKLLDSEISNYVDEYDVTLDVCLSS--VNQQAYVLN  297

Query  945   --TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPT  1109
                ET K D C+      YL+  EVQEALHAN    + W +     +    NL I  +P 
Sbjct  298   QLQETQKIDVCIGDKTTTYLNTKEVQEALHANLVGVAKWSTCSSVLHYDYQNLEIPTIPI  357

Query  1110  LSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQ  1289
             L +L+  GI +L+YSGD+D  +P+  +R L N LA  + L T      W++GKQ+ GW+Q
Sbjct  358   LGSLVNSGIRVLVYSGDQDSVLPLLGSRSLVNGLAKEIGLDTTVAYRAWFEGKQVAGWTQ  417

Query  1290  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              +GN         L++AT+RG SH  P S P ++L L KAFL+G P P
Sbjct  418   VYGNI--------LSYATIRGASHEAPFSQPQRSLGLLKAFLEGKPLP  457



>ref|XP_002322611.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
 gb|EEF04372.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
Length=442

 Score =   341 bits (874),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 188/459 (41%), Positives = 261/459 (57%), Gaps = 29/459 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L  T + I   ++    D   SLPGQP  V F QY+GY+   + + RALFYYF EA++ 
Sbjct  3     VLCATFFQICRAVDSSADDKLLSLPGQPR-VSFQQYAGYVTVDENQDRALFYYFVEAET-  60

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS   G F E+GPFRP+  G LV+N +SWN  +NMLY+++P G
Sbjct  61    DPASKPLVLWLNGGPGCSSVGAGAFSEHGPFRPSGGGSLVRNDYSWNKEANMLYLESPAG  120

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAE  605
             V FSYS   S Y + +DT+T ++N  FL+ WF++F EY++ D +I G+SY GH  PQLA+
Sbjct  121   VGFSYSANQSFYDLVNDTITVQDNFVFLQNWFLKFPEYKNRDLFITGESYAGHYVPQLAD  180

Query  606   LILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNVE--HLWHYGIISTELYHLQKRQCDS  779
             LI++   K        LKGIALGNPLLE     N E    W +G+IS   Y L    C++
Sbjct  181   LIVKSGLK------FNLKGIALGNPLLEFSTDFNSEGDFYWSHGLISNPTYELLSAVCNT  234

Query  780   TRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK  959
             +++ +E +   +S  CS +N  ++ EI D + K ++    C      S     LG     
Sbjct  235   SQLWRERIGNSLSASCSKVNDQLNAEIPDAIDKYDVTANVCL-----SFGASLLGKAQEN  289

Query  960   ADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKR  1130
              DPC+      YL+R +VQE+ HA       W       N  L NL I  +  + +L+  
Sbjct  290   IDPCVQEETFVYLNRKDVQESFHAKLVGTPKWTFCSGVVNYDLRNLEIPTIDVVGSLVNS  349

Query  1131  GIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGG  1310
             G+ +L+YSGD+D  IP + +R L   LA +L L       PW++ KQ+GGW+Q +GN   
Sbjct  350   GVRVLVYSGDQDSVIPFTGSRTLVEGLAKKLGLNATVPYTPWFEDKQVGGWTQVYGNI--  407

Query  1311  GEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSP  1427
                   LTF+T+RGGSH  P SSP ++L LF AFL G P
Sbjct  408   ------LTFSTIRGGSHMAPFSSPGRSLALFAAFLSGKP  440



>gb|KHN13827.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   340 bits (873),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 186/442 (42%), Positives = 259/442 (59%), Gaps = 26/442 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F+Q+SGY+       RALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +G LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+       
Sbjct  90    GVGAFSENGPFRPKGEG-LVRNQFSWNKEANMLYLETPIGVGFSYSTDTSSYE-------  141

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A +NL FL+ WF++F EYR+   +I G+SY GH  PQLAEL+L +NRK    +   LKGI
Sbjct  142   AGDNLVFLQNWFMKFPEYRNRSLFIVGESYAGHYVPQLAELMLRFNRKE---KLFNLKGI  198

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +  V+E  +G +S  CS + 
Sbjct  199   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPTCSSVM  258

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C +  +S ++       T   D C+     +YL+R +VQ 
Sbjct  259   SQVSTETSRFVEKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  318

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA+      W +  +  +  L +L    +  +  L+K GIP+L+YSGD+D  IP++ +
Sbjct  319   ALHAHLVGVQRWSACSNVLDYELRDLETPTITVVGKLVKEGIPVLVYSGDQDSVIPLTGS  378

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA  L L T      W++ +Q+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  379   RTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI--------LSFATIRGASHEAP  430

Query  1371  NSSPSKALTLFKAFLKGSPPPN  1436
              S P ++L LFK+FL+G P P 
Sbjct  431   FSQPERSLVLFKSFLEGGPLPQ  452



>ref|XP_007223033.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24232.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=465

 Score =   341 bits (874),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 189/445 (42%), Positives = 264/445 (59%), Gaps = 24/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  37    IALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCSSL  94

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  95    GVGAFSENGPFRPS--GEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVNDHI  152

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL+ W  +F +Y++   +I G+SY GH  PQLAEL+L+Y     +     LKG
Sbjct  153   TARDNLLFLQNWLEKFPQYKNRSLFITGESYAGHYVPQLAELMLQYKEYQFN-----LKG  207

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS +
Sbjct  208   IALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICSRV  267

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA-DPCLLTWVDDYLSRPEV  1013
                +S E    + K ++    C +  +S S+      +  +A D C+   + +YL+RP+V
Sbjct  268   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQQVTEAIDVCVEDEIVNYLNRPDV  327

Query  1014  QEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVS  1184
             Q+ALHA       W    +  +  L ++ I     +  L+K GIP+L+YSGD+D  IP++
Sbjct  328   QKALHARLVGVRQWAVCSNILDYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQDSVIPLT  387

Query  1185  HTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
              +R L + LA +L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH 
Sbjct  388   GSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNI--------LSFATIRGASHE  439

Query  1365  VPNSSPSKALTLFKAFLKGSPPPNT  1439
              P S P ++L LFK+FL+G P P  
Sbjct  440   APFSQPERSLVLFKSFLEGRPLPEV  464



>ref|XP_010460580.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   342 bits (876),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 188/441 (43%), Positives = 261/441 (59%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             + SLPGQP  V F QYSGY+     + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  62    VTSLPGQP-QVGFQQYSGYVTVDDKKQRALFYYFAEAET-DPTSKPLVLWLNGGPGCSSL  119

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN  SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  120   GVGAFSENGPFRP-KGPILVKNYHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDKIT  178

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLA+L+++YN+K  H+    L+GI
Sbjct  179   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMIQYNKKH-HL--FNLRGI  235

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G MS  CS + 
Sbjct  236   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSICSKVM  295

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C     S S+           D C+     +YL+R +VQE
Sbjct  296   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQE  355

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W    +  +  L ++    +  + +L++ G+P+L+YSGD+D  IP++ +
Sbjct  356   ALHARLIGVREWTVCSNVLDYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQDSVIPLTGS  415

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W+ G+Q+GGW+Q +GN         L+FATVRG SH VP
Sbjct  416   RTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASHEVP  467

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAFL G P P
Sbjct  468   FSQPERSLVLFKAFLNGHPLP  488



>ref|XP_004310134.1| PREDICTED: serine carboxypeptidase-like 45-like [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 189/442 (43%), Positives = 262/442 (59%), Gaps = 22/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F  YSGY+   + + RALFYYFAEA+ E   S PL LWL GG  CSS 
Sbjct  30    ITRLPGQP-QVGFQHYSGYVTVDEKKQRALFYYFAEAEVEPA-SKPLVLWLNGGPGCSSL  87

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LV+N++SWN  +NMLY++TPIGV FSYS  ++ Y+  +D +
Sbjct  88    GVGAFSENGPFRPS--GEVLVRNEYSWNREANMLYLETPIGVGFSYSTDTASYESVNDRI  145

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL+KW  +F +YR+   +I G+SY GH  PQLAEL+L+++ K  H     LKG
Sbjct  146   TARDNLMFLQKWLDKFPQYRNRSLFITGESYAGHYVPQLAELMLQFS-KEYH---FNLKG  201

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS +
Sbjct  202   IALGNPVLEYATDFNSRSEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICSKV  261

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S E    + K ++    C +  +S S+       T   D C+     +YL+R +VQ
Sbjct  262   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLSPQQVTESIDVCVEDETVNYLNRLDVQ  321

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       W    +  +  L +L I  +  +  L+K GI +L+YSGD+D  IP++ 
Sbjct  322   KALHARLVGVRKWAVCSNVLDYELLDLEIPTISIVGKLIKAGISVLVYSGDQDSVIPLTG  381

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA  L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  
Sbjct  382   SRTLVHGLAEELKLNTTVPYRVWFEGQQVGGWTQVYGNM--------LSFATIRGASHEA  433

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LFK+FL+G P P
Sbjct  434   PFSQPERSLVLFKSFLEGRPLP  455



>ref|XP_006589008.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=464

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 269/467 (58%), Gaps = 29/467 (6%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             LL F++   +  ++     + I +LPGQP  V F QY+GYI     + RALFYYF EA+ 
Sbjct  13    LLLFVIAQCVVGVNSLSQADKISTLPGQPP-VKFQQYAGYITVDDKQKRALFYYFVEAEV  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             E   S PL LWL GG  CSS   G F E+GPF+P+E+G L+KN+ SWN  +NMLY+++P 
Sbjct  72    EPA-SKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKEANMLYLESPA  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS   S Y   +D MTAR+NL FL++WF +F E ++ DF+I G+SY GH  PQLA
Sbjct  130   GVGFSYSANKSFYDFVNDEMTARDNLVFLQRWFTKFPELKNNDFFITGESYAGHYVPQLA  189

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLE--KMGLSNVEHLWHYGIISTELYHLQKRQCD  776
             +LI++   K        LKGIA+GNPL+E      S  E  W +G+IS   Y +  + C+
Sbjct  190   QLIVQTKTK------FNLKGIAIGNPLVEFNTDFNSRAEFFWSHGLISDSTYEIFTKVCN  243

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG----  944
              +++ ++   G ++  CS +N ++S E+   +   ++    C +   +  Q + L     
Sbjct  244   YSQIRRQHQGGTLTPICSGVNRLVSTEVSRYIDTYDVTLDVCLSS--ADQQAYVLNQLTQ  301

Query  945   -TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
               E AK D C+      YL+R +VQEALHA     ++W +        + NL I  +  L
Sbjct  302   LQEGAKIDVCVEDETIAYLNRKDVQEALHAKLVGITSWSTCSDVLKYDMQNLEIPTISIL  361

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              AL K GI +L+YSGD+D  IP++ TR L N LA    L T      W++G+Q+ GW+Q 
Sbjct  362   GALAKSGIRVLVYSGDQDSVIPLTGTRSLVNGLAKDFGLNTTVSYRAWFEGRQVAGWTQV  421

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +G+         L+FAT+RG +H  P S P ++L L KAFL+G P P
Sbjct  422   YGDI--------LSFATIRGAAHEAPFSQPERSLVLLKAFLEGKPLP  460



>ref|XP_009113703.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
 emb|CDY46627.1| BnaA09g27540D [Brassica napus]
Length=454

 Score =   339 bits (870),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/449 (42%), Positives = 264/449 (59%), Gaps = 22/449 (5%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             S+  + + I  LPGQP  V F QYSGY+   + + RALFYY AEA++ D  + PL LWL 
Sbjct  20    SVLSHSDRITRLPGQPR-VGFQQYSGYVTVDEKKQRALFYYLAEAET-DPINKPLVLWLN  77

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDY  461
             GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS   + Y
Sbjct  78    GGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLETPVGVGFSYS---TQY  133

Query  462   KIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHV  641
             +  +D +TAR+NL FL++WF++F  Y +   +I G+SY GH  PQLAEL+++YN+K  H+
Sbjct  134   ESVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAELMIQYNQKH-HL  192

Query  642   RPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEM  815
                 L+GIA+GNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G M
Sbjct  193   --FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSM  250

Query  816   SEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDY  995
             S  CS +   +S E    + K ++    C     S S+           D C+      Y
Sbjct  251   SSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVKY  310

Query  996   LSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDED  1166
             L+R +VQEALHA       W    +  +  L ++ I  +  + +L++ G+P+L+YSGD+D
Sbjct  311   LNRRDVQEALHARLVGVREWTVCSNVLDYQLLDVEIPTINIVGSLVQAGVPVLVYSGDQD  370

Query  1167  LRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATV  1346
               IP++ +R L N LA RL L T      W+ G+Q+GGW+Q +GN         L+FATV
Sbjct  371   SVIPLTGSRTLVNRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATV  422

Query  1347  RGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             RG SH VP S P ++L LFKAFL G P P
Sbjct  423   RGASHEVPFSQPHRSLVLFKAFLDGHPLP  451



>gb|KHN07932.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=464

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/466 (41%), Positives = 270/466 (58%), Gaps = 27/466 (6%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             LL F++   +  ++     + I +LPGQP  V F QY+GYI     + RALFYYF EA+ 
Sbjct  13    LLLFVIAQCVVGVNSLSQADKISTLPGQPP-VKFQQYAGYITVDDKQKRALFYYFVEAEV  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             E   S PL LWL GG  CSS   G F E+GPF+P+E+G L+KN+ SWN  +NMLY+++P 
Sbjct  72    EPA-SKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKEANMLYLESPA  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS   S Y   +D MTAR+NL FL++WF +F E ++ DF+I G+SY GH  PQLA
Sbjct  130   GVGFSYSANKSFYDFVNDEMTARDNLVFLQRWFTKFPELKNNDFFITGESYAGHYVPQLA  189

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLE--KMGLSNVEHLWHYGIISTELYHLQKRQCD  776
             +LI++   K        LKGIA+GNPL+E      S  E  W +G+IS   Y +  + C+
Sbjct  190   QLIVQTKTK------FNLKGIAIGNPLVEFNTDFNSRAEFFWSHGLISDSTYEIFTKVCN  243

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC--QTDQ--YSSSQRHCLG  944
              +++ ++   G ++  CS +N ++S E+   +   ++    C    DQ  Y  +Q   L 
Sbjct  244   YSQIRRQHQGGTLTPICSGVNRLVSTEVSRYIDTYDVTLDVCLSSADQQAYVPNQLTQL-  302

Query  945   TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLS  1115
              E AK D C+      YL+R +VQEALHA     ++W +        + NL I  +  L 
Sbjct  303   QEGAKIDVCVEDETIAYLNRKDVQEALHAKLVGITSWSTCSDVLKYDMQNLEIPTISILG  362

Query  1116  ALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTF  1295
             AL K GI +L+YSGD+D  IP++ TR L N LA    L T      W++G+Q+ GW+Q +
Sbjct  363   ALAKSGIRVLVYSGDQDSVIPLTGTRSLVNGLAKDFGLNTTVSYRAWFEGRQVAGWTQVY  422

Query  1296  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             G+         L+FAT+RG +H  P S P ++L L KAFL+G P P
Sbjct  423   GDI--------LSFATIRGAAHEAPFSQPERSLVLLKAFLEGKPLP  460



>gb|KHN09723.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   339 bits (870),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 186/449 (41%), Positives = 266/449 (59%), Gaps = 21/449 (5%)
 Frame = +3

Query  114   NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHD  293
             + + I  LPGQP  V F Q+SGY+     + ++LFYYFAEA++ D  S PL LWL GG  
Sbjct  22    HADTIALLPGQP-HVSFQQFSGYVTVDDKKHKSLFYYFAEAET-DPSSKPLVLWLNGGPG  79

Query  294   CSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWS  473
             CSS  +G F ENGPFRP E+  L+KN +SWN  +NMLY++TP+GV FSY+  SS Y   +
Sbjct  80    CSSLGVGAFSENGPFRPNEEF-LIKNDYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVN  138

Query  474   DTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIK  653
             D  TAR+NL FL +WF +F +Y+  D ++ G+SY GH  PQLA+L++E N K    +   
Sbjct  139   DEATARDNLVFLLRWFNKFPQYKSRDLFLTGESYAGHYVPQLAKLMVEMNTKN---KIFN  195

Query  654   LKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDC  827
             LKGIALGNP+LE      S  E  W +G+IS   Y++  + C  +R V E     +S  C
Sbjct  196   LKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTKVCYYSRYVSEYYRDLVSPLC  255

Query  828   SDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA--KADPCLLTWVDDYLS  1001
             S +   +S E    + K ++    C +   S S+  C  ++ A    D C+   V +YL+
Sbjct  256   SKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLN  315

Query  1002  RPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLR  1172
             R +VQEALHA       W+   +  +  + NL +  L  + +L+K G+ +LIYSGD+D  
Sbjct  316   RRDVQEALHAKLVGVRKWEVCSNILDYDMLNLEVPTLLVVGSLIKAGVKVLIYSGDQDSV  375

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             IP++ +R L   LA +L L +      W++G+Q+GGW+Q +GN         L+FATVRG
Sbjct  376   IPLTGSRTLVQKLARKLGLNSTVPYRVWFEGQQVGGWTQGYGNI--------LSFATVRG  427

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              SH  P S P ++L LFK+FL+G P P+ 
Sbjct  428   ASHEAPFSQPERSLVLFKSFLEGRPLPDA  456



>ref|XP_008667418.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF78622.1| unknown [Zea mays]
 gb|ACF84275.1| unknown [Zea mays]
 tpg|DAA38061.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=471

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 267/465 (57%), Gaps = 26/465 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGE--IIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSED  248
             LL+   +S+S +   E   I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D
Sbjct  21    LLLGDAWSVSAQAAAEEDKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-D  78

Query  249   KFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGV  428
               + PL LWL GG  CSS  +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV
Sbjct  79    PAAKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGV  137

Query  429   AFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAEL  608
              FSYS   + Y+   D+MTAR+NLKFL+ WF  F +Y+  D YI G+SY GH  PQLA+ 
Sbjct  138   GFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGESYAGHYVPQLAQR  197

Query  609   ILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDST  782
             ++E+N+K    +   LKGIALGNP+LE      S  E  W +G+IS   Y++    C+ +
Sbjct  198   MVEFNKKE---KLFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYS  254

Query  783   RMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA  962
             R V E   G +S  C  +   ++ E    + K ++    C +     SQ       + + 
Sbjct  255   RYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSREL  314

Query  963   DPCLLTWVDDYLSRPEVQEALHA---NASTW---DSIFHGRNMILNNLAIDILPTLSALL  1124
             D C+      YL+R +VQ+A+HA       W    S+   + +   +L I  + T+ AL+
Sbjct  315   DVCVEDETMRYLNRKDVQQAMHARLDGVQRWTVCSSVLEYKQL---DLQIPTVNTVGALV  371

Query  1125  KRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNS  1304
             K GIP L+YSGD+D  IP++ +R L   LA RL L        W+ GKQ+GGW+Q FG  
Sbjct  372   KAGIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG--  429

Query  1305  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             GG      L+FATVRG SH  P S P ++L LF+AFL G   P +
Sbjct  430   GGA-----LSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  469



>ref|XP_008667417.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA38060.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=472

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 192/466 (41%), Positives = 267/466 (57%), Gaps = 27/466 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGE--IIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSED  248
             LL+   +S+S +   E   I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D
Sbjct  21    LLLGDAWSVSAQAAAEEDKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-D  78

Query  249   KFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGV  428
               + PL LWL GG  CSS  +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV
Sbjct  79    PAAKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGV  137

Query  429   AFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAEL  608
              FSYS   + Y+   D+MTAR+NLKFL+ WF  F +Y+  D YI G+SY GH  PQLA+ 
Sbjct  138   GFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGESYAGHYVPQLAQR  197

Query  609   ILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDST  782
             ++E+N+K    +   LKGIALGNP+LE      S  E  W +G+IS   Y++    C+ +
Sbjct  198   MVEFNKKE---KLFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYS  254

Query  783   RMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA  962
             R V E   G +S  C  +   ++ E    + K ++    C +     SQ       + + 
Sbjct  255   RYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSREL  314

Query  963   DPCLLTWVDDYLSRPEVQEALHA---NASTW----DSIFHGRNMILNNLAIDILPTLSAL  1121
             D C+      YL+R +VQ+A+HA       W     S+   + +   +L I  + T+ AL
Sbjct  315   DVCVEDETMRYLNRKDVQQAMHARLDGVQRWTVCSSSVLEYKQL---DLQIPTVNTVGAL  371

Query  1122  LKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGN  1301
             +K GIP L+YSGD+D  IP++ +R L   LA RL L        W+ GKQ+GGW+Q FG 
Sbjct  372   VKAGIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG-  430

Query  1302  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              GG      L+FATVRG SH  P S P ++L LF+AFL G   P +
Sbjct  431   -GGA-----LSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  470



>ref|XP_010549305.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 187/441 (42%), Positives = 257/441 (58%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  37    VAQLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAEA-DPASKPLVLWLNGGPGCSSL  94

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN+ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  95    GVGAFSENGPFRP-KGPILVKNEHSWNKEANMLYLETPVGVGFSYSTDSSSYEGVNDKIT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F +Y +   +I G+SY GH  PQLA+L+++YN+K    +   L+GI
Sbjct  154   ARDNLVFLQRWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKH---KLFNLRGI  210

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGTVSAMCSKVM  270

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C     S S+           D C+      YL+R +VQ 
Sbjct  271   SQVSVETSRFVDKYDVTLDVCIPSVLSQSKVVSPQQVGETVDVCVEDETVSYLNRRDVQR  330

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             +LHA       W    +  +  L ++ I  +  +  L+K GIP+L+YSGD+D  IP++ +
Sbjct  331   SLHARLVGVRKWAVCSNVLDYELLDVEIPTITVVGNLVKAGIPVLVYSGDQDSVIPLTGS  390

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L N LA  L L T      W+ G+Q+GGW+Q +GN         L+FATVRG SH VP
Sbjct  391   RTLVNRLAEELRLRTTVPYRVWFAGQQVGGWTQVYGNI--------LSFATVRGASHEVP  442

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAF+ G P P
Sbjct  443   FSQPQRSLVLFKAFINGHPLP  463



>ref|XP_008777392.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 189/454 (42%), Positives = 259/454 (57%), Gaps = 30/454 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  VDF Q+SGYI     + RALFYYF EA+  D  + PL LWL GG  CSS 
Sbjct  34    ISKLPGQP-QVDFQQFSGYITVDDRKQRALFYYFTEAEL-DPSAKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+E   LV+N++SWN  +NMLY++TP GV FSY+N +S Y+   D MT
Sbjct  92    GVGAFSENGPFRPSEQ-VLVRNEYSWNKEANMLYLETPAGVGFSYANDTSCYEGVDDKMT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL +WF +F +Y+  D YI G+SY GH  PQLAEL++++N+K        LKG 
Sbjct  151   ARDNLVFLLRWFSKFPQYKVRDLYITGESYAGHYVPQLAELMVKFNKKK---NIFNLKGA  207

Query  666   A-----------LGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILS  806
             A           LGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   
Sbjct  208   APIFPFSRCTWQLGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTLACNYSRYVSEYYR  267

Query  807   GEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWV  986
             G +S  C+ +   +++E    + K ++    C +   S S+       T   D C+    
Sbjct  268   GSLSAVCARVMGQVTQETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDET  327

Query  987   DDYLSRPEVQEALHANAS---TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSG  1157
              +YL+R +VQ+ALHA  +    W          L NL I  +  + +L++ GIP+L+YSG
Sbjct  328   VNYLNRKDVQDALHARLAGVPKWSVCSSVLEYELLNLEIPTISVVGSLVRSGIPVLVYSG  387

Query  1158  DEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTF  1337
             D+D  IP++ +R L   LA  L L T      W+ GKQ+GGW+Q +G+         LTF
Sbjct  388   DQDSVIPLTGSRTLVQRLAKELKLKTTVPYRVWFAGKQVGGWTQVYGDI--------LTF  439

Query  1338  ATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             AT+RG SH  P S P ++L LF+AFL+G P P T
Sbjct  440   ATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  473



>ref|XP_010509871.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   339 bits (870),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 187/465 (40%), Positives = 271/465 (58%), Gaps = 21/465 (5%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             L+ FL   +L S ++    + I  LPGQP  V F QYSGY+   + + RALFYY AEA++
Sbjct  13    LILFLQTLSLVSSTVLSRADRITRLPGQP-QVGFQQYSGYVTVDEKKQRALFYYLAEAET  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             +   S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+
Sbjct  72    K-PISKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPV  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSY+  SS Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA
Sbjct  130   GVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLA  189

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             +L+++YN++        LKGIA+GNP++E      S  E+ W +G+IS   Y +    C+
Sbjct  190   QLMIQYNKQH---NLFNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCN  246

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA  956
              +R V E   G +S  C+ +   +S E    + K ++    C     S S+R     +  
Sbjct  247   YSRYVSEYYRGTVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSKRVNPQPQEM  306

Query  957   --KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSAL  1121
                 D C+     +YL+R +VQ+ALHA       W    +  +  + ++ +  +  +  L
Sbjct  307   GETVDVCVEDETVNYLNRRDVQKALHARLVGTRKWSVCSNVLDYEVLDVEVPTINIVGTL  366

Query  1122  LKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGN  1301
             +K G+P+L+YSGD+D  IP++ +R L   LA  L L T      W+ G+Q+GGW+Q +GN
Sbjct  367   VKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGN  426

Query  1302  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1436
                      L FATVRG +H VP S P++AL LFKAFL G P P+
Sbjct  427   I--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGLPLPD  463



>emb|CBI32794.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   339 bits (869),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 187/459 (41%), Positives = 266/459 (58%), Gaps = 24/459 (5%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKF  254
              L+    ++    + + I SLPGQP  V F Q++GYI   + + R LFYYF EA++ D  
Sbjct  7     FLIQICLTVESPPSADKIVSLPGQP-QVGFQQFAGYITVDEKQQRHLFYYFVEAET-DPA  64

Query  255   SMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVA  431
             S PL LWL GG  CSS   G F E+GPF+P+  GE LV N +SWN  +NMLY+++P GV 
Sbjct  65    SKPLVLWLNGGPGCSSIGAGAFCEHGPFKPS--GEILVNNDYSWNKVANMLYLESPAGVG  122

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYS  +S Y   +D MTAR+NLKFL++WF++F EY++ D ++ G+SY GH  PQLA+LI
Sbjct  123   FSYSANTSFYAFVNDEMTARDNLKFLQRWFLKFPEYKNRDLFLTGESYAGHYVPQLAQLI  182

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTR  785
             ++   K        LKG+A+GNPLLE      S  E++W +G+IS   Y      C+ ++
Sbjct  183   VQSKVK------FNLKGVAIGNPLLEFNTDFNSRAEYMWSHGLISDITYEAFTVICNYSQ  236

Query  786   MVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKAD  965
             + +EI+ G +S  CS +   +S E+G  +   ++    C     S S+R      T K D
Sbjct  237   VRREIVMGSLSPACSGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSERLNQPRGTEKID  296

Query  966   PCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGI  1136
              C+      YL+R +VQ+ALHA+    S W            NL I  +  + A+LK GI
Sbjct  297   VCVEDETIKYLNRKDVQKALHAHLKGVSRWSICSEVLKYEYRNLEIPTIHVVGAVLKSGI  356

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGE  1316
              +L+YSGD+D  +P++ TR L N LA  L L T      W+ G+Q+GGW+Q +G+     
Sbjct  357   RVLVYSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYGD-----  411

Query  1317  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                 L+FAT+RG SH  P S P ++L LF  FL+G P P
Sbjct  412   ---KLSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLP  447



>ref|XP_004513403.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 181/441 (41%), Positives = 259/441 (59%), Gaps = 23/441 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLP QP +V+F QY+GYI   + + RAL+YYF EA+  D  S P+ LWL GG  CSS 
Sbjct  35    IKSLPEQP-EVEFKQYAGYITVDEVQQRALYYYFVEAEV-DPASKPVVLWLNGGPGCSSI  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F E+GPF+P + G L+KN +SWN  +NMLY+++P GV FSYS   S Y + +D MT
Sbjct  93    GVGAFVEHGPFKPAKKG-LMKNDYSWNKEANMLYLESPAGVGFSYSVNESFYDLVNDEMT  151

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WF +FSEY++ DF++ G+SY GH  PQLA+LI++   K        LKGI
Sbjct  152   ARDNLIFLQHWFTKFSEYKNNDFFLTGESYAGHYVPQLAQLIIQTKTK------FNLKGI  205

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNPL+E      S  E+ W +G+IS   Y +  + C+ +++ ++  SG +S  C+ +N
Sbjct  206   AIGNPLMEFNTDFNSRAEYFWSHGLISDSTYEIFTKSCNYSQIRRQYQSGTLSSICARVN  265

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
              ++S EI   +   ++    C   +   +       E  K D C+      YL+R EVQ+
Sbjct  266   RLVSMEISRYIDLYDVTLDVCLPSEKQQAYVLTQLQEGEKIDVCVEDETYIYLNRKEVQK  325

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA     +TW +        + NL I  +  L +L+K G+ +L+YSGD+D  IP+  T
Sbjct  326   ALHAKLVGITTWLTCSGVLKYNMKNLEIPTISVLGSLVKSGVRVLVYSGDQDSVIPLLGT  385

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L N LA    L T E    W+ G+Q+ GW+Q +G         +L+FAT+RG SH  P
Sbjct  386   RSLVNKLAKEFGLNTTESYRAWFKGRQVAGWTQVYG---------DLSFATIRGASHEAP  436

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L L K FLKG   P
Sbjct  437   FSQPERSLVLLKTFLKGKSLP  457



>ref|XP_007038110.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOY22611.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 257/445 (58%), Gaps = 23/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+   + + + LFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  34    IVRLPGQPR-VGFQQFSGYVTVDEKKHKVLFYYFVEAEI-DPASKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE LV+N +SWN  +NMLY++TPIGV FSYS  SS Y    D  
Sbjct  92    GVGAFSENGPFRP--NGEVLVRNDYSWNREANMLYLETPIGVGFSYSTNSSSYVAVDDET  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++W+ +F  YR  D +I G+SY GH  PQLA+L++E N+K        LKG
Sbjct  150   TARDNLVFLQRWYHKFPNYRQRDLFITGESYAGHYIPQLAKLMVELNKKQ---NLFNLKG  206

Query  663   IALGNPLLEKMGL---SNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             IALGNP+LE   +   S  E+ W +G+IS   Y +    C+ +R V E     +S  CS 
Sbjct  207   IALGNPVLE-FAIDFNSRAEYFWSHGLISDSTYRMFTSVCNYSRYVSEYYRDSVSPSCSR  265

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEV  1013
             +   +S E    + K ++    C +   S S        + + D C+   + +YL+R +V
Sbjct  266   VMSQVSRETSKFVDKYDVTLDVCISSVLSQSMVLNPQQVSERVDVCVEDKIVNYLNRKDV  325

Query  1014  QEALHA---NASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVS  1184
             Q+ALHA       W    +  +  L NL I  +  + +L+K GIP+L+YSGD+D  IP++
Sbjct  326   QKALHALLVGVRRWAVCSNILDYQLLNLEIPTISIVGSLIKAGIPVLVYSGDQDSVIPLT  385

Query  1185  HTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
              +R L   LA  L L T      W++GKQ+GGW+Q +GN         L FAT+RG SH 
Sbjct  386   GSRTLVRGLAKELGLETTVPYRVWFEGKQVGGWTQVYGNI--------LAFATIRGASHE  437

Query  1365  VPNSSPSKALTLFKAFLKGSPPPNT  1439
              P S P ++L LFK+FL+G P P  
Sbjct  438   APFSQPERSLMLFKSFLEGKPLPEV  462



>tpg|DAA38059.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=466

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 268/465 (58%), Gaps = 31/465 (7%)
 Frame = +3

Query  75    LLVNTLYSISIRINGE--IIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSED  248
             LL+   +S+S +   E   I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D
Sbjct  21    LLLGDAWSVSAQAAAEEDKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-D  78

Query  249   KFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGV  428
               + PL LWL GG  CSS  +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV
Sbjct  79    PAAKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGV  137

Query  429   AFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAEL  608
              FSYS   + Y+   D+MTAR+NLKFL+ WF  F +Y+  D YI G+SY GH  PQLA+ 
Sbjct  138   GFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGESYAGHYVPQLAQR  197

Query  609   ILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDST  782
             ++E+N+K    +   LKGIALGNP+LE      S  E  W +G+IS   Y++    C+ +
Sbjct  198   MVEFNKKE---KLFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYS  254

Query  783   RMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA  962
             R V E   G +S  C  +   ++ E    + K ++    C +     SQ+      + + 
Sbjct  255   RYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQQG-----SREL  309

Query  963   DPCLLTWVDDYLSRPEVQEALHA---NASTW---DSIFHGRNMILNNLAIDILPTLSALL  1124
             D C+      YL+R +VQ+A+HA       W    S+   + +   +L I  + T+ AL+
Sbjct  310   DVCVEDETMRYLNRKDVQQAMHARLDGVQRWTVCSSVLEYKQL---DLQIPTVNTVGALV  366

Query  1125  KRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNS  1304
             K GIP L+YSGD+D  IP++ +R L   LA RL L        W+ GKQ+GGW+Q FG  
Sbjct  367   KAGIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG--  424

Query  1305  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             GG      L+FATVRG SH  P S P ++L LF+AFL G   P +
Sbjct  425   GGA-----LSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  464



>ref|XP_008791046.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
 ref|XP_008791047.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
Length=463

 Score =   338 bits (868),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 187/444 (42%), Positives = 257/444 (58%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGYI     + RALFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  34    ITKLPGQP-QVSFQQFSGYITVDDRKQRALFYYFAEAEL-DPSTKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGEL-VKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  G+L V+N++SWN  +NMLY++TP GV FSY+  SS Y+  +D M
Sbjct  92    GVGAFSENGPFRPS--GQLLVRNEYSWNKEANMLYLETPAGVGFSYATDSSYYEGVNDKM  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL +WF +F +Y+D D YI G+SY GH  PQLAEL++ +N+K        LKG
Sbjct  150   TARDNLVFLLRWFTKFPQYKDRDLYITGESYAGHYVPQLAELMVLFNKKN---NVFNLKG  206

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  C+ +
Sbjct  207   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYRIFTSACNYSRYVSEYYRGSLSPVCARV  266

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                ++ E    + K ++    C +   S S+         + D C+     +YL+R +VQ
Sbjct  267   MGQVTRETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVAERIDVCVEDETVNYLNRKDVQ  326

Query  1017  EALHANAS---TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA  +    W          L NL    +  + +L+  GIP+L+YSGD+D  IP++ 
Sbjct  327   DALHARLTGVPKWTVCSSVLEYELLNLENPTISVVGSLVSSGIPVLVYSGDQDSVIPLTG  386

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L   LA  L L T      W++GKQ+GGW+Q +G+         L FAT+RG SH  
Sbjct  387   SRTLVQRLANELKLKTTVPYRVWFEGKQVGGWTQVYGDI--------LAFATIRGASHEA  438

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LF+AFL+  P P T
Sbjct  439   PFSQPERSLVLFRAFLQRRPLPET  462



>ref|XP_010469459.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=466

 Score =   338 bits (868),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 187/464 (40%), Positives = 271/464 (58%), Gaps = 21/464 (5%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             L+ FL   +L S ++    + I  LPGQP  V F QYSGY+   + + RALFYY AEA++
Sbjct  14    LILFLQTLSLVSSTVLSRADRITRLPGQPR-VGFQQYSGYVNIDEKKQRALFYYLAEAET  72

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             +   S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+
Sbjct  73    K-PISKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPV  130

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSY+  SS Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA
Sbjct  131   GVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLA  190

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             +L+++YN+K        LKGIA+GNP++E      S  E+ W +G+IS   Y +    C+
Sbjct  191   QLMIQYNKKH---NLFNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCN  247

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA  956
              +R V E   G +S  C+ +   +S E    + K ++    C     S S+R     +  
Sbjct  248   YSRYVSEYYRGTVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSKRVNPQPQQV  307

Query  957   --KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSAL  1121
                 D C+     +YL+R +VQ+ALHA       W    +  +  + ++ +  +  + +L
Sbjct  308   GEAVDVCVEDETVNYLNRRDVQKALHARLVGTRNWAVCSNVLDYEVLDVEVPTINIVGSL  367

Query  1122  LKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGN  1301
             +K G+P+L+YSGD+D  IP++ +R L   LA  L L T      W+ G+Q+GGW+Q +GN
Sbjct  368   VKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGN  427

Query  1302  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                      L FATVRG +H VP S P++AL LFKAF+ G P P
Sbjct  428   I--------LAFATVRGAAHEVPFSQPARALVLFKAFMGGRPLP  463



>ref|XP_009109757.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
Length=460

 Score =   338 bits (868),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 189/459 (41%), Positives = 270/459 (59%), Gaps = 20/459 (4%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             F L+  L S ++  + ++I  LPGQP  V F QYSGY+   + + RALFYYFAEA++ + 
Sbjct  14    FALIFFLSSSTVLSHSDLITRLPGQPR-VGFQQYSGYVTLDEKKQRALFYYFAEAET-NP  71

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV 
Sbjct  72    TSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYS T   Y+   D +TAR+NL FL +WF++F  Y +   +I G+SY GH  PQLA+L+
Sbjct  131   FSYS-TQRSYESVDDKITARDNLVFLERWFLKFPHYLNRSLFITGESYAGHYVPQLADLM  189

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTR  785
             ++YN+K  H+    L+GIA+GNP+LE      S  E+ W +G+IS   + L    C+ +R
Sbjct  190   IQYNKKH-HL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTFKLFTSYCNYSR  246

Query  786   MVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKAD  965
              V E   G MS  CS +   ++ E    + K ++    C +   S S+           D
Sbjct  247   YVSEYYRGSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSKVVSPNQVGESVD  306

Query  966   PCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGI  1136
              C+     +YL+R +VQEALHA       W    +  +  + ++    +  + +L++ G+
Sbjct  307   VCVEDETVNYLNRRDVQEALHARLVGVREWTVCSNVLDYQMLDVEKPTINIVGSLVEAGV  366

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGE  1316
             P+L+YSGD+D  IP++ +R L + LA RL L T      W+ G+Q+GGW+Q +GN     
Sbjct  367   PVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV----  422

Query  1317  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                 L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  423   ----LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  457



>ref|XP_010653629.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=461

 Score =   338 bits (867),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 187/459 (41%), Positives = 266/459 (58%), Gaps = 24/459 (5%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKF  254
              L+    ++    + + I SLPGQP  V F Q++GYI   + + R LFYYF EA++ D  
Sbjct  15    FLIQICLTVESPPSADKIVSLPGQP-QVGFQQFAGYITVDEKQQRHLFYYFVEAET-DPA  72

Query  255   SMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVA  431
             S PL LWL GG  CSS   G F E+GPF+P+  GE LV N +SWN  +NMLY+++P GV 
Sbjct  73    SKPLVLWLNGGPGCSSIGAGAFCEHGPFKPS--GEILVNNDYSWNKVANMLYLESPAGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYS  +S Y   +D MTAR+NLKFL++WF++F EY++ D ++ G+SY GH  PQLA+LI
Sbjct  131   FSYSANTSFYAFVNDEMTARDNLKFLQRWFLKFPEYKNRDLFLTGESYAGHYVPQLAQLI  190

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTR  785
             ++   K        LKG+A+GNPLLE      S  E++W +G+IS   Y      C+ ++
Sbjct  191   VQSKVK------FNLKGVAIGNPLLEFNTDFNSRAEYMWSHGLISDITYEAFTVICNYSQ  244

Query  786   MVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKAD  965
             + +EI+ G +S  CS +   +S E+G  +   ++    C     S S+R      T K D
Sbjct  245   VRREIVMGSLSPACSGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSERLNQPRGTEKID  304

Query  966   PCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGI  1136
              C+      YL+R +VQ+ALHA+    S W            NL I  +  + A+LK GI
Sbjct  305   VCVEDETIKYLNRKDVQKALHAHLKGVSRWSICSEVLKYEYRNLEIPTIHVVGAVLKSGI  364

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGE  1316
              +L+YSGD+D  +P++ TR L N LA  L L T      W+ G+Q+GGW+Q +G+     
Sbjct  365   RVLVYSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYGD-----  419

Query  1317  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                 L+FAT+RG SH  P S P ++L LF  FL+G P P
Sbjct  420   ---KLSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLP  455



>ref|XP_010549304.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Tarenaya 
hassleriana]
Length=467

 Score =   338 bits (867),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 187/442 (42%), Positives = 259/442 (59%), Gaps = 20/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  37    VAQLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAEA-DPASKPLVLWLNGGPGCSSL  94

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN+ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  95    GVGAFSENGPFRP-KGPILVKNEHSWNKEANMLYLETPVGVGFSYSTDSSSYEGVNDKIT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F +Y +   +I G+SY GH  PQLA+L+++YN+K    +   L+GI
Sbjct  154   ARDNLVFLQRWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKH---KLFNLRGI  210

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  CS + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGTVSAMCSKVM  270

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK-ADPCLLTWVDDYLSRPEVQ  1016
               +S E    + K ++    C     S S+      +  +  D C+      YL+R +VQ
Sbjct  271   SQVSVETSRFVDKYDVTLDVCIPSVLSQSKVVSPQQQVGETVDVCVEDETVSYLNRRDVQ  330

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
              +LHA       W    +  +  L ++ I  +  +  L+K GIP+L+YSGD+D  IP++ 
Sbjct  331   RSLHARLVGVRKWAVCSNVLDYELLDVEIPTITVVGNLVKAGIPVLVYSGDQDSVIPLTG  390

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L N LA  L L T      W+ G+Q+GGW+Q +GN         L+FATVRG SH V
Sbjct  391   SRTLVNRLAEELRLRTTVPYRVWFAGQQVGGWTQVYGNI--------LSFATVRGASHEV  442

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LFKAF+ G P P
Sbjct  443   PFSQPQRSLVLFKAFINGHPLP  464



>emb|CDX90124.1| BnaA08g18600D [Brassica napus]
Length=460

 Score =   338 bits (866),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 188/459 (41%), Positives = 270/459 (59%), Gaps = 20/459 (4%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             F L+  L S ++  + +++  LPGQP  V F QYSGY+   + + RALFYYFAEA++ + 
Sbjct  14    FALIFFLSSSTVLSHSDLVTRLPGQPR-VGFQQYSGYVTLDEKKQRALFYYFAEAET-NP  71

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV 
Sbjct  72    TSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYS T   Y+   D +TAR+NL FL +WF++F  Y +   +I G+SY GH  PQLA+L+
Sbjct  131   FSYS-TQRSYESVDDKITARDNLVFLERWFLKFPHYLNRSLFITGESYAGHYVPQLADLM  189

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTR  785
             ++YN+K  H+    L+GIA+GNP+LE      S  E+ W +G+IS   + L    C+ +R
Sbjct  190   IQYNKKH-HL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTFKLFTSYCNYSR  246

Query  786   MVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKAD  965
              V E   G MS  CS +   ++ E    + K ++    C +   S S+           D
Sbjct  247   YVSEYYRGSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSKVVSPNQVGESVD  306

Query  966   PCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGI  1136
              C+     +YL+R +VQEALHA       W    +  +  + ++    +  + +L++ G+
Sbjct  307   VCVEDETVNYLNRRDVQEALHARLVGVREWTVCSNVLDYQMLDVEKPTINIVGSLVEAGV  366

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGE  1316
             P+L+YSGD+D  IP++ +R L + LA RL L T      W+ G+Q+GGW+Q +GN     
Sbjct  367   PVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV----  422

Query  1317  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                 L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  423   ----LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  457



>ref|XP_004975453.1| PREDICTED: serine carboxypeptidase-like 45-like [Setaria italica]
Length=522

 Score =   340 bits (872),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 187/447 (42%), Positives = 263/447 (59%), Gaps = 25/447 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QY+GY+       R+LFYYFAEA++ D  + PL LWL GG  CSS 
Sbjct  90    IGGLPGQP-PVGFAQYAGYVPVDDAGKRSLFYYFAEAEA-DPAAKPLVLWLNGGPGCSSV  147

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +NMLY+++P GV FSYS   S Y+   D+MT
Sbjct  148   GVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYQGVGDSMT  206

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NLKFL+ WF +F +Y+  D YI G+SY GH  PQLA+ ++E+N+K    +   LKGI
Sbjct  207   ARDNLKFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  263

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E   G +S  C  + 
Sbjct  264   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYSRYVSEYYHGSLSASCDRVM  323

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +     SQ       + + D C+      YL+R +VQ+
Sbjct  324   SQVTRETSRFVDKYDVTLDVCISSVLMQSQILSPQQGSRELDVCVEDETMSYLNRKDVQQ  383

Query  1020  ALHANAS-------TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIP  1178
             A+HA  S          S+   + +   +L I  + T+ AL+K GIP+L+YSGD+D  IP
Sbjct  384   AMHARLSGGVQRWTVCSSVLEYKQL---DLQIPTINTVGALVKSGIPVLVYSGDQDSVIP  440

Query  1179  VSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGS  1358
             ++ +R L + LA+RL L        W+ GKQ+GGW++ FG  GG      L+FATVRG S
Sbjct  441   LTGSRTLVSRLASRLRLNATAPYRAWFQGKQVGGWTRVFG--GGA-----LSFATVRGAS  493

Query  1359  HFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             H  P S P ++L LF+AFL G P P +
Sbjct  494   HEAPFSQPERSLGLFRAFLAGRPLPES  520



>ref|XP_010499305.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
 ref|XP_010499306.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=489

 Score =   339 bits (869),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 186/441 (42%), Positives = 261/441 (59%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             + SLPGQP  V F QYSGY+     + RA+FYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  60    VTSLPGQP-QVGFQQYSGYVTVDDKKQRAMFYYFAEAET-DPTSKPLVLWLNGGPGCSSL  117

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN  SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  118   GVGAFSENGPFRP-KGPILVKNLHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDKIT  176

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLA+L+++YN+K  H+    L+GI
Sbjct  177   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMMQYNKKH-HL--FNLRGI  233

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G MS  CS + 
Sbjct  234   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSICSKVM  293

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C     S S+           D C+     +YL+R +VQ 
Sbjct  294   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQG  353

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W    +  +  L ++    +  + +L++ G+P+L+YSGD+D  IP++ +
Sbjct  354   ALHARLVGVREWTVCSNVLDYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQDSVIPLTGS  413

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L+T      W+ G+Q+GGW+Q +GN         L+FATVRG SH VP
Sbjct  414   RTLVSRLAKQLGLSTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASHEVP  465

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAFL G P P
Sbjct  466   FSQPERSLVLFKAFLGGHPLP  486



>ref|XP_002280796.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinifera]
 emb|CBI15743.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 186/442 (42%), Positives = 261/442 (59%), Gaps = 22/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+     + RALFYYF EA+S D  S PL LWL GG  CSS 
Sbjct  34    IIQLPGQP-QVGFQQFSGYVSLDDKKQRALFYYFVEAES-DPASKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE L++N++SWN  +NMLY++TP+GV FSYS + + Y    D +
Sbjct  92    GVGAFSENGPFRP--NGEFLLRNEYSWNREANMLYLETPVGVGFSYS-SDTPYVTVDDKI  148

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF++F +Y+  D +I G+SY GH  PQLAEL++ +N+K    +   LKG
Sbjct  149   TARDNLAFLQRWFLKFPQYKHRDLFITGESYAGHYVPQLAELMIRFNKKE---KLFNLKG  205

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E+ W +G+IS   Y L    C+ +R V E     +S  CS +
Sbjct  206   IALGNPVLEFATDLNSRAEYFWSHGLISDSTYRLFTSACNYSRYVSEYYRDSVSSVCSRV  265

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S E    + K ++    C +   S S+           D C+     +YL+R +VQ
Sbjct  266   MAQVSRETSKFVDKYDVTLDVCLSSVLSQSKVISPQQVAETIDVCIDDKTVNYLNRKDVQ  325

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA      +W       +  L NL I  +  + +L+K GIP+L+YSGD+D  IP++ 
Sbjct  326   KALHARLVGIRSWTVCSDILDYELLNLEIPTISIVGSLIKAGIPVLVYSGDQDSVIPLTG  385

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA  L L T      W++GKQ+GGW++ +GN         L+FAT+RG SH  
Sbjct  386   SRTLVHNLAKELGLNTTVPYRVWFEGKQVGGWTRVYGNI--------LSFATIRGASHEA  437

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LFK+FL+  P P
Sbjct  438   PFSQPERSLVLFKSFLEARPLP  459



>gb|KHN08897.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=451

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 186/465 (40%), Positives = 265/465 (57%), Gaps = 22/465 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  +  +L  TL  ++     + I +LPGQP  V F QYSGY        RALFYYF E
Sbjct  1     MIATIIIVLAQTLVGVNSLPEADKISNLPGQP-HVKFQQYSGYFSVDNQNQRALFYYFVE  59

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+     S P+ LWL GG  CSS  +G   E+GPF+P +   LVKN FSWN  +N+LY++
Sbjct  60    AEKHPT-SKPVVLWLNGGPGCSSIGVGALVEHGPFKP-DSNVLVKNHFSWNKVANVLYLE  117

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+ +S Y + +D +TAR+NL FL++WF EF EY + DF+I G+SY GH AP
Sbjct  118   SPAGVGFSYSSNASFYTLVTDEITARDNLVFLQRWFTEFPEYSNNDFFITGESYAGHYAP  177

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGL-SNVEHLWHYGIISTELYHLQKR  767
             QLA+LI++            LKGIA+GNPL+E    L S  E LW +G+IS   Y L  R
Sbjct  178   QLAQLIVQTKTN------FNLKGIAIGNPLMEFDTDLNSKAEFLWSHGLISDSTYDLFTR  231

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT  947
              C+ + + ++ + G +S+ C+ IN ++  E+ + + + ++    C +     S       
Sbjct  232   VCNYSTIRRQTIHGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSSANQQSYELNQMQ  291

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
             ET K D C+      YL+R +VQ+ALHA     S W +     +    NL I  +  L A
Sbjct  292   ETQKIDVCVDDKAVTYLNRKDVQKALHAKLVGVSKWSTCSRVLHYDRRNLEIPTISILGA  351

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+   I +L+YSGD+D  IP+  +R L N LA  L L T      W++GKQ+ GW+Q +G
Sbjct  352   LVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFEGKQVAGWTQVYG  411

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                       L++AT+RG SH  P + P ++L L KAFL+G P P
Sbjct  412   --------GMLSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLP  448



>emb|CDY61693.1| BnaC05g51120D [Brassica napus]
Length=456

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 191/466 (41%), Positives = 270/466 (58%), Gaps = 22/466 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             +  F + F +V  L   S+  + + I  LPGQP  V F QYSGY+   + + RALFYY A
Sbjct  5     LQCFTISFAIVLFLSFSSVLSHSDRITRLPGQPR-VGFQQYSGYVTVDENKQRALFYYLA  63

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA++ D  + PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY+
Sbjct  64    EAET-DPINKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYL  121

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             +TP+GV FSYS   + Y+  +D +TAR+NL FL++WF++F  Y +   +I G+SY GH  
Sbjct  122   ETPVGVGFSYS---TQYESVNDEITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYV  178

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQK  764
             PQLAEL+++YN+K  H+    L+GIA+GNP+LE      S  E+ W +G+IS   Y +  
Sbjct  179   PQLAELMIQYNQKH-HL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTYKMFT  235

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG  944
               C+ +R V E   G MS  C+ +   +S E    + K ++    C     S S+     
Sbjct  236   SYCNYSRYVSEYYRGSMSSICAKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPN  295

Query  945   TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLS  1115
                   D C+      YL+R +VQEALHA       W    +  +  L ++ I  +  + 
Sbjct  296   QVGESVDVCVEDETVKYLNRRDVQEALHARLVGVREWTVCSNVLDYQLLDVEIPTINIVG  355

Query  1116  ALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTF  1295
             +L++ G+P+L+YSGD+D  IP++ +R L + LA RL L T      W+ G+Q+GGW+Q +
Sbjct  356   SLVQAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVY  415

Query  1296  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             GN         L+FATVRG SH VP S P ++L LFKAFL   P P
Sbjct  416   GNV--------LSFATVRGASHEVPFSQPQRSLVLFKAFLDSHPLP  453



>ref|XP_003520486.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 185/469 (39%), Positives = 269/469 (57%), Gaps = 25/469 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  L  +L  TL  ++     + I +LPGQP  V F QYSGYI       RALFYYF E
Sbjct  10    MIVTLIIVLAQTLVVVNSLPEADKITNLPGQP-HVKFQQYSGYITVDDQNQRALFYYFVE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+     S P+ LWL GG  CSS  +G   E+GPF+P ++  LVKN +SWN  +N+LY++
Sbjct  69    AEKHPT-SKPVVLWLNGGPGCSSIGVGALVEHGPFKPGDNNVLVKNHYSWNKVANVLYLE  127

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+ +S Y + +D +TAR+NL FL++WF EF EY   DF+I G+SY GH AP
Sbjct  128   SPAGVGFSYSSNTSFYTLVTDEITARDNLIFLQRWFTEFPEYSKNDFFITGESYAGHYAP  187

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGL-SNVEHLWHYGIISTELYHLQKR  767
             QLA+LI++            LKG+A+GNPL+E    L S  E  W +G+IS   Y L  R
Sbjct  188   QLAQLIVQTKTN------FNLKGVAIGNPLMEFDTDLNSKAEFFWSHGLISDSTYDLFTR  241

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG-  944
              C+ + + ++ + G +S+ C+ IN ++  E+ + + + ++    C +   ++ Q + L  
Sbjct  242   VCNYSTIRRQTIQGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSS--ANQQAYVLNQ  299

Query  945   -TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
               ET K D C+      YL+R +VQ+ALHA     S W +     +    NL I  +  L
Sbjct  300   MQETQKIDVCVDDKAVTYLNRKDVQKALHAKLVEVSKWSACSRVLHYDRRNLEIPTVSIL  359

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+   I +L+YSGD+D  IP+  +R L N LA  L L T      W++ KQ+ GW+Q 
Sbjct  360   GSLVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFERKQVAGWTQV  419

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             +G          L++AT+RG SH  P + P ++L L KAFL+G P PN 
Sbjct  420   YGEL--------LSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLPNV  460



>ref|XP_009380118.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=467

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 190/444 (43%), Positives = 262/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  34    IVKLPGQP-QVSFQQFSGYVTVDERKHRALFYYFAEAEM-DPSSKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N++SWN  +NMLY++TP GV FS+S+ SSDY+  +D +
Sbjct  92    GVGAFSENGPFRP--KGEVLVRNEYSWNKEANMLYLETPAGVGFSFSSDSSDYEGVNDRI  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF +F  Y+  D YI G+SY GH  PQLA+L++++N+K    +   LKG
Sbjct  150   TARDNLVFLQRWFTKFPRYKGRDLYITGESYAGHYVPQLAQLMVDFNKKE---KVFNLKG  206

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  C  +
Sbjct  207   IALGNPVLEFSTDFNSRAEFFWSHGLISDTTYRIFTSACNYSRYVSEYYRGSLSSICQRV  266

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                ++ E    + K ++    C +   S S        T + D C+      YL+R +VQ
Sbjct  267   MSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQQVTERVDVCVEDETVSYLNRKDVQ  326

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
              ALHAN    + W          L NL +  +  + +L+K GIP+L+YSGD+D  IP++ 
Sbjct  327   AALHANLVGVTKWTVCSSVIEYELLNLEVPTISIVGSLVKSGIPVLVYSGDQDSVIPLTG  386

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L   LA  L L T      W++G+Q+GGW+Q +G+         L+FATVRG SH  
Sbjct  387   SRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYGDV--------LSFATVRGASHEA  438

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LF+AFL+G P P T
Sbjct  439   PFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_002277400.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=455

 Score =   337 bits (863),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 180/441 (41%), Positives = 260/441 (59%), Gaps = 27/441 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  35    ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTTLKPLVVWFSGGPGCSSV  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  94    GGGAFAQHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  152

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA+LILE   K        LKGI
Sbjct  153   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESRVK------FNLKGI  206

Query  666   ALGNPLLE-KMGLSNVEHL-WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
              +G+PL++     ++V H  W +G+IS   Y+L   +C+ +RM +E  SG +S  C  + 
Sbjct  207   LMGDPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  266

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
                S+E+GD + + ++   SC        Q       T   D C+   V+ YL+R +VQ+
Sbjct  267   SQYSQEVGDSVDRFDVTLNSCLPSVDPQPQ------VTENVDVCIGDEVNKYLNREDVQK  320

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             +LHA     + W          + +  I ++P + +L+K GI   +YSGD+D  IP+  T
Sbjct  321   SLHARLVGVANWSMCSGALRYNIKDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFGT  380

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA  L L T      W++G+Q+GGW+Q +G+         L+FATVRGGSH VP
Sbjct  381   RTLVDGLAKELRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTVP  432

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              + P++AL LF AFLKG PPP
Sbjct  433   GTQPARALVLFTAFLKGQPPP  453



>ref|NP_001150027.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG37565.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=471

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 187/446 (42%), Positives = 259/446 (58%), Gaps = 24/446 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D  + PL LWL GG  CSS 
Sbjct  40    ISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-DPAAKPLVLWLNGGPGCSSV  97

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV FSYS   + Y+   D+MT
Sbjct  98    GVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGVGFSYSTDPAFYEGVGDSMT  156

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NLKFL+ WF  F +Y+  D YI G+SY GH  PQLA+ ++E+N+K    +   LKGI
Sbjct  157   ARDNLKFLQGWFARFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  213

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E   G +S  C  + 
Sbjct  214   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYSRYVSEYYRGSLSTACDRVM  273

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +     SQ       + + D C+      YL+R +VQ+
Sbjct  274   SQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSRELDVCVEDETMRYLNRKDVQQ  333

Query  1020  ALHAN---ASTW---DSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             A+HA       W    S+   + +   +L I  + T+ AL+K GIP L+YSGD+D  IP+
Sbjct  334   AMHARLDGVQRWTVCSSVLEYKQL---DLQIPTVNTVGALVKAGIPALVYSGDQDSVIPL  390

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + +R L   LA RL L +      W+ GKQ+GGW+Q FG  GG      L+FATVRG SH
Sbjct  391   TGSRTLVGRLAARLRLNSTAPYRAWFQGKQVGGWTQVFG--GGA-----LSFATVRGASH  443

Query  1362  FVPNSSPSKALTLFKAFLKGSPPPNT  1439
               P S P ++L LF+AFL G   P +
Sbjct  444   EAPFSQPERSLGLFRAFLAGQQLPES  469



>ref|XP_006410496.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
 gb|ESQ51949.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
Length=462

 Score =   337 bits (863),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 186/465 (40%), Positives = 268/465 (58%), Gaps = 19/465 (4%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M   L+ L   +  S +++   + I  LPGQP  V F QYSGY+   + + RALFYY AE
Sbjct  9     MATALFLLQALSSVSSTVQSRADQITRLPGQPR-VGFQQYSGYVSIDEKKQRALFYYLAE  67

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A++E   S  L LWL GG  CSS  +G F ENGPFRP +  +LV+NQ SWNL +NMLY++
Sbjct  68    AETE-PISKSLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSDLVRNQHSWNLEANMLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP+GV FSY+  SS Y+  +D +TA++NL FL+KWF+ F +Y +   ++ G+SY GH  P
Sbjct  126   TPVGVGFSYATESSLYEGVNDKITAKDNLVFLQKWFLRFPQYLNRSLFLTGESYAGHYVP  185

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKR  767
             QLAEL+++YN+K        LKGIA+GNP++E      S  E+ W +G+IS   Y +   
Sbjct  186   QLAELMIQYNKKH---NLFNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDSTYKMFTS  242

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT  947
              C+ +R V E   G++S  CS +   +S E    + K ++    C     S S+      
Sbjct  243   YCNYSRYVSEYYRGQVSSMCSKVMTQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVNPQQ  302

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
                  D C+     +YL+R +VQ+ALHA       W    +  +  L ++ +  +  + +
Sbjct  303   VGETVDVCVEDETVNYLNRRDVQKALHARLVGTRKWAVCSNVLDYELLDVEVPTVNIVGS  362

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+K G+P+L+YSGD+D  IP++ +R L   LA  L L T      W+ G+Q+GGW+Q +G
Sbjct  363   LVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYG  422

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                       L FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  423   EI--------LAFATVRGAAHEVPFSQPERSLVLFKAFLGGRPLP  459



>emb|CBI32795.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   336 bits (862),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 180/441 (41%), Positives = 260/441 (59%), Gaps = 27/441 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  29    ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTTLKPLVVWFSGGPGCSSV  87

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  88    GGGAFAQHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  146

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA+LILE   K        LKGI
Sbjct  147   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESRVK------FNLKGI  200

Query  666   ALGNPLLE-KMGLSNVEHL-WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
              +G+PL++     ++V H  W +G+IS   Y+L   +C+ +RM +E  SG +S  C  + 
Sbjct  201   LMGDPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  260

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
                S+E+GD + + ++   SC        Q       T   D C+   V+ YL+R +VQ+
Sbjct  261   SQYSQEVGDSVDRFDVTLNSCLPSVDPQPQ------VTENVDVCIGDEVNKYLNREDVQK  314

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             +LHA     + W          + +  I ++P + +L+K GI   +YSGD+D  IP+  T
Sbjct  315   SLHARLVGVANWSMCSGALRYNIKDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFGT  374

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA  L L T      W++G+Q+GGW+Q +G+         L+FATVRGGSH VP
Sbjct  375   RTLVDGLAKELRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTVP  426

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              + P++AL LF AFLKG PPP
Sbjct  427   GTQPARALVLFTAFLKGQPPP  447



>gb|EYU28449.1| hypothetical protein MIMGU_mgv1a004999mg [Erythranthe guttata]
Length=501

 Score =   337 bits (865),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 184/442 (42%), Positives = 260/442 (59%), Gaps = 18/442 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+       RALFYYF EA++ D  S PL LWL GG  CSS 
Sbjct  71    ITELPGQPR-VSFQQFSGYVFVDHNNERALFYYFVEAET-DPASKPLVLWLNGGPGCSSL  128

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV N+FSWN  +N+LY+++PIGV FSYS  SS Y   +D +T
Sbjct  129   GVGAFSENGPFRPSGNA-LVTNEFSWNKEANVLYLESPIGVGFSYSANSSSYDGVNDKIT  187

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A +NL FL+ WF++F +Y+D   +I G+SY GH  PQL ELIL++N+K    +   LKGI
Sbjct  188   AEDNLVFLQNWFLKFPQYKDRSLFITGESYAGHYIPQLTELILQFNKKE---KIFNLKGI  244

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E LW +G+IS   + +    C+ +R V E     +S  CS + 
Sbjct  245   ALGNPVLEFATDFNSRAEFLWSHGLISDTTFKVFTSACNYSRYVSEYYRASLSPICSKVM  304

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
              +++ E    + K ++    C +   S S+       T K D C+     +YL+R +VQ 
Sbjct  305   SLVTIETSKFVDKYDVTLDVCISSVLSQSKALVPQQMTDKVDVCVEDETVNYLNRRDVQR  364

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA     + W    +  +  L +L I  +  +  +++ GIP+L+YSGD+D  IP++ +
Sbjct  365   ALHARLLGVNRWLVCSNILDYELLDLEIPTINIVGRIVEAGIPVLVYSGDQDSVIPLTGS  424

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R+L + LA  L L T      W+ G Q+GGW+Q +GN+        L+FAT+RG SH  P
Sbjct  425   RKLVHRLARELRLRTSTPYRVWFAGMQVGGWTQVYGNN-------KLSFATIRGASHEAP  477

Query  1371  NSSPSKALTLFKAFLKGSPPPN  1436
              S P ++L LF+AFL+G P P 
Sbjct  478   FSQPERSLVLFRAFLQGKPLPQ  499



>ref|XP_003554111.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=460

 Score =   336 bits (862),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 185/465 (40%), Positives = 265/465 (57%), Gaps = 22/465 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  +  +L  TL  ++     + I +LPGQP  V F QYSGY        RALFYYF E
Sbjct  10    MIATIIIVLAQTLVGVNSLPEADKISNLPGQP-HVKFQQYSGYFSVDNQNQRALFYYFVE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+     S P+ LWL GG  CSS  +G   E+GPF+P +   LVKN FSWN  +N+LY++
Sbjct  69    AEKHPT-SKPVVLWLNGGPGCSSIGVGALVEHGPFKP-DSNVLVKNHFSWNKVANVLYLE  126

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+ +S Y + +D +TAR+NL FL++WF EF EY + DF+I G+SY GH AP
Sbjct  127   SPAGVGFSYSSNASFYTLVTDEITARDNLVFLQRWFTEFPEYSNNDFFITGESYAGHYAP  186

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGL-SNVEHLWHYGIISTELYHLQKR  767
             QLA+LI++            LKGIA+GNPL+E    L S  E LW +G+IS   Y L  R
Sbjct  187   QLAQLIVQTKTN------FNLKGIAIGNPLMEFDTDLNSKAEFLWSHGLISDSTYDLFTR  240

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT  947
              C+ + + ++ + G +S+ C+ IN ++  E+ + + + ++    C +     +       
Sbjct  241   VCNYSTIRRQTIHGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSSANQQAYELNQMQ  300

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
             ET K D C+      YL+R +VQ+ALHA     S W +     +    NL I  +  L A
Sbjct  301   ETQKIDVCVDDKAVTYLNRKDVQKALHAKLVGVSKWSTCSRVLHYDRRNLEIPTISILGA  360

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+   I +L+YSGD+D  IP+  +R L N LA  L L T      W++GKQ+ GW+Q +G
Sbjct  361   LVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFEGKQVAGWTQVYG  420

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                       L++AT+RG SH  P + P ++L L KAFL+G P P
Sbjct  421   --------GMLSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLP  457



>gb|KEH33274.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=457

 Score =   336 bits (861),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 182/462 (39%), Positives = 269/462 (58%), Gaps = 26/462 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRING----EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             ++   ++ +++ +N     + I SLP QP  V F QY+GYI   + + RALFYYF EA+ 
Sbjct  10    VIATIIFFVTVGVNSISEVDKISSLPQQP-KVGFQQYAGYITVDEVQKRALFYYFVEAEV  68

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             E   S P+ LWL GG  CSS   G F E+GPF+PT++G L+KN +SWN  +NMLY+++P 
Sbjct  69    EPA-SKPVVLWLNGGPGCSSVGAGAFVEHGPFKPTKNG-LIKNDYSWNKEANMLYLESPA  126

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS   S Y   +D +TAR+NL FL+ WF +FSEY++ +F+I G+SY GH  PQLA
Sbjct  127   GVGFSYSTNESFYDSVNDYLTARDNLIFLQHWFTKFSEYKNNEFFITGESYAGHYVPQLA  186

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             +LI++   K        LKGIA+GNPLLE      S  E+LW +G+IS   Y    + C+
Sbjct  187   QLIVQTKSK------FNLKGIAIGNPLLEFNTDFNSRAEYLWSHGLISDSTYDSFTKICN  240

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA  956
              +++ ++  +G ++  C+ +N ++S E+   +   ++    C +     +       E  
Sbjct  241   FSQIRRQYANGALTTVCARVNRLVSMEVSRYIDSYDVTLDVCLSTVEQQTYVLTQLQEGE  300

Query  957   KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLK  1127
             K D C+      YL+R EVQEALHA     +TW +        + NL I  +  L  L+K
Sbjct  301   KIDVCVEDETFTYLNRKEVQEALHAKLVGITTWTTCSGVLKYNMQNLEIPTINILGTLVK  360

Query  1128  RGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSG  1307
              G+ +L+YSGD+D  +P+  TR L N LA  + L T E    W++G+Q+ GW+Q +G+  
Sbjct  361   SGVRVLVYSGDQDSVLPLIGTRSLVNGLAKDIGLNTTESYRTWFNGRQVAGWTQVYGDM-  419

Query  1308  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                    L+FAT+RG SH  P S P ++L L KAFL+G   P
Sbjct  420   -------LSFATIRGASHEAPFSQPGRSLVLLKAFLEGKSLP  454



>ref|XP_004298533.1| PREDICTED: serine carboxypeptidase-like 45-like [Fragaria vesca 
subsp. vesca]
Length=466

 Score =   336 bits (861),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 190/466 (41%), Positives = 273/466 (59%), Gaps = 24/466 (5%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVT--HKFRGRALFYYFAEAQ  239
             L F+ +  + S S   + +I+  LPGQP +V F  +SGYI    H+   +ALFYYF EA+
Sbjct  16    LCFIAMEVVESSSHHHDHKIV-RLPGQP-NVGFQHFSGYISVGDHQKNHKALFYYFVEAE  73

Query  240   SEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDT  416
               +  S PL LWL GG  CSS  +G F ENGPFRP  DG+ LV+N++SWN  +NMLY++T
Sbjct  74    I-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGQVLVRNEYSWNREANMLYLET  130

Query  417   PIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQ  596
             PIGV FS S  SS+Y    D  TAR+NL FL++WF +F +Y+  D ++ G+SY GH  PQ
Sbjct  131   PIGVGFSNSRHSSNYVAVDDKATARDNLVFLQRWFNKFPQYKHRDLFLTGESYAGHYIPQ  190

Query  597   LAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQ  770
             LA+L++E NRK    +   LKG+ALGNP+LE      S  E+ W +G+IS   Y +    
Sbjct  191   LAKLMVEANRKE---KLFNLKGLALGNPVLEYATDFNSRAEYFWSHGLISDSTYRMFTSV  247

Query  771   CDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTE  950
             C+ +R V E     +S  CS +  ++S E    + K ++    C +   S S+       
Sbjct  248   CNYSRYVSEYYRDSVSPVCSRVMSLVSRETSKFVDKYDVTLDVCISSVLSQSKAISPNQM  307

Query  951   TAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSAL  1121
             T + D C+   + +YL+R +VQ ALHA       WD   +  +  + +L I  +  + ++
Sbjct  308   TERIDVCVEDKIVNYLNRKDVQNALHAKLVGVRRWDVCSNILDYQMLDLEIPTISLVGSI  367

Query  1122  LKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGN  1301
             +K GIP+L+YSGD+D  IP++ +R L + LA  L L T      W+ GKQ+GGW+Q +GN
Sbjct  368   VKAGIPVLVYSGDQDSVIPLTGSRTLVDRLARELGLNTTVPYRVWFQGKQVGGWTQVYGN  427

Query  1302  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
                      L+FAT+RG SH  P S P ++L LFK+FL+G P P  
Sbjct  428   I--------LSFATIRGASHEAPFSQPERSLVLFKSFLQGRPLPQV  465



>gb|KDP37688.1| hypothetical protein JCGZ_06345 [Jatropha curcas]
Length=468

 Score =   336 bits (861),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 185/458 (40%), Positives = 271/458 (59%), Gaps = 40/458 (9%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GY+  ++ + RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  25    ILSLPGQPK-VSFKQYAGYVTINERQQRALFYYFVEAE-RDTASKPLVLWLNGGPGCSSL  82

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+  G LV+N++SWN  +N++Y+++P+GV FSYS  +S Y   +DT+T
Sbjct  83    GAGAFSEHGPFRPSGKGNLVRNEYSWNKEANIIYLESPVGVGFSYSANASFYDSVNDTIT  142

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A++N  F++KWFI+F EYR+ D +IAG+SY GH  PQLAEL+++   +        LKGI
Sbjct  143   AQDNFIFMQKWFIKFPEYRNRDLFIAGESYAGHYVPQLAELVVQSGLQ------FNLKGI  196

Query  666   ALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQCDSTRMVQE-ILSGEMSEDCSDI  836
             ALGNPLL+    SN   ++ W +G+IS   + L    C+++++++E I+ G +S  C  +
Sbjct  197   ALGNPLLDFSRDSNSRGDYYWSHGLISDSTHQLLNSICNASQLLREGIIIGSLSPACKTV  256

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRH----------CLGTET----AKA----  962
              V +S+EI D ++  ++    C + + S  + H           L T+      KA    
Sbjct  257   TVQLSKEISDSINGYDVTADVCISYENSKLKLHNDLLRPEFLVSLSTQLPNHPTKAPENI  316

Query  963   DPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRG  1133
             D C+     +YL++ +VQEALHA     + W          + NL I ++  + +L+  G
Sbjct  317   DLCVEEKALEYLNKKDVQEALHAKLVGVTNWTFCSPVLQYDIENLEISMIDVVGSLVTSG  376

Query  1134  IPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGG  1313
             I +++YSGD+D  +P + TR L N LA +L L T      W + KQ+GGW+Q +G     
Sbjct  377   IQVMVYSGDQDSVVPFTGTRTLVNDLAKKLRLNTTTTYRAWLEDKQVGGWTQVYGEI---  433

Query  1314  EKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSP  1427
                  L FAT+RGGSH  P SSP ++L LFK F+ G P
Sbjct  434   -----LRFATIRGGSHMTPLSSPKRSLALFKTFVTGDP  466



>ref|XP_009380117.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   337 bits (863),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 190/444 (43%), Positives = 262/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  56    IVKLPGQP-QVSFQQFSGYVTVDERKHRALFYYFAEAEM-DPSSKPLVLWLNGGPGCSSV  113

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N++SWN  +NMLY++TP GV FS+S+ SSDY+  +D +
Sbjct  114   GVGAFSENGPFRP--KGEVLVRNEYSWNKEANMLYLETPAGVGFSFSSDSSDYEGVNDRI  171

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF +F  Y+  D YI G+SY GH  PQLA+L++++N+K    +   LKG
Sbjct  172   TARDNLVFLQRWFTKFPRYKGRDLYITGESYAGHYVPQLAQLMVDFNKKE---KVFNLKG  228

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  C  +
Sbjct  229   IALGNPVLEFSTDFNSRAEFFWSHGLISDTTYRIFTSACNYSRYVSEYYRGSLSSICQRV  288

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                ++ E    + K ++    C +   S S        T + D C+      YL+R +VQ
Sbjct  289   MSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQQVTERVDVCVEDETVSYLNRKDVQ  348

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
              ALHAN    + W          L NL +  +  + +L+K GIP+L+YSGD+D  IP++ 
Sbjct  349   AALHANLVGVTKWTVCSSVIEYELLNLEVPTISIVGSLVKSGIPVLVYSGDQDSVIPLTG  408

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L   LA  L L T      W++G+Q+GGW+Q +G+         L+FATVRG SH  
Sbjct  409   SRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYGDV--------LSFATVRGASHEA  460

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LF+AFL+G P P T
Sbjct  461   PFSQPERSLVLFRAFLQGRPLPET  484



>ref|XP_007162065.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
 gb|ESW34059.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
Length=459

 Score =   335 bits (860),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 186/469 (40%), Positives = 270/469 (58%), Gaps = 25/469 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  +  +L  TL  +S     + I +LPGQP  V F QYSG+I       RALFYYF E
Sbjct  8     MIATIIIVLAQTLVGVSSLPESDQISNLPGQP-QVKFQQYSGHITVDDQHQRALFYYFVE  66

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+ ED  S PL LWL GG  CSS  +G F E+GPFRP+++  L KN +SWN  +N+LY++
Sbjct  67    AE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEKNDYSWNKEANVLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+  S Y + +D +TAR+NL FL++WF +F EY + DF+I G+SYGGH  P
Sbjct  126   SPAGVGFSYSSNKSFYILVTDEITARDNLVFLQRWFTKFPEYSNNDFFITGESYGGHYVP  185

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKR  767
             QLA+LI++            LKGIA+GNPLLE     N   E+ W +G+IS   + +  R
Sbjct  186   QLAQLIVQTKTH------FNLKGIAIGNPLLEFNTDFNARSEYFWSHGLISDSTFEILTR  239

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG-  944
              C+ + + ++  +G +   C   +  +  E+ D + + ++    C +    + Q + L  
Sbjct  240   VCNYSSIRRQRQNGNLGGVCEKASKQLYAEVSDYVDEYDVTLDVCLSS--VNQQAYVLHQ  297

Query  945   -TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
               ET K D C+      YL+R EVQEALHA     + W +     +   +NL I  +P L
Sbjct  298   LQETQKIDVCVGDKTITYLNRKEVQEALHAKLVGVTKWSTCSSVLHYDYSNLEIPTIPIL  357

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+K GI +L+YSGD+D  IP+  +R L N LA  + L T      W++ KQ+ GW+QT
Sbjct  358   GSLVKSGIRVLVYSGDQDSVIPLISSRYLVNGLAKEIGLETTVAYRAWFEEKQVAGWTQT  417

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             +G+         L++AT+RG SH  P + P ++L L KAFL G   P+ 
Sbjct  418   YGDM--------LSYATIRGASHEAPFTQPQRSLVLLKAFLDGKQLPSV  458



>gb|EAY93940.1| hypothetical protein OsI_15713 [Oryza sativa Indica Group]
Length=470

 Score =   335 bits (860),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 186/445 (42%), Positives = 263/445 (59%), Gaps = 20/445 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP +V F QYSGY+     R R LFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  37    IVALPGQP-NVSFAQYSGYVTVDAARRRELFYYFAEAEL-DPATKPLVLWLNGGPGCSSV  94

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +NMLY+++P GV FSYS   S Y    D+ T
Sbjct  95    GVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYGGVGDSRT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL+FL+ WF +F +Y+  D YI G+SY GH  PQLA+ ++E+N+K    +   LKGI
Sbjct  154   ARDNLRFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  210

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   YH     C+ +R V E   G +S  C  + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDSTYHSFTTVCNYSRYVSEYYHGSLSSACDTVM  270

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +     S+       + + D C+      YL+R +VQE
Sbjct  271   TQVARETSRFVDKYDVTLDVCVSSVLMQSKSLAPQRGSRELDVCVEDETMGYLNRKDVQE  330

Query  1020  ALHANASTWDSIFHGRNMILNNLAIDI-LPTLS---ALLKRGIPLLIYSGDEDLRIPVSH  1187
             A+HA        +   + +L    +D+ +PT++    L+K G+P+L+YSGD+D  IP++ 
Sbjct  331   AMHARLEGGVPKWTVCSSVLEYKQLDLQIPTINIVGGLVKSGVPVLVYSGDQDSVIPLTG  390

Query  1188  TRELANVLATRLNL-TTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
             +R +   LA RL L TT      W++G+Q+GGW+Q+FG  GG      L+FATVRG SH 
Sbjct  391   SRTVVQRLAGRLRLGTTAAGYRVWFEGRQVGGWTQSFG--GGA-----LSFATVRGASHE  443

Query  1365  VPNSSPSKALTLFKAFLKGSPPPNT  1439
              P S P ++L LF AFL G P P++
Sbjct  444   APFSQPERSLVLFAAFLAGRPLPDS  468



>ref|XP_002446348.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
 gb|EES10676.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
Length=474

 Score =   335 bits (859),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 266/445 (60%), Gaps = 20/445 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D  + PL LWL GG  CSS 
Sbjct  41    ISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-DPAAKPLVLWLNGGPGCSSV  98

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV FSYS   + Y+   D+MT
Sbjct  99    GVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGVGFSYSTDPAFYEGVGDSMT  157

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NLKFL+ WF +F +Y+  D YI G+SY GH  PQLA+ ++E+N+K    +   LKGI
Sbjct  158   ARDNLKFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  214

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E   G +S  C  + 
Sbjct  215   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYSRYVSEYYHGSLSTACDRVM  274

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +     SQ       + + D C+     +YL+R +VQ+
Sbjct  275   SQVTRETSRFVDKYDVTLDVCISSVLMQSQILAPQQGSRELDVCVEDETMNYLNRKDVQQ  334

Query  1020  ALHANASTWDSIFHGRNMILNNLAIDI-LPTLS---ALLKRGIPLLIYSGDEDLRIPVSH  1187
             A+HA  +     +   + +L    +D+ +PT++   AL+K GIP+L+YSGD+D  IP++ 
Sbjct  335   AMHARLTDGVQRWTVCSSVLEYKQLDLQIPTVNIVGALVKSGIPVLVYSGDQDSVIPLTG  394

Query  1188  TRELANVLATRLNL-TTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
             +R L + LA RL L TT      W+ GKQ+GGW+Q FG  GG      L+FATVRG SH 
Sbjct  395   SRTLVSRLAGRLRLNTTAAPYRAWFQGKQVGGWTQVFG--GGA-----LSFATVRGASHE  447

Query  1365  VPNSSPSKALTLFKAFLKGSPPPNT  1439
              P S P ++L LF+AFL G   P +
Sbjct  448   APFSQPERSLGLFRAFLAGQQLPES  472



>ref|XP_009415855.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 187/463 (40%), Positives = 263/463 (57%), Gaps = 22/463 (5%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEI---IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +LV   +S  ++ N  +   I  LPGQP  V F Q+SGYI   + + RALFYYF EA+  
Sbjct  14    ILVQVCFSRGLQPNPAVPDRITKLPGQP-QVTFQQFSGYITVDELQKRALFYYFVEAEM-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS  +G F ENGPFRP+    LV+N++SWN  +NMLY++ P G
Sbjct  72    DPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVRNEYSWNKEANMLYLEAPAG  130

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAE  605
             V FSYS  SS Y   +D  TA +NL FL++WF +F  Y++ D YI G+SY GH  PQLA+
Sbjct  131   VGFSYSGDSSFYDGVNDKKTAWDNLVFLQRWFNKFPGYKNRDLYITGESYAGHYVPQLAQ  190

Query  606   LILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDS  779
             L++E+N+K    +   LKGIA+GNP+LE      S  E  W +G+IS   Y +    C+ 
Sbjct  191   LMVEFNKK---AKIFNLKGIAMGNPVLEFATDFNSRAEFFWSHGLISDSTYRIFTSACNY  247

Query  780   TRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK  959
             +R V E   G +S  C+ +   ++ E    + K ++    C +   S S           
Sbjct  248   SRYVSEYYRGSLSPVCARVMSQVTRETSRFVDKYDVTLDVCISSVLSQSLVLSPQQVPEN  307

Query  960   ADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKR  1130
              D C+     +YL+R +VQ+ALHA     + W          L NL I  +  + +LLK 
Sbjct  308   IDVCIEDETVNYLNRKDVQDALHARLTGVTKWTVCSSVLQYELLNLEIPTITLVGSLLKA  367

Query  1131  GIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGG  1310
              IP+L+YSGD+D  IP++ +R L   LA  + L T      W++GKQ+GGW+Q +G+   
Sbjct  368   RIPVLVYSGDQDSVIPLTGSRTLVQKLANEMGLKTTVPYRVWFEGKQVGGWTQVYGDI--  425

Query  1311  GEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
                   L+FAT+RG SH  P S P ++L LF++FL+G P P T
Sbjct  426   ------LSFATIRGASHEAPFSQPERSLVLFRSFLQGRPLPET  462



>ref|XP_010271868.1| PREDICTED: serine carboxypeptidase-like 45 isoform X4 [Nelumbo 
nucifera]
Length=503

 Score =   336 bits (861),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/443 (41%), Positives = 266/443 (60%), Gaps = 22/443 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V+F QYSGYI   + + RALFYYF EA++ +  S PL LW+ GG  CSS 
Sbjct  73    IIKLPGQP-EVNFQQYSGYITVDEEQQRALFYYFVEAET-NPASKPLVLWVNGGPGCSSI  130

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV+N++SWN  +NMLY++TP GV FSYS  +S Y   +D MT
Sbjct  131   GTGAFSEHGPFRPS-GKNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVNDEMT  189

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL F+++W  +F E+++ D +I G+SY GH  PQLA+L++++N + +      LKGI
Sbjct  190   ARDNLVFMQRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQFNDQKL----FNLKGI  245

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNPLLE      S  E LW +G+IS   Y      C+ +R + +   G +S  C  + 
Sbjct  246   ALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFLSKYYRGSVSSVCLRVV  305

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
              +++ EI   + + ++    C +   S S+           D C+     +YL+R +VQ+
Sbjct  306   SLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQKVVESTDVCVEDETYNYLNRDDVQK  365

Query  1020  ALHAN---ASTWDSIFHGRNMILN--NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVS  1184
             +LHA+    S W +  + R +  +  NL +  +P LS+L + GI +L+YSGD+D  IP++
Sbjct  366   SLHAHLVGVSGWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILVYSGDQDSIIPLT  425

Query  1185  HTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
              TR L + LA  L L T      W++GKQ+GGW+Q +G+         LTFAT+RGGSH 
Sbjct  426   GTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI--------LTFATIRGGSHE  477

Query  1365  VPNSSPSKALTLFKAFLKGSPPP  1433
              P S P ++L LF +FLKG P P
Sbjct  478   APFSQPQRSLVLFNSFLKGKPLP  500



>ref|XP_007159977.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31971.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=466

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/444 (41%), Positives = 262/444 (59%), Gaps = 23/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +  F Q+SGY+     + +ALFYYF E+++    S PL LWL GG  CSS 
Sbjct  35    IVRLPGQP-NTGFQQFSGYVTVDDLKHKALFYYFVESETHPA-SKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE L+KN++SWN  +NMLY++TP+GV FSY+   S Y+  +D  
Sbjct  93    GVGAFSENGPFRP--NGEVLIKNEYSWNRETNMLYLETPVGVGFSYAKGGSSYETVNDET  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF +F ++R+ D ++AG+SY GH  PQLA+L++E N+K    +   LKG
Sbjct  151   TARDNLVFLQRWFNKFPQFRNRDLFLAGESYAGHYVPQLAKLMIEINKKE---KLFNLKG  207

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y L    C+ +R V E     +S  CS +
Sbjct  208   IALGNPVLEYATDLNSRAEFFWSHGLISDSTYKLFTTGCNYSRYVSEYYRDSISPVCSKV  267

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTE--TAKADPCLLTWVDDYLSRPE  1010
                ++ E    + K ++    C +   S S+  C   +      D C+   V +YL+R +
Sbjct  268   LRHVARETSRFVDKYDVTLDVCISSVLSQSKAICPQGQKINESIDVCVDDKVTNYLNRKD  327

Query  1011  VQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQEALHA       WD   +  +  + NL    LP + +L+K G+ +LIYSGD+D  IP+
Sbjct  328   VQEALHAKLVGVRKWDVCSNILDYDMLNLEKPTLPVVGSLIKAGVRVLIYSGDQDSVIPL  387

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + +R L   LA +L L T      W++G+Q+GGW+Q +G+         L+FATVRG SH
Sbjct  388   TGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGSI--------LSFATVRGASH  439

Query  1362  FVPNSSPSKALTLFKAFLKGSPPP  1433
               P S P ++  LFK+FL+  P P
Sbjct  440   EAPFSQPERSFVLFKSFLEDRPLP  463



>ref|XP_007028221.1| Serine carboxypeptidase 45 [Theobroma cacao]
 gb|EOY08723.1| Serine carboxypeptidase 45 [Theobroma cacao]
Length=470

 Score =   334 bits (857),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 184/459 (40%), Positives = 273/459 (59%), Gaps = 42/459 (9%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP   +F Q+SGY+   + + RALFYYF EA++    S PL LWL GG  CSS 
Sbjct  29    IVALPGQPR-ANFQQFSGYLTVDEKQKRALFYYFVEAETMPA-SKPLVLWLNGGPGCSSI  86

Query  306   AIGMFYENGPFRPTEDGELV-KNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
               G   E+GPF+P  +GE + KN++SWN  +NMLY+++P GV FSYS  +S Y   +D +
Sbjct  87    GAGALTEHGPFKP--NGETMEKNKYSWNKEANMLYLESPAGVGFSYSANNSFYANLNDEV  144

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
              AR+NL FL +WF++F EY++ DFYI G+SY GH  PQLA+LI+  N K      + LKG
Sbjct  145   AARDNLVFLERWFVKFPEYKNRDFYITGESYAGHYVPQLAQLIIHSNLK------LNLKG  198

Query  663   IALGNPLLE-KMGLSNV-EHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IA+GNPLLE    +++V ++ W +G+IS   Y L    C+S+R+++E++   +S DC  +
Sbjct  199   IAIGNPLLEFATDMNSVDQYYWSHGLISDSAYELLTSFCNSSRLMREVIRRSISSDCISV  258

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYS---------------SSQRHCLGTE--TAKAD  965
                +S E+   + + +++   C +   S               SSQ   L  +  + K D
Sbjct  259   YSEVSTELTKSIDQYDVIADVCLSSGQSPMAILSHSLLSGPQHSSQADGLSQQQVSVKED  318

Query  966   PCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGI  1136
             PC+      YL+R +VQ+ALHA     ++W+ + +     ++NL    +  + +++K GI
Sbjct  319   PCIQDKTTKYLNRKDVQKALHAQLVGTTSWN-LCNKFVQYMDNLETPTIHIVGSIVKSGI  377

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGE  1316
             P+++YSGD+D  IP + TR L   LA  L L T     PW++GKQ+GGW+Q +G+     
Sbjct  378   PVMVYSGDQDSVIPFTGTRTLVYKLAKALGLNTTVPYRPWFEGKQVGGWTQVYGDI----  433

Query  1317  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                 L+FAT+RG SH  P S P ++L LFKA L G P P
Sbjct  434   ----LSFATIRGASHTAPASQPERSLALFKAVLAGKPLP  468



>gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=458

 Score =   333 bits (855),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 186/451 (41%), Positives = 267/451 (59%), Gaps = 24/451 (5%)
 Frame = +3

Query  96    SISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLW  275
             S +I    + I  LPGQP  V F QYSGY+   + + RALFYY AEA+++   S PL LW
Sbjct  24    SSTILSRADRITRLPGQPR-VGFQQYSGYVTIDEKKQRALFYYLAEAETK-PISKPLVLW  81

Query  276   LGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSS  455
             L GG  CSS  +G F ENGPFRP +   LV+NQ SWN  +NMLY++TP+GV FSY+N SS
Sbjct  82    LNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQEANMLYLETPVGVGFSYANESS  140

Query  456   DYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPV  635
              Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA+L+++YN+K  
Sbjct  141   SYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKH-  199

Query  636   HVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSG  809
                   LKGIA+GNP++E      S  E+ W +G+IS   Y L    C+ +R + E   G
Sbjct  200   --NLFNLKGIAIGNPVMEFATDFNSRAEYFWSHGLISDPTYKLFTSSCNYSRFLSEYHRG  257

Query  810   EMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVD  989
              +S  C+ +   +  E    + K ++    C     S S++  +G ET   D CL     
Sbjct  258   SVSSMCTKVLSQVGIETSRFIDKYDVTLDVCIPSVLSQSKQ--VG-ET--VDVCLEDETV  312

Query  990   DYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGD  1160
             +YL+R +VQ+ALHA       W       +  + ++ +  +  + +L+K G+P+ +YSGD
Sbjct  313   NYLNRRDVQKALHARLVGTRKWTVCSDVLDYEVLDVEVPTINIVGSLVKAGVPVFVYSGD  372

Query  1161  EDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFA  1340
             +D  IP++ +R L   LA  L L T      W+ G+Q+GGW+Q +GN+        L FA
Sbjct  373   QDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNT--------LAFA  424

Query  1341  TVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             TVRG +H VP S P++AL LFKAFL G P P
Sbjct  425   TVRGAAHEVPFSQPARALVLFKAFLGGRPLP  455



>ref|XP_007159978.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31972.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=468

 Score =   333 bits (855),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 186/448 (42%), Positives = 263/448 (59%), Gaps = 29/448 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +  F Q+SGY+     + +ALFYYF E+++    S PL LWL GG  CSS 
Sbjct  35    IVRLPGQP-NTGFQQFSGYVTVDDLKHKALFYYFVESETHPA-SKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE L+KN++SWN  +NMLY++TP+GV FSY+   S Y+  +D  
Sbjct  93    GVGAFSENGPFRP--NGEVLIKNEYSWNRETNMLYLETPVGVGFSYAKGGSSYETVNDET  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL++WF +F ++R+ D ++AG+SY GH  PQLA+L++E N+K    +   LKG
Sbjct  151   TARDNLVFLQRWFNKFPQFRNRDLFLAGESYAGHYVPQLAKLMIEINKKE---KLFNLKG  207

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E  W +G+IS   Y L    C+ +R V E     +S  CS +
Sbjct  208   IALGNPVLEYATDLNSRAEFFWSHGLISDSTYKLFTTGCNYSRYVSEYYRDSISPVCSKV  267

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTE--TAKADPCLLTWVDDYLSRPE  1010
                ++ E    + K ++    C +   S S+  C   +      D C+   V +YL+R +
Sbjct  268   LRHVARETSRFVDKYDVTLDVCISSVLSQSKAICPQGQKINESIDVCVDDKVTNYLNRKD  327

Query  1011  VQEALHAN---ASTWDSIFHGRNMILN----NLAIDILPTLSALLKRGIPLLIYSGDEDL  1169
             VQEALHA       WD      N IL+    NL    LP + +L+K G+ +LIYSGD+D 
Sbjct  328   VQEALHAKLVGVRKWDVC--SNNSILDYDMLNLEKPTLPVVGSLIKAGVRVLIYSGDQDS  385

Query  1170  RIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVR  1349
              IP++ +R L   LA +L L T      W++G+Q+GGW+Q +G+         L+FATVR
Sbjct  386   VIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGSI--------LSFATVR  437

Query  1350  GGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             G SH  P S P ++  LFK+FL+  P P
Sbjct  438   GASHEAPFSQPERSFVLFKSFLEDRPLP  465



>ref|XP_010413849.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   333 bits (855),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 184/443 (42%), Positives = 261/443 (59%), Gaps = 21/443 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + RALFYY AEA+++   S PL LWL GG  CSS 
Sbjct  34    ITRLPGQPR-VGFQQYSGYVTVDEKQQRALFYYLAEAETK-PISKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSY+  SS Y+  +D +T
Sbjct  92    GVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVGFSYATESSSYEGVNDKIT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A++NL FL+KWF++F +Y +   +I G+SY GH  PQLA+L+++YN+K  H     LKGI
Sbjct  151   AKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKK--H-NLFNLKGI  207

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP++E      S  E+ W +G+IS   Y +    C+ +R V E   G +S  C+ + 
Sbjct  208   AIGNPVMEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCNYSRYVSEYYRGTVSSMCTKVM  267

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA--KADPCLLTWVDDYLSRPEV  1013
               +S E    + K ++    C     S S+R     +      D C+     +YL+R +V
Sbjct  268   SQVSIETSRFVDKYDVTLDVCIPSVLSQSKRVNPQPQQMGEAVDVCVEDETVNYLNRRDV  327

Query  1014  QEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVS  1184
             Q+ALHA       W    +  +  + ++ +  +  +  L+K G+P+L+YSGD+D  IP++
Sbjct  328   QKALHARLVGTRKWSVCSNVLDYEVLDVEVPTINIVGRLVKAGVPVLVYSGDQDSVIPLT  387

Query  1185  HTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
              +R L   LA  L L T      W+ G+Q+GGW+Q +GN         L FATVRG +H 
Sbjct  388   GSRTLVKRLADELGLRTTVPYRVWFAGQQVGGWTQVYGNI--------LAFATVRGAAHE  439

Query  1365  VPNSSPSKALTLFKAFLKGSPPP  1433
             VP S P++AL LFKAFL G P P
Sbjct  440   VPFSQPARALVLFKAFLGGRPLP  462



>ref|XP_002307963.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
 gb|EEE91486.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
Length=459

 Score =   333 bits (854),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 192/455 (42%), Positives = 263/455 (58%), Gaps = 27/455 (6%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             SI   G+I+ +LPGQP+ V F QY+GYI   + + RALFYYFAEA+  D  + PL LWL 
Sbjct  24    SISEAGKIV-ALPGQPT-VSFQQYAGYITIDEQQKRALFYYFAEAEI-DPATKPLVLWLN  80

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSD  458
             GG  CSS   G F E+GPF+P+  GE L+KN +SWN  +NMLY+++P GV FSYS   S 
Sbjct  81    GGPGCSSIGAGAFCEHGPFKPS--GEILLKNDYSWNKEANMLYLESPAGVGFSYSANDSF  138

Query  459   YKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVH  638
             Y   +D +TA++NL FL +WF EF EY+  DF+I G+SY GH  PQLA LI++   K   
Sbjct  139   YTYVTDGITAQDNLVFLERWFDEFPEYKGRDFFITGESYAGHYVPQLATLIVQSKAK---  195

Query  639   VRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGE  812
                  LKGIA+GNPLLE      S  E LW +G+IS   Y +    C+ +++ ++  SG 
Sbjct  196   ---FNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDNTYEIFTTVCNYSQIRRQYQSGS  252

Query  813   MSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDD  992
             +S  CS +N  +S E+   +   ++    C +   S SQ       T   D C+      
Sbjct  253   LSLPCSAVNSQVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQMEYTGTIDVCVEDETIK  312

Query  993   YLSRPEVQEALHANASTWDSIFHGRNMI---LNNLAIDILPTLSALLKRGIPLLIYSGDE  1163
             YL+R +V EALHA     D      +++   + NL I  +P L+ LLK GI + +YSGD+
Sbjct  313   YLNRKDVLEALHAQLVGVDQWTVCSDVVKYEMENLEISTVPLLAKLLKSGIRVHVYSGDQ  372

Query  1164  DLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFAT  1343
             D  IP++ TR + N LA  L L T      W+ GKQ+ GW+Q +GN         L+FAT
Sbjct  373   DSVIPLTGTRTVVNGLAKELGLNTTVPYRTWFQGKQVAGWTQVYGNI--------LSFAT  424

Query  1344  VRGGSHFVPNSSPSKALTLFKAFLKGS--PPPNTH  1442
             +RG SH  P S P ++  LF AFL+G   PPP  +
Sbjct  425   IRGASHEAPFSQPERSFVLFNAFLEGKQLPPPTVY  459



>ref|XP_002517289.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45082.1| serine carboxypeptidase, putative [Ricinus communis]
Length=464

 Score =   333 bits (853),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 190/444 (43%), Positives = 255/444 (57%), Gaps = 27/444 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP +V F QY+GYI   + + RALFYYF EA++ D  S PL LWL GG  CSS 
Sbjct  30    IGTLPGQP-EVSFKQYAGYITIDEKQQRALFYYFVEAET-DPSSKPLVLWLNGGPGCSSI  87

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+    L+KN +SWN  +NMLY+++P GV FSY    S Y   +D MT
Sbjct  88    GAGAFCEHGPFKPS-GKILLKNDYSWNREANMLYLESPAGVGFSYCANKSFYNSVNDEMT  146

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A +NL FL +WF +F EYR+ DF+I G+SY GH  PQLA+LI+E   K      + LKGI
Sbjct  147   AIDNLAFLERWFSKFPEYRNRDFFITGESYAGHYVPQLAQLIVESKSK------LNLKGI  200

Query  666   ALGNPLLE--KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEI-LSGEMSEDCSDI  836
             A+GNPLLE      S  E  W +G+IS   Y +  R C+ +++ ++   SG +S DCS +
Sbjct  201   AIGNPLLEFDTDFNSRAEFFWSHGLISDATYEIFTRICNYSQIRRQYQTSGSLSPDCSRV  260

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTE--TAKADPCLLTWVDDYLSRPE  1010
             +  +S E+   +   ++    C +     SQ H L       K D C+      YL+R +
Sbjct  261   SREVSREVSKFVDTYDITLDVCLSS--IQSQSHVLNQMEYAGKIDVCVEDETVKYLNRKD  318

Query  1011  VQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQEALHA     + W          + NL I   P L  L+K GI +LIYSGD+D  IP+
Sbjct  319   VQEALHAQLFGVNGWTVCSDVLKYNMQNLEISTTPLLGKLIKSGIRVLIYSGDQDSVIPL  378

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + TR L N LA  L L T      W+ GKQ+ GW+Q FG+         L++AT+RG SH
Sbjct  379   TGTRALVNGLAKELTLNTTVPYRAWFGGKQVAGWTQVFGDI--------LSYATIRGASH  430

Query  1362  FVPNSSPSKALTLFKAFLKGSPPP  1433
               P S P +++ LF AFL G P P
Sbjct  431   EAPFSQPERSIVLFSAFLGGVPLP  454



>ref|XP_010271867.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Nelumbo 
nucifera]
Length=504

 Score =   333 bits (855),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/444 (41%), Positives = 269/444 (61%), Gaps = 23/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V+F QYSGYI   + + RALFYYF EA++ +  S PL LW+ GG  CSS 
Sbjct  73    IIKLPGQP-EVNFQQYSGYITVDEEQQRALFYYFVEAET-NPASKPLVLWVNGGPGCSSI  130

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV+N++SWN  +NMLY++TP GV FSYS  +S Y   +D MT
Sbjct  131   GTGAFSEHGPFRPS-GKNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVNDEMT  189

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL F+++W  +F E+++ D +I G+SY GH  PQLA+L++++N + +      LKGI
Sbjct  190   ARDNLVFMQRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQFNDQKL----FNLKGI  245

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNPLLE      S  E LW +G+IS   Y      C+ +R + +   G +S  C  + 
Sbjct  246   ALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFLSKYYRGSVSSVCLRVV  305

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA-DPCLLTWVDDYLSRPEVQ  1016
              +++ EI   + + ++    C +   S S+      +  ++ D C+     +YL+R +VQ
Sbjct  306   SLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQQKVVESTDVCVEDETYNYLNRDDVQ  365

Query  1017  EALHAN---ASTWDSIFHGRNMILN--NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             ++LHA+    S W +  + R +  +  NL +  +P LS+L + GI +L+YSGD+D  IP+
Sbjct  366   KSLHAHLVGVSGWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILVYSGDQDSIIPL  425

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + TR L + LA  L L T      W++GKQ+GGW+Q +G+         LTFAT+RGGSH
Sbjct  426   TGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI--------LTFATIRGGSH  477

Query  1362  FVPNSSPSKALTLFKAFLKGSPPP  1433
               P S P ++L LF +FLKG P P
Sbjct  478   EAPFSQPQRSLVLFNSFLKGKPLP  501



>ref|XP_004136792.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 ref|XP_004159658.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
Length=436

 Score =   331 bits (849),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 182/443 (41%), Positives = 263/443 (59%), Gaps = 21/443 (5%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
             G +I SLPGQP  V+F Q+ GYI   + + R+LFYYF EAQS D  S PL LWL GG  C
Sbjct  10    GHLIKSLPGQPI-VNFKQFGGYITIDELQSRSLFYYFVEAQS-DPTSKPLVLWLNGGPGC  67

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F ENGPFRP  D  L+ N+FSWN  +N+LY+++P GV FS+S  ++ Y   +D
Sbjct  68    SSLGAGAFIENGPFRPKGD-VLILNEFSWNNVANVLYLESPAGVGFSFSKNTTFYDTVND  126

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
              +TA++N+ FL +W  +F EY++ +FYI G+SY GH  PQLA LI++          IKL
Sbjct  127   KITAQDNIVFLERWLEKFPEYKNREFYITGESYAGHYVPQLARLIVQSKLS------IKL  180

Query  657   KGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             K IA+GNPLLE     N   ++LW +G+IS   + L    C  +++V+E ++GE+S+ C 
Sbjct  181   KAIAIGNPLLEFNTDFNSRGKYLWSHGVISESTFELLNTVCSISQIVREGINGEISDACL  240

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPE  1010
              IN +I+ E+   +++ ++    C +   + +    L     K D C+   +D YL+R +
Sbjct  241   SINDLIAREMSPFINEYSINLDVCLSGDQTQTALSAL-HYAGKVDVCIGNEIDAYLNRVD  299

Query  1011  VQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQ+ALHA     STW       +    NL +  +  + +L++ GI +LI+SGD+D  IP+
Sbjct  300   VQQALHAQLIGVSTWSLCSDILDYDRTNLFVPTINIVGSLVRSGIRVLIFSGDQDAVIPL  359

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
               +R L N LA  L L T      W+   Q+GGW +TFG         NL+FAT+RG +H
Sbjct  360   LGSRTLVNKLAKALRLNTTLPYSAWFHNHQVGGWVETFGEKN------NLSFATIRGAAH  413

Query  1362  FVPNSSPSKALTLFKAFLKGSPP  1430
               P +SP+ +LTLF AFL+   P
Sbjct  414   QAPYTSPATSLTLFTAFLQAKNP  436



>ref|XP_003621641.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=489

 Score =   333 bits (854),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 188/470 (40%), Positives = 265/470 (56%), Gaps = 48/470 (10%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  VDF+Q+SGY+       +ALF+YF EA++ D  S PL LWL GG  CSS 
Sbjct  31    ITNLPGQP-HVDFHQFSGYVNVDDQNKKALFFYFVEAKN-DAVSKPLVLWLNGGPGCSSL  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +  LVKNQFSWN  +NMLY+++PIGV FSYS  +S Y+  +D +T
Sbjct  89    GVGAFSENGPFRPKGEA-LVKNQFSWNTEANMLYLESPIGVGFSYSTDTSSYEGVNDKIT  147

Query  486   A-----------------------------RENLKFLRKWFIEFSEYRDLDFYIAGDSYG  578
                                           R+NL FL+ WF++F EYR+   +I G+SY 
Sbjct  148   GKFSIFILLFDLRMILNFILLNGQAPFNSTRDNLIFLQNWFVKFPEYRNRSLFIVGESYA  207

Query  579   GHLAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELY  752
             GH  PQLAEL+L++N+K    +   LKGIALGNP+LE      S  E  W +G+IS   +
Sbjct  208   GHYVPQLAELMLQFNKKE---KLFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDLTF  264

Query  753   HLQKRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR  932
              +    C+ +R V+E  +G +S  CS +   +S E    + K ++    C +  +S +  
Sbjct  265   KMFTSVCNYSRYVREYYNGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTNV  324

Query  933   HCLGTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDIL  1103
                   T   D C+     +YL+R +VQ ALHA+      W       +  L +L I  +
Sbjct  325   LNPQQVTETIDVCVEDETVNYLNRKDVQSALHAHLIGVHRWSPCSSVLDYELRDLEIPTI  384

Query  1104  PTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGW  1283
               +  L+K GIP+L+YSGD+D  IP++ +R L + LA +L + T      W+ G+Q+GGW
Sbjct  385   TVVGKLVKAGIPVLVYSGDQDSVIPLTGSRTLVHQLAKQLRMNTTVPYRVWFAGQQVGGW  444

Query  1284  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +Q +GN         L+FATVRG SH VP S P ++L LFK+FL+G P P
Sbjct  445   TQVYGNI--------LSFATVRGASHEVPFSQPERSLVLFKSFLEGRPLP  486



>ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
 sp|Q8VY01.1|SCP46_ARATH RecName: Full=Serine carboxypeptidase-like 46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL67013.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC08849.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
Length=465

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 187/456 (41%), Positives = 267/456 (59%), Gaps = 27/456 (6%)
 Frame = +3

Query  96    SISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLW  275
             S +I    + I  LPGQP  V F QYSGY+   + + RALFYY AEA+++   S PL LW
Sbjct  24    SSTILSRADRITRLPGQPR-VGFQQYSGYVTIDEKKQRALFYYLAEAETK-PISKPLVLW  81

Query  276   LGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSS  455
             L GG  CSS  +G F ENGPFRP +   LV+NQ SWN  +NMLY++TP+GV FSY+N SS
Sbjct  82    LNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQEANMLYLETPVGVGFSYANESS  140

Query  456   DYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPV  635
              Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA+L+++YN+K  
Sbjct  141   SYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKK--  198

Query  636   HVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSG  809
             H     LKGIA+GNP++E      S  E+ W +G+IS   Y L    C+ +R + E   G
Sbjct  199   H-NLFNLKGIAIGNPVMEFATDFNSRAEYFWSHGLISDPTYKLFTSSCNYSRFLSEYHRG  257

Query  810   EMSEDCSDINVMISEEIGDDMHKDNLLFQSC-----QTDQYSSSQRHCLGTETAKADPCL  974
              +S  C+ +   +  E    + K ++    C        +  S Q   +G ET   D CL
Sbjct  258   SVSSMCTKVLSQVGIETSRFIDKYDVTLDVCIPSVLSQSKVVSPQPQQVG-ET--VDVCL  314

Query  975   LTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLL  1145
                  +YL+R +VQ+ALHA       W       +  + ++ +  +  + +L+K G+P+ 
Sbjct  315   EDETVNYLNRRDVQKALHARLVGTRKWTVCSDVLDYEVLDVEVPTINIVGSLVKAGVPVF  374

Query  1146  IYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVA  1325
             +YSGD+D  IP++ +R L   LA  L L T      W+ G+Q+GGW+Q +GN+       
Sbjct  375   VYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNT-------  427

Query  1326  NLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              L FATVRG +H VP S P++AL LFKAFL G P P
Sbjct  428   -LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  462



>ref|XP_002881286.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57545.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 191/470 (41%), Positives = 271/470 (58%), Gaps = 27/470 (6%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M   L  L   +L S +I    + I  LPGQP  V F QYSGY+     + RALFYY AE
Sbjct  1     MATALILLQALSLVSSTILSRADRITRLPGQPR-VGFQQYSGYVTIDDKKQRALFYYLAE  59

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+++   S PL LWL GG  CSS  +G F ENGPFRP +   LV+N  SWN  +NMLY++
Sbjct  60    AETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNLHSWNQEANMLYLE  117

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP+GV FSY+  SS Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  P
Sbjct  118   TPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVP  177

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKR  767
             QLA+L+++YN+K  H     LKGIA+GNP++E     N   E+ W +G+IS   Y +   
Sbjct  178   QLAQLMIQYNKK--H-NLFNLKGIAIGNPVMEFATDFNSRGEYFWSHGLISDPTYKMFTS  234

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSS-----QR  932
              C+ +R V E   G +S  C+ +   +S E    + K ++    C     S S     Q 
Sbjct  235   YCNYSRYVSEYYRGSVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSKVVNPQP  294

Query  933   HCLGTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDIL  1103
               +G ET   D C+     +YL+R +VQ ALHA       W    +  +  + ++ +  +
Sbjct  295   QQVG-ET--VDVCVEDETVNYLNRRDVQRALHARLVGTRKWAVCSNVLDYEVLDVEVPTI  351

Query  1104  PTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGW  1283
               + +L+K G+P+L+YSGD+D  IP++ +R L   LA  L L T      W+ G+Q+GGW
Sbjct  352   NIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGW  411

Query  1284  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +Q +GN+        L FATVRG +H VP S P++AL LFKAFL G P P
Sbjct  412   TQVYGNT--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  453



>ref|XP_004501743.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=470

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 186/445 (42%), Positives = 267/445 (60%), Gaps = 24/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  + F Q+SGY+     + ++LFYYF E++  D  S PL LWL GG  CSS 
Sbjct  38    IVGLPGQP-HITFQQFSGYVSVDDKKNKSLFYYFVESEI-DPPSKPLVLWLNGGPGCSSL  95

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW-SDT  479
              +G F ENGPFRP  +GE L+KN+ SWN  +NMLY++TPIGV FSY+  SS Y    +D 
Sbjct  96    GVGAFSENGPFRP--NGEFLIKNEHSWNKEANMLYLETPIGVGFSYAKGSSSYTTTVNDE  153

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLK  659
              TAR+NL FL++WF +F +YR+ D ++ G+SY GH  PQLA+L++E N++    +   LK
Sbjct  154   ETARDNLVFLQRWFNKFPQYRNRDLFLTGESYAGHYVPQLAKLMIEMNKRN---KIFNLK  210

Query  660   GIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             GIALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E     +S  CS 
Sbjct  211   GIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYNRDSVSPLCSK  270

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA--KADPCLLTWVDDYLSRP  1007
             +  ++S+E    + K ++    C +   S S+      + A  + D C+   V +YL+R 
Sbjct  271   VMGLVSKETSKFVDKYDVTLDVCISSVLSQSKVINPQPQQANERIDVCVDDKVTNYLNRR  330

Query  1008  EVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIP  1178
             +VQEALHA       WD   +  +  + NL +  LP + +L+K G+ +LIYSGD+D  IP
Sbjct  331   DVQEALHAKLVGVRKWDVCSNILDYDVLNLEVPTLPIVGSLIKSGVRVLIYSGDQDSVIP  390

Query  1179  VSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGS  1358
             ++ +R L   LA +L L T      W++ +Q+GGW+Q +GN         L+FATVRG +
Sbjct  391   LTGSRTLVQKLARQLGLNTTVSYRVWFESQQVGGWTQVYGNM--------LSFATVRGAA  442

Query  1359  HFVPNSSPSKALTLFKAFLKGSPPP  1433
             H VP S P ++L LFK+FL+G P P
Sbjct  443   HEVPFSQPERSLVLFKSFLEGRPLP  467



>ref|XP_009355272.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Pyrus 
x bretschneideri]
Length=461

 Score =   332 bits (850),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 180/446 (40%), Positives = 259/446 (58%), Gaps = 41/446 (9%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LP QP  V+F QY+GY+   + + R+LFYYF EAQ+ +  S PL LWL GG  CSS  +G
Sbjct  38    LPSQP-QVNFQQYAGYVTVDEKQERSLFYYFVEAQT-NPASKPLVLWLNGGPGCSSVGVG  95

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPF+P+ D  L+KN FSWN  +N+LY+++P GV FSYS   S Y   +D +TAR+
Sbjct  96    AFNENGPFQPSGD-ILLKNDFSWNREANILYLESPAGVGFSYSANKSFYGFVNDDITARD  154

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALG  674
             N++FL++WF EF  Y++ DF+I G+SY GH  PQLA+LI++   K        LK IA+G
Sbjct  155   NIEFLQRWFDEFPAYKNRDFFITGESYAGHYVPQLAQLIIQSKLK------FNLKAIAIG  208

Query  675   NPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTRMVQE--ILSGEMSEDCSDINV  842
             NPLLE    +N   E+LW +G+IS   +      C+++ ++++  I  G ++  C  +  
Sbjct  209   NPLLEFNSDNNAQAEYLWSHGLISDATFENLTSVCNNSEIIRQVRIRGGPLTPACDAVAT  268

Query  843   MISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT---------ETAKADPCLLTWVDDY  995
              +  E+   +            DQY  +   CL +         +TAK D C+      Y
Sbjct  269   QVESEVPGYL-----------IDQYDVTHDVCLSSVEAQSFQLQKTAKIDVCIADETVSY  317

Query  996   LSRPEVQEALHANASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRI  1175
             L+RP+VQEALHA  + W +  +     + N+ + +LP L  L+K GI +LIYSGD+D  I
Sbjct  318   LNRPDVQEALHARVTNWTTCSNVLKYDMKNVEVPMLPVLGDLVKSGIRVLIYSGDQDSVI  377

Query  1176  PVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGG  1355
             P++ TR LAN LA  L L T      W   KQ+ GW+Q + ++        L++AT+RG 
Sbjct  378   PLTSTRTLANGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------LSYATIRGA  429

Query  1356  SHFVPNSSPSKALTLFKAFLKGSPPP  1433
              H  P S P ++L LF +FLKG P P
Sbjct  430   GHEAPISQPERSLLLFTSFLKGKPLP  455



>ref|XP_002318164.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
 gb|EEE96384.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
Length=463

 Score =   332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 184/441 (42%), Positives = 256/441 (58%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+     + RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  34    IAGLPGQP-HVGFQQFSGYVTVDGNKHRALFYYFVEAEI-DPASKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP     L++N+ SWN  +NMLY++TP+GV FSYS  +S Y    D  T
Sbjct  92    GVGAFSENGPFRPN-GRVLIRNEHSWNREANMLYLETPVGVGFSYSTDNSSYVAVDDEAT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WF +F +YR+ D +I G+SY GH  PQLA+L++E N+K    R + LKGI
Sbjct  151   ARDNLVFLQGWFHKFPQYRNKDLFITGESYAGHYIPQLAKLMVEINKKE---RLVNLKGI  207

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E+ W +G+IS   Y +    C+ +R V E     +S  CS + 
Sbjct  208   ALGNPVLEFATDLNSRAEYFWSHGLISDSTYKMFTSACNYSRYVSEYYRDSVSSVCSLVM  267

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S E    + K ++    C     S S+       + + D C+     +YL+R +V++
Sbjct  268   KQVSTETSRFVDKYDVTLDVCIPSVLSQSKVISPKQVSERIDVCIEDETVNYLNREDVRK  327

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W+   +  +  + N+ I  +  + +L+K GIP+LIYSGD+D  IP++ +
Sbjct  328   ALHARLIGVRRWEVCSNILDYEVLNIEIPTINIVGSLIKAGIPVLIYSGDQDSVIPLTGS  387

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA  L L T      W+ GKQ+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  388   RTLVHRLAKELGLNTTVPYRAWFAGKQVGGWTQVYGNI--------LSFATIRGASHEAP  439

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFK+FL+G   P
Sbjct  440   FSQPERSLMLFKSFLQGKHLP  460



>ref|NP_001052663.1| Os04g0396800 [Oryza sativa Japonica Group]
 emb|CAE05146.2| OSJNBa0039C07.2 [Oryza sativa Japonica Group]
 dbj|BAF14577.1| Os04g0396800 [Oryza sativa Japonica Group]
 gb|EAZ30581.1| hypothetical protein OsJ_14632 [Oryza sativa Japonica Group]
 dbj|BAG91822.1| unnamed protein product [Oryza sativa Japonica Group]
Length=470

 Score =   332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 185/445 (42%), Positives = 262/445 (59%), Gaps = 20/445 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP +V F QYSGY+     R R LFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  37    IVALPGQP-NVSFAQYSGYVTVDAARRRELFYYFAEAEL-DPATKPLVLWLNGGPGCSSV  94

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +NMLY+++P GV FSYS   S Y    D+ T
Sbjct  95    GVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYGGVGDSRT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL+FL+ WF +F +Y+  D YI G+SY GH  PQLA+ ++E+N+K    +   LKGI
Sbjct  154   ARDNLRFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  210

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E  W +G+IS   YH     C+ +R V E   G +S  C  + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDSTYHSFTTVCNYSRYVSEYYHGSLSSACDTVM  270

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +     S+       + + D C+      YL+R +VQE
Sbjct  271   TQVARETSRFVDKYDVTLDVCVSSVLMQSKSLAPQRGSRELDVCVEDETMGYLNRKDVQE  330

Query  1020  ALHANASTWDSIFHGRNMILNNLAIDI-LPTLS---ALLKRGIPLLIYSGDEDLRIPVSH  1187
             A+HA        +   + +L    +D+ +PT++    L+K G+P+L+YSGD+D  IP++ 
Sbjct  331   AMHARLEGGVPKWTVCSSVLEYKQLDLQIPTINIVGGLVKSGVPVLVYSGDQDSVIPLTG  390

Query  1188  TRELANVLATRLNL-TTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
             +R +   LA  L L TT      W++G+Q+GGW+Q+FG  GG      L+FATVRG SH 
Sbjct  391   SRTVVQRLAGWLRLGTTAAGYRVWFEGRQVGGWTQSFG--GGA-----LSFATVRGASHE  443

Query  1365  VPNSSPSKALTLFKAFLKGSPPPNT  1439
              P S P ++L LF AFL G P P++
Sbjct  444   APFSQPERSLVLFAAFLAGRPLPDS  468



>ref|XP_011075459.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=472

 Score =   332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 186/467 (40%), Positives = 269/467 (58%), Gaps = 29/467 (6%)
 Frame = +3

Query  69    WFLLVNTLYSISIRI-------NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             W+ ++  ++ + I +        G+ I SLPGQP  V F QYSGYI+    + R+ FYYF
Sbjct  7     WWSVLAMIFVLQIYVAAGKAQNQGDKIVSLPGQP-KVSFQQYSGYIIIGGKQQRSYFYYF  65

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA++E   S PL LWL GG  CSS   G F E+GPF+P+ +  LV+N +SWN A+NMLY
Sbjct  66    VEAETEPA-SKPLVLWLNGGPGCSSVGAGAFSEHGPFQPSGN-VLVRNNYSWNKAANMLY  123

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             +++P GV FSYS   S Y+   D MTAR+NL FL KWF +F EY++ +FYI G+SYGGH 
Sbjct  124   LESPAGVGFSYSANKSFYESVDDEMTARDNLNFLEKWFDKFPEYKNREFYITGESYGGHY  183

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLE--KMGLSNVEHLWHYGIISTELYHLQ  761
              PQLA LI++   K        LKGIA+GNPLLE      S  E LW +G+IS   Y+  
Sbjct  184   VPQLANLIIQSKAK------FNLKGIAIGNPLLEFDTDFNSRAEFLWSHGLISDATYYQF  237

Query  762   KRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCL  941
                C+ +++ ++  SG ++  CS +  ++S EI   +   ++    C +     ++    
Sbjct  238   TSVCNYSQIRRQAASGALTPVCSRVIKLVSSEISRFIDTYDVTLDVCLSSVMLQAEVLNQ  297

Query  942   GTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
               +  K D C+    + YL+R +VQ+ALHA     S W       +  + NL I  +  L
Sbjct  298   VQDEPKIDVCVEDEANAYLNRKDVQQALHARLVGVSRWSICSDILHYEMQNLEIPTIGIL  357

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
               L+K G+ +L+YSGD+D  +P++ TR L N LA  L L T E    W++G+Q+ GW+Q+
Sbjct  358   GLLVKSGVRVLVYSGDQDSVLPLTGTRALVNGLAKDLKLNTSEPYGAWFEGRQVAGWTQS  417

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +G          L+FAT+RG SH  P S P ++L LF +F+ G P P
Sbjct  418   YGEF--------LSFATIRGASHEAPFSQPERSLVLFSSFVGGKPLP  456



>ref|XP_004503800.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=466

 Score =   331 bits (849),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 189/469 (40%), Positives = 271/469 (58%), Gaps = 24/469 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             I V LL  L ++++    +  + + I  LPGQP  ++F Q+SGY+   + + R+LFYYF 
Sbjct  11    ITVVLLQ-LSISSMKIFCLSSHADRIHKLPGQP-HINFQQFSGYVTVDEMKQRSLFYYFV  68

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             E+++    S PL LWL GG  CSS  IG F ENGPFRP  +GE L+KN  SWN  +NMLY
Sbjct  69    ESKTNPS-SKPLVLWLNGGPGCSSIGIGAFSENGPFRP--NGEVLIKNDHSWNREANMLY  125

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TP+GV FSY+  +  Y   +D MTAR+NL FL  WF +F +Y+  D ++ G+SY GH 
Sbjct  126   LETPVGVGFSYAKGTFSYMKVNDEMTARDNLVFLLGWFNKFPQYKHRDLFLTGESYAGHY  185

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQ  761
              PQLA+L++  N+K    +   LKGIALGNPLLE      S  E  W +G+IS   Y + 
Sbjct  186   IPQLAKLMIGINKKK---KIFNLKGIALGNPLLEYATDFNSRAEFFWSHGLISDSTYKMF  242

Query  762   KRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCL  941
                C+ +R V E     +S  CS +   +S E    + K ++    C +   S S+  C 
Sbjct  243   TAGCNYSRYVSEYYRNSISPLCSKVMRKVSRETSKFVDKYDVTLDVCISSVLSQSKVICP  302

Query  942   GTETAK--ADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILP  1106
              T  A    D C+   V +YL+R +VQ+ALHA      TWD   +  +  + NL +  L 
Sbjct  303   QTHQANESIDVCVDDKVTNYLNRRDVQKALHAELVGVPTWDVCNNVLDYNMLNLEVPTLH  362

Query  1107  TLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWS  1286
              + +L+K G+ +LIYSGD+D  IP++ +R L   LA +L+L T      W++G Q+GGW+
Sbjct  363   VVGSLIKAGVRVLIYSGDQDSVIPLTGSRSLVQKLARQLSLNTTVPYRVWFEGHQVGGWT  422

Query  1287  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             Q +GN         L+FAT+RG SH  P S P ++L LF +FL+  P P
Sbjct  423   QVYGNI--------LSFATIRGASHEAPFSQPQRSLVLFNSFLEDRPLP  463



>ref|XP_010678341.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=476

 Score =   331 bits (849),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 181/445 (41%), Positives = 260/445 (58%), Gaps = 23/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q++GY+     + ++LFYYF EAQ  D  S PL LWL GG  CSS 
Sbjct  43    ITILPGQPK-VSFKQFAGYVTVDHKKHKSLFYYFVEAQV-DPSSKPLVLWLNGGPGCSSL  100

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN+ SWN  +NMLY++TP+GV FSYS  ++ Y   SD +T
Sbjct  101   GVGAFSENGPFRP-KGNILVKNEHSWNTEANMLYLETPVGVGFSYSIDTTGYDAVSDAVT  159

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FLR+WF +F +Y+  D +I G+SY GH  PQLA+L++ +N+K    +   LKGI
Sbjct  160   ARDNLVFLRRWFNKFPQYKHRDLFITGESYAGHYIPQLADLMVAFNKKE---KLFNLKGI  216

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G +S  CS + 
Sbjct  217   ALGNPVLEFANDFNSRAEYFWSHGLISDSTYKIFTSACNYSRYVSEYYRGYVSPICSKVM  276

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTET----AKADPCLLTWVDDYLSRP  1007
               +  E    + K ++    C +   S S+      +T       D C+      YL+R 
Sbjct  277   RQVGRETSKFVDKYDVTLDVCISSVLSQSKIISPQEQTEAGGESVDVCIEDETVSYLNRQ  336

Query  1008  EVQEALHA---NASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIP  1178
             +VQ+ALHA   N   W+   +  +  L ++ I  +  + +L+K G+P+L+YSGD+D  IP
Sbjct  337   DVQKALHARLVNVRRWEVCSNILDYELLDVEIPTITIVGSLVKSGVPVLVYSGDQDSVIP  396

Query  1179  VSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGS  1358
             ++ +R L + LA  L L        W+ G+Q+GGW++ +GN         L+FATVRG +
Sbjct  397   LTGSRTLVHRLAMELGLNATTPYRVWFAGEQVGGWTEVYGNI--------LSFATVRGAA  448

Query  1359  HFVPNSSPSKALTLFKAFLKGSPPP  1433
             H VP S P+++L LFK+FL+  P P
Sbjct  449   HEVPYSQPARSLVLFKSFLESRPLP  473



>ref|XP_006662960.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=470

 Score =   331 bits (848),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 184/469 (39%), Positives = 271/469 (58%), Gaps = 20/469 (4%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++V  L  LL+  L+ +     G+ I  LPGQP +V F QY+GYI       RALFYYF 
Sbjct  14    VVVSSLQLLLIAALFHLGSCNGGDRITRLPGQP-EVSFGQYAGYIGVDDKGKRALFYYFV  72

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA+  D  + PL LWL GG  CSS  +G F ENGPFRP+    LVKN++SWN  +N++Y+
Sbjct  73    EAEL-DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYL  130

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             +TP GV +SYS+ ++ Y+   D MTA +N+ FL++W  +F +Y+  + YI+G+SY GH  
Sbjct  131   ETPAGVGYSYSSDAAYYQGVDDKMTAMDNMVFLQRWLEKFPQYKGRELYISGESYAGHYI  190

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQK  764
             PQLAE+++E+N+K    +   LKGIALGNP+LE      S  E+ W +G+IS   Y +  
Sbjct  191   PQLAEVMVEFNKKN---KIFNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDSTYRIFT  247

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG  944
               C+ +R V E   G ++  C+ +   ++ E    + K ++    C +   S S+     
Sbjct  248   SVCNYSRYVTEYYGGSLTPLCTRVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILTPH  307

Query  945   TETA-KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
              +   + D C+     +YL+R +VQEALHA       W          L NL I  +  +
Sbjct  308   QQAGQRIDVCVEDETVNYLNRKDVQEALHAKLIGVKNWAVCSSVLEYELLNLQIPTINIV  367

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+K GI +L+YSGD+D  IP++ +R L   LA  L L T      W++G+Q+GGW+Q 
Sbjct  368   GSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLARNLGLKTTVPYRVWFEGQQVGGWTQV  427

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             +G+         L+FAT+RG SH  P S P ++L LF+AFL+G P P T
Sbjct  428   YGDM--------LSFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  468



>ref|XP_011040748.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=459

 Score =   330 bits (847),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 189/454 (42%), Positives = 260/454 (57%), Gaps = 25/454 (6%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             SI   G+I+ +LPGQP  V F QY+GYI   + + RALFYYFAEA+  D  + PL LWL 
Sbjct  24    SISEAGKIV-ALPGQPR-VSFQQYAGYITIDEQQKRALFYYFAEAEI-DPATKPLVLWLN  80

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDY  461
             GG  CSS   G F E+GPF+P+ +  L+KN +SWN  +NMLY+++P GV FSYS   S Y
Sbjct  81    GGPGCSSIGAGAFCEHGPFKPSAE-ILLKNDYSWNKEANMLYLESPAGVGFSYSANDSFY  139

Query  462   KIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHV  641
                +D +TA++NL FL +WF EF EY+  DF+I G+SY GH  PQLA LI++   K    
Sbjct  140   TYVTDEITAQDNLVFLERWFDEFPEYKGRDFFITGESYAGHYVPQLATLIVQSQTK----  195

Query  642   RPIKLKGIALGNPLLE--KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEM  815
                 LKGIA+GNPLLE      S  E  W +G+IS + Y +    C+ +++ ++  SG +
Sbjct  196   --FNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDDTYEIFTTVCNYSQIRRQYQSGSL  253

Query  816   SEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDY  995
             S  CS +N  +S E+   +   ++    C +   S SQ       T   D C+      Y
Sbjct  254   SLPCSAVNSRVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQMEYTGTIDVCVEDETIKY  313

Query  996   LSRPEVQEALHANASTWDSIFHGRNMI---LNNLAIDILPTLSALLKRGIPLLIYSGDED  1166
             L+R +V EALHA     D      ++I   + NL I  +P L+ LLK GI + +YSGD+D
Sbjct  314   LNRKDVLEALHAQLVGVDQWTVCSDVIKYEMENLEISTVPLLAKLLKSGIRVHVYSGDQD  373

Query  1167  LRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATV  1346
               IP++ TR + N LA  L L T      W+ GKQ+ GW+Q +GN         L+FAT+
Sbjct  374   SVIPLTGTRTIVNGLAKELGLNTTVPYRTWFQGKQVAGWTQVYGNI--------LSFATI  425

Query  1347  RGGSHFVPNSSPSKALTLFKAFLKGS--PPPNTH  1442
             R  SH  P S P ++  LF AFL+G   PPP  +
Sbjct  426   RAASHEAPFSQPERSFVLFNAFLEGKQLPPPTVY  459



>ref|XP_002282978.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=451

 Score =   330 bits (845),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 259/441 (59%), Gaps = 31/441 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  35    ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTALKPLVVWFSGGPGCSSV  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
                   ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  94    GA----QHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA+LILE + K        LKGI
Sbjct  149   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESSVK------FNLKGI  202

Query  666   ALGNPLLE-KMGLSNVEHL-WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
              +GNPL++     ++V H  W +G+IS   Y+L   +C+ +RM +E  SG +S  C  + 
Sbjct  203   LMGNPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  262

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
                S+E+GD + + ++   SC        Q       T   D C+   V+ Y +R +VQ+
Sbjct  263   SQYSQEVGDSVDRFDVTLNSCLPSVDPQPQ------VTENVDVCIGDEVNKYFNREDVQK  316

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             +LHA     + W          + +  I ++P + +L+K GI   +YSGD+D  IP+  T
Sbjct  317   SLHARLVGVANWSMCSGALRYNIKDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFGT  376

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W++G+Q+GGW+Q +G+         L+FATVRGGSH VP
Sbjct  377   RTLVDGLAKKLRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTVP  428

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              + P++AL LF AFLKG PPP
Sbjct  429   GTQPARALVLFTAFLKGQPPP  449



>ref|XP_009404114.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   330 bits (846),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 259/445 (58%), Gaps = 19/445 (4%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             ++I  LPGQP  V F Q+SGYI   +   RALFYYFAEA+  D  + PL LWL GG  CS
Sbjct  32    DMIMKLPGQPP-VSFQQFSGYITVDQLDRRALFYYFAEAEV-DPSTKPLVLWLNGGPGCS  89

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G F ENGPFRP +   LV+N++SWN  +NMLY++TP GV FSYS+ SS Y+  +D 
Sbjct  90    SVGVGAFSENGPFRP-KGAVLVRNEYSWNKEANMLYLETPAGVGFSYSSDSSYYEGVNDR  148

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLK  659
             MTA +NL FL++WF +F +Y   D YIAG+SY GH  PQLA+L++E + K    R   LK
Sbjct  149   MTATDNLVFLQRWFTKFPQYEGRDLYIAGESYAGHYVPQLAQLMVESDDKQ---RVFNLK  205

Query  660   GIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             GIALGNP+LE      S  E  W +G+IS   Y +    C+ +R V E   G +S  C  
Sbjct  206   GIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTSACNYSRYVSEYYRGSLSSVCQR  265

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEV  1013
             +   ++ E    + K ++    C +   S S        T + D C+      YL+R +V
Sbjct  266   VMSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQQVTERVDVCVEDETVRYLNRRDV  325

Query  1014  QEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVS  1184
             Q ALHA+    + W          L +L +  +  + +L+K GIP+L+YSGD+D  IP++
Sbjct  326   QSALHAHLDGVTKWTVCSSVLEYELLDLEVPTISVVGSLVKSGIPVLVYSGDQDSVIPLT  385

Query  1185  HTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
              +R L   LA  L L T      W++G+Q+GGW+Q +G+         L+FATVRG SH 
Sbjct  386   GSRTLVQRLANELGLKTTVPYRVWFEGEQVGGWTQVYGDV--------LSFATVRGASHE  437

Query  1365  VPNSSPSKALTLFKAFLKGSPPPNT  1439
              P S P ++L LF+AFL+G P P T
Sbjct  438   APFSQPERSLVLFRAFLQGRPLPET  462



>gb|KDP37690.1| hypothetical protein JCGZ_06347 [Jatropha curcas]
Length=467

 Score =   330 bits (846),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 188/444 (42%), Positives = 255/444 (57%), Gaps = 27/444 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V F QY+GYI   +   RALFYYF EA+     S PL LWL GG  CSS 
Sbjct  32    IVKLPGQP-EVSFKQYAGYITIDENHKRALFYYFVEAEINSA-SKPLVLWLNGGPGCSSI  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+ D  L+KN FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  90    GAGAFCEHGPFKPSGD-ILLKNDFSWNKEANMLYLESPAGVGFSYSANDSFYASVNDEIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A++NL FL  WF +F EY+D DF+I G+SY GH APQLA+LI++ N K      I LKGI
Sbjct  149   AQDNLAFLEHWFSKFPEYKDRDFFITGESYAGHYAPQLAQLIVQSNAK------INLKGI  202

Query  666   ALGNPLLE--KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEI-LSGEMSEDCSDI  836
             A+GNPLLE      S  E+ W +G+IS   Y +    C+ +++ +E   SG +S  CS +
Sbjct  203   AIGNPLLEFDTDFNSRAEYFWSHGLISDATYQIFTTICNYSQIRREYEASGFLSPACSKV  262

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTE--TAKADPCLLTWVDDYLSRPE  1010
             N  +S E+   +   ++    C +     SQ H L       + D C+      YL+R +
Sbjct  263   NSEVSREVSKFVDTYDITLDVCLSS--VQSQAHLLNQMEYAGQIDVCVEDKTVKYLNRKD  320

Query  1011  VQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQEALHA     + W            NL I  +P +  L+K GI + +YSGD+D  IP+
Sbjct  321   VQEALHAQLLGVNAWTVCTDVVKYNTQNLEIPTIPIIGKLVKSGIRVFVYSGDQDSVIPL  380

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + TR L N LA +L L T      W++GKQ+ GW+Q +G+         L+FAT+RG SH
Sbjct  381   TGTRSLVNGLAKQLGLNTTVPYRTWFEGKQVAGWTQVYGDI--------LSFATIRGASH  432

Query  1362  FVPNSSPSKALTLFKAFLKGSPPP  1433
               P S P ++L LF +FL+G   P
Sbjct  433   EAPFSQPERSLVLFSSFLEGKQLP  456



>ref|XP_007209121.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
 gb|EMJ10320.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
Length=460

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 194/469 (41%), Positives = 270/469 (58%), Gaps = 21/469 (4%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++V  LWF +     S S       I  LPGQP  V F  +SGYI     + +ALFYYF 
Sbjct  6     VVVLQLWFSMEVESSSSSSHHPDHNITRLPGQP-HVGFQHFSGYITVDDQKHKALFYYFV  64

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             EA+  +  S PL LWL GG  CSS  +G F ENGPFRP  DGE LV+N++SWN  +NMLY
Sbjct  65    EAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLY  121

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TP+GV FSYS +SS Y    D  TAR+NL FL++WF +F +Y+  D ++ G+SY GH 
Sbjct  122   LETPVGVGFSYSKSSSSYVSVDDEATARDNLVFLQRWFNKFPQYKHRDLFLTGESYAGHY  181

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQ  761
              PQLA L++E NRK    +   +KGIALGNP+LE      S  E  W +G+IS   Y++ 
Sbjct  182   IPQLANLMVEINRKE---KLFSIKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNMF  238

Query  762   KRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCL  941
                C+ +R V E     +S  CS +   +S E    + K ++    C +   S S+    
Sbjct  239   TSVCNYSRYVSEYYRDSVSPSCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSKVISP  298

Query  942   GTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
                T + D C+   + +YL+R +VQ+ALHA       WD   +  +  + NL I  +  +
Sbjct  299   NQMTERIDVCVEDKIVNYLNRKDVQKALHARLVGVRRWDVCSNILDYQVLNLEIPTISLV  358

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+K GIP+L+YSGD+D  IP++ +R L   LA  L L T      W++GKQ+GGW+Q 
Sbjct  359   GSLVKAGIPVLVYSGDQDSVIPLTGSRTLVYRLARELGLNTTVPYRVWFEGKQVGGWTQV  418

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             +GN         L+FAT+RG SH  P S P ++L LFK+FL+G P P  
Sbjct  419   YGNI--------LSFATIRGASHEAPFSQPERSLRLFKSFLEGRPLPEV  459



>ref|XP_008239549.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=467

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 194/467 (42%), Positives = 272/467 (58%), Gaps = 23/467 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++V  LWF +   + S S       I  LPGQP  V F  +SGYI     + +ALFYYF 
Sbjct  15    VVVLQLWFSM--EVKSSSSHHPDHNITRLPGQP-HVGFQHFSGYITVDDQKHKALFYYFV  71

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             EA+  +  S PL LWL GG  CSS  +G F ENGPFRP  DGE LV+N++SWN  +NMLY
Sbjct  72    EAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLY  128

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TP+GV FSYS +SS Y    D  TAR+NL FL++WF +F +Y+  D ++ G+SY GH 
Sbjct  129   LETPVGVGFSYSKSSSSYVAVDDETTARDNLVFLQRWFNKFPQYKHRDLFLTGESYAGHY  188

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQ  761
              PQLA L++E NRK    +   LKGIALGNP+LE      S  E  W +G+IS   Y++ 
Sbjct  189   IPQLANLMVEINRKE---KLFSLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNMF  245

Query  762   KRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCL  941
                C+ +R V E     +S  CS +   +S+E    + K ++    C +   S S+    
Sbjct  246   TSVCNYSRYVSEYYRDSVSPSCSKVMSQVSKETSKFVDKYDVTLDVCISSVLSQSKVISP  305

Query  942   GTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTL  1112
                T + D C+   + +YL+R +VQ+ALHA       WD   +  +  + N+ I  +  +
Sbjct  306   NQMTERIDVCVEDKIVNYLNRKDVQKALHARLVGVRRWDVCSNILDYQVLNMEIPTISLV  365

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+K GIP+L+YSGD+D  IP++ +R L   LA  L L T      W++GKQ+GGW+Q 
Sbjct  366   GSLVKAGIPVLVYSGDQDSVIPLTGSRTLVYRLARELGLNTTVPYRVWFEGKQVGGWTQV  425

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +GN         L+FAT+RG SH  P S P ++L LFK+FL+G P P
Sbjct  426   YGNI--------LSFATIRGASHEAPFSQPERSLRLFKSFLEGRPLP  464



>ref|XP_006652227.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=467

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/449 (41%), Positives = 258/449 (57%), Gaps = 26/449 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKF--RGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I +LPGQP +V F QYSGYI       + R LFYYFAEA+  D  + PL LWL GG  CS
Sbjct  32    IGALPGQP-NVSFAQYSGYITVDAAAAKKRELFYYFAEAEL-DPDTKPLVLWLNGGPGCS  89

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G F ENGPFRP+ +  LV+N++SWN  +NM+Y+++P GV FSYS   S Y    D+
Sbjct  90    SVGVGAFSENGPFRPSGN-VLVRNEYSWNKEANMMYLESPAGVGFSYSTDPSFYGGVGDS  148

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLK  659
              TAR+NL+FL+ WF +F +Y+  D YI G+SY GH  PQLA+ ++E+N+K    +   LK
Sbjct  149   RTARDNLRFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLK  205

Query  660   GIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             GIALGNP+LE      S  E  W +G+IS   Y      C+ +R V E   G +S  C  
Sbjct  206   GIALGNPVLEFATDFNSRAEFFWSHGLISDATYRSFTAVCNYSRYVSEYYRGSLSAACDA  265

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEV  1013
             +    + E    + K ++    C +     S        + + D C+      YL+R +V
Sbjct  266   VMGAGATETSRFVDKYDVTLDVCVSSLSMQSLSLAPQRGSRELDVCVEDETMGYLNRKDV  325

Query  1014  QEALHA----NASTW---DSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLR  1172
             QEA+HA      + W    S+   R +   +L I  + T+  L+K G+P+L+YSGD+D  
Sbjct  326   QEAMHARLDGGVAKWTVCSSVLEYRQL---DLQIPTINTVGGLVKSGVPVLVYSGDQDSV  382

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             IP++ +R L   LA RL L T      W+ G+Q+GGW+Q +G  GGG     L FATVRG
Sbjct  383   IPLTGSRTLVQRLAARLRLNTTAPYRVWFQGRQVGGWTQAYG--GGG----TLAFATVRG  436

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              SH  P S P ++L LF+AFL G P P++
Sbjct  437   ASHEAPFSQPERSLVLFRAFLAGRPLPDS  465



>ref|XP_007046209.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
 gb|EOY02041.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
Length=401

 Score =   327 bits (837),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 182/395 (46%), Positives = 247/395 (63%), Gaps = 22/395 (6%)
 Frame = +3

Query  48    KIMVFLLWFLLVNTLYSIS--IRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFY  221
             K M FLL F +++  +        + E+I +LPGQP++V F QYSGYIVT    GRALFY
Sbjct  3     KRMRFLLAFRVISCFFLFFFFCSASAELIKALPGQPANVTFKQYSGYIVTEPKHGRALFY  62

Query  222   YFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNM  401
             YF E  S +    PLTLWL GG  CSS   G F E+GPF+P E+G L+KN++SWNL SNM
Sbjct  63    YFVEVDSANPGLHPLTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNLESNM  122

Query  402   LYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGG  581
             LY+++PIGV FSYSNTSSDY   +DT+TA ENL F+  WF +F +YRD D Y++G+SY G
Sbjct  123   LYLESPIGVGFSYSNTSSDYLGVNDTITAGENLIFILNWFKKFPQYRDSDLYLSGESYAG  182

Query  582   HLAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLE-KMGLSNVEHLWHYGIISTELYHL  758
             H  PQLA LIL YN++    RPIKLK IALGNPLL+ ++ ++N E LW +G+IS E+  L
Sbjct  183   HYIPQLAALILSYNKR-FSGRPIKLKAIALGNPLLDLEISVNNAEFLWSHGVISDEMLML  241

Query  759   QKRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTD--------Q  914
             +K  C  +R ++E L   +S+ C D+     EEIG      +L+   C +         Q
Sbjct  242   RKTVCSESRSLKESLHRNLSKQCIDVLNKEQEEIGSYTDPGDLILPICLSSTVLGQTVYQ  301

Query  915   YSSSQRHC--LGTETAKADPCLLTWVDDYLSRPEVQEALHANA----STWDSIFHGRNMI  1076
              + ++ H     T    +DPCL   +  YL+ P+VQEALHAN     S W+  F G +++
Sbjct  302   GALNRLHAKLAMTSAVASDPCLGDRIYQYLNTPKVQEALHANTTHLPSDWE--FCGGHLV  359

Query  1077  LN--NLAIDILPTLSALLKRGIPLLIYSGDEDLRI  1175
                 +L I+I+P LS LL+R IP+L++   E   I
Sbjct  360   YQRESLEINIIPLLSKLLRRSIPILLFKRIEACAI  394



>ref|XP_008454133.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=456

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 184/442 (42%), Positives = 254/442 (57%), Gaps = 23/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F  YSGYI       +ALFYYFAEAQ  D  S PL LWL GG  CSS 
Sbjct  29    ISSLPGQPL-VGFRHYSGYINVGDRNQKALFYYFAEAQV-DPPSKPLVLWLNGGPGCSSL  86

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TP+GV FSYS  +S Y+   D +
Sbjct  87    GVGAFSENGPFRPR--GEVLVRNEHSWNTEANMLYLETPVGVGFSYSTDTSSYEAVGDKI  144

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL+FL KWF+ F  YR+   +I G+SY GH  PQLAEL+++ N+         L+G
Sbjct  145   TARDNLEFLEKWFVRFPHYRNRSLFITGESYAGHYVPQLAELMVQSNKT-----SFNLRG  199

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IA+GNP+LE      S  E LW +G+IS   + +    C+ +R V E   G +S  CS +
Sbjct  200   IAIGNPVLEFATDFNSRAEFLWSHGLISDSTFKMFTSMCNYSRYVGEYYRGSVSPICSRV  259

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S+E    + K ++    C +  +S S+       T   D C+     +YL+R +V 
Sbjct  260   MSQVSKETSRFVDKYDVTLDVCISSVFSQSKILNPQQVTESVDVCVEDETVNYLNRQDVH  319

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       W       +  L +L +  +  +  L+  GI +L+YSGD+D  IP++ 
Sbjct  320   KALHARLVGVRRWAVCSSILDYELLDLEVPTINIVGKLINAGIQVLVYSGDQDSVIPLTG  379

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA  L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  
Sbjct  380   SRTLVHKLAKELGLQTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGASHEA  431

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LFK+FL+  P P
Sbjct  432   PFSQPERSLVLFKSFLQSQPLP  453



>ref|XP_006380972.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58769.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=467

 Score =   329 bits (843),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 183/467 (39%), Positives = 269/467 (58%), Gaps = 49/467 (10%)
 Frame = +3

Query  111   INGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGH  290
             +  + I  LPGQP  V F Q+SGYI   + + R+LFYYF EA++    S PL LWL GG 
Sbjct  24    LEADRIVRLPGQPP-VSFQQFSGYITVDEKQHRSLFYYFVEAETSPA-SKPLVLWLNGGP  81

Query  291   DCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
              CSS  +G F E+GPFRPT    LV+N++SWN  +NMLY+++P GV FSYS   + Y   
Sbjct  82    GCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKEANMLYLESPAGVGFSYSANQTFYSYV  141

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPI  650
             +D MTAR+NL FLR+WF++F +Y+  DF+IAG+SY GH  PQLA+LI+   R  V+    
Sbjct  142   NDEMTARDNLVFLRRWFVKFPQYKQRDFFIAGESYAGHYVPQLAQLII---RSKVN---F  195

Query  651   KLKGIALGNPLLE-KMGLSNVEHL-WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSED  824
              LKGIA+GNPLLE    L+  +H  W +G+IS   Y L    C+S+++++E L+G +S  
Sbjct  196   NLKGIAIGNPLLEFNTDLNAQDHFYWSHGLISDSTYQLLTSVCNSSKLMREALTGTVSSA  255

Query  825   CSDINVMISEEIGDDMHKDNLLFQSCQTDQYSS----------------SQRHCLGTETA  956
             C  +  ++ +E+ + +   ++    C +   S                 S +  +G    
Sbjct  256   CLGVYTLVQKELSESIDPYDVTGDICLSSNQSQLKIFHQQLLRSRLPYLSPQQVMG----  311

Query  957   KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMIL----NNLAIDILPTLS  1115
             K D CLL    +YL+R +VQ ALHA     + W    H  +++L    +N     +  + 
Sbjct  312   KVDVCLLEETTNYLNRKDVQMALHARLVGVTNW----HVCSVVLEYDRSNEERPTIHVVR  367

Query  1116  ALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTF  1295
             +L+K G+ +L+YSGD+D  I  + TR L + +A  L L T      W  G Q+GGW+Q +
Sbjct  368   SLVKSGLAVLVYSGDQDSIIAFTGTRSLVSKIAKDLRLKTTVPYRAWLSGNQVGGWTQVY  427

Query  1296  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1436
             G+        NL+FAT+RG SH  P++ P ++L LFK+FL+  P P 
Sbjct  428   GD--------NLSFATIRGASHTAPSTQPKRSLLLFKSFLEKKPLPT  466



>ref|XP_009355265.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   328 bits (842),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 182/444 (41%), Positives = 265/444 (60%), Gaps = 29/444 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F QY+GY+   + + R+LFYYF EAQ+ D  S PL LWL GG  CSS 
Sbjct  35    IARLPGQP-QVNFQQYAGYVTVDEKQERSLFYYFVEAQT-DPASKPLVLWLNGGPGCSSI  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPF+P+ED  L+KN FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  93    GVGAFNENGPFQPSEDN-LLKNDFSWNREANMLYLESPAGVGFSYSANKSFYGFVNDDIT  151

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A++NL+FL++WF EF EY++ D +I G+SY GH  PQLA+LI++   K        LK +
Sbjct  152   AQDNLEFLQRWFDEFPEYKNRDLFITGESYAGHYVPQLAQLIIQSKLK------FNLKAV  205

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQE--ILSGEMSEDCSD  833
             A+GNPL E      S  E+LW +G+IS   +      C+ + + ++  I  G +S  C +
Sbjct  206   AIGNPLFEFSTDINSRAEYLWSHGLISDATFENLTSVCNYSEIFRQEVIRGGPLSPACDE  265

Query  834   INVMISEEI-GDDMHKDNLLFQSCQTD-QYSSSQRHCLGTETAKADPCLLTWVDDYLSRP  1007
             +      E+ G  +++ ++    C +  +  SSQ      +T K D C+   +  YL+RP
Sbjct  266   VANQFEREVPGHLINQYDVTLDVCLSSVEAQSSQLR----KTVKIDVCIGDEIVTYLNRP  321

Query  1008  EVQEALHANASTWDSIFHGRNMI--LNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             ++QEALHA  + W +  +G  +   + NL I +LP L  L+K GI +LIYSGD+D  IP+
Sbjct  322   DLQEALHARLTNWTTCSNGGVLEYDMKNLEIPMLPVLGDLVKSGIRVLIYSGDQDSVIPL  381

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + TR L + LA  L L T      W++ KQ+ GW+Q + ++        L++AT+RG  H
Sbjct  382   TSTRTLVSGLAKDLGLQTNVPYRVWFEEKQVAGWTQVYSDA--------LSYATIRGAGH  433

Query  1362  FVPNSSPSKALTLFKAFLKGSPPP  1433
               P S P ++L LF +FL+G P P
Sbjct  434   EAPISQPERSLLLFTSFLRGKPLP  457



>ref|XP_010099600.1| Serine carboxypeptidase-like 45 [Morus notabilis]
 gb|EXB79994.1| Serine carboxypeptidase-like 45 [Morus notabilis]
Length=464

 Score =   328 bits (842),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 185/447 (41%), Positives = 261/447 (58%), Gaps = 28/447 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+     +  +LFYYF EA+ +D  S PL LWL GG  CSS 
Sbjct  32    IHELPGQP-QVGFQQFSGYVKVDAQKNTSLFYYFVEAE-KDPSSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +G+ L++N++SWN  +NMLY++TP+GV FSYS  SS Y    D  
Sbjct  90    GVGAFSENGPFRP--NGKILLRNKYSWNREANMLYLETPVGVGFSYSTNSSSYVAVDDKA  147

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR NL FLR WF +F +YR  D ++ G+SY GH  PQLA+L++E NRK    +   LKG
Sbjct  148   TARANLIFLRGWFRKFPQYRKRDLFLTGESYAGHYIPQLAKLMVEVNRKR---KVFNLKG  204

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E+LW +G+IS   Y +    C+ +R V E     +S  C  +
Sbjct  205   IALGNPVLEYATDFNSRAEYLWSHGLISDTTYKMFNSVCNYSRYVSEYYRDAVSPTCLRV  264

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA-----DPCLLTWVDDYLS  1001
                ++ E  + + K ++    C +   S S+   L  +  K      D C+   V  YL+
Sbjct  265   INQVNAETSNFVDKYDVTLDVCISSVLSQSK--VLNPKPQKVSDQTIDVCVDDKVVKYLN  322

Query  1002  RPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLR  1172
             R +VQ ALHA       WD+  +  +  + N+ +  +  + +L+K GI +L+YSGD+D  
Sbjct  323   RRDVQRALHARLVGVRQWDACSNILDYEVLNVELPTISIVGSLVKAGISVLVYSGDQDSV  382

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             IP+  +R L + LA+ L L T      W+ GKQ+GGW+Q +GN+        L+FAT+R 
Sbjct  383   IPLMGSRTLVDKLASELGLKTTVPYRVWFQGKQVGGWTQVYGNA--------LSFATIRD  434

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              SH  P S P ++L LFK+FL+G+P P
Sbjct  435   ASHEAPFSQPERSLILFKSFLQGNPLP  461



>ref|XP_004152156.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 ref|XP_004169817.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 gb|KGN52977.1| hypothetical protein Csa_4G008800 [Cucumis sativus]
Length=456

 Score =   328 bits (841),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 183/442 (41%), Positives = 254/442 (57%), Gaps = 23/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F  YSGY+       +ALFYYFAEAQ  D  S PL LWL GG  CSS 
Sbjct  29    ISSLPGQPL-VGFRHYSGYVNVGDRNQKALFYYFAEAQV-DPPSKPLVLWLNGGPGCSSL  86

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TP+GV FSYS  +S Y+   D +
Sbjct  87    GVGAFSENGPFRPR--GEVLVRNEHSWNTEANMLYLETPVGVGFSYSTDTSSYEAVGDKI  144

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL+FL KWF+ F  YR+   +I G+SY GH  PQLAEL+++ N+         L+G
Sbjct  145   TARDNLEFLEKWFVRFPHYRNRSLFITGESYAGHYVPQLAELMVQSNKT-----SFNLRG  199

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IA+GNP+LE      S  E LW +G+IS   + +    C+ +R V E   G +S  CS +
Sbjct  200   IAIGNPVLEFATDFNSRAEFLWSHGLISDSTFKMFTSMCNYSRYVGEYYRGSVSPICSRV  259

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S+E    + K ++    C +  +S S+       T   D C+     +YL+R +V 
Sbjct  260   MSQVSKETSRFVDKYDVTLDVCISSVFSQSKILNPQQVTESVDVCVEDETVNYLNRQDVH  319

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +ALHA       W       +  L +L +  +  +  L+  GI +L+YSGD+D  IP++ 
Sbjct  320   KALHARLVGVRRWAVCSSILDYELLDLEVPTINIVGKLINAGIQVLVYSGDQDSVIPLTG  379

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA  L L T      W++G+Q+GGW+Q +GN         L+FAT+RG SH  
Sbjct  380   SRTLVHKLAKELGLQTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGASHEA  431

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LFK+FL+  P P
Sbjct  432   PFSQPERSLVLFKSFLQSQPLP  453



>ref|XP_010682654.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score =   328 bits (841),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 186/474 (39%), Positives = 270/474 (57%), Gaps = 27/474 (6%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIV--------THKFRG  206
             + + L+  +++     + +    + I SLPGQPS V+F  YSGY+         T+    
Sbjct  11    VKMLLVLHVVIKIGSVMMLEFEADKITSLPGQPS-VNFQHYSGYVYVSFANQTQTNHNNQ  69

Query  207   RALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWN  386
             +A+FYYF EA++E   S PL LWL GG  CSS  +G F ENGPFRP  +  L+ N +SWN
Sbjct  70    KAMFYYFVEAETE-PVSKPLVLWLNGGPGCSSLGVGAFSENGPFRPAGN-RLIINHYSWN  127

Query  387   LASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAG  566
               +NMLY++TP GV FS+S   S Y+  +D  TAR+NLKFL+KWF++F  Y++   YI G
Sbjct  128   KEANMLYLETPAGVGFSHSTNISSYETANDHTTARDNLKFLQKWFLKFPHYQNRSLYITG  187

Query  567   DSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIIS  740
             +SY GH  PQLAEL+L++N+K    +   LKGIALGNP+LE +    S  E+ W +G+IS
Sbjct  188   ESYAGHYVPQLAELMLQFNKKE---KLFNLKGIALGNPVLEFITDFNSRAEYFWSHGLIS  244

Query  741   TELYHLQKRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYS  920
                Y++    C+ +R V E   G +S  CS +  ++S E    + K ++    C    +S
Sbjct  245   DSTYNVFTSACNYSRYVGEYYRGFVSPMCSKVMSLVSRETSRFVDKYDVTLDVCLPSIFS  304

Query  921   SSQRHCLGTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLA  1091
              S+           D C+      YL+R +VQ+ALHA     ++W       +  + +L 
Sbjct  305   QSKFLTPHQVGETIDVCVEDETVGYLNRRDVQKALHARLVGVNSWTVCSRILDYEMLDLE  364

Query  1092  IDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQ  1271
                +  +  L+K GIP+LIYSGD+D  +P++ +R L   LA  L L T      W+ GKQ
Sbjct  365   RPTIHLIGNLVKAGIPVLIYSGDQDSVVPLTGSRTLVKRLAEELKLNTTVPYRVWFVGKQ  424

Query  1272  IGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +GGW++  G+         L+FATVRG SH  P S P ++L LFK+FL+G P P
Sbjct  425   VGGWTEVHGDL--------LSFATVRGASHEAPFSQPERSLVLFKSFLEGKPLP  470



>ref|XP_009759845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=463

 Score =   328 bits (840),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 178/462 (39%), Positives = 265/462 (57%), Gaps = 19/462 (4%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +  FL   +L  ++   + + I  LPGQP  V F Q+SGY+     + ++LFYYF EA++
Sbjct  13    IFLFLFCVSLGIVAALPHPDKIIQLPGQP-QVGFQQFSGYVTVDDKKQKSLFYYFVEAET  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              +  S PL LWL GG  CSS  +G F ENGPFRP     LV+N++SWN  +NMLY+++PI
Sbjct  72    -NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEYSWNKEANMLYLESPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYSN +S Y+  +D +TAR+NL FL +WF +F +YR  + ++ G+SY GH  PQLA
Sbjct  130   GVGFSYSNNTSSYETVNDEVTARDNLVFLLRWFQKFPQYRKSNLFLTGESYAGHYVPQLA  189

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             +L++ +N+K    +   LKG+ALGNP+LE      S  E+ W +G+IS   Y +    C+
Sbjct  190   KLMMVFNKKQ---QIFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFSSACN  246

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA  956
              +R V E   G +S  CS +  ++S E    + K  +    C +   S S+         
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISSVLSQSKIISPQENVE  306

Query  957   KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLK  1127
             K D C+   + +YL+R +V+ ALHA       W    +  +  L ++ I  +  +  L+K
Sbjct  307   KLDVCVEDEIINYLNRKDVRRALHAELVGVRRWAVCSNILDYQLLDIEIPTISIIGMLVK  366

Query  1128  RGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSG  1307
               IP+LIYSGD+D  IP+  +R   + LA R+ L T      W+ G+Q+GGW+  + N  
Sbjct  367   ERIPVLIYSGDQDSVIPLIGSRATVHQLARRMQLNTTVPYRVWFAGQQVGGWTHVYDNI-  425

Query  1308  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                    L+FAT+RG SH  P S P ++L LF++FL+G P P
Sbjct  426   -------LSFATIRGASHEAPFSQPERSLVLFRSFLEGRPLP  460



>ref|XP_006294161.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
 gb|EOA27059.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
Length=465

 Score =   327 bits (839),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 185/447 (41%), Positives = 262/447 (59%), Gaps = 27/447 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+     + RALFYY AEA+++   S PL LWL GG  CSS 
Sbjct  34    ITRLPGQPR-VGFQQYSGYVNIDDKKQRALFYYLAEAETK-PISKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSY+  SS Y+  +D +T
Sbjct  92    GVGAFSENGPFRP-KGSILVKNQHSWNQEANMLYLETPVGVGFSYATESSSYEGVNDKIT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A++NL FL+KWF++F +Y +   +I G+SY GH  PQLA+L+++YN+K        LKGI
Sbjct  151   AKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKH---NLFNLKGI  207

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNP++E      S  E+ W +G+IS   Y +    C+ +R V E   G +S  C+ + 
Sbjct  208   AIGNPVMEFSTDFNSRAEYFWSHGLISDLTYKMFTSYCNYSRYVSEYYRGTVSSMCTKVM  267

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSS-----QRHCLGTETAKADPCLLTWVDDYLSR  1004
               +S E    + K ++    C     S S     Q   +G ET   D C+     +YL+R
Sbjct  268   SQVSIETSRFVDKYDVTLDVCIPSVLSQSKVVNPQPQQMG-ET--VDVCVEDETVNYLNR  324

Query  1005  PEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRI  1175
              +VQ+ALHA       W    +  +  + ++ +  +  + +L+K  +P+L+YSGD+D  I
Sbjct  325   RDVQKALHARLVGTRKWAVCSNVLDYEVLDVEVPTINIVGSLVKARVPVLVYSGDQDSVI  384

Query  1176  PVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGG  1355
             P++ +R L   LA  L L T      W+ G+Q+GGW+Q +GN         L FATVRG 
Sbjct  385   PLTGSRTLVKRLAEELGLRTTGPYRVWFAGQQVGGWTQVYGNI--------LAFATVRGA  436

Query  1356  SHFVPNSSPSKALTLFKAFLKGSPPPN  1436
             +H VP S P++AL LFKAFL G P P+
Sbjct  437   AHEVPFSQPARALVLFKAFLGGRPLPD  463



>emb|CAN72076.1| hypothetical protein VITISV_041583 [Vitis vinifera]
Length=451

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 177/441 (40%), Positives = 257/441 (58%), Gaps = 31/441 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  35    ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTALKPLVVWFSGGPGCSSV  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
                   ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  94    GA----QHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA+LILE   K        LKGI
Sbjct  149   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESRVK------FNLKGI  202

Query  666   ALGNPLLE-KMGLSNVEHL-WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
              +G+PL++     ++V H  W +G+IS   Y+L   +C+ +RM +E  SG +S  C  + 
Sbjct  203   LMGBPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  262

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
                S+E+GD + + ++   SC        Q       T   D C+   V+ Y +R +VQ+
Sbjct  263   SQYSQEVGDSVDRFDVTLNSCLPSVDPQPQ------VTENVDVCIGDEVNKYXNREDVQK  316

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             +LHA     + W          + +  I ++P + +L+K GI   +YSGD+D  IP+  T
Sbjct  317   SLHARLVGVANWSMCSGALRYNIKDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFGT  376

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA  L L T      W++G+Q+GGW+Q +G+         L+FATVRGGSH VP
Sbjct  377   RTLVDGLAKXLRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTVP  428

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              + P++AL LF AFLKG PPP
Sbjct  429   GTQPARALVLFTAFLKGQPPP  449



>ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF51706.1| serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 183/458 (40%), Positives = 264/458 (58%), Gaps = 19/458 (4%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKF  254
             ++  +  S+S   + + I  LPGQP  V F Q+SGY+     + RALFYYF EA+  D  
Sbjct  14    MMFQSCISLSSSFHSDKIVRLPGQP-HVGFQQFSGYVSVDDKKHRALFYYFVEAEI-DPA  71

Query  255   SMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAF  434
             S PL LWL GG  CSS  +G F ENGPFRP +   LV+N++SWN  +NMLY++TP+GV F
Sbjct  72    SKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGKVLVRNEYSWNKEANMLYLETPVGVGF  130

Query  435   SYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELIL  614
             SY+  SS Y    D  TAR+NL FL+ W+  F +YR  D +I G+SY GH  PQLA+L++
Sbjct  131   SYATDSSSYLAVDDEATARDNLVFLKHWYNRFPQYRHRDLFITGESYAGHYIPQLAKLMV  190

Query  615   EYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRM  788
             E N+K    +   LKGIALGNP+LE      S  E+LW +G+IS   + +    C+ +R 
Sbjct  191   EINKKE---KLFHLKGIALGNPVLEFATDFNSRAEYLWSHGLISDSTFKMFTAACNYSRY  247

Query  789   VQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADP  968
             V E     +S  CS +   ++ E    + K ++    C +   S S+       + + D 
Sbjct  248   VSEYYRDSLSTICSRVMSRVNTETSRFVDKYDVTLDVCISSILSQSKVLRPQQVSERIDV  307

Query  969   CLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIP  1139
             C+     +YL+R +VQ+ALHA       W+   +  +  L NL I  +  + +L+K GIP
Sbjct  308   CVDDETMNYLNRKDVQKALHARLVGVGRWEVCSNILDYELLNLEIPTISVVGSLVKAGIP  367

Query  1140  LLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEK  1319
             +L+YSGD+D  IP++ +R L + LA  L L T      W+  KQ+GGW+Q + +      
Sbjct  368   VLVYSGDQDSVIPLTGSRTLVHGLAKELGLNTTVPYRVWFAEKQVGGWTQVYSDI-----  422

Query  1320  VANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                L+FAT+RG +H VP S P ++L LFK+FL+G   P
Sbjct  423   ---LSFATIRGAAHEVPYSQPERSLVLFKSFLEGKHLP  457



>ref|XP_006430527.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
 gb|ESR43767.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
Length=455

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 182/465 (39%), Positives = 261/465 (56%), Gaps = 27/465 (6%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEI-----IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             W ++V+ L+  +I     +     I SLPGQP    F QY+GYI   + + RALFYYF E
Sbjct  6     WIIIVSALFCTTILTAKSVPQADKIISLPGQP-QASFQQYAGYITIDEKQQRALFYYFVE  64

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A +E   S PL LWL GG  CSS   G F E+GPF+P+ D  L++N++SWN  +NMLY++
Sbjct  65    AATEAA-SKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-TLLRNEYSWNKEANMLYLE  122

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS   S Y   +D + AR+NL FL  W+ +F+EY++ +F+I G+SY GH  P
Sbjct  123   SPAGVGFSYSANKSFYGSINDAIAARDNLAFLEGWYEKFTEYKNREFFITGESYAGHYVP  182

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKR  767
             QLA+LI++ N K        LKGIA+GNPLLE      S  E LW +G+IS   Y +  R
Sbjct  183   QLAQLIIQSNMK------FNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDSTYDIFTR  236

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT  947
              C+ +++ ++  SG ++  CS +   +S EI   +   ++    C       S+      
Sbjct  237   VCNYSQIRRQYASGSLTAVCSQVISQVSREISRFVDTYDVTLDVCLPSVLLQSKMLSQLQ  296

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
             +  + D C+      YL+R +VQ+ALHA     ++W          + NL I  +  L  
Sbjct  297   DKEEIDVCVEDETTKYLNRKDVQKALHAQLIGVTSWTVCSEVLKYDMQNLEIPTIHVLGK  356

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L K GI +L+YSGD+D  +P++ TR L N LA  + L T      W +G+Q  GW+Q +G
Sbjct  357   LAKSGIRVLVYSGDQDSVLPLTGTRTLVNGLAKEIGLNTTVPYRTWVEGRQAAGWTQVYG  416

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +         L+FAT+RG SH  P S P ++L LF AFL G P P
Sbjct  417   DI--------LSFATIRGASHEAPLSQPRRSLALFNAFLGGKPLP  453



>ref|XP_009599118.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana tomentosiformis]
Length=457

 Score =   326 bits (835),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 185/472 (39%), Positives = 272/472 (58%), Gaps = 30/472 (6%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRING----EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFY  221
             M   ++F L+     I+   NG    + I  LPGQP  V F Q+SGY+     + RALFY
Sbjct  1     MTLSIFFFLLCAFVGIA---NGFPQPDKIILLPGQP-QVGFQQFSGYVTVDDKKQRALFY  56

Query  222   YFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASN  398
             YF EA+     S PL LWL GG  CSS  +G F ENGPFRP  +G+ LVKN++SWN  +N
Sbjct  57    YFVEAEINPA-SKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVKNEYSWNKEAN  113

Query  399   MLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYG  578
             MLY+++PIGV FSYS  +S Y+  +D  TAR+N+ FL++WF +F +YR+ + ++ G+SY 
Sbjct  114   MLYLESPIGVGFSYSTNTSSYETVNDVTTARDNVVFLQRWFNKFPQYRNSNLFLTGESYA  173

Query  579   GHLAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELY  752
             GH  PQLA+L++E N+     +   LKG+ALGNP+LE      S  E+ W +G+IS   Y
Sbjct  174   GHYVPQLAKLMIELNQMK---KLFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDSTY  230

Query  753   HLQKRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR  932
              +    C+ +R V E     +S  CS +  ++S E    + K ++    C +  +S S+ 
Sbjct  231   RMFTSFCNYSRYVSEYYRDNVSPMCSRVMSLVSRETSKFVDKYDVTLDVCLSSVFSQSKI  290

Query  933   HC--LGTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAID  1097
              C     +  K D C+     +YL+R +V+ ALHA       WD   +  +  L ++ I 
Sbjct  291   ICPQENADAEKIDVCIDDKTVNYLNREDVRRALHAKLVGVRRWDVCSNILDYQLLDIEIP  350

Query  1098  ILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIG  1277
              +  +  L+K  IP+LIYSGD+D  +P++ +R + + LA R+ L T      W+ G+Q+G
Sbjct  351   TISIVGLLVKERIPVLIYSGDQDSVVPLTGSRTVIHQLAKRMGLNTTVPYRVWFAGQQVG  410

Query  1278  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             GW+  + N         L+FATVRG SH VP S P ++L LFK+FL+G   P
Sbjct  411   GWTVVYDNI--------LSFATVRGASHEVPFSQPERSLVLFKSFLEGRALP  454



>ref|XP_002307961.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
 gb|EEE91484.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
Length=482

 Score =   327 bits (837),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 193/493 (39%), Positives = 265/493 (54%), Gaps = 46/493 (9%)
 Frame = +3

Query  60    FLLWFLLVNTLYSISIRINGEIID----SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             +++  ++  T   IS  ++   +D    SLPGQP  V F QYSGY+   + + RALFYYF
Sbjct  6     WIIMVVICATFMQISRAVDSSSVDDKILSLPGQPP-VSFQQYSGYVTVDENQDRALFYYF  64

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA+S D  S PL LWL GG  CSS  IG F ENGPFRP   G LV+N + WN  +NMLY
Sbjct  65    VEAES-DPASKPLVLWLNGGPGCSSFGIGAFSENGPFRPRGGGLLVRNDYRWNKEANMLY  123

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             +++P GV FSYS   S Y + +DT+TA+++  FL+ WF++F EY+D DFYI G+SY GH 
Sbjct  124   LESPAGVGFSYSANQSFYDLVNDTITAQDSYIFLQLWFVKFPEYKDRDFYITGESYAGHY  183

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNVE--HLWHYGIISTELYHLQ  761
              PQLA LI +   K        LKGIA+GN LLE     N E  + W +G+IS   Y L 
Sbjct  184   VPQLAHLIAQSGLK------FNLKGIAVGNALLEFNTDFNSEGDYYWAHGLISDATYELM  237

Query  762   KRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC------QTD----  911
                C+S+++ +E ++G     C  +N  +S E  +     N++   C      Q D    
Sbjct  238   NSVCNSSQLWRESITGSRFAACVVVNKRLSIEFPNSFDDYNVIGDICISSGESQLDVPSY  297

Query  912   ------QYSSSQRHCLGT-----ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWD  1049
                   Q SSS +          +    D C+      YL+R +VQEALHA     + W 
Sbjct  298   PFRPKFQVSSSTQSVQAALDQTKDAENIDVCVQEKSSQYLNRKDVQEALHAQLVGVTRWT  357

Query  1050  SIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNL  1229
                   N    N  I  +  + +L+  GI +L+YSGD+D  IP   +R L + LA  L L
Sbjct  358   GCSSVVNYDRRNFEIPTINIVGSLVSSGIRVLVYSGDQDSVIPFIGSRILVDGLAKELGL  417

Query  1230  TTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKA  1409
                    PW++ KQ+GGW+Q +G+         LTFAT+RG  H  P +SP ++L LF A
Sbjct  418   NATVPYRPWFEDKQVGGWTQVYGDI--------LTFATIRGAGHLAPLTSPKRSLALFSA  469

Query  1410  FLKGSPPPNTHPD  1448
             FL G P P   P+
Sbjct  470   FLSGKPLPEALPN  482



>ref|XP_004235841.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=455

 Score =   326 bits (835),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 183/468 (39%), Positives = 267/468 (57%), Gaps = 21/468 (4%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             + VFL  FLL   +  +S   + + I  LPGQP  V F Q+SGY+     + R+LFYYF 
Sbjct  3     MAVFL--FLLYAYVGIVSALPHPDKITKLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFV  59

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA++ D  S PL LWL GG  CSS  +G F ENGPFRP  +G LV N+ SWN  +NMLY+
Sbjct  60    EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVINEHSWNKEANMLYL  117

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYS+ +S Y+  +D +TAR+N+ FL +WF +F +YR  + ++ G+SY GH  
Sbjct  118   ESPIGVGFSYSSDTSSYETVNDEITARDNVVFLLRWFHKFPQYRKSNLFLTGESYAGHYV  177

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQK  764
             PQLA+L++ +N+K    +   LKGIALGNP+LE      S  E+ W +G+IS   Y +  
Sbjct  178   PQLAKLMMAFNKKQ---QLFNLKGIALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFS  234

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG  944
               C+ +R V E     +S  CS +  ++S E    + K ++    C +   S S+     
Sbjct  235   SACNYSRYVSEYYRDTVSPICSRVMSLVSRETSKFVDKYDVTLDVCISSVLSQSKIISPQ  294

Query  945   TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLS  1115
               + K D C+   V +YL+R +V+ ALHA       W       +  L ++ I  +  + 
Sbjct  295   ENSEKLDVCVEDEVVNYLNRKDVKRALHAELVGVHRWSVCSSILDYQLLDIEIPTISIIG  354

Query  1116  ALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTF  1295
              L+K  IP+LIYSGD+D  +P+  +R     LA ++ L T      W+ G+Q+GGW+  +
Sbjct  355   TLIKERIPVLIYSGDQDSVVPLIGSRATVQQLARQMQLNTTVPYRVWFAGQQVGGWTHVY  414

Query  1296  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              N         L+FAT+RG SH  P S P ++L LFK+FL+G P P  
Sbjct  415   DNI--------LSFATIRGASHEAPFSQPERSLVLFKSFLEGKPLPEV  454



>ref|XP_011040753.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=482

 Score =   327 bits (837),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 190/493 (39%), Positives = 267/493 (54%), Gaps = 46/493 (9%)
 Frame = +3

Query  60    FLLWFLLVNTLYSISIRINGEIID----SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             +++  ++  T   IS  ++   +D    SLPGQP  V F QY+GY+   + + RALFYYF
Sbjct  6     WIIMVVICATFMQISRAVDSSSVDDKILSLPGQPP-VSFQQYAGYVTVDENQDRALFYYF  64

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA+S D  S PL LWL GG  CSS  IG F ENGPFRP   G LV+N +SWN  +NMLY
Sbjct  65    VEAES-DPASKPLVLWLNGGPGCSSFGIGAFSENGPFRPRGGGLLVRNDYSWNKEANMLY  123

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             +++P GV FSYS   S Y + +DT+TA+++  FL++WF++F EY+D DFYI G+SY GH 
Sbjct  124   LESPAGVGFSYSANQSFYDLVNDTITAQDSYIFLQQWFVKFPEYKDRDFYITGESYAGHY  183

Query  588   APQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNVE--HLWHYGIISTELYHLQ  761
              PQLA LI +   K        LKGIA+GN LLE     N E  + W +G+IS   Y L 
Sbjct  184   VPQLAHLIAQSGLK------FNLKGIAVGNALLEFNTDLNSEGDYYWAHGLISDATYELM  237

Query  762   KRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC------QTD----  911
                C+S+++ +E ++G     C  +N  +S E  +     N++   C      Q D    
Sbjct  238   NSVCNSSQLWRESITGSSFAACVVVNKRLSVEFPNAFDDYNVIGDICISSGESQLDVPSY  297

Query  912   ------QYSSSQRHCLGT-----ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWD  1049
                   + SSS +          +    D C+      YL++ +VQEALHA     + W 
Sbjct  298   PFRPKFKVSSSTQSVQAALDQTKDAGNIDVCVQEKSSQYLNKKDVQEALHAQLVGVTRWT  357

Query  1050  SIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNL  1229
                   N    N  I  +  + +L+  GI +L+YSGD+D  IP   +R L + LA  L L
Sbjct  358   GCSSVVNYDRRNFEIPTINIVGSLVSSGIRVLVYSGDQDSVIPFMGSRILVDGLAKELGL  417

Query  1230  TTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKA  1409
                    PW++ KQ+GGW+Q +G+         LTFAT+RG  H  P +SP ++L LF A
Sbjct  418   NATVPYRPWFEDKQVGGWTQVYGDI--------LTFATIRGAGHLAPLTSPKRSLALFSA  469

Query  1410  FLKGSPPPNTHPD  1448
             F+ G P P   P+
Sbjct  470   FMSGKPLPEALPN  482



>ref|XP_008443350.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=479

 Score =   327 bits (837),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 189/462 (41%), Positives = 260/462 (56%), Gaps = 49/462 (11%)
 Frame = +3

Query  126   IDSLPGQPSD--VDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I SLP QPSD   +F Q+ GY+   + +GRALFYYF EAQ+    S PL LWL GG  CS
Sbjct  32    IRSLPSQPSDSKANFKQFGGYVTVDEKQGRALFYYFVEAQTPQPTSKPLVLWLNGGPGCS  91

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S  +G F E+GPF+   +GE LVKN++SWN  +NMLYV++P GV FSYS+  S Y    D
Sbjct  92    SVGVGAFIEHGPFKI--NGEVLVKNEYSWNTEANMLYVESPAGVGFSYSSNKSFYFKIDD  149

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
              +TAR+N+ FL+ WF +F EY++ DFYI G+SYGGH  PQLA+LIL+          IKL
Sbjct  150   KITARDNMLFLQNWFDKFPEYKNADFYITGESYGGHYVPQLAQLILKSRTN------IKL  203

Query  657   KGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KGIA+GNPLL+ +   N   +++W +G++S  +Y L    C+++R  QEI  G +S +C+
Sbjct  204   KGIAIGNPLLDIVNDFNARDKYMWSHGVVSDSIYKLLSSVCNTSRFYQEIFQGSISSECT  263

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQ----------------YSSSQRHCLGTETAKA  962
              +  ++S+++   +   N++   C                     S+SQRH L       
Sbjct  264   VVISLLSQQLSPFIDDYNVIGDVCSLAAKSQPSILLHPLSSFITKSASQRHLLSHPQENV  323

Query  963   ----DPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNM----ILNNLAIDILPT  1109
                 D C    V  YL+R +VQ+ALHA       W S+ +  N      L N  I  +  
Sbjct  324   GVDRDICSQENVAKYLNRKDVQKALHAKLVGVHQW-SVCNTNNTDWLYDLKNWLIPTIDV  382

Query  1110  LSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQ  1289
             + +L+K  I +L+YSGD+D  IP + TR L N LA  L L      + W    Q GGWS+
Sbjct  383   VGSLVKSQIRVLVYSGDQDTVIPFTGTRTLVNSLAKSLGLNITMSYKVWIVDNQAGGWSE  442

Query  1290  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFL  1415
              +G          LTFA+VRG SH  P + P + L LFKAFL
Sbjct  443   AYGKF--------LTFASVRGASHLAPETQPKRTLALFKAFL  476



>ref|XP_007043818.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 ref|XP_007043819.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99649.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99650.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
Length=462

 Score =   326 bits (835),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 266/468 (57%), Gaps = 31/468 (7%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEA  236
             L F+++   + + +  +  + D    LPGQP  V F QYSGY+   + + RALFYYFAEA
Sbjct  11    LGFIVLEVWFCVQVECSLALFDRITQLPGQPK-VGFQQYSGYVTVDEKKQRALFYYFAEA  69

Query  237   QSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVD  413
             +  D  S PL LWL GG  CSS  +G F ENGPFRP+  GE LVKN++SWN  +NMLY++
Sbjct  70    EV-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPS--GEVLVKNEYSWNREANMLYLE  126

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
              PIGV FSYS  +S Y+   D +TAR+NL F++ WF++F +YR+   +I G+SY GH  P
Sbjct  127   APIGVGFSYSTDASSYEAVDDKITARDNLVFMQNWFLKFPQYRNRSLFITGESYAGHYIP  186

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGL---SNVEHLWHYGIISTELYHLQK  764
             QLAEL+L++NRK    +   LKGIALGNP+LE   +   S  E  W +G+IS   Y +  
Sbjct  187   QLAELMLQFNRKD---KLFNLKGIALGNPVLE-FAIDFNSRAEFFWSHGLISDSTYKMFT  242

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG  944
               C+ +R V E     +S  CS +   +S E    + K ++    C +   S S+     
Sbjct  243   TSCNYSRYVSEYYRDAVSPICSRVMRQVSTETSRFVDKYDVTLDVCISSMLSQSKVLTPQ  302

Query  945   TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWD--SIFHGRNMILNNLAIDILPT  1109
                   D C+     +YL+R +VQ+ALHA       W   S      ++ N   + ++  
Sbjct  303   QVGETIDVCVEDETANYLNRQDVQKALHARLVGVRKWAVCSNVLDYELLENTEHVIVIWL  362

Query  1110  LSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQ  1289
             +  L+     +L  SGD+D  IP++ +R L N LA  L L T      W++G+Q+GGW+Q
Sbjct  363   IVVLITY---VLKCSGDQDSVIPLTGSRTLVNRLAKELGLKTTVTYRVWFEGQQVGGWTQ  419

Query  1290  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              +GN         L+FAT+RG SH  P S P ++L LFKAFL+G P P
Sbjct  420   VYGNI--------LSFATIRGASHEAPFSQPERSLVLFKAFLEGRPLP  459



>ref|XP_006482059.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=455

 Score =   325 bits (834),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 182/465 (39%), Positives = 260/465 (56%), Gaps = 27/465 (6%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEI-----IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             W  +V+ L+  +I     +     I SLPGQP    F QY+GYI   + + RALFYYF E
Sbjct  6     WITIVSALFCTTILTAKSVPQADKIISLPGQP-QASFQQYAGYITIDEKQQRALFYYFVE  64

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A +E   S PL LWL GG  CSS   G F E+GPF+P+ D  L++N++SWN  +NMLY++
Sbjct  65    AATEAA-SKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-TLLRNEYSWNKEANMLYLE  122

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS   S Y   +D + AR+NL FL  W+ +F EY++ +F+I G+SY GH  P
Sbjct  123   SPAGVGFSYSANKSFYGSVNDAIAARDNLAFLEGWYEKFPEYKNREFFITGESYAGHYVP  182

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKR  767
             QLA+LI++ N K      + LKGIA+GNPLLE      S  E LW +G+IS   Y +  R
Sbjct  183   QLAQLIIQSNMK------LNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDSTYDIFTR  236

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT  947
              C+ +++ ++  SG ++  CS +   +S EI   +   ++    C       S+      
Sbjct  237   VCNYSQIRRQYASGSLTAVCSQVISQVSREISRFVDTYDVTLDVCLPSVLLQSKMLSQLQ  296

Query  948   ETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSA  1118
             +  + D C+      YL+R +VQ+ALHA     ++W          + NL I  +  L  
Sbjct  297   DKEEIDVCVEDETTKYLNRKDVQKALHAQLIGVTSWTVCSEVLKYDMQNLEIPTIHVLGK  356

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L K GI +L+YSGD+D  +P++ TR L N LA  + L T      W +G+Q  GW+Q +G
Sbjct  357   LAKSGIRVLVYSGDQDSVLPLTGTRTLVNGLAKEIGLNTTVPYRTWVEGRQAAGWTQVYG  416

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +         L+FAT+RG SH  P S P ++L LF AFL G P P
Sbjct  417   DI--------LSFATIRGASHEAPLSQPRRSLALFNAFLGGKPLP  453



>ref|XP_006380973.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58770.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=478

 Score =   326 bits (836),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 183/478 (38%), Positives = 269/478 (56%), Gaps = 60/478 (13%)
 Frame = +3

Query  111   INGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGH  290
             +  + I  LPGQP  V F Q+SGYI   + + R+LFYYF EA++    S PL LWL GG 
Sbjct  24    LEADRIVRLPGQPP-VSFQQFSGYITVDEKQHRSLFYYFVEAETSPA-SKPLVLWLNGGP  81

Query  291   DCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
              CSS  +G F E+GPFRPT    LV+N++SWN  +NMLY+++P GV FSYS   + Y   
Sbjct  82    GCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKEANMLYLESPAGVGFSYSANQTFYSYV  141

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPI  650
             +D MTAR+NL FLR+WF++F +Y+  DF+IAG+SY GH  PQLA+LI+   R  V+    
Sbjct  142   NDEMTARDNLVFLRRWFVKFPQYKQRDFFIAGESYAGHYVPQLAQLII---RSKVN---F  195

Query  651   KLKGIALGNPLLE-KMGLSNVEHL-WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSED  824
              LKGIA+GNPLLE    L+  +H  W +G+IS   Y L    C+S+++++E L+G +S  
Sbjct  196   NLKGIAIGNPLLEFNTDLNAQDHFYWSHGLISDSTYQLLTSVCNSSKLMREALTGTVSSA  255

Query  825   CSDINVMISEEIGDDMHKDNLLFQSCQTDQYS---------------------------S  923
             C  +  ++ +E+ + +   ++    C +   S                            
Sbjct  256   CLGVYTLVQKELSESIDPYDVTGDICLSSNQSQLKIFHQQLLRSRLPYLSPQVLELDSVK  315

Query  924   SQRHCLGTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMIL----N  1082
              Q+  +G    K D CLL    +YL+R +VQ ALHA     + W    H  +++L    +
Sbjct  316   QQQQVMG----KVDVCLLEETTNYLNRKDVQMALHARLVGVTNW----HVCSVVLEYDRS  367

Query  1083  NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYD  1262
             N     +  + +L+K G+ +L+YSGD+D  I  + TR L + +A  L L T      W  
Sbjct  368   NEERPTIHVVRSLVKSGLAVLVYSGDQDSIIAFTGTRSLVSKIAKDLRLKTTVPYRAWLS  427

Query  1263  GKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1436
             G Q+GGW+Q +G+        NL+FAT+RG SH  P++ P ++L LFK+FL+  P P 
Sbjct  428   GNQVGGWTQVYGD--------NLSFATIRGASHTAPSTQPKRSLLLFKSFLEKKPLPT  477



>ref|XP_010055744.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Eucalyptus 
grandis]
Length=477

 Score =   326 bits (835),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 188/455 (41%), Positives = 258/455 (57%), Gaps = 26/455 (6%)
 Frame = +3

Query  84    NTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMP  263
             +TL +IS   + + I SLPGQP  V F+QY+GYI   + + RALFYYF EA+++     P
Sbjct  25    STLSTIS---DADKIASLPGQP-KVSFSQYAGYITVDEKQQRALFYYFTEAEADPALK-P  79

Query  264   LTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYS  443
             L LWL GG  CSS  +G F E+GPF+P+ D  L+KN +SWN  +NMLY+++P GV FSYS
Sbjct  80    LVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-VLLKNDYSWNKEANMLYIESPAGVGFSYS  138

Query  444   NTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYN  623
               +S Y +  D MTAR+NL FL  WF +F +YR+ D +I G+SY GH  PQLA+LI    
Sbjct  139   VNNSFYNLVDDKMTARDNLAFLCNWFEKFPQYRERDLFITGESYAGHYVPQLAKLI----  194

Query  624   RKPVHVRPIKLKGIALGNPLLE--KMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQE  797
                V  +   LKGIA+GNPLLE      S  E LW +G+IS   Y      C+ +++ ++
Sbjct  195   ---VQSKLFNLKGIAIGNPLLEFDTDINSRAEFLWSHGLISDATYESFNTICNFSKIQRQ  251

Query  798   ILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLL  977
               SG ++  CS +      EI   +   ++    C +  +S S       ET K D C+ 
Sbjct  252   RRSGALTPVCSHVFTEALREISKFVDGYDVTLDVCLSTVFSQSAVLNKLQETQKIDVCVQ  311

Query  978   TWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLI  1148
                  YL+R EVQEALHA     S W +        + NL I  +  L  L K GI +L+
Sbjct  312   EETYKYLNRKEVQEALHARLIGISAWTTCSSVLKYEMQNLEIPTVSILGELAKSGIHVLV  371

Query  1149  YSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVAN  1328
             YSGD+D  IP+  TR + N LA +L L T      W+  +Q+ GW+Q +G+         
Sbjct  372   YSGDQDAAIPLLGTRTIVNNLAKQLGLNTTVPYRVWFKERQVAGWTQVYGDI--------  423

Query  1329  LTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             L+FAT+RG SH  P S P ++L LF +FL G P P
Sbjct  424   LSFATIRGASHEAPFSQPERSLVLFSSFLGGRPLP  458



>ref|XP_011040747.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=467

 Score =   325 bits (834),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 189/462 (41%), Positives = 261/462 (56%), Gaps = 33/462 (7%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             SI   G+I+ +LPGQP  V F QY+GYI   + + RALFYYFAEA+  D  + PL LWL 
Sbjct  24    SISEAGKIV-ALPGQPR-VSFQQYAGYITIDEQQKRALFYYFAEAEI-DPATKPLVLWLN  80

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDY  461
             GG  CSS   G F E+GPF+P+ +  L+KN +SWN  +NMLY+++P GV FSYS   S Y
Sbjct  81    GGPGCSSIGAGAFCEHGPFKPSAE-ILLKNDYSWNKEANMLYLESPAGVGFSYSANDSFY  139

Query  462   KIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHV  641
                +D +TA++NL FL +WF EF EY+  DF+I G+SY GH  PQLA LI++   K    
Sbjct  140   TYVTDEITAQDNLVFLERWFDEFPEYKGRDFFITGESYAGHYVPQLATLIVQSQTK----  195

Query  642   RPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEM  815
                 LKGIA+GNPLLE      S  E  W +G+IS + Y +    C+ +++ ++  SG +
Sbjct  196   --FNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDDTYEIFTTVCNYSQIRRQYQSGSL  253

Query  816   SEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQ--------RHCLGTETAKADPC  971
             S  CS +N  +S E+   +   ++    C +   S SQ           +   T   D C
Sbjct  254   SLPCSAVNSRVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQMAFLSSPVQEYTGTIDVC  313

Query  972   LLTWVDDYLSRPEVQEALHANASTWDSIFHGRNMI---LNNLAIDILPTLSALLKRGIPL  1142
             +      YL+R +V EALHA     D      ++I   + NL I  +P L+ LLK GI +
Sbjct  314   VEDETIKYLNRKDVLEALHAQLVGVDQWTVCSDVIKYEMENLEISTVPLLAKLLKSGIRV  373

Query  1143  LIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKV  1322
              +YSGD+D  IP++ TR + N LA  L L T      W+ GKQ+ GW+Q +GN       
Sbjct  374   HVYSGDQDSVIPLTGTRTIVNGLAKELGLNTTVPYRTWFQGKQVAGWTQVYGNI------  427

Query  1323  ANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGS--PPPNTH  1442
               L+FAT+R  SH  P S P ++  LF AFL+G   PPP  +
Sbjct  428   --LSFATIRAASHEAPFSQPERSFVLFNAFLEGKQLPPPTVY  467



>gb|EEC68261.1| hypothetical protein OsI_36290 [Oryza sativa Indica Group]
Length=472

 Score =   325 bits (834),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 181/465 (39%), Positives = 268/465 (58%), Gaps = 20/465 (4%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +L  LL+  L  +     G+ I+ LPGQP +V F QY+GY+       RALFYYF EA+ 
Sbjct  20    VLQMLLIAALLHLGSCNGGDRIERLPGQP-EVSFGQYAGYVGVDDKGQRALFYYFVEAEL  78

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              D  + PL LWL GG  CSS  +G F ENGPFRP+    LVKN++SWN  +N++Y++TP 
Sbjct  79    -DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPA  136

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV +SYS  ++ Y+   D MTA +N+ FL++W  +F +Y+  + YI+G+SY GH  PQLA
Sbjct  137   GVGYSYSADAAYYQGVDDKMTAMDNMVFLQRWLEKFPQYKGRELYISGESYAGHYIPQLA  196

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             ++++E+N+K    +   LKGIALGNP+LE      S  E+ W +G+IS   Y +    C+
Sbjct  197   DVMVEFNKKN---KIFNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDSTYRIFTSVCN  253

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA  956
              +R V E   G ++  C+ +   ++ E    + K ++    C +   S S+      +  
Sbjct  254   YSRYVTEYYGGSLTPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILTPHQQVG  313

Query  957   -KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALL  1124
              + D C+     +YL+R +VQEALHA       W          L NL I  +  + +L+
Sbjct  314   QRIDVCVEDETVNYLNRKDVQEALHAKLIGVKNWAVCSSVLEYELLNLQIPTINIVGSLV  373

Query  1125  KRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNS  1304
             K GI +L+YSGD+D  IP++ +R L   LA  L L T      W++G+Q+GGW+Q +G+ 
Sbjct  374   KSGIRVLVYSGDQDSVIPLTGSRTLVQNLARDLGLKTSVPYRVWFEGQQVGGWTQVYGDM  433

Query  1305  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
                     L+FAT+RG SH  P S P ++L LF+AFL+G P P T
Sbjct  434   --------LSFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  470



>ref|XP_006341487.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=463

 Score =   325 bits (833),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 183/468 (39%), Positives = 266/468 (57%), Gaps = 21/468 (4%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             + VFL  FLL   +  +S   + + I  LPGQP  V F Q+SGY+     + R+LFYYF 
Sbjct  11    MAVFL--FLLYVCVGIVSALPHPDKIIKLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFV  67

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA++ D  S PL LWL GG  CSS  +G F ENGPFRP  +G LVKN+ SWN  +NMLY+
Sbjct  68    EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVKNEHSWNKEANMLYL  125

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYS+ +S Y+  +D +TAR+N+ FL +WF +F +Y   + ++ G+SY GH  
Sbjct  126   ESPIGVGFSYSSDTSSYETVNDEVTARDNVVFLLRWFHKFPQYSKSNLFLTGESYAGHYV  185

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQK  764
             PQLA+L++ +N+K    +   LKGIALGNP+LE      S  E+ W +G+IS   Y +  
Sbjct  186   PQLAKLMMAFNKKQ---QLFNLKGIALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFS  242

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG  944
               C+ +R V E     +S  CS +  ++S E    + K ++    C +   S S+     
Sbjct  243   SACNYSRYVSEYYRDTVSPICSRVMSLVSRETSKFVDKYDVTLDVCISSVLSQSKIISPQ  302

Query  945   TETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLS  1115
                 K D C+   V +YL+R +V+ ALHA       W       +  L ++ I  +  + 
Sbjct  303   ENAEKLDVCVEDEVVNYLNRKDVRRALHAELVGVRRWSVCSSILDYQLLDIEIPTISIIG  362

Query  1116  ALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTF  1295
              L+K  IP+LIYSGD+D  +P+  +R     LA ++ L T      W+ G+Q+GGW+  +
Sbjct  363   TLIKERIPVLIYSGDQDSVVPLIGSRATVQQLARQMQLNTTVPYRVWFAGQQVGGWTHVY  422

Query  1296  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
              N         L+FAT+RG SH  P S P ++L LFK+FL+G P P  
Sbjct  423   DNI--------LSFATIRGASHEAPFSQPERSLVLFKSFLEGKPLPEV  462



>ref|NP_001176565.1| Os11g0522900 [Oryza sativa Japonica Group]
 gb|ABA93967.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG86949.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52189.1| hypothetical protein OsJ_34064 [Oryza sativa Japonica Group]
 dbj|BAH95293.1| Os11g0522900 [Oryza sativa Japonica Group]
Length=472

 Score =   325 bits (834),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 181/465 (39%), Positives = 268/465 (58%), Gaps = 20/465 (4%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +L  LL+  L  +     G+ I+ LPGQP +V F QY+GY+       RALFYYF EA+ 
Sbjct  20    VLQMLLIAALLHLGSCNGGDRIERLPGQP-EVSFGQYAGYVGVDDKGRRALFYYFVEAEL  78

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              D  + PL LWL GG  CSS  +G F ENGPFRP+    LVKN++SWN  +N++Y++TP 
Sbjct  79    -DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPA  136

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV +SYS  ++ Y+   D MTA +N+ FL++W  +F +Y+  + YI+G+SY GH  PQLA
Sbjct  137   GVGYSYSADAAYYQGVDDKMTAMDNMVFLQRWLEKFPQYKGRELYISGESYAGHYIPQLA  196

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             ++++E+N+K    +   LKGIALGNP+LE      S  E+ W +G+IS   Y +    C+
Sbjct  197   DVMVEFNKKN---KIFNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDSTYRIFTSVCN  253

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA  956
              +R V E   G ++  C+ +   ++ E    + K ++    C +   S S+      +  
Sbjct  254   YSRYVTEYYGGSLTPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILTPHQQVG  313

Query  957   -KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALL  1124
              + D C+     +YL+R +VQEALHA       W          L NL I  +  + +L+
Sbjct  314   QRIDVCVEDETVNYLNRKDVQEALHAKLIGVKNWAVCSSVLEYELLNLQIPTINIVGSLV  373

Query  1125  KRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNS  1304
             K GI +L+YSGD+D  IP++ +R L   LA  L L T      W++G+Q+GGW+Q +G+ 
Sbjct  374   KSGIRVLVYSGDQDSVIPLTGSRTLVQNLARDLGLKTSVPYRVWFEGQQVGGWTQVYGDM  433

Query  1305  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
                     L+FAT+RG SH  P S P ++L LF+AFL+G P P T
Sbjct  434   --------LSFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  470



>ref|XP_004136793.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 ref|XP_004159657.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
Length=475

 Score =   325 bits (833),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 190/476 (40%), Positives = 268/476 (56%), Gaps = 36/476 (8%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEI--IDSLPGQPSD--VDFNQYSGYIVTHKFRGRALFYYFAEAQ  239
              LLV  +    I  + E   I  LPGQPS   V+F Q+SGYI    ++ RALFYYF EA 
Sbjct  13    LLLVGVILCSRIECSKESDRILRLPGQPSSSTVNFQQFSGYITVDDYQNRALFYYFVEAY  72

Query  240   SEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTP  419
             + D  S PL LWL GG  CSS  +G F E+GPFRP  D  L+ N+FSWN  +N+LYV++P
Sbjct  73    T-DPSSKPLLLWLDGGPGCSSLGVGAFVEHGPFRPEGD-VLIHNRFSWNNVANILYVESP  130

Query  420   IGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQL  599
              GV FS+S   + Y   +DT+TA++NL FL +WF +F EY++ DF+I+G+SY GH  PQL
Sbjct  131   AGVGFSFSENITFYTTVNDTITAQDNLVFLERWFKKFPEYKNRDFFISGESYAGHYVPQL  190

Query  600   AELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQC  773
             A LIL+       +    LK IA+GNPLLE     N   E+LW +G+IS   Y L  + C
Sbjct  191   ATLILQ-----SKLSIFNLKAIAIGNPLLEFYTDFNARGEYLWTHGLISDSTYKLLNKVC  245

Query  774   DSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTET  953
             + + + ++ +   +S  CS ++  +S+E  + ++  ++    C +   S +    L   T
Sbjct  246   NISEITRQSILHNVSTSCSFVDNSVSKEYSEFINLYSVNLDVCTSSTLSQAASSFLSKRT  305

Query  954   -------------AKADPCLLTWVDDYLSRPEVQEALHAN----ASTWDSIFHGRNMILN  1082
                           K D C+   V  YL+R +VQ+ALHA+     S W            
Sbjct  306   PRKTLPQYSVLQSGKIDVCIADEVSSYLNREDVQKALHAHLLGGLSNWSFCSFVLKYDKK  365

Query  1083  NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYD  1262
             NL I  + TL +L+  GI +L+YSGDED  IP+  +R L N LA  L L T     PW+ 
Sbjct  366   NLLIPTIDTLGSLVHSGIRVLVYSGDEDAVIPLIGSRRLVNKLAKSLRLNTTLPYSPWFY  425

Query  1263  GKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPP  1430
               Q+GGW +T+G         +L+FATVRGG+H  P ++P ++LTL  AFL+G+ P
Sbjct  426   NHQVGGWVETYGEKN------SLSFATVRGGAHQAPYTAPQRSLTLITAFLQGTNP  475



>ref|NP_001151474.1| LOC100285107 precursor [Zea mays]
 gb|ACG42988.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=480

 Score =   325 bits (833),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 181/445 (41%), Positives = 256/445 (58%), Gaps = 19/445 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRG-RALFYYFAEAQSEDKFSMPLTLWLGGGHDCSS  302
             I  LPG+P +V F QYSGY+      G RALFYYF EA   D  S PL LWL GG  CSS
Sbjct  46    IRRLPGEP-EVSFAQYSGYVAVDSGGGKRALFYYFVEADVVDPASKPLVLWLNGGPGCSS  104

Query  303   AAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
               +G F ENGPFRP+    LVKN++SWN  +N++Y++TP GV +SYS  ++ Y+   D M
Sbjct  105   LGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPAGVGYSYSADAAYYQGVDDKM  163

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TA +N+ FL++W  +F +Y+  D YIAG+SY GH  PQLAE ++E+N+K    R   L+G
Sbjct  164   TAMDNMVFLQRWLQKFPQYKGRDLYIAGESYAGHYIPQLAEAMVEFNKKD---RIFNLRG  220

Query  663   IALGNPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             +ALGNP+LE     N   E+ W +G+IS   Y +    C+ +R V E   G +S  C+ +
Sbjct  221   VALGNPVLEFATDFNARAEYFWSHGLISDATYRVFTSACNYSRYVTEYYGGSLSPLCARV  280

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA-KADPCLLTWVDDYLSRPEV  1013
                ++ E    + K ++    C +   S S+      +   + D C+      YL+R +V
Sbjct  281   MNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILSPHEQVGQRIDVCVEDETVRYLNRRDV  340

Query  1014  QEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVS  1184
             Q ALHA       W          L NL I  +  + +L+K GI +L+YSGD+D  IP++
Sbjct  341   QAALHARLVGVDKWAVCSSVLEYELLNLQIPTINVVGSLVKSGIRVLVYSGDQDSVIPLT  400

Query  1185  HTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
              +R L   LA  + L T      W++G+Q+GGW+Q +G  GG      L+FAT+RG SH 
Sbjct  401   GSRTLVQNLARDMGLKTTTPYRVWFEGQQVGGWTQVYG--GGA-----LSFATIRGASHE  453

Query  1365  VPNSSPSKALTLFKAFLKGSPPPNT  1439
              P S P ++L LF+AFL+G P P T
Sbjct  454   APFSQPGRSLVLFRAFLQGQPLPET  478



>ref|XP_008443351.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=472

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/487 (38%), Positives = 270/487 (55%), Gaps = 47/487 (10%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +  L+   ++       G++I SLPGQP  V+F QY GYI   + + R+LFYYF EAQS 
Sbjct  1     MLLLMQKIMFRFGECFEGDLIKSLPGQPI-VNFKQYGGYITIDELQSRSLFYYFVEAQS-  58

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS   G F ENGPFRP +   L+ N+FSWN  +N+LY+++P G
Sbjct  59    DPSSKPLVLWLNGGPGCSSLGAGAFVENGPFRP-KGNVLILNEFSWNNVANVLYLESPAG  117

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAE  605
             V FS+S  ++ Y   +D +TA++N+ FL +W  +F EY++ +FYI G+SY GH  PQLA 
Sbjct  118   VGFSFSKNTTFYDTVNDKITAQDNIVFLERWLEKFPEYKNKEFYITGESYAGHYVPQLAR  177

Query  606   LILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQCDS  779
             LI++          IKLK IA+GNPLLE     N   ++LW +G+IS   + L    C  
Sbjct  178   LIVQSKLN------IKLKAIAIGNPLLEFNTDFNSRGKYLWSHGVISESTFELLNSVCSI  231

Query  780   TRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQT---DQYSSSQRHCL---  941
             ++M++E ++GE+S+ C  IN ++S+E+   ++   +    C +    Q + S  H L   
Sbjct  232   SQMIRESINGEISDACFSINDLVSQEMSPFINGYAINLDVCSSGDPTQTALSSLHSLTFT  291

Query  942   ---------------------GTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWD  1049
                                    +  K D C++  ++ YL+R +VQ+ALHA     S+W 
Sbjct  292   KRLGDDQSNPKPTSSTPLPQFSGDAGKVDVCIVNEIEAYLNRVDVQQALHAQLVGVSSWS  351

Query  1050  SIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNL  1229
                   +    NL I  +  + +L+  GI +L+YSGD+D  IP+  TR L N LA  + L
Sbjct  352   LCSDILDYDRTNLFIPTINIMGSLVHSGIRVLVYSGDQDSVIPLLGTRTLVNKLAKAMRL  411

Query  1230  TTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKA  1409
              T      W+   Q+GGW +TFG         NL+FAT+RG +H  P +SP+ +L LF A
Sbjct  412   NTTLPYSAWFHNHQVGGWVETFGEKN------NLSFATIRGAAHQAPYTSPATSLALFTA  465

Query  1410  FLKGSPP  1430
             FL+   P
Sbjct  466   FLQAKNP  472



>ref|XP_003577529.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=468

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 186/470 (40%), Positives = 266/470 (57%), Gaps = 28/470 (6%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             MV LL    +  L S +    G+ I  LPGQP +V F QYSGYI       RALFYYF E
Sbjct  13    MVSLLLIAALCHLGSCNGGGRGDRITKLPGQP-EVSFGQYSGYIGVDGKGSRALFYYFVE  71

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+  D  S PL LWL GG  CSS  +G F ENGPFRP+    LVKN++SWN  +N++Y++
Sbjct  72    AEL-DPISKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLE  129

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP GV +SYS  ++ Y+  +D MTA +N+ F+++W  +F +Y+  + YIAG+SY GH  P
Sbjct  130   TPAGVGYSYSADAAYYQGVNDKMTAMDNMVFMQRWLEKFPQYKGRELYIAGESYAGHYIP  189

Query  594   QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKR  767
             QLAE+++E+N+     +   LKG+ALGNP+LE      S  E+ W +G+IS   Y +   
Sbjct  190   QLAEVMVEFNKNE---KIFNLKGLALGNPVLEFTTDFNSRAEYFWSHGLISDSTYRIFTS  246

Query  768   QCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSS-----QR  932
              C+ ++ V E   G +S  C+ +   ++ E    + K ++    C     S S      R
Sbjct  247   VCNYSQYVSEYYGGSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLASVLSQSMILSPHR  306

Query  933   HCLGTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDIL  1103
             H       + D C+     +YL+R +VQEALHA       W          L NL I  +
Sbjct  307   HV----GQRIDVCIEDETVNYLNRKDVQEALHAKLIGVKNWAVCSSVLQYELLNLQIPTI  362

Query  1104  PTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGW  1283
               + +L+K GI +L+YSGD+D  IP++ +R L   LA  L L T      W++GKQ+GGW
Sbjct  363   NIVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLAHDLGLKTSTPYRVWFEGKQVGGW  422

Query  1284  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +Q +G+         L+FAT+RG SH  P S P ++L L++AFL+G P P
Sbjct  423   TQVYGDM--------LSFATIRGASHEAPFSQPKRSLVLYRAFLQGRPLP  464



>ref|XP_009615672.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nicotiana 
tomentosiformis]
Length=463

 Score =   324 bits (830),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 180/464 (39%), Positives = 261/464 (56%), Gaps = 19/464 (4%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +  FL   +L  +S   + + I  LPGQP  V F Q+SGY+     + R+LFYYF EA++
Sbjct  13    IFLFLFCVSLGIVSALPHPDKIIQLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFVEAET  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              +  S PL LWL GG  CSS  +G F ENGPFRP     LV+N+ SWN  +NMLY+++PI
Sbjct  72    -NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKEANMLYLESPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYSN +S Y+  +D +TAR+NL FL +WF +F  YR  + ++ G+SY GH  PQLA
Sbjct  130   GVGFSYSNDTSSYETVNDEITARDNLVFLLRWFHKFPLYRKSNLFLTGESYAGHYVPQLA  189

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             +L++ +N+K    +   LKG+ALGNP+LE      S  E+ W +G+IS   Y +    C+
Sbjct  190   KLMMAFNKKQ---QIFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFSSACN  246

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA  956
              +R V E   G +S  CS +  ++S E    + K  +    C +   S S+         
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISSVLSQSKIISPQENVE  306

Query  957   KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLK  1127
             K D C+   + +YL+R +V+ ALHA       W       +  L ++ I  +  +  L+K
Sbjct  307   KLDVCVEDEIVNYLNRKDVRRALHAELVGVRRWAVCSSILDYQLLDIEIPTISIIGMLVK  366

Query  1128  RGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSG  1307
               IP+LIYSGD+D  IP+  +R   + LA R+ L T      W+ G+Q+GGW+  + N  
Sbjct  367   ERIPVLIYSGDQDSVIPLIGSRATVHQLARRMRLNTTVPYRVWFAGQQVGGWTHVYDNI-  425

Query  1308  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
                    L+FAT+RG SH  P S P ++L LFK+FL+  P P  
Sbjct  426   -------LSFATIRGASHEAPFSQPERSLVLFKSFLEDRPLPEV  462



>ref|XP_004241645.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=457

 Score =   323 bits (828),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/442 (40%), Positives = 260/442 (59%), Gaps = 27/442 (6%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LPGQP  V F Q+SGY+     + RALFYYF EA++ D  S PL LWL GG  CSS  +G
Sbjct  31    LPGQP-QVGFQQFSGYVTVDDKKQRALFYYFVEAET-DPASKPLVLWLNGGPGCSSVGVG  88

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPFRP     LVKN+ SWN  +NMLY+++P+GV FSYS  +S Y+  +D +TAR+
Sbjct  89    AFSENGPFRP-RGQVLVKNEHSWNKEANMLYLESPVGVGFSYSTNTSSYETVNDEITARD  147

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALG  674
             N+ FL++WF +F +YR+ + ++ G+SY GH  PQLA+L++E N K    +   LKG+ALG
Sbjct  148   NVVFLQRWFNKFPQYRENNLFLTGESYAGHYVPQLAKLMIELNNKK---KLFNLKGVALG  204

Query  675   NPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDINVMI  848
             NP+LE      S  E+ W +G+IS   Y +    C+ +R V E     +S  CS +  ++
Sbjct  205   NPVLEFATDFNSRAEYFWSHGLISDSTYRMFTSVCNYSRYVSEYYRDGVSPMCSRVMSLV  264

Query  849   SEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQEALH  1028
             S E    + K ++    C +   S S          K D C+     +YL+R +V+ ALH
Sbjct  265   SRETSKFVDKYDVTLDVCMSSVLSQSNIISPQENGEKIDVCIDDETVNYLNRQDVRTALH  324

Query  1029  AN---ASTWDSIFHGRNMILNNLAIDI-LPTLSA---LLKRGIPLLIYSGDEDLRIPVSH  1187
             A      +WD      + IL+   +DI +PT+S    L+K  IP+LIYSGD+D  +P++ 
Sbjct  325   ARLVGVHSWDVC----STILDYQLLDIEIPTISIVGLLVKERIPVLIYSGDQDSVVPLTG  380

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R + + LA ++ L T      W+ G+Q+GGW+Q + N         L+FAT+RG +H  
Sbjct  381   SRSVVHQLANQMGLNTTVPYRVWFSGQQVGGWTQVYDNI--------LSFATIRGAAHEA  432

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LF++FL+G   P
Sbjct  433   PFSQPERSLVLFRSFLQGKALP  454



>ref|XP_002520628.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF41764.1| serine carboxypeptidase, putative [Ricinus communis]
Length=467

 Score =   323 bits (829),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 196/478 (41%), Positives = 267/478 (56%), Gaps = 43/478 (9%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEI---------IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFY  221
             W ++V    ++ I+ N  +         I SLP QP  V F QY+GYI   + + RALFY
Sbjct  6     WIVMVVICITLIIKCNAAVGSSSKEDDKIVSLPRQP-QVSFQQYAGYITIDEKQQRALFY  64

Query  222   YFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNM  401
             YF EA++ D  S PL LWL GG  CSS   G F E+GPFRP+    LV N++SWN  +NM
Sbjct  65    YFVEAET-DPASKPLVLWLNGGPGCSSLGAGAFSEHGPFRPSSGESLVINEYSWNKEANM  123

Query  402   LYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGG  581
             LY++TP GV FSYS  +S Y   +DT+TA++NL FL++WF++F EY   DF+I G+SY G
Sbjct  124   LYLETPAGVGFSYSVNTSFYDNVNDTITAQDNLVFLQQWFLKFPEYMSRDFFITGESYAG  183

Query  582   HLAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNVE--HLWHYGIISTELYH  755
             H  PQLA LIL+   K        LKGIA+GNPLLE     N E    W +G+IS   Y 
Sbjct  184   HYVPQLANLILQSGLK------FNLKGIAIGNPLLEFNTDFNSEGDFYWSHGLISDYTYV  237

Query  756   LQKRQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC----QTDQYSS  923
             L    C+ +++++E +SG +S  C  +   +S EI D +   ++    C    Q      
Sbjct  238   LVNTACNISQLMREYMSGSLSSGCELVADQLSIEIPDAIDDYDVTSDVCPSYLQAVTLLK  297

Query  924   SQRHCLGTE-----TAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMIL  1079
             S  H L ++         D C+     +YL+  +VQ+ALHA     S W   F  R M  
Sbjct  298   SFNHPLISKFQLSPLENIDLCVQEKSFEYLNNKDVQDALHAKLVGISNW--TFCSRVMYY  355

Query  1080  N--NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEP  1253
             +  N  I  +  + +L+  GI +L+YSGD+D  IP   +R L N LAT+L L        
Sbjct  356   DRRNFEIPTIDVVGSLVSSGIRVLVYSGDQDSVIPFIGSRTLVNGLATKLKLNATTTYSG  415

Query  1254  WYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSP  1427
             W   KQ+GGW+Q +G+         LT+AT+RGGSH  P SSP ++L LFKAFL GSP
Sbjct  416   WLVDKQVGGWTQVYGDI--------LTYATIRGGSHMAPWSSPKRSLALFKAFLSGSP  465



>ref|XP_009355271.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Pyrus 
x bretschneideri]
Length=478

 Score =   323 bits (829),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 182/465 (39%), Positives = 262/465 (56%), Gaps = 60/465 (13%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LP QP  V+F QY+GY+   + + R+LFYYF EAQ+ +  S PL LWL GG  CSS  +G
Sbjct  36    LPSQP-QVNFQQYAGYVTVDEKQERSLFYYFVEAQT-NPASKPLVLWLNGGPGCSSVGVG  93

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPF+P+ D  L+KN FSWN  +N+LY+++P GV FSYS   S Y   +D +TAR+
Sbjct  94    AFNENGPFQPSGD-ILLKNDFSWNREANILYLESPAGVGFSYSANKSFYGFVNDDITARD  152

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALG  674
             N++FL++WF EF  Y++ DF+I G+SY GH  PQLA+LI++   K        LK IA+G
Sbjct  153   NIEFLQRWFDEFPAYKNRDFFITGESYAGHYVPQLAQLIIQSKLK------FNLKAIAIG  206

Query  675   NPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTRMVQE--ILSGEMSEDCSDINV  842
             NPLLE    +N   E+LW +G+IS   +      C+++ ++++  I  G ++  C  +  
Sbjct  207   NPLLEFNSDNNAQAEYLWSHGLISDATFENLTSVCNNSEIIRQVRIRGGPLTPACDAVAT  266

Query  843   MISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT---------ETAKADPCLLTWVDDY  995
              +  E+   +            DQY  +   CL +         +TAK D C+      Y
Sbjct  267   QVESEVPGYL-----------IDQYDVTHDVCLSSVEAQSFQLQKTAKIDVCIADETVSY  315

Query  996   LSRPEVQEALHANASTWDSIFHGR-------NMI------------LNNLAIDILPTLSA  1118
             L+RP+VQEALHA  + W +  +         N+I            + N+ + +LP L  
Sbjct  316   LNRPDVQEALHARVTNWTTCSNKSFLFTVLLNLIILFYIGSVLKYDMKNVEVPMLPVLGD  375

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+K GI +LIYSGD+D  IP++ TR LAN LA  L L T      W   KQ+ GW+Q + 
Sbjct  376   LVKSGIRVLIYSGDQDSVIPLTSTRTLANGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYS  435

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             ++        L++AT+RG  H  P S P ++L LF +FLKG P P
Sbjct  436   DA--------LSYATIRGAGHEAPISQPERSLLLFTSFLKGKPLP  472



>ref|XP_010055754.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW90022.1| hypothetical protein EUGRSUZ_A02225 [Eucalyptus grandis]
Length=474

 Score =   323 bits (828),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 184/441 (42%), Positives = 249/441 (56%), Gaps = 23/441 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GY+   + + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  33    IASLPGQP-KVSFGQYAGYVTVDEKQQRALFYYFAEAEA-DPASKPLVLWLNGGPGCSSI  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+ D  L+KN +SWN  +NMLY+++P GV FSYS  +S Y    D MT
Sbjct  91    GAGAFCEHGPFKPSGD-VLLKNDYSWNKEANMLYLESPAGVGFSYSVNTSYYSSVDDKMT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FLR WF +F EY++ D +I G+SY GH  PQLA LI       V  +   LKGI
Sbjct  150   ARDNLAFLRNWFEKFPEYKERDLFITGESYAGHYVPQLALLI-------VQSKLFNLKGI  202

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNPLLE      S  E  W +G+IS   Y      C+ +++ ++  SG ++  CS +N
Sbjct  203   AIGNPLLEFNTDFNSRAEFFWSHGLISDATYESFNTMCNYSQIRRQAQSGTLTPVCSRVN  262

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
                + +I   +   ++    C +   S S       +  K D C+      YL+R EVQE
Sbjct  263   SEANRQISKFIDTYDVTLDVCLSTVSSQSAVLNKLQQAEKIDVCVEDKTLKYLNRKEVQE  322

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA     S+W    +       NL I  +  L  L+K GI +L+YSGD+D  IP+  T
Sbjct  323   ALHARLVGISSWTVCSYVLKYEYQNLEIPTISILGELVKSGIQVLVYSGDQDSAIPLLGT  382

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L N LA +L L T      W++  Q+ GW+Q +G+         L++AT+RG SH  P
Sbjct  383   RTLVNNLAKQLGLNTTVPYRVWFEESQVAGWTQVYGD--------KLSYATIRGASHEAP  434

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LF +FL G P P
Sbjct  435   FSQPERSLLLFSSFLGGRPLP  455



>ref|XP_009355270.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Pyrus 
x bretschneideri]
Length=480

 Score =   323 bits (828),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 182/465 (39%), Positives = 262/465 (56%), Gaps = 60/465 (13%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LP QP  V+F QY+GY+   + + R+LFYYF EAQ+ +  S PL LWL GG  CSS  +G
Sbjct  38    LPSQP-QVNFQQYAGYVTVDEKQERSLFYYFVEAQT-NPASKPLVLWLNGGPGCSSVGVG  95

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPF+P+ D  L+KN FSWN  +N+LY+++P GV FSYS   S Y   +D +TAR+
Sbjct  96    AFNENGPFQPSGD-ILLKNDFSWNREANILYLESPAGVGFSYSANKSFYGFVNDDITARD  154

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALG  674
             N++FL++WF EF  Y++ DF+I G+SY GH  PQLA+LI++   K        LK IA+G
Sbjct  155   NIEFLQRWFDEFPAYKNRDFFITGESYAGHYVPQLAQLIIQSKLK------FNLKAIAIG  208

Query  675   NPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTRMVQE--ILSGEMSEDCSDINV  842
             NPLLE    +N   E+LW +G+IS   +      C+++ ++++  I  G ++  C  +  
Sbjct  209   NPLLEFNSDNNAQAEYLWSHGLISDATFENLTSVCNNSEIIRQVRIRGGPLTPACDAVAT  268

Query  843   MISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT---------ETAKADPCLLTWVDDY  995
              +  E+   +            DQY  +   CL +         +TAK D C+      Y
Sbjct  269   QVESEVPGYL-----------IDQYDVTHDVCLSSVEAQSFQLQKTAKIDVCIADETVSY  317

Query  996   LSRPEVQEALHANASTWDSIFHGR-------NMI------------LNNLAIDILPTLSA  1118
             L+RP+VQEALHA  + W +  +         N+I            + N+ + +LP L  
Sbjct  318   LNRPDVQEALHARVTNWTTCSNKSFLFTVLLNLIILFYIGSVLKYDMKNVEVPMLPVLGD  377

Query  1119  LLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFG  1298
             L+K GI +LIYSGD+D  IP++ TR LAN LA  L L T      W   KQ+ GW+Q + 
Sbjct  378   LVKSGIRVLIYSGDQDSVIPLTSTRTLANGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYS  437

Query  1299  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             ++        L++AT+RG  H  P S P ++L LF +FLKG P P
Sbjct  438   DA--------LSYATIRGAGHEAPISQPERSLLLFTSFLKGKPLP  474



>ref|XP_011002097.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   323 bits (827),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 179/441 (41%), Positives = 253/441 (57%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+       RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  34    IVRLPGQP-HVGFQQFSGYVTVDNNEHRALFYYFVEAEI-DPESRPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP E   L++N+ SWN  +NMLY++TP+GV FSY+  SS +    D  T
Sbjct  92    GLGAFSENGPFRP-EGRVLIRNEHSWNREANMLYLETPVGVGFSYATNSSSFVAVDDEAT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WF +F +YR  D +IAG+SY GH  PQLA+L++  N+K    +   LKGI
Sbjct  151   ARDNLLFLQGWFHKFPQYRSTDLFIAGESYAGHYIPQLAKLMIGINKKE---KLFNLKGI  207

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+L+      S  E+ W +G+IS   Y +    C+ +R V E     +S  CS + 
Sbjct  208   ALGNPVLDFATDLNSRAEYFWSHGLISDSTYKMFTSACNYSRYVSEYYRDSVSSICSIVM  267

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               ++ E    + K ++    C +  +S S+       + + D C+     +YL+R +V+ 
Sbjct  268   NQVNTETSRFVDKYDVTLDVCVSTVFSQSKFISPKQVSERIDVCIEDETVNYLNRKDVRR  327

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W+   +  +    N+ I     + +L+K GIP+L+YSGD+D  IP++ +
Sbjct  328   ALHARLIGVRRWEVCSNILDYEFLNIEIPTFNIVGSLVKAGIPVLVYSGDQDSVIPLTGS  387

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + +A  L L T      W+ GKQ+GGW+Q +GN         L+FAT+RG SH  P
Sbjct  388   RTLVHRVAKELGLNTTVPYRVWFAGKQVGGWTQVYGNI--------LSFATIRGASHEAP  439

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFK+FL+G   P
Sbjct  440   FSQPERSLMLFKSFLEGKHLP  460



>ref|XP_004159625.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
45-like [Cucumis sativus]
Length=479

 Score =   323 bits (828),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 191/463 (41%), Positives = 259/463 (56%), Gaps = 48/463 (10%)
 Frame = +3

Query  126   IDSLPGQPSD--VDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I SLP QPSD   +F Q+ GY+   + +GRALFYYF EAQ++   S PL LWL GG  CS
Sbjct  33    IRSLPSQPSDSKANFKQFGGYVTIDEKQGRALFYYFVEAQTQPT-SKPLVLWLNGGPGCS  91

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E+GPF+   +GE LVKN++SWN  +NMLYV++P GV FSYS+  S Y   +D
Sbjct  92    SVGAGAFIEHGPFKI--NGETLVKNEYSWNTEANMLYVESPAGVGFSYSSNKSFYSKIND  149

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
              +TAR+NL FL+ WF++F EY++ DFYI G+SYGGH  PQLA+LIL+          IKL
Sbjct  150   KITARDNLLFLQNWFVKFPEYKNADFYITGESYGGHYVPQLAQLILKSKAN------IKL  203

Query  657   KGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KGIA+GNPLL+ +   N   + +W +G+IS   Y L    C+++R  QEI  G +S DC 
Sbjct  204   KGIAIGNPLLDLVNDFNARDKFMWSHGVISDSAYMLLSSICNTSRFYQEIFQGFISSDCI  263

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSS----------------SQRHCLGTETAKA  962
              +   +S+++   +   N++   C     S                 SQRH L     K 
Sbjct  264   FVXSEVSKQLSPLIDDYNVIGDVCSLTAKSQPSVLLHPLSSFITKSVSQRHLLSHPQEKV  323

Query  963   ----DPCLLTWVDDYLSRPEVQEALHANASTWD--SIFHGRN----MILNNLAIDILPTL  1112
                 D C    +  YL+R +VQ+ALHA     D  S+ +  N      L N     +  +
Sbjct  324   GIDRDVCSQENIAKYLNRNDVQKALHAKLIGVDQWSVCNSNNSDWHYDLKNWLTPTIGVV  383

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+K  I +L+YSGD+D  +P + TR L N+LA  L L      + W    Q GGWS+ 
Sbjct  384   GSLVKSHIRVLVYSGDQDSVVPFTGTRTLVNLLANSLGLNITMSYKVWVVDNQAGGWSEA  443

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKG  1421
             +G          L+FATVRG SH  P + P  +L LFKAFL G
Sbjct  444   YGKF--------LSFATVRGASHLAPETQPKTSLALFKAFLDG  478



>ref|XP_008378883.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score =   322 bits (825),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 180/449 (40%), Positives = 255/449 (57%), Gaps = 45/449 (10%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LPGQP  V+F QY+GY+   + + R+LFYYF EAQ+ +  S PL LWL GG  CSS  +G
Sbjct  37    LPGQP-QVNFQQYAGYVTVDEKQERSLFYYFVEAQT-NPASKPLVLWLNGGPGCSSVGVG  94

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPF+P+ D  L+KN FSWN  +NMLY+++P GV FSYS   S Y   +D +TAR+
Sbjct  95    AFNENGPFQPSXD-ILLKNDFSWNRZANMLYLESPAGVGFSYSANKSFYGYMNDDITARD  153

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALG  674
             N++FL++WF +F EY++ DF+I G+SY GH  PQLA+LI++   K        LK IA+G
Sbjct  154   NIEFLQRWFDKFPEYKNRDFFITGESYAGHYVPQLAQLIIQSKLK------FNLKAIAIG  207

Query  675   NPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTRMVQE--ILSGEMSEDCSDINV  842
             NPLLE     N   E+ W +G+I    +      C+ + +V++  I  G +S  C  +  
Sbjct  208   NPLLEFNSDKNAQAEYWWSHGLIXDATFEXXTSVCNFSEIVRQIDIRGGPLSPACDAVAN  267

Query  843   MISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGT---------ETAKADPCLLTWVDDY  995
                 E+ D +            +QY  ++  CL +         +T K D C+      Y
Sbjct  268   QFESEVPDHV-----------INQYDVTRNVCLSSVKAQSFQLRKTEKIDVCIGDETVTY  316

Query  996   LSRPEVQEALHANASTWDSIFHGRNMI---LNNLAIDILPTLSALLKRGIPLLIYSGDED  1166
             L+RP+VQE LHA  + W +    R +I   + NL   +LP L  L+K GI +LIYSGD+D
Sbjct  317   LNRPDVQEVLHARVTNWTTC-SNRVVIQYDMKNLETPMLPVLGDLVKSGIRVLIYSGDQD  375

Query  1167  LRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATV  1346
               IP+  TR L N LA  L L T      W   KQ+ GW+Q + ++        L++AT+
Sbjct  376   SAIPLXSTRTLVNGLAKDLGLQTNVPYSVWVQEKQVAGWTQVYSDA--------LSYATI  427

Query  1347  RGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             RG  H  P S P ++L +F +FL+G P P
Sbjct  428   RGAGHEAPISQPERSLLMFASFLRGKPLP  456



>ref|XP_011041403.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=476

 Score =   322 bits (824),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 186/484 (38%), Positives = 263/484 (54%), Gaps = 53/484 (11%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L  T + I   ++    D   SLPGQP  V F QY+GY+   + + +ALFYYF EA++ 
Sbjct  11    VLCATFFQICRAVDSPADDKLLSLPGQPR-VSFQQYAGYVTVDENQDKALFYYFVEAET-  68

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS   G F E+GPFRP+  G LV+N +SWN  +NMLY+++P G
Sbjct  69    DPASKPLVLWLNGGPGCSSVGAGAFSEHGPFRPSGGGSLVRNDYSWNKEANMLYLESPAG  128

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAE  605
             V FSYS   S Y + +DT+T ++N  FL+ WF +F EY++ D +I G+SY GH  PQLA+
Sbjct  129   VGFSYSANQSFYDLVNDTITVQDNFVFLQNWFQKFPEYKNRDLFITGESYAGHYVPQLAD  188

Query  606   LILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNVE--HLWHYGIISTELYHLQKRQCDS  779
             LI++   K        LKGIALGNPLLE     N E    W +G+IS   Y L    C++
Sbjct  189   LIVKSGLK------FNLKGIALGNPLLEFGTDFNSEGDFYWSHGLISNPTYELLSAVCNT  242

Query  780   TRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNL------------------------  887
             +++ +E +   +S  CS +N  +  EI   + K ++                        
Sbjct  243   SQLWRERIGNSLSASCSKVNDQLHAEISYAIDKYDVTANVCLSFGASLLGVQNNPLTPRF  302

Query  888   -LFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSI  1055
              LF S ++ Q + SQ+          DPC+      YL+R +VQE+ HA       W   
Sbjct  303   RLFSSAESLQEALSQQKA----QENIDPCVQEETFVYLNRKDVQESFHAKLVGTPKWTFC  358

Query  1056  FHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTT  1235
                 N  L NL I  +  + +L+  G+ +L+YSGD+D  IP + +R L   LA +L L  
Sbjct  359   SGVVNYDLRNLEIPTIDVVGSLVTSGVRVLVYSGDQDSVIPFTGSRTLVEGLAKKLGLNA  418

Query  1236  MEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFL  1415
                   W++ KQ+GGW+Q +G+         LTF+T+RGGSH  P SSP ++L LF AFL
Sbjct  419   TVPYTAWFEDKQVGGWTQVYGDI--------LTFSTIRGGSHMAPFSSPGRSLALFAAFL  470

Query  1416  KGSP  1427
              G P
Sbjct  471   SGKP  474



>ref|XP_009778790.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=457

 Score =   321 bits (822),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 176/441 (40%), Positives = 261/441 (59%), Gaps = 23/441 (5%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LPGQP  V F Q+SGY+     + R+LFYYF EA++    S PL LWL GG  CSS  +G
Sbjct  29    LPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFVEAETNPA-SKPLVLWLNGGPGCSSLGVG  86

Query  315   MFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTAR  491
              F ENGPFRP  +G+ LVKN++SWN  +NMLY+++PIGV FSYS  +S Y+  +D  TAR
Sbjct  87    AFSENGPFRP--NGQVLVKNEYSWNKEANMLYLESPIGVGFSYSTNTSAYETVNDETTAR  144

Query  492   ENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIAL  671
             +N+ FL++WF +F +YR+ + ++ G+SY GH  PQLA+L++E N+K    +   LKG+AL
Sbjct  145   DNVVFLQRWFNKFPQYRNNNLFLTGESYAGHYVPQLAKLMIELNQKK---KLFNLKGVAL  201

Query  672   GNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDINVM  845
             GNP+LE      S  E+ W +G+IS   Y +    C+ +R V E     +S  CS +  +
Sbjct  202   GNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSFCNYSRYVSEYYRENVSPMCSRVMSL  261

Query  846   ISEEIGDDMHKDNLLFQSCQTDQYSSSQ--RHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
             ++ E    + K ++    C +   S S+        +T K D C+     +YL+R +V+ 
Sbjct  262   VTRETSKFVDKYDVTLDVCLSSVLSQSKIISPQENADTEKIDVCIDDKTVNYLNRQDVRR  321

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       WD   +  +  L ++ I  +  +  L+K  IP+LIYSGD+D  +P++ +
Sbjct  322   ALHAKLVGVRRWDVCSNVLDYQLLDIEIPTIYIVGLLVKERIPVLIYSGDQDSVVPLTGS  381

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R + + LA R+ L T      W+ G+Q+GGW+  + N         L+FATVRG +H VP
Sbjct  382   RTVVHQLAKRMGLNTTVPYRVWFAGQQVGGWTIVYDNI--------LSFATVRGAAHEVP  433

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFK+FL+G   P
Sbjct  434   FSQPERSLVLFKSFLEGRALP  454



>ref|XP_008240683.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=456

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 182/464 (39%), Positives = 267/464 (58%), Gaps = 31/464 (7%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             +LL+    S +     + I SLPGQP  V F QY+GY+   + + RALFYYF EA++ D 
Sbjct  9     YLLIGLSISSNSLPEADKITSLPGQPQ-VSFQQYAGYVTVDEKQQRALFYYFVEAET-DA  66

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS   G F E+GPF+P+ D  L+KN FSWN  +NMLY+++P GV 
Sbjct  67    ASKPLVLWLNGGPGCSSVGAGAFIEHGPFKPSGD-ILLKNDFSWNKEANMLYLESPAGVG  125

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYS+  S Y   +D +TA +NL FL +WF +F E+++ DF+I G+SYGGH  P+LA L+
Sbjct  126   FSYSSNQSFYDFVNDAITANDNLVFLERWFDKFPEFKNRDFFITGESYGGHYVPELARLV  185

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTR  785
             ++            LKGIA+GNPLL+     N   E+ W +G+IS   +      C+ ++
Sbjct  186   VQSKLN------FNLKGIAIGNPLLDFNTDFNAGAEYYWSHGLISDATFESFTSVCNYSQ  239

Query  786   MVQEIL-SGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA  962
             M+++I+ +G++S  C+ +   +  EI + +   ++    C +   + S++     ET K 
Sbjct  240   MLRQIINTGKLSPACAAVYNQVQTEISNFIDPHDVTLDVCLSSDAAQSRKLTQLQETEKI  299

Query  963   DPCLLTWVDDYLSRPEVQEALHAN---ASTW----DSIFHGRNMILNNLAIDILPTLSAL  1121
             D CL      YL+R +VQEALHA     S W    D + + R     ++ I +LP L  L
Sbjct  300   DVCLEDETIKYLNRQDVQEALHAQLIGVSNWTICSDVVRYNR----QSMEILMLPVLGYL  355

Query  1122  LKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGN  1301
              + GI +L YSGD+D  IP++ TR   + LA  L L T      W++ KQ+ GW+Q +G+
Sbjct  356   SRSGIRILAYSGDQDSVIPLTGTRTAVDGLAEVLELNTTVPYRVWFEEKQVAGWTQVYGD  415

Query  1302  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                      L+FAT+RG  H VP + P ++L LF +FL G P P
Sbjct  416   V--------LSFATIRGAGHTVPYTQPERSLLLFSSFLGGKPLP  451



>ref|XP_011040750.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=499

 Score =   322 bits (824),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 182/478 (38%), Positives = 266/478 (56%), Gaps = 60/478 (13%)
 Frame = +3

Query  111   INGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGH  290
             +  + I  LPGQP  V F Q+SGYI   + + R+LFYYF EA+S    S PL LWL GG 
Sbjct  45    LEADRIVRLPGQPP-VSFQQFSGYITVDEKQHRSLFYYFVEAESSPA-SKPLVLWLNGGP  102

Query  291   DCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
              CSS   G F E+GPFRPT    LV+N++SWN  +N+LY+++P GV FSYS   + Y   
Sbjct  103   GCSSVGAGAFVEHGPFRPTTGNNLVRNEYSWNKEANLLYLESPAGVGFSYSANQTFYSYV  162

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPI  650
             +D MTAR+NL FLR+WF++F +Y+  DF+IAG+SY GH  PQLA LI+   R  V+    
Sbjct  163   NDEMTARDNLVFLRRWFVKFPQYKQRDFFIAGESYAGHYVPQLARLII---RSKVN---F  216

Query  651   KLKGIALGNPLLE-KMGLSNVEHL-WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSED  824
              LKGIA+GNPLL+    L+  +H  W +G+IS   Y L    C+++++++E ++  +S  
Sbjct  217   NLKGIAIGNPLLDFDTDLNAQDHFYWSHGLISDSTYQLLTSVCNNSKLMREAITSTVSSA  276

Query  825   CSDINVMISEEIGDDMHKDNLLFQSCQTDQYS---------------------------S  923
             C  +  ++ +E+ + +   ++    C +   S                            
Sbjct  277   CLGVYTLVQKELSESVDPYDVTGDICLSSNQSQLKIFNQQLLRSRLPYLSPQVLEMDSVK  336

Query  924   SQRHCLGTETAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMIL----N  1082
              Q+  +GT     D CLL     YL+R +VQ ALHA     + W    H  +++L    +
Sbjct  337   QQQQVMGT----VDVCLLEETTKYLNRKDVQMALHARLVGVTNW----HVCSVVLEYDRS  388

Query  1083  NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYD  1262
             N     +  + +L+K G+ +L+YSGD+D  IP + TR L + LA  L L T      W  
Sbjct  389   NEERPTIHVVRSLVKSGLKVLVYSGDQDSVIPFTGTRSLVSKLAKDLRLKTTVPYRAWLS  448

Query  1263  GKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1436
             G Q+GGW+Q +G+        NL+FAT+RG SH  P++ P ++L LFKAFL+  P P 
Sbjct  449   GNQVGGWTQVYGD--------NLSFATIRGASHTAPSTQPKRSLLLFKAFLEKKPLPT  498



>ref|XP_004979352.1| PREDICTED: serine carboxypeptidase-like 45-like [Setaria italica]
Length=472

 Score =   320 bits (820),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 179/444 (40%), Positives = 256/444 (58%), Gaps = 19/444 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V F QYSGY+       RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  40    IRRLPGQP-EVSFGQYSGYVGVDDVGKRALFYYFVEAEV-DPASKPLVLWLNGGPGCSSL  97

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+    LVKN++SWN  +N++Y++TP GV +SYS  ++ Y+   D MT
Sbjct  98    GVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPAGVGYSYSADAAYYQGVDDKMT  156

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A +N+ FL++W  +F +Y+  D YIAG+SY GH  PQLAE+++E+N+K    +   LKGI
Sbjct  157   ATDNMVFLQRWLQKFPQYKGRDLYIAGESYAGHYIPQLAEVMVEFNKKD---KIFNLKGI  213

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNP+LE      S  E+ W +G+IS   Y +    C+ +R V E   G +S  C+ + 
Sbjct  214   ALGNPVLEFTTDFNSRAEYFWSHGLISDGTYRVFTSVCNYSRYVAEYYGGALSPLCARVM  273

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA-KADPCLLTWVDDYLSRPEVQ  1016
               ++ E    + K ++    C +   S S+      +   + D C+      YL+R +VQ
Sbjct  274   NQVTRETSRFVDKYDVTLDVCLSSVLSQSKVLTPHQQAGNRIDVCVEDETVRYLNRRDVQ  333

Query  1017  EALHA---NASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
              A+HA       W          L NL I  +  + +L+K GI +L+YSGD+D  IP++ 
Sbjct  334   AAMHARLVGVDKWAVCSSVLEYELLNLQIPTINIVGSLVKSGIRVLVYSGDQDSVIPLTG  393

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L   LA  + L T      W++G+Q+GGW+Q +G  GG      L+FAT+RG SH  
Sbjct  394   SRTLVQNLAHDMGLKTTTPYRVWFEGQQVGGWTQVYG--GG-----TLSFATIRGASHEA  446

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L L ++FL+G P P T
Sbjct  447   PFSQPERSLVLVRSFLQGQPLPET  470



>emb|CBI32802.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   329 bits (843),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 259/441 (59%), Gaps = 31/441 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  368   ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTALKPLVVWFSGGPGCSSV  426

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
                   ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  427   GA----QHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  481

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA+LILE + K        LKGI
Sbjct  482   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESSVK------FNLKGI  535

Query  666   ALGNPLLE-KMGLSNVEHL-WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
              +GNPL++     ++V H  W +G+IS   Y+L   +C+ +RM +E  SG +S  C  + 
Sbjct  536   LMGNPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  595

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
                S+E+GD + + ++   SC        Q       T   D C+   V+ Y +R +VQ+
Sbjct  596   SQYSQEVGDSVDRFDVTLNSCLPSVDPQPQV------TENVDVCIGDEVNKYFNREDVQK  649

Query  1020  ALHA---NASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             +LHA     + W          + +  I ++P + +L+K GI   +YSGD+D  IP+  T
Sbjct  650   SLHARLVGVANWSMCSGALRYNIKDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFGT  709

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA +L L T      W++G+Q+GGW+Q +G+         L+FATVRGGSH VP
Sbjct  710   RTLVDGLAKKLRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTVP  761

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              + P++AL LF AFLKG PPP
Sbjct  762   GTQPARALVLFTAFLKGQPPP  782


 Score =   203 bits (517),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 111/287 (39%), Positives = 165/287 (57%), Gaps = 12/287 (4%)
 Frame = +3

Query  54   MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
            MV L    +    +++      + + SLPGQP  V F Q+ GY+   + +GRALFYYF E
Sbjct  8    MVVLATLCVAPLCFAMEPVSESDKLGSLPGQP-HVSFQQFGGYVTIDEKQGRALFYYFVE  66

Query  234  AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
            A ++   S PL LWL GG  CSS   G F E+GPFRP     L++N+ SWN  +NMLYV+
Sbjct  67   AVTDPTASKPLVLWLTGGPGCSSLGGGAFMEHGPFRP-RGNTLLRNKHSWNREANMLYVE  125

Query  414  TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
            +P GV FSYS   S Y   +D +TAR+NL FL  WF++F +YR+ + +I G+SY GH  P
Sbjct  126  SPAGVGFSYSRNKSFYDDINDEVTARDNLAFLEGWFMKFPKYRNRELFITGESYAGHYVP  185

Query  594  QLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNVE--HLWHYGIISTELYHLQKR  767
            QLA+L++   +         LKGI +GNPLLE     N +    W +G+IS   + L   
Sbjct  186  QLAQLVINSGKN------FNLKGILIGNPLLEFDTDMNAQGDFFWSHGLISDSTHALLTS  239

Query  768  QCDSTRMVQEI--LSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSC  902
             C+ +++++ +  +S  +S +C ++    + EIG  +   ++L   C
Sbjct  240  TCNYSQIMRWVYNISESLSPECYEVYNKSAGEIGGSVDPFDVLGDKC  286



>gb|ABK26025.1| unknown [Picea sitchensis]
Length=384

 Score =   317 bits (812),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 160/384 (42%), Positives = 251/384 (65%), Gaps = 13/384 (3%)
 Frame = +3

Query  324   ENGPFRPT-EDGELV-KNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTAREN  497
             E+GPF+P   +GEL+  N++SWN+ +NMLY+++PIGV FSYSN+SSDY+ ++D MTA++N
Sbjct  2     EHGPFKPRGHNGELLWTNKYSWNMETNMLYLESPIGVGFSYSNSSSDYQYYNDAMTAQDN  61

Query  498   LKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGIALGN  677
             L FL  WF +F EYR +DFYI G+SYGGH  PQLA L+L +N+ P +++P+KL+GIA+GN
Sbjct  62    LAFLLNWFEKFPEYRSVDFYITGESYGGHYVPQLATLVLNHNKNP-NIKPVKLEGIAMGN  120

Query  678   PLLE-KMGLSNVEHLWHYGIISTELYHLQKRQC-DSTRMVQEILSGEMSEDCSDINVMIS  851
             P ++ ++ ++N E  W +G+IS E Y L +  C +S R V+  +   +S+ C ++   + 
Sbjct  121   PFVDIEISINNDEFFWSHGLISDETYRLAQSVCNNSRRWVESYVLNNLSKTCQNVFSKVQ  180

Query  852   EEIGDDMHKD-------NLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPE  1010
              E G+   +D       N               +H +     K DPC+   ++ YL++ E
Sbjct  181   SETGNINLEDVTLGLCLNGGGSQTTGSGKPRKFQHKIEHTFNKIDPCIDFKINQYLNKQE  240

Query  1011  VQEALHANAST-WDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             V+++LHAN S  W++     +    N  I+++P LS LLK G+ + +YSGD+D ++P + 
Sbjct  241   VKKSLHANTSLYWEACSGKLHYDQKNRGINVIPVLSDLLKAGLRITLYSGDQDSKVPFTA  300

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             TR +AN LA  LNL T+    PWYD KQ+ GW+Q++G++  G+  + LT+ATVRGG H V
Sbjct  301   TRTIANNLAKELNLYTVIPYGPWYDNKQVAGWTQSYGHTVKGKNESILTYATVRGGGHEV  360

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P ++PS+AL L++AF++  P P++
Sbjct  361   PYTNPSEALNLYRAFIRALPLPSS  384



>ref|XP_002517286.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45079.1| serine carboxypeptidase, putative [Ricinus communis]
Length=434

 Score =   319 bits (817),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 253/435 (58%), Gaps = 25/435 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GYI   + + RALF+YF EA++ D  S PL LWL GG  CSS 
Sbjct  11    IVSLPGQPR-VSFQQYAGYITIDENQQRALFFYFVEAEA-DPASKPLVLWLNGGPGCSSV  68

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV N++SWN  +NMLY++ P GV FSYS  +S Y   +DT+T
Sbjct  69    GAGAFSEHGPFRPSGGDNLVVNEYSWNKEANMLYLEAPAGVGFSYSGNTSFYHSVNDTIT  128

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A++NL FL++WF +F EY + DFYI G+SY GH  PQLA LI++   K        LKGI
Sbjct  129   AQDNLVFLQQWFAKFPEYMNRDFYITGESYAGHYVPQLANLIVQSGLK------FNLKGI  182

Query  666   ALGNPLLEKMGLSNVE--HLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNPLLE     N +  + W +G+IS   Y L    C++++++++ + G +S  C  ++
Sbjct  183   AIGNPLLEFNTDFNSQGDYYWSHGLISDATYQLVTSVCNTSQLMRDYIRGSLSSTCQAVD  242

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S EI   +   ++    C ++  + S+       + + D CL     +YL+  EVQ+
Sbjct  243   DQLSIEIPAAIDGYDVTSDVCASNLQAVSKSRT----SEEIDLCLEEKTSEYLNLKEVQD  298

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA     S W       +    NL I  +  + +L+  GI +L+YSGD+D  IP   +
Sbjct  299   ALHAKLVGISNWTICSRVLSYDYGNLEIPTIDVVGSLVSSGIQVLVYSGDQDSVIPFIGS  358

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L N LA +L L +        D KQ+GGW Q +G+         LT+AT+RGGSH  P
Sbjct  359   RTLVNGLAKKLKLNSTTYRGWLEDNKQVGGWRQVYGDV--------LTYATIRGGSHLAP  410

Query  1371  NSSPSKALTLFKAFL  1415
              SSP ++L LFKAFL
Sbjct  411   WSSPRRSLALFKAFL  425



>gb|KHG30064.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=472

 Score =   320 bits (819),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 186/484 (38%), Positives = 268/484 (55%), Gaps = 48/484 (10%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHK---FRGRALFYYFAEAQ  239
             W   V  L  +      +I+ +LPGQP  V F  +SGY+  H     R RALFYYF EA+
Sbjct  6     WVGFVTLLLHVCFSGADKIV-ALPGQP-KVSFQHFSGYVTVHDEKPHRQRALFYYFVEAE  63

Query  240   SEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTP  419
             +    S PL LWL GG  CSS   G F E+GPF+P     L KN  SWN  +NMLY+++P
Sbjct  64    TMPA-SKPLVLWLNGGPGCSSVGAGAFIEHGPFKPNGK-TLTKNANSWNKEANMLYLESP  121

Query  420   IGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQL  599
              GV FSYS  +S Y   +D + AR+N  FL +W + F +Y++ DFYI G+SY GH  PQL
Sbjct  122   AGVGFSYSANNSFYTDLNDEVVARDNFVFLERWLLIFPQYKNRDFYITGESYAGHYVPQL  181

Query  600   AELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQC  773
                I+  N K      + LKGIA+GNPLLE +   N   ++ W +G+IS   Y L    C
Sbjct  182   TLHIIHSNLK------LNLKGIAIGNPLLEFVTDMNSADQYYWSHGLISDSAYELLLSFC  235

Query  774   DSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTD--------------  911
             +S+R+++E L+   S DC  +   +++E+G  + K +++   C +               
Sbjct  236   NSSRLMREALTQSFSSDCLSVYGEVAKELGKSVDKYDVIADVCLSSGQSSMAIFSHPMFL  295

Query  912   --QYSS---SQRHCLGTETAK--ADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFH  1061
               Q+SS   SQ      +  K  ADPC+      YL+R +VQ+ALHA     ++W+ + +
Sbjct  296   GPQFSSSLHSQVDGFSQQQVKVEADPCIEDKTTKYLNRKDVQKALHAKLVGITSWN-LCN  354

Query  1062  GRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTME  1241
                  +++L    + T+  ++K GIP+++YSGD+D  IP + TR L   LA  L L T  
Sbjct  355   KIVQYMDDLETPTIYTVGKIVKSGIPVMVYSGDQDSVIPFTGTRNLVYKLAKALGLKTTV  414

Query  1242  MNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKG  1421
                PW++GKQ+GGW+Q +G+         L+FAT+RG SH  P S P +++ LFKA L G
Sbjct  415   PYRPWFEGKQVGGWTQVYGDI--------LSFATIRGASHTAPASQPKRSMALFKAVLSG  466

Query  1422  SPPP  1433
              P P
Sbjct  467   KPLP  470



>ref|XP_009615670.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nicotiana 
tomentosiformis]
Length=464

 Score =   319 bits (818),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 180/465 (39%), Positives = 261/465 (56%), Gaps = 20/465 (4%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +  FL   +L  +S   + + I  LPGQP  V F Q+SGY+     + R+LFYYF EA++
Sbjct  13    IFLFLFCVSLGIVSALPHPDKIIQLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFVEAET  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              +  S PL LWL GG  CSS  +G F ENGPFRP     LV+N+ SWN  +NMLY+++PI
Sbjct  72    -NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKEANMLYLESPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYSN +S Y+  +D +TAR+NL FL +WF +F  YR  + ++ G+SY GH  PQLA
Sbjct  130   GVGFSYSNDTSSYETVNDEITARDNLVFLLRWFHKFPLYRKSNLFLTGESYAGHYVPQLA  189

Query  603   ELILEYNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCD  776
             +L++ +N+K    +   LKG+ALGNP+LE      S  E+ W +G+IS   Y +    C+
Sbjct  190   KLMMAFNKKQ---QIFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFSSACN  246

Query  777   STRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA  956
              +R V E   G +S  CS +  ++S E    + K  +    C +   S S+         
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISSVLSQSKIISPQENVE  306

Query  957   KADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLK  1127
             K D C+   + +YL+R +V+ ALHA       W       +  L ++ I  +  +  L+K
Sbjct  307   KLDVCVEDEIVNYLNRKDVRRALHAELVGVRRWAVCSSILDYQLLDIEIPTISIIGMLVK  366

Query  1128  RGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQ-IGGWSQTFGNS  1304
               IP+LIYSGD+D  IP+  +R   + LA R+ L T      W+ G+Q +GGW+  + N 
Sbjct  367   ERIPVLIYSGDQDSVIPLIGSRATVHQLARRMRLNTTVPYRVWFAGQQVVGGWTHVYDNI  426

Query  1305  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
                     L+FAT+RG SH  P S P ++L LFK+FL+  P P  
Sbjct  427   --------LSFATIRGASHEAPFSQPERSLVLFKSFLEDRPLPEV  463



>ref|XP_004136677.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 gb|KGN59516.1| hypothetical protein Csa_3G823640 [Cucumis sativus]
Length=479

 Score =   319 bits (817),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 190/463 (41%), Positives = 258/463 (56%), Gaps = 48/463 (10%)
 Frame = +3

Query  126   IDSLPGQPSD--VDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I SLP QPSD   +F Q+ GY+   + +GRALFYYF EAQ++   S PL LWL GG  CS
Sbjct  33    IRSLPSQPSDSKANFKQFGGYVTIDEKQGRALFYYFVEAQTQPT-SKPLVLWLNGGPGCS  91

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E+GPF+   +GE LVKN++SWN  +NMLYV++P GV FSYS+  S Y   +D
Sbjct  92    SVGAGAFIEHGPFKI--NGETLVKNEYSWNTEANMLYVESPAGVGFSYSSNKSFYSKIND  149

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
              +TAR+NL FL+ WF++F EY++ DFYI G+SYGGH  PQLA+LIL+          IKL
Sbjct  150   KITARDNLLFLQNWFVKFPEYKNADFYITGESYGGHYVPQLAQLILKSKAN------IKL  203

Query  657   KGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KGIA+GNPLL+ +   N   + +W +G+IS   Y L    C+++R  QEI  G +S DC 
Sbjct  204   KGIAIGNPLLDLVNDFNARDKFMWSHGVISDSAYMLLSSICNTSRFYQEIFQGFISSDCI  263

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSS----------------SQRHCLGTETAKA  962
              +   +S+++   +   N++   C     S                 SQRH L     K 
Sbjct  264   FVFSEVSKQLSPLIDDYNVIGDVCSLTAKSQPSVLLHPLSSFITKSVSQRHLLSHPQEKV  323

Query  963   ----DPCLLTWVDDYLSRPEVQEALHANASTWD--SIFHGRN----MILNNLAIDILPTL  1112
                 D C    +  YL+R +VQ+ALHA     D  S+ +  N      L N     +  +
Sbjct  324   GIDRDVCSQENIAKYLNRNDVQKALHAKLIGVDQWSVCNSNNSDWHYDLKNWLTPTIGVV  383

Query  1113  SALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQT  1292
              +L+K  I +L+YSGD+D  +  + TR L N+LA  L L      + W    Q GGWS+ 
Sbjct  384   GSLVKSHIRVLVYSGDQDSVVSFTGTRTLVNLLANSLGLNITMSYKVWVVDNQAGGWSEA  443

Query  1293  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKG  1421
             +G          L+FATVRG SH  P + P  +L LFKAFL G
Sbjct  444   YGKF--------LSFATVRGASHLAPETQPKTSLALFKAFLDG  478



>gb|KCW90016.1| hypothetical protein EUGRSUZ_A02215 [Eucalyptus grandis]
Length=469

 Score =   318 bits (816),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 185/442 (42%), Positives = 249/442 (56%), Gaps = 24/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GY+   + + RALF+YFAEA++ D  S PL LWL GG  CSS 
Sbjct  33    IASLPGQP-KVSFGQYAGYVTVDEKQQRALFFYFAEAEA-DPASKPLVLWLNGGPGCSSI  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F E+GPF+P  D  L+KN +SWN  +NMLY+++P GV FSYS  +S Y    D MT
Sbjct  91    GLGSFSEHGPFKPRGD-VLLKNDYSWNKEANMLYLESPAGVGFSYSVHTSYYSSVDDEMT  149

Query  486   -ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
               R+NL FLR WF +F EY++ DF+I G+SY GH  PQLA LI       V  +   LKG
Sbjct  150   EQRDNLAFLRSWFEKFPEYKERDFFITGESYAGHYVPQLAMLI-------VQSKLFNLKG  202

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IA+GNPLLE      S  E  W +G+IS   Y      C+ +++ ++  SG ++  CS +
Sbjct  203   IAIGNPLLEFNTDFNSRAEFFWSHGLISDATYESFNTMCNYSQIRRQAQSGTLTPVCSRV  262

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
             N   + EI   +   ++    C +   S S       +T K D C+      YL+R EVQ
Sbjct  263   NSEANREISKFIDTYDVTLDVCLSTVSSQSAVLNKLQQTEKIDVCVQDETLKYLNRKEVQ  322

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             EALHA     S+W            NL I  +  L  L+K GI +L+YSGD+D  IP+  
Sbjct  323   EALHARLVGISSWTVCSDVLEYEYQNLEIPTITILGELVKSGIHVLVYSGDQDSAIPLLG  382

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             TR L N LA +L L T      W++  Q+ GW+Q +G+         L++AT+RG SH  
Sbjct  383   TRTLVNNLAKQLGLNTTVPYRVWFEESQVAGWTQVYGDI--------LSYATIRGASHVA  434

Query  1368  PNSSPSKALTLFKAFLKGSPPP  1433
             P S P ++L LF +FL G P P
Sbjct  435   PFSQPERSLVLFSSFLGGRPLP  456



>gb|KDP37687.1| hypothetical protein JCGZ_06344 [Jatropha curcas]
Length=463

 Score =   318 bits (815),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 186/464 (40%), Positives = 257/464 (55%), Gaps = 46/464 (10%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GYI   + + RALFYYF EA++ +  S PL LWL GG  CSS 
Sbjct  14    IVSLPGQP-QVSFQQYAGYITVDEKQQRALFYYFVEAET-NPASKPLVLWLNGGPGCSSV  71

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP     L +N++SWN  +N+LY+++P GV FSYS  +S Y   +DT+T
Sbjct  72    GAGAFSEHGPFRPAGGVNLTRNEYSWNKEANILYLESPAGVGFSYSANTSFYDSVNDTIT  131

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A++NL FL++WF +F +Y++ DF+I G+SY GH  PQLA LI++   K        LKGI
Sbjct  132   AQDNLVFLQQWFEKFPDYKNRDFFITGESYAGHYVPQLANLIVQSGLK------FNLKGI  185

Query  666   ALGNPLLEKMGLSNVE--HLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNPLLE     N E  + W +G+IS   Y L    C+ +++ +E + G +S DC  +N
Sbjct  186   ALGNPLLEFSTDMNSEGYYYWSHGLISDSTYQLLTSTCNMSQLWREGIRGSLSPDCEAVN  245

Query  840   VMISEEIGDDMHKDNLLFQSCQT---------------------DQYSSSQRHCLGTETA  956
               IS EI  ++ + ++    C +                         +S +      T 
Sbjct  246   DRISAEIPYEIDEYDVTSDVCVSYGQAQLKVNDHPLRARFRFSKSLQENSSKPVSSPYTQ  305

Query  957   KA----DPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLS  1115
             KA    D C+     +YL+   VQEALHA     + W S     N    NL I  +  + 
Sbjct  306   KASENIDLCVQEKTYEYLNFKNVQEALHAQLVGIAKWSSCSQVVNYDRENLEIPTIGVVG  365

Query  1116  ALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTF  1295
             +L+  GI +LIYSGD+D  IP   +R L N LA +L L        W + KQ+GGW++ +
Sbjct  366   SLVSSGIRVLIYSGDQDSVIPFIGSRTLVNNLAKQLGLNATVAYRGWIEDKQVGGWTEVY  425

Query  1296  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSP  1427
             G+         L+F T+RGGSH  P SSP ++L LFKAFL G P
Sbjct  426   GDI--------LSFTTIRGGSHLAPFSSPKRSLALFKAFLAGKP  461



>ref|XP_009355268.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Pyrus 
x bretschneideri]
Length=461

 Score =   317 bits (811),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 182/446 (41%), Positives = 258/446 (58%), Gaps = 31/446 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F QY+GY+   + +GR+LFYYF EAQ+ D  S PL LWL GG  CSS 
Sbjct  35    ITRLPGQP-QVNFQQYAGYVTVDEKQGRSLFYYFVEAQT-DPASKPLVLWLNGGPGCSSV  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+ D  L+K  FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  93    G-GAFIEHGPFQPSGD-ILLKKDFSWNREANMLYLESPAGVGFSYSANKSFYGFVNDDIT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL+FL++WF EF EY++ D +I G SY GH  PQLA+LI++   K        LK +
Sbjct  151   ARDNLEFLQRWFDEFPEYKNRDLFITGVSYAGHYVPQLAQLIIQSKLK------FNLKAV  204

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQE--ILSGEMSEDCSD  833
             A+GNPLLE      S  E+ W +G+IS   +      C+ + + ++  I  G ++  C  
Sbjct  205   AIGNPLLEFNTDINSRAEYWWSHGLISDATFANLTSVCNYSEIFRQERIRGGPLTPACDA  264

Query  834   INVMISEEI-GDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPE  1010
             +      E+ G  +++ ++    C +   + S +     +T K D CL+  +  YL+RP+
Sbjct  265   VANQFEREVPGHLINRYDVTLDVCLSSVEAQSFQL---RKTVKIDVCLVDEIVSYLNRPD  321

Query  1011  VQEALHANASTWDSIFHGRNMI---LNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQEALHA  + W   F  + +I   L NL   +LP L  L+K GI +LIYSGD+D  IP+
Sbjct  322   VQEALHARITNW--TFCSKAVIQYDLKNLETPMLPVLGELVKSGIRVLIYSGDQDSIIPL  379

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + TR L N LA  L L T      W   KQ+ GW+Q + ++        L++AT+RG  H
Sbjct  380   TSTRTLVNGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------LSYATIRGAGH  431

Query  1362  FVPNSSPSKALTLFKAFLKGSPPPNT  1439
               P S P ++L LF +FL+G P P  
Sbjct  432   EAPISQPERSLLLFASFLRGKPLPKA  457



>ref|XP_007203526.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
 gb|EMJ04725.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
Length=461

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 179/464 (39%), Positives = 265/464 (57%), Gaps = 37/464 (8%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             FL+ N+L         + I SLPGQP  V F QY+GY+   + + RALFYYF EA++ D 
Sbjct  20    FLIANSL------PEADKITSLPGQP-QVSFQQYAGYVTVDEKQQRALFYYFVEAET-DA  71

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS   G F E+GPF+P+ D  L+KN FSWN  +NMLY+++P GV 
Sbjct  72    ASKPLVLWLNGGPGCSSVGAGAFIEHGPFKPSGD-ILLKNDFSWNKEANMLYLESPAGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELI  611
             FSYS+  S Y   +D +TA +N  FL +WF +F E+++ DF+I G+SYGGH  P+LA L+
Sbjct  131   FSYSSNQSFYDFVNDAITANDNFVFLERWFDKFPEFKNRDFFITGESYGGHYVPELARLV  190

Query  612   LEYNRKPVHVRPIKLKGIALGNPLLE--KMGLSNVEHLWHYGIISTELYHLQKRQCDSTR  785
             ++            LKGIA+GNPLL+      S  E+ W +G+IS   +      C+ ++
Sbjct  191   VQSKLN------FNLKGIAIGNPLLDFNTDFNSGAEYYWSHGLISDATFESFTSVCNYSQ  244

Query  786   MVQEIL-SGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA  962
             M+++I+ +G++S  C+ +   +  EI + +   ++    C +   + S++     ET K 
Sbjct  245   MLRQIINTGKLSPACAAVYNQVQTEISNFIDLYDVTLNVCLSSDAAQSRKLTQLQETEKI  304

Query  963   DPCLLTWVDDYLSRPEVQEALHAN---ASTW----DSIFHGRNMILNNLAIDILPTLSAL  1121
             D CL      YL+R +VQEALHA     S W    D + + R     ++ I +LP L  L
Sbjct  305   DVCLEDETSKYLNRQDVQEALHARLIGVSNWTICSDVVRYNR----QSMEILMLPVLGYL  360

Query  1122  LKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGN  1301
              + GI + +YSGD+D  IP++ TR   + LA  L L T      W++ KQ+ GW+Q +G+
Sbjct  361   SRFGIRIFVYSGDQDSVIPLTGTRTAVDGLAEVLELNTTVPYRVWFEEKQVAGWTQVYGD  420

Query  1302  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                      L+FAT+RG  H  P + P ++L LF +F+ G P P
Sbjct  421   V--------LSFATIRGAGHTAPYTQPERSLLLFSSFVGGKPLP  456



>gb|EMS58238.1| Serine carboxypeptidase-like 45 [Triticum urartu]
Length=455

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 178/447 (40%), Positives = 253/447 (57%), Gaps = 20/447 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
             G  I  LPGQP +V F QYSGYI       RALFYYF EA+  D  + PL LWL GG  C
Sbjct  21    GGRITRLPGQP-EVSFGQYSGYIEVDGKGSRALFYYFVEAEL-DPATKPLVLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS  +G F ENGPFRP+    LV+N++SWN  +N++Y++TP GV FSYS  ++ Y+  +D
Sbjct  79    SSLGVGAFSENGPFRPSGQA-LVRNEYSWNKEANVIYLETPAGVGFSYSADAAYYQGVND  137

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
              MTA  N+ F+++W  +F +Y+  + YIAG+SY GH  PQLAE+++E+N+K        L
Sbjct  138   NMTAMGNMVFMQRWLEKFPQYKGRELYIAGESYAGHYIPQLAEVMVEFNKKD---NIFNL  194

Query  657   KGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KG+ALGNP+L       S  E+ W +G+IS   Y +    C+ +R V E   G +S  C+
Sbjct  195   KGLALGNPVLHFTTDFNSRAEYFWSHGLISDSTYRIFTSVCNYSRYVSEYYGGSLSPLCA  254

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA-KADPCLLTWVDDYLSRP  1007
              +   ++ E    + K ++    C +   S S           + D C+     +YL+R 
Sbjct  255   RVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSMILSPHKRVGHRIDVCVEDETVNYLNRK  314

Query  1008  EVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIP  1178
             +VQEALHA       W          L NL I  +  + +L+K GI +L+YSGD+D  IP
Sbjct  315   DVQEALHAKLIGVKNWAVCSSVLEYELLNLQIPTIDIVGSLVKSGIRVLVYSGDQDSVIP  374

Query  1179  VSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGS  1358
             ++ +R L   LA  L L T      W++GKQ+GGW+Q +G+         L+FAT+RG S
Sbjct  375   LTGSRTLVQNLARDLGLKTSIPYRVWFEGKQVGGWTQVYGD--------KLSFATIRGAS  426

Query  1359  HFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             H  P S P ++L L +AFL+  P P T
Sbjct  427   HEAPFSQPERSLVLIRAFLQDRPLPET  453



>ref|XP_009355267.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Pyrus 
x bretschneideri]
Length=462

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 182/446 (41%), Positives = 258/446 (58%), Gaps = 30/446 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F QY+GY+   + +GR+LFYYF EAQ+ D  S PL LWL GG  CSS 
Sbjct  35    ITRLPGQP-QVNFQQYAGYVTVDEKQGRSLFYYFVEAQT-DPASKPLVLWLNGGPGCSSV  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+ D  L+K  FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  93    G-GAFIEHGPFQPSGD-ILLKKDFSWNREANMLYLESPAGVGFSYSANKSFYGFVNDDIT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL+FL++WF EF EY++ D +I G SY GH  PQLA+LI++   K        LK +
Sbjct  151   ARDNLEFLQRWFDEFPEYKNRDLFITGVSYAGHYVPQLAQLIIQSKLK------FNLKAV  204

Query  666   ALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQE--ILSGEMSEDCSD  833
             A+GNPLLE      S  E+ W +G+IS   +      C+ + + ++  I  G ++  C  
Sbjct  205   AIGNPLLEFNTDINSRAEYWWSHGLISDATFANLTSVCNYSEIFRQERIRGGPLTPACDA  264

Query  834   INVMISEEI-GDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPE  1010
             +      E+ G  +++ ++    C +   + S +     +T K D CL+  +  YL+RP+
Sbjct  265   VANQFEREVPGHLINRYDVTLDVCLSSVEAQSFQL---RKTVKIDVCLVDEIVSYLNRPD  321

Query  1011  VQEALHANASTWDSIFHGRNMI---LNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQEALHA  + W +    R +I   L NL   +LP L  L+K GI +LIYSGD+D  IP+
Sbjct  322   VQEALHARITNW-TFCSNRAVIQYDLKNLETPMLPVLGELVKSGIRVLIYSGDQDSIIPL  380

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + TR L N LA  L L T      W   KQ+ GW+Q + ++        L++AT+RG  H
Sbjct  381   TSTRTLVNGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------LSYATIRGAGH  432

Query  1362  FVPNSSPSKALTLFKAFLKGSPPPNT  1439
               P S P ++L LF +FL+G P P  
Sbjct  433   EAPISQPERSLLLFASFLRGKPLPKA  458



>ref|XP_007224935.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
 gb|EMJ26134.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
Length=438

 Score =   315 bits (806),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 171/441 (39%), Positives = 252/441 (57%), Gaps = 41/441 (9%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q++GY+       R+LFYYF EA+S    S PL +W  GG  CSS 
Sbjct  31    IVSLPGQPR-VSFQQFAGYVDVDDHPQRSLFYYFVEAESRPA-SKPLVVWFNGGPGCSSV  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+    L+KN +SWN  +NMLY+++P GV FS++   S Y+  +D +T
Sbjct  89    GEGAFVEHGPFKPSGGATLIKNPYSWNTEANMLYLESPAGVGFSFAADKSFYENVNDNIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR++L FL++WF +F EY   D ++ G+SY GH  PQLA+LI++            LKGI
Sbjct  149   ARDSLTFLQRWFDKFPEYNHRDLFLVGESYAGHYVPQLAQLIIQSGVN------FNLKGI  202

Query  666   ALGNPLLEKMGLSNVEHL--WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNPLLE     N E L  W +G+IS   Y L    C+S+++++E ++G  S+ CSD+ 
Sbjct  203   AIGNPLLEFSTDVNAEDLFYWSHGLISDAAYGLLTSVCNSSQLLRETIAGSPSDACSDVI  262

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +S+E+ + + K   L                    T K D C+      YL+R +VQ+
Sbjct  263   TQVSQELSNYVDKYYQL--------------------TDKIDACVEEETVTYLNRKDVQK  302

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA     S W          + ++ I  +P + +L+K GI +++YSGD+D  +P   +
Sbjct  303   ALHAKLVGVSNWSLCSQVLQYDMRDMEIPTIPIVGSLVKSGIRVMVYSGDQDSVVPFFGS  362

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L N LAT+L L +      W++GKQ+GGW+Q + +         L+FA +RG SH  P
Sbjct  363   RSLINGLATQLGLKSTVPYRAWFEGKQVGGWTQVYDDI--------LSFAIIRGASHTAP  414

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
             ++ P ++L LFK+FL G P P
Sbjct  415   STQPKRSLALFKSFLGGKPLP  435



>ref|XP_010023719.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=477

 Score =   316 bits (809),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 185/450 (41%), Positives = 249/450 (55%), Gaps = 32/450 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GY+   + + RALF+YFAEA++ D  S PL LWL GG  CSS 
Sbjct  33    IASLPGQP-KVSFGQYAGYVTVDEKQQRALFFYFAEAEA-DPASKPLVLWLNGGPGCSSI  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F E+GPF+P  D  L+KN +SWN  +NMLY+++P GV FSYS  +S Y    D MT
Sbjct  91    GLGSFSEHGPFKPRGD-VLLKNDYSWNKEANMLYLESPAGVGFSYSVHTSYYSSVDDEMT  149

Query  486   A---------RENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVH  638
                       R+NL FLR WF +F EY++ DF+I G+SY GH  PQLA LI       V 
Sbjct  150   GSFPCKLRYQRDNLAFLRSWFEKFPEYKERDFFITGESYAGHYVPQLAMLI-------VQ  202

Query  639   VRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGE  812
              +   LKGIA+GNPLLE      S  E  W +G+IS   Y      C+ +++ ++  SG 
Sbjct  203   SKLFNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDATYESFNTMCNYSQIRRQAQSGT  262

Query  813   MSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDD  992
             ++  CS +N   + EI   +   ++    C +   S S       +T K D C+      
Sbjct  263   LTPVCSRVNSEANREISKFIDTYDVTLDVCLSTVSSQSAVLNKLQQTEKIDVCVQDETLK  322

Query  993   YLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDE  1163
             YL+R EVQEALHA     S+W            NL I  +  L  L+K GI +L+YSGD+
Sbjct  323   YLNRKEVQEALHARLVGISSWTVCSDVLEYEYQNLEIPTITILGELVKSGIHVLVYSGDQ  382

Query  1164  DLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFAT  1343
             D  IP+  TR L N LA +L L T      W++  Q+ GW+Q +G+         L++AT
Sbjct  383   DSAIPLLGTRTLVNNLAKQLGLNTTVPYRVWFEESQVAGWTQVYGDI--------LSYAT  434

Query  1344  VRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
             +RG SH  P S P ++L LF +FL G P P
Sbjct  435   IRGASHVAPFSQPERSLVLFSSFLGGRPLP  464



>ref|XP_011042948.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   315 bits (806),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 183/444 (41%), Positives = 256/444 (58%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+     + RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  34    IAGLPGQP-HVGFQQFSGYVTVDGNKHRALFYYFVEAEI-DPASKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +G  L++N+ SWN  +NMLY++TP+GV FSY+  +S Y    D  
Sbjct  92    GVGAFSENGPFRP--NGRILIRNEHSWNREANMLYLETPVGVGFSYATDNSSYVAVDDEA  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKG  662
             TAR+NL FL+ WF +F +YR+ D +I G+SY GH  PQLA+L++E N+K   V    LKG
Sbjct  150   TARDNLVFLQGWFHKFPQYRNKDLFITGESYAGHYIPQLAKLMVEINKKKKLV---NLKG  206

Query  663   IALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IALGNP+LE      S  E+ W +G+IS   Y +    C+ +R V E     +S  CS +
Sbjct  207   IALGNPVLEFATDLNSRAEYFWSHGLISDSTYKMFTSACNYSRYVSEYYRDSVSSVCSLV  266

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                +S E    + K ++    C     S S+       + + D C+     +YL+R +V+
Sbjct  267   MKQVSTETSRFVDKYDVTLDVCIPSVLSQSKVISPKQVSERIDVCIEDETVNYLNREDVR  326

Query  1017  EALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSH  1187
             +A HA       W+   +  +  + N+ I  +  + +L+K GIP+LIYSGD+D  IP++ 
Sbjct  327   KAFHARLIGVRRWEVCSNILDYEVLNIEIPTINIVGSLIKAGIPVLIYSGDQDSVIPLTG  386

Query  1188  TRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1367
             +R L + LA  L L T      W+ GKQ+GGW+Q +GN         L+FAT+RG SH  
Sbjct  387   SRTLVHRLAKELGLNTTVPYRAWFAGKQVGGWTQVYGNI--------LSFATIRGASHEA  438

Query  1368  PNSSPSKALTLFKAFLKGSPPPNT  1439
             P S P ++L LFK+FL+G   P  
Sbjct  439   PFSQPERSLMLFKSFLQGKHLPEV  462



>ref|XP_003630573.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AET05049.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 180/447 (40%), Positives = 259/447 (58%), Gaps = 25/447 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  + F  +SGY+   + + R LFYYF E+++    S PL LWL GG  CSS 
Sbjct  34    IHKLPGQP-HIGFQHFSGYVTVDEKKRRYLFYYFVESETGPS-SKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTS-SDYKIWSDT  479
              +G F ENGPFRP  +GE L+KN+ SWN  +NMLY++TP+GV FSY+  S S+ K+ +D 
Sbjct  92    GVGAFSENGPFRP--NGEVLIKNEHSWNREANMLYLETPVGVGFSYAKGSFSNIKV-NDE  148

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLK  659
             +TAR+NL FL  WF +F +Y+  D ++ G+SY GH  PQLA L++  N K    +   LK
Sbjct  149   VTARDNLVFLLHWFNKFPQYKHTDLFLTGESYAGHYIPQLANLMIGINNKE---KIFNLK  205

Query  660   GIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             GIALGNPLLE      S  E  W +G+IS   Y +    C+ ++ V E     +S  CS 
Sbjct  206   GIALGNPLLEYATDFNSRAEFFWSHGLISDSTYKMFTAGCNYSQYVSEYYRNSISLLCSK  265

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAK--ADPCLLTWVDDYLSRP  1007
             +   +S E    + K ++    C +   S S+  C     A    D C+   V +YL+R 
Sbjct  266   VMSQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQNHHANESIDVCVDDEVTNYLNRR  325

Query  1008  EVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIP  1178
             +VQ+ALHA       W+   +  +  + NL +  L  + +++K G+ +LIYSGD+D  IP
Sbjct  326   DVQKALHAELIGVPKWNVCSNILDYNMLNLEVPTLHVVGSIIKAGVRVLIYSGDQDSVIP  385

Query  1179  VSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGS  1358
             ++ +R L + LA +L L T      W++G Q+GGW+Q +GN+        LTFAT+RG S
Sbjct  386   LTGSRTLVHKLARQLALKTTIPYRVWFEGHQVGGWTQVYGNT--------LTFATIRGAS  437

Query  1359  HFVPNSSPSKALTLFKAFLKGSPPPNT  1439
             H  P S P ++L LFK+FL+  P P +
Sbjct  438   HEAPFSQPERSLVLFKSFLENKPLPKS  464



>ref|XP_002990798.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ08071.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=467

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 177/447 (40%), Positives = 251/447 (56%), Gaps = 21/447 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             +++ +LPGQP+ V F QY+GY+      GRALFYYF EA S    S PL LWL GG  CS
Sbjct  28    DLVTNLPGQPA-VPFKQYAGYVTVDSHAGRALFYYFVEAHSHAS-SKPLALWLNGGPGCS  85

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E GPF P   G  LVKN  SWN A+N+L++++P GV +SYSN S DY I++D
Sbjct  86    SIGGGAFTELGPFYPNGTGRGLVKNSNSWNKAANILFLESPAGVGWSYSNRSEDYSIYND  145

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
               TA++++ FL +WF  F EY+  +FYI G+SY GH  PQLA  +L+YN+   H     +
Sbjct  146   AKTAKDSVTFLLRWFDAFPEYKSREFYITGESYAGHYVPQLAAALLDYNKAAGH-SVFNV  204

Query  657   KGIALGNPLLEKM--GLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KGIA+GNP L       S  + LW +G+IS + Y    R C  +       +  +S +C+
Sbjct  205   KGIAIGNPALNLAIDTASTYDFLWSHGLISDKTYEGLGRSCYWSDYDHGSGNNNVSAECN  264

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR--HCLGTETAKADPCLLTWVDDYLSR  1004
                   + E+GD ++  +++   C         R    +G  +   D C+      Y + 
Sbjct  265   QFISNSALEMGDHVNPYDIILDVCVPSIVEQEFRLKKRMGHRSIGVDVCMSYERYYYFNL  324

Query  1005  PEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLR  1172
             PEVQ+ALHAN +     W +        +N++ +DI+P L  LLK G+ + ++SGDED  
Sbjct  325   PEVQKALHANTTGLPYPWTNCDGPVQYDINDMRLDIVPVLRDLLKNGLRVWVFSGDEDAV  384

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             +P   TR   N LA  L L T    + W+   Q+GGW+++FG         NLTFATVRG
Sbjct  385   VPFLGTRVNVNSLAQELKLRTTASYKAWFLRTQVGGWAESFG---------NLTFATVRG  435

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              +H VP + P++AL LF+ F+ G P P
Sbjct  436   AAHMVPLAQPARALLLFQKFISGQPLP  462



>ref|XP_010673054.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=467

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 181/463 (39%), Positives = 262/463 (57%), Gaps = 27/463 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKF  254
             LL N L           I SLPGQP  V+F Q++GYI   + + R LFYYF EA++    
Sbjct  19    LLCNNLAEEFPSSEAHKITSLPGQP-HVNFQQFAGYITVDETQKRYLFYYFVEAETNPS-  76

Query  255   SMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAF  434
             S PL LWL GG  CSS   G F E+GPF P+ +  LVKN +SWN  +NMLY+++P GV F
Sbjct  77    SKPLVLWLNGGPGCSSIGAGAFSEHGPFHPSGN-VLVKNDYSWNKEANMLYLESPAGVGF  135

Query  435   SYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELIL  614
             SYS  +S Y   +D +TA++NL FL+ W   F EY++ DF+I G+SYGGH  PQLA LIL
Sbjct  136   SYSVNTSFYDGVNDEITAKDNLVFLQNWLEIFPEYKNRDFFITGESYGGHYVPQLANLIL  195

Query  615   EYNRKPVHVRPIKLKGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQCDSTRM  788
             + + K        LKGIALGNPLLE     N   E+LW +G+IS   Y L ++ C+ +++
Sbjct  196   KSSLKS------NLKGIALGNPLLEFNTDFNSRPEYLWSHGLISDATYELSQKVCNFSQI  249

Query  789   VQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLG---TETAK  959
              ++   G +S  C+ +N  +S EIG  +   ++    C      + Q H L     +  +
Sbjct  250   RRQAQKGFLSPSCALVNSHMSSEIGKFIDSYDVTLDVCY--HSIAKQAHVLDLNQMDEQQ  307

Query  960   ADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKR  1130
              D CL      Y++R +VQ+ ++A     + W       N  +++L +  LP L    K 
Sbjct  308   IDVCLDDETTQYINRKDVQKVMNAQLVGVTQWSMCSGVVNYHMDDLEVPTLPLLGTFAKS  367

Query  1131  GIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGG  1310
             G+ +L+YSGD+D  +P++ +R L + LA  L L T      W   KQ+GGW+Q +G+   
Sbjct  368   GVRVLVYSGDQDSVLPLTGSRMLVDSLAKELGLKTTVSYRTWLSDKQVGGWTQVYGDI--  425

Query  1311  GEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1439
                   L +AT+RG +H  P S P+++L LF++FL GSP P+ 
Sbjct  426   ------LAYATIRGAAHEAPFSQPARSLVLFRSFLNGSPLPDV  462



>ref|XP_010271869.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=465

 Score =   313 bits (803),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 256/441 (58%), Gaps = 19/441 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I+ LPGQP DV+F Q+SGYI   + + RALFYYF EA++ D  S PL LWL GG  CSS 
Sbjct  36    INKLPGQP-DVNFQQFSGYITVDESQQRALFYYFVEAET-DPASKPLVLWLNGGPGCSSV  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F E+GPF+P+ D  LV+N +SWN  +NMLY++TP GV FSYS  SS Y   +D MT
Sbjct  94    GVGAFSEHGPFKPSGD-ILVRNDYSWNREANMLYLETPAGVGFSYSTNSSYYSNVNDEMT  152

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             A +NL FL++WFI+F +YRD D +I G+SY GH  PQLA L++++N K    +   LKGI
Sbjct  153   AMDNLIFLQRWFIKFPQYRDRDLFITGESYAGHYVPQLALLMIQFNEKE---KLFNLKGI  209

Query  666   ALGNPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             ALGNPLLE     N   E +W +G+IS   Y +    C+ ++   E   G +S  C  + 
Sbjct  210   ALGNPLLEFATDFNARAEFMWSHGLISDPTYGIFTSSCNYSQYKSESYRGSVSPICLGVI  269

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               + +EI   + + ++    C +     ++           D C+      YL+R +VQ+
Sbjct  270   SQVEKEISKYVDQYDVTLDICLSSIVQQTKSLTRPQIVENIDVCVGDETFAYLNRADVQK  329

Query  1020  ALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALHA       W+      N  + NL +  +  + ++++ G+ +L+YSGD+D  IP++ +
Sbjct  330   ALHARLLGVKGWEVCSEVLNYDMLNLEVPTIHVVGSVIRSGVRVLVYSGDQDSVIPLTGS  389

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L + LA  L L T      W+  KQ+GGW+Q + +         L+FAT+RG SH  P
Sbjct  390   RMLVHRLANELGLNTTIAYRVWFQDKQVGGWTQVYSDI--------LSFATIRGASHEAP  441

Query  1371  NSSPSKALTLFKAFLKGSPPP  1433
              S P ++L LFKAFL+  P P
Sbjct  442   FSQPERSLLLFKAFLEDKPLP  462



>ref|XP_004238587.1| PREDICTED: putative serine carboxypeptidase-like 23 [Solanum 
lycopersicum]
Length=483

 Score =   314 bits (804),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 177/443 (40%), Positives = 246/443 (56%), Gaps = 35/443 (8%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I+ LPG+P DVDFNQYSGY+      GRALFYYF E+ +    S PL LWL GG  CSS 
Sbjct  67    IEKLPGEPEDVDFNQYSGYVTVDSSAGRALFYYFTESPTHSA-SKPLVLWLNGGPGCSSL  125

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E GPFR  +DG L +NQFSW   +N++++++P GV FSY+NTSSD+    D  T
Sbjct  126   GGGAFGELGPFRVNKDGTLQRNQFSWISEANIIFLESPAGVGFSYTNTSSDFNFSGDRTT  185

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVH-VRPIKLKG  662
             A ++  FL  W   F EY+  DFY+ G+SY GH  PQLA+LIL +N      +  I LKG
Sbjct  186   AHDSYTFLVNWLERFPEYKPNDFYLIGESYAGHYIPQLAQLILLHNSNSDETISTINLKG  245

Query  663   IALGNPLL--EKMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDI  836
             IA+GN  +  E       E+ W + +IS ELY+     C+ +          +S+ C+  
Sbjct  246   IAIGNAYVDFEANMKGTTEYYWSHALISEELYNKIILTCNFST------PSSVSKKCNAY  299

Query  837   NVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQ  1016
                I EEIG ++   N+    C       + R    T T+  DPCL +++  Y + PEVQ
Sbjct  300   LDQIDEEIG-NIFIYNVYAPLC-------TNRSPSSTSTSDVDPCLPSYIQSYFNIPEVQ  351

Query  1017  EALHANAST----WDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVS  1184
             +A+HAN +     W+S  +  N+   +  + +LP L  L+K G+ + +YSGD D+ +PV+
Sbjct  352   KAMHANVTNLPYPWESCNNTLNLNWKDRPLSVLPLLHQLMKSGLRIWLYSGDMDVVVPVT  411

Query  1185  HTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
              TR        +LNL+      PWY   ++GG+          E+  NLTF T+RG  HF
Sbjct  412   DTR----YAIKKLNLSVKTSWYPWYLQGEVGGYV---------EEYENLTFVTIRGAGHF  458

Query  1365  VPNSSPSKALTLFKAFLKGSPPP  1433
             VP   P++AL  F  FL G PPP
Sbjct  459   VPTYQPNRALAFFSQFLSGKPPP  481



>ref|XP_008670742.1| PREDICTED: serine carboxypeptidase-like 45 [Zea mays]
 tpg|DAA42025.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=479

 Score =   313 bits (803),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 182/446 (41%), Positives = 254/446 (57%), Gaps = 19/446 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRG--RALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I  LPGQP +V F QYSGY+      G  RALFYYF EA + D  S PL LWL GG  CS
Sbjct  43    ITRLPGQP-EVSFGQYSGYVGVDGDGGGKRALFYYFVEADAPDPASKPLVLWLNGGPGCS  101

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G F ENGPFRP+    LVKN++SWN  +N++Y++TP GV +SYS  ++ Y+   D 
Sbjct  102   SLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPAGVGYSYSADAAYYQGVDDK  160

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLK  659
             MTA +N+ FL++W  +F +YR  D YIAG+SY GH  PQLAE ++E+N K    R   LK
Sbjct  161   MTAMDNMVFLQRWLQKFPQYRGRDLYIAGESYAGHYIPQLAEAMVEFNNK--EERIFNLK  218

Query  660   GIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSD  833
             G+ALGNP+LE      S  E+ W +G+IS   +      C+ +R V E   G +S  C+ 
Sbjct  219   GVALGNPVLEFATDFNSRAEYFWSHGLISDATFRAFTSACNYSRYVAEYYGGALSPLCAR  278

Query  834   INVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETA-KADPCLLTWVDDYLSRPE  1010
             +   ++ E    + K ++      +   S S+      +   + D C+      YL+R +
Sbjct  279   VMNRVTRETSRFVDKYDVTLDVFLSSVLSQSKTLSPHEQVGQRVDVCVEDETVRYLNRRD  338

Query  1011  VQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPV  1181
             VQ ALHA       W          L NL I  +  + +L++ GI +L+YSGD+D  IP+
Sbjct  339   VQAALHARLVGVDKWAVCSSVLQYELLNLQIPTINVVGSLVRSGIRVLVYSGDQDSVIPL  398

Query  1182  SHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1361
             + +R L   LA  + L T      W++G+Q+GGW+Q +G  GG      L+FATVRG SH
Sbjct  399   TGSRTLVQSLARGMGLKTTTPYRVWFEGQQVGGWTQVYG--GGA-----LSFATVRGASH  451

Query  1362  FVPNSSPSKALTLFKAFLKGSPPPNT  1439
               P S P ++L LF+AFL+G P P T
Sbjct  452   EAPFSQPGRSLVLFRAFLQGQPLPET  477



>ref|XP_009355269.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   313 bits (802),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 181/443 (41%), Positives = 256/443 (58%), Gaps = 28/443 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F QY+GY+   + +GR+LFYYF EAQ+ D  S PL LWL GG  CSS 
Sbjct  35    ITRLPGQPQ-VNFQQYAGYVTVDEKQGRSLFYYFVEAQT-DPASKPLVLWLNGGPGCSSV  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F  +GPF+P+ D  L+KN FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  93    G-GAFIAHGPFQPSGD-ILLKNDFSWNREANMLYLESPAGVGFSYSANKSFYGFVNDDIT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR+NL+FLR+WF EF EY++ D +I G SY GH  PQLA+LI++   K        LK +
Sbjct  151   ARDNLEFLRRWFHEFPEYKNRDLFITGQSYAGHYVPQLAQLIIQSKLK------FNLKAV  204

Query  666   ALGNPLLEKMGLSN--VEHLWHYGIISTELYHLQKRQCDSTRMVQE--ILSGEMSEDCSD  833
             A+GNPLLE    +N   E+ W +G+IS   +      C+ + + ++  I  G +S  C  
Sbjct  205   AIGNPLLEFNTDANSPAEYWWSHGLISDATFANLTSVCNYSEIFRQEVIRGGPLSPACDA  264

Query  834   INVMISEEI-GDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPE  1010
             +      E+ G  ++  ++    C +   + S +     +T K D C+   +  YL+RP+
Sbjct  265   VANQFEREVPGHLINPYDVTLDVCLSSVEAQSFQL---RKTVKIDVCIGDEIVTYLNRPD  321

Query  1011  VQEALHANASTWDSIFHGRNMI--LNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVS  1184
             VQEALHA  + W    +G  +   + +  I +LP L  L+K GI +LIYSGD+D  IP+ 
Sbjct  322   VQEALHARVTNWTICSNGGVLEYDMKDHEILMLPVLGDLVKSGIRVLIYSGDQDSIIPLV  381

Query  1185  HTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1364
              TR L N LA  L L T      W   KQ+ GW+Q +G++        L++AT+RG  H 
Sbjct  382   STRTLVNGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYGDT--------LSYATIRGAGHE  433

Query  1365  VPNSSPSKALTLFKAFLKGSPPP  1433
              P S P ++L LF +FL+G P P
Sbjct  434   APISQPERSLLLFTSFLRGKPLP  456



>gb|ABK25236.1| unknown [Picea sitchensis]
Length=469

 Score =   313 bits (801),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 185/472 (39%), Positives = 264/472 (56%), Gaps = 26/472 (6%)
 Frame = +3

Query  69    WFLLVN-TLYSISIRING----EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             W  LV   L+ I+++I+G    ++ID LPGQP  V+F QY+GYI   +  GRALFYYFAE
Sbjct  10    WLCLVMYILFGIAVQISGGPAEDLIDRLPGQPK-VNFKQYAGYITVDEHAGRALFYYFAE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYV  410
             A+ +D  S P+ LWL GG  CSS   G F E GPF P +DG  L KN  SWN  SN+L+V
Sbjct  69    AE-DDSDSKPVALWLNGGPGCSSVGGGAFTELGPFYPRDDGHGLRKNLQSWNKVSNLLFV  127

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++P GV +SYSNT+SDY    D  TAR  L FL KWF  F EY   D ++ G+SY GH  
Sbjct  128   ESPAGVGWSYSNTTSDYTC-GDESTARNMLVFLSKWFKRFPEYASRDLFLTGESYAGHYI  186

Query  591   PQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKM--GLSNVEHLWHYGIISTELYHLQK  764
             PQLA  +L YN+     +   LKGI++GNPLL       ++ E LW +G+IS E      
Sbjct  187   PQLANKLLNYNKVAKRYK-FNLKGISIGNPLLSLNVDTAASYEFLWSHGLISDESNIAIL  245

Query  765   RQCDSTRMVQEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTD--QYSSSQRHC  938
             + C   + ++ +   ++S++C DI   + +EIGD +++ +++   C     +     R  
Sbjct  246   KSCKFDKRIKNVDVIDISKECDDILKQVEQEIGDYVNEYDVILDVCPPSLIEQELRLRKK  305

Query  939   LGTETAKADPCLLTWVDDYLSRPEVQEALHANAST----WDSIFHGRNMILNNLAIDILP  1106
             +   +   D C+ +    Y + P VQ+ALHAN +     W    +  N    +  IDILP
Sbjct  306   VSHMSLGVDVCMTSERQFYFNLPNVQKALHANRTNLPYDWSMCSNVLNYSGYDEGIDILP  365

Query  1107  TLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWS  1286
              L  ++++GI + I+SGD+D  +P+  +R     LA  L ++       WY   Q+ GW+
Sbjct  366   VLKDIIQQGIRVWIFSGDQDSVVPLMGSRTNVRNLANDLKMSVKVPYRAWYHEGQVAGWT  425

Query  1287  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1442
               +G+         LTFATVRG SH VP S P++AL LF+ FL G   P+  
Sbjct  426   TVYGDL--------LTFATVRGASHMVPYSQPARALHLFRTFLSGKDLPDQQ  469



>ref|XP_010271866.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nelumbo 
nucifera]
Length=519

 Score =   314 bits (805),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 182/459 (40%), Positives = 265/459 (58%), Gaps = 38/459 (8%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V+F QYSGYI   + + RALFYYF EA++ +  S PL LW+ GG  CSS 
Sbjct  73    IIKLPGQP-EVNFQQYSGYITVDEEQQRALFYYFVEAET-NPASKPLVLWVNGGPGCSSI  130

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV+N++SWN  +NMLY++TP GV FSYS  +S Y   +D MT
Sbjct  131   GTGAFSEHGPFRPS-GKNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVNDEMT  189

Query  486   ---------ARENLK----FLR---KWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILE  617
                      A+++      FLR   +W  +F E+++ D +I G+SY GH  PQLA+L+++
Sbjct  190   GPGKNYSIEAQKSYSYTSWFLRTSSRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQ  249

Query  618   YNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMV  791
             +N + +      LKGIALGNPLLE      S  E LW +G+IS   Y      C+ +R +
Sbjct  250   FNDQKL----FNLKGIALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFL  305

Query  792   QEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPC  971
              +   G +S  C  +  +++ EI   + + ++    C +   S S+           D C
Sbjct  306   SKYYRGSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQKVVESTDVC  365

Query  972   LLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILN--NLAIDILPTLSALLKRGI  1136
             +     +YL+R +VQ++LHA+    S W +  + R +  +  NL +  +P LS+L + GI
Sbjct  366   VEDETYNYLNRDDVQKSLHAHLVGVSGWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGI  425

Query  1137  PLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGE  1316
              +L+YSGD+D  IP++ TR L + LA  L L T      W++GKQ+GGW+Q +G+     
Sbjct  426   KILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI----  481

Query  1317  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                 LTFAT+RGGSH  P S P ++L LF +FLKG P P
Sbjct  482   ----LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  516



>ref|XP_002974500.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ24722.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=471

 Score =   313 bits (801),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 175/447 (39%), Positives = 251/447 (56%), Gaps = 21/447 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             +++ +LPGQP+ V F QY+GY+      GRALFYYF EA S    S PL LWL GG  CS
Sbjct  32    DLVTNLPGQPA-VPFKQYAGYVTVDSHAGRALFYYFVEAHSHAS-SRPLALWLNGGPGCS  89

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E GPF P   G  LVKN  SWN A+N+L++++P GV +SYSN S DY I++D
Sbjct  90    SIGGGAFTELGPFYPNGTGRGLVKNSNSWNKAANILFLESPAGVGWSYSNRSEDYSIYND  149

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
               TA++++ F+ +WF  F EY+  +FYI G+SY GH  PQLA  +L+YN+   H     +
Sbjct  150   AKTAKDSVTFMLRWFDAFPEYKSREFYITGESYAGHYVPQLAAALLDYNKAAGH-SVFNV  208

Query  657   KGIALGNPLLEKM--GLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KG+A+GNP L       S  + LW +G+IS + Y    R C  +       +  +S +C+
Sbjct  209   KGVAIGNPALNLAIDTASTYDFLWSHGLISDKTYEGLGRSCYWSDYDHGSGNNNVSAECN  268

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR--HCLGTETAKADPCLLTWVDDYLSR  1004
                   + E+GD ++  +++   C         R    +G  +   D C+      Y + 
Sbjct  269   QFISNSALEMGDHVNPYDIILDVCVPSIVEQEFRLKKRMGHRSIGVDVCMSYERYYYFNL  328

Query  1005  PEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLR  1172
             PEVQ+ALHAN +     W +        +N++ +DI+P L  LLK G+ + ++SGDED  
Sbjct  329   PEVQKALHANTTGLPYPWTNCDGPVQYDINDMRLDIVPVLRDLLKNGLRVWVFSGDEDAV  388

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             +P   TR   N LA  L L T    + W+   Q+GGW+++FG         NLTFATVRG
Sbjct  389   VPFLGTRVNVNSLAQELKLRTTASYKAWFLRTQVGGWAESFG---------NLTFATVRG  439

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              +H VP + P++AL LF+ F+ G P P
Sbjct  440   AAHMVPLAQPARALLLFQKFISGQPLP  466



>gb|EMS60816.1| Serine carboxypeptidase-like 45 [Triticum urartu]
Length=506

 Score =   313 bits (802),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 188/495 (38%), Positives = 265/495 (54%), Gaps = 62/495 (13%)
 Frame = +3

Query  99    ISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWL  278
             +S+ +  + I +LPGQP  V F QYSGY+     R R+LFYYFAEA+  D  + PL LWL
Sbjct  24    LSMAMVEDKITALPGQPP-VSFAQYSGYVEVDAMRKRSLFYYFAEAEL-DPATKPLVLWL  81

Query  279   GGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSD  458
              GG  CSS  +G F ENGPFRP+ +  LV N++SWN  +NMLY+++P GV FSYS   S 
Sbjct  82    NGGPGCSSVGVGAFSENGPFRPSGNA-LVGNEYSWNKEANMLYLESPAGVGFSYSTDPSF  140

Query  459   YKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVH  638
             Y    D+MTAR+NL+FL  WF +F +Y+  D YIAG+SY GH  PQLA+ ++E++ K   
Sbjct  141   YGGVGDSMTARDNLRFLEGWFAKFPQYKGRDLYIAGESYAGHYVPQLAQRMVEFDDKE--  198

Query  639   VRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGE  812
              +   LKGIALGNP+LE      S  E  W +G+IS   Y++    C+ +R V E   G 
Sbjct  199   -KLFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYSRYVSEYYHGS  257

Query  813   MSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQ---------------------  929
             +S  C  +   ++ E    + K ++    C +     SQ                     
Sbjct  258   ISTVCDRVMSQVTRETSRFVDKYDVTLDVCISSVLMQSQVLTPSPNVSFFSITFAKEMYV  317

Query  930   ------RHCLGTE--TAKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIF------  1058
                        TE      D C+     +YL+R +VQ+A+HA       W   F      
Sbjct  318   TLSLTDNFLQSTEQLNRALDVCVEDETMNYLNRKDVQKAMHAQLNGVPKWTLHFLQQGCD  377

Query  1059  ----HGRNMILNNLAIDI-LPTLS---ALLKRGIPLLIYSGDEDLRIPVSHTRELANVLA  1214
                    + +L    +D+ +PT++   AL+K GIP+L+YSGD+D  IP++ +R L + LA
Sbjct  378   FTECFALSSVLEYKQLDLQIPTINIVGALVKSGIPVLVYSGDQDSVIPLTGSRTLVHRLA  437

Query  1215  TRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKAL  1394
              RL L        W+ GKQ+GGW+Q F +         L+FAT+RG SH  P S P ++L
Sbjct  438   KRLRLNATVPYRVWFQGKQVGGWTQVFSDV--------LSFATIRGASHEAPFSQPERSL  489

Query  1395  TLFKAFLKGSPPPNT  1439
              LF+AFL   P P +
Sbjct  490   VLFRAFLASRPLPES  504



>gb|EYU18606.1| hypothetical protein MIMGU_mgv1a004861mg [Erythranthe guttata]
Length=507

 Score =   313 bits (801),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 177/460 (38%), Positives = 260/460 (57%), Gaps = 22/460 (5%)
 Frame = +3

Query  78    LVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFS  257
             +V T+ +       + I SLPGQP + DFNQYSGYI   + + R+ FYYF EA++ D  S
Sbjct  52    IVITISAAKPHFESDKISSLPGQP-NADFNQYSGYIAIDEHQQRSYFYYFVEAET-DPAS  109

Query  258   MPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFS  437
              PL LWL GG  CSS   G F E+GPF+P+ +  LVKN +SWN  +NMLY+++P GV FS
Sbjct  110   KPLVLWLNGGPGCSSIGAGAFGEHGPFQPSGN-VLVKNNYSWNKVANMLYLESPAGVGFS  168

Query  438   YSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILE  617
             YS   S Y+   D +TAR+NL FL  W  +F +++  +FYI G+SYGGH  PQLA LI++
Sbjct  169   YSANKSFYQSVDDVITARDNLIFLENWLKKFPQFKGREFYITGESYGGHYVPQLANLIIK  228

Query  618   YNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMV  791
                K      + LKGIA+GNPLLE      S  E LW +G+IS   Y+     C+ +++ 
Sbjct  229   SKSK------LNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDSTYNQFTFACNYSQIR  282

Query  792   QEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPC  971
             ++  +G ++  CS +   +S E+   +   ++    C +     S+      E  K + C
Sbjct  283   RQAATGFLTPVCSGVIRQVSSEMSRFVDSYDVTLDVCLSSVELQSEVLNQLQEERKINVC  342

Query  972   LLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALLKRGIPL  1142
             +      YL+R +V++ALHA      +W          + NL I  +  L +L+K GI +
Sbjct  343   VEDETIVYLNREDVRKALHARLIGVKSWSICSEILRYDMQNLEIPTIGILGSLVKSGIRV  402

Query  1143  LIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKV  1322
             L+YSGD+D  +P++ TR L N LA  + L T      W++GKQ+ GW+Q +         
Sbjct  403   LVYSGDQDSVLPLTGTRTLVNGLAKDVGLNTTVGYHAWFEGKQVAGWTQVYNEY------  456

Query  1323  ANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1442
               L+FAT+RG SH  P S P ++L LF +F++G P P  +
Sbjct  457   --LSFATIRGASHEAPFSQPERSLVLFSSFVEGKPLPRAN  494



>ref|XP_002964377.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ34710.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/447 (38%), Positives = 256/447 (57%), Gaps = 21/447 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             E++  LPGQP  V F QY+GY+   K  GRALFYYFAEA++    S PLTLWL GG  CS
Sbjct  26    ELVSRLPGQP-HVSFKQYAGYVTVDKNAGRALFYYFAEAETRAS-SQPLTLWLNGGPGCS  83

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E GPF P   G+ L+ N+ +WN  SNML+++ P GV +SYSN SSDY+  +D
Sbjct  84    SIGGGAFTELGPFYPNASGQGLLVNRQAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQVTD  143

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
              +TA + L FL  W  +F EY+  DFYI G+SY GH  PQLAELI+++++ P +    +L
Sbjct  144   RITAVDTLNFLLGWMDKFPEYQTRDFYITGESYAGHYVPQLAELIIKHSQVPGNY-AFRL  202

Query  657   KGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KG+A+GNPLL     ++   E+ W +G+IS E +      C        +    +S  C+
Sbjct  203   KGVAIGNPLLNLAVDTSAMYEYFWSHGLISDETFQALSNSCKFEDYELGLADHNVSNACN  262

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR--HCLGTETAKADPCLLTWVDDYLSR  1004
             D  +  + E+G  ++  +++   C    +    R    +  ++   D C+    D Y + 
Sbjct  263   DGILQSNTEVGRFINNYDVILDVCLPSIFLQEVRLKQQMAQKSYGVDICIDKERDVYFNL  322

Query  1005  PEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLR  1172
             PEVQ  LHAN +    +W       +  + + + +++P L  +LK G+ + I+SGD+D  
Sbjct  323   PEVQRELHANTTGLSYSWSMCTGPVDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQDSV  382

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             +P++ TR L   LA  L + T +    WY G Q+ GW+Q++G         NLT+AT+RG
Sbjct  383   VPLTGTRSLIGGLAKSLGMQTTQPYTAWYQGGQVAGWTQSYG---------NLTYATIRG  433

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              +H VP + P +AL LF++F++G+  P
Sbjct  434   AAHMVPYAQPERALLLFRSFIRGNALP  460



>ref|XP_002967656.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ31003.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/447 (38%), Positives = 256/447 (57%), Gaps = 21/447 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             E++  LPGQP  V F QY+GY+   K  GRALFYYFAEA++    S PLTLWL GG  CS
Sbjct  26    ELVSRLPGQP-HVSFKQYAGYVTVDKNAGRALFYYFAEAETRAS-SQPLTLWLNGGPGCS  83

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E GPF P   G+ L+ N+ +WN  SNML+++ P GV +SYSN SSDY+  +D
Sbjct  84    SIGGGAFTELGPFYPNASGQGLLVNRRAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQVTD  143

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKL  656
              +TA + L FL  W  +F EY+  DFYI G+SY GH  PQLAELI+++++ P +    +L
Sbjct  144   RITAVDTLNFLLGWMDKFPEYQTRDFYITGESYAGHYVPQLAELIIKHSQVPGNY-AFRL  202

Query  657   KGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCS  830
             KG+A+GNPLL     ++   E+ W +G+IS E +      C        +    +S  C+
Sbjct  203   KGVAIGNPLLNLAVDTSAMYEYFWSHGLISDETFQALSNSCKFEDYELGLADHNVSNACN  262

Query  831   DINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQR--HCLGTETAKADPCLLTWVDDYLSR  1004
             D  +  + E+G  ++  +++   C    +    R    +  ++   D C+    D Y + 
Sbjct  263   DGILQSNTEVGRFINNYDVILDVCLPSIFLQEVRLKQQMAQKSYGVDICIDKERDVYFNL  322

Query  1005  PEVQEALHANAS----TWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLR  1172
             PEVQ  LHAN +    +W       +  + + + +++P L  +LK G+ + I+SGD+D  
Sbjct  323   PEVQRELHANTTGLPYSWSMCTGPVDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQDSV  382

Query  1173  IPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRG  1352
             +P++ TR L   LA  L + T +    WY G Q+ GW+Q++G         NLT+AT+RG
Sbjct  383   VPLTGTRSLIGGLAKSLGMQTTQPYTAWYQGGQVAGWTQSYG---------NLTYATIRG  433

Query  1353  GSHFVPNSSPSKALTLFKAFLKGSPPP  1433
              +H VP + P +AL LF++F++G+  P
Sbjct  434   AAHMVPYAQPERALLLFRSFIRGNALP  460



>ref|XP_008218862.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=480

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 173/463 (37%), Positives = 259/463 (56%), Gaps = 43/463 (9%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q++GYI       R+LFYYF EA+S    S PL +W  GG  CSS 
Sbjct  31    IVSLPGQPR-VSFQQFAGYIDVDDHPQRSLFYYFVEAESRPA-SKPLVVWFNGGPGCSSV  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+    L+KN +SWN  +NMLY+++P GV FS++   S Y+  +D +T
Sbjct  89    GEGAFVEHGPFKPSGGATLIKNPYSWNTEANMLYLESPAGVGFSFAADKSFYENVNDNIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRPIKLKGI  665
             AR++L FL++WF +F EY   D ++ G+SY GH  PQLA+LI++            LKGI
Sbjct  149   ARDSLTFLQRWFDKFPEYNHRDLFLVGESYAGHYVPQLAQLIIQSGVN------FNLKGI  202

Query  666   ALGNPLLEKMGLSNVEHL--WHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
             A+GNPLLE     N E L  W +G+IS   Y L    C+S+++++E ++G  S+ CSD+ 
Sbjct  203   AIGNPLLEFSTDVNAEDLFYWSHGLISDAAYGLLTSVCNSSQLLRETIAGSPSDACSDVA  262

Query  840   VMISEEIGDDMHKDNLLFQSCQT--------------DQYSSSQRHCLGTE--------T  953
               +S+E+ + + K  +    C +                + +S  H    E        T
Sbjct  263   TQVSQELSNYVDKYYVTGDICLSPPFPTKLELLNPLRSNFRTSAFHRSSAEAGNYNQQLT  322

Query  954   AKADPCLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILNNLAIDILPTLSALL  1124
              K D C+      YL+R +VQ+ALHA     S+W          + ++ I  +  + +L+
Sbjct  323   DKIDACVEEETVTYLNRKDVQKALHAKLVGVSSWSLCSQVLQYDMRDIEISTIHIVGSLV  382

Query  1125  KRGIPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNS  1304
             K G+ +++YSGD+D  +P   +R L N LAT+L L +      W++GKQ+GGW+Q +G+ 
Sbjct  383   KSGVRVMVYSGDQDSVVPFFGSRGLINGLATQLGLKSTVPYRAWFEGKQVGGWTQVYGDI  442

Query  1305  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                     L+FA +RG SH  P++ P ++L LFK+FL G   P
Sbjct  443   --------LSFAIIRGASHTAPSTQPKRSLALFKSFLGGKTLP  477



>ref|XP_010271865.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=520

 Score =   312 bits (799),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 182/460 (40%), Positives = 268/460 (58%), Gaps = 39/460 (8%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V+F QYSGYI   + + RALFYYF EA++ +  S PL LW+ GG  CSS 
Sbjct  73    IIKLPGQP-EVNFQQYSGYITVDEEQQRALFYYFVEAET-NPASKPLVLWVNGGPGCSSI  130

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV+N++SWN  +NMLY++TP GV FSYS  +S Y   +D MT
Sbjct  131   GTGAFSEHGPFRPS-GKNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVNDEMT  189

Query  486   ---------ARENLK----FLR---KWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILE  617
                      A+++      FLR   +W  +F E+++ D +I G+SY GH  PQLA+L+++
Sbjct  190   GPGKNYSIEAQKSYSYTSWFLRTSSRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQ  249

Query  618   YNRKPVHVRPIKLKGIALGNPLLEKMG--LSNVEHLWHYGIISTELYHLQKRQCDSTRMV  791
             +N + +      LKGIALGNPLLE      S  E LW +G+IS   Y      C+ +R +
Sbjct  250   FNDQKL----FNLKGIALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFL  305

Query  792   QEILSGEMSEDCSDINVMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKA-DP  968
              +   G +S  C  +  +++ EI   + + ++    C +   S S+      +  ++ D 
Sbjct  306   SKYYRGSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQQKVVESTDV  365

Query  969   CLLTWVDDYLSRPEVQEALHAN---ASTWDSIFHGRNMILN--NLAIDILPTLSALLKRG  1133
             C+     +YL+R +VQ++LHA+    S W +  + R +  +  NL +  +P LS+L + G
Sbjct  366   CVEDETYNYLNRDDVQKSLHAHLVGVSGWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSG  425

Query  1134  IPLLIYSGDEDLRIPVSHTRELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGG  1313
             I +L+YSGD+D  IP++ TR L + LA  L L T      W++GKQ+GGW+Q +G+    
Sbjct  426   IKILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI---  482

Query  1314  EKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1433
                  LTFAT+RGGSH  P S P ++L LF +FLKG P P
Sbjct  483   -----LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  517



>gb|KEH37845.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=464

 Score =   310 bits (793),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 179/443 (40%), Positives = 246/443 (56%), Gaps = 25/443 (6%)
 Frame = +3

Query  132   SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAI  311
             +LP QP  VDF QY  YI   +   R LFYYF E+ + D  S PL LWL GG  CSS   
Sbjct  40    TLPDQPRVVDFEQYGNYITVDENHQRKLFYYFVESTT-DPASKPLVLWLNGGPGCSSIGQ  98

Query  312   GMFYENGPFRPTEDG-ELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTA  488
             G F E+GPF+PT  G  LV+N +SWN  +NMLY+D+P GV FSYS  SSDY + +D MTA
Sbjct  99    GAFTEHGPFKPTAMGLGLVENPYSWNRVANMLYLDSPTGVGFSYSANSSDYYLVNDEMTA  158

Query  489   RENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAELILEYNRKPVHVRP-IKLKGI  665
             R+N+ FL  WF +F +Y++ +F+I G+SY GH APQLA+LIL+        +P IKLKGI
Sbjct  159   RDNMMFLLGWFSKFPKYQNSEFFITGESYAGHYAPQLAQLILQ-------TQPNIKLKGI  211

Query  666   ALGNPLL--EKMGLSNVEHLWHYGIISTELYHLQKRQCDSTRMVQEILSGEMSEDCSDIN  839
              +GNPLL  +    S  E+LW +G+IS   Y    + C+     ++   G +S  CSD+ 
Sbjct  212   MIGNPLLDFDTDFNSRAEYLWSHGLISDSTYSRFTKACNFATYKRQKRIGNISTICSDVY  271

Query  840   VMISEEIGDDMHKDNLLFQSCQTDQYSSSQRHCLGTETAKADPCLLTWVDDYLSRPEVQE  1019
               +       +   ++    C    +  + R        K D CL      YL+R +VQ+
Sbjct  272   HEVVTSTSRFIDTFDVTSDVCL--DFLQAHRLLHPHSGEKMDVCLEDHTAKYLNRQDVQK  329

Query  1020  ALHANA---STWDSIFHGRNMILNNLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHT  1190
             ALH+       W +          NL    L  L  L+K G+ +L YSGD+D  IP++ T
Sbjct  330   ALHSRVVGMPYWSTCTSVMLYDFQNLENPTLSLLGTLVKAGVRVLAYSGDQDSFIPLTGT  389

Query  1191  RELANVLATRLNLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1370
             R L   LA  L L T E+   W+DGKQ+ GW++ +G          L+FAT+RG +H  P
Sbjct  390   RTLVKGLAKDLGLNTTEVYRVWFDGKQVAGWTEVYG--------GFLSFATIRGAAHAAP  441

Query  1371  NSSPSKALTLFKAFLKGSPPPNT  1439
              S P + L LFK+F++G  PP +
Sbjct  442   FSQPERLLVLFKSFVEGKSPPTS  464



>gb|KHN30339.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=481

 Score =   310 bits (794),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 183/490 (37%), Positives = 271/490 (55%), Gaps = 51/490 (10%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEI--------IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYY  224
             W  L+ T+ +IS+ ++  +        + SLP Q   V F Q++G++       RALFYY
Sbjct  6     WIFLIATIIAISLFMSSLVESFPVADKVKSLPEQ-LPVSFQQFAGFVPVDDKNQRALFYY  64

Query  225   FAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNML  404
             F EA++    S PL LWL GG  C+S  +G F E+GPF   +   + KNQ+SWN  +N+L
Sbjct  65    FVEAETNPA-SKPLVLWLNGGPGCTSVGVGAFTEHGPFVTNQGEAIEKNQYSWNKEANIL  123

Query  405   YVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGH  584
             Y+++P GV FSYS   S YK  +D +TAR++L FLR+WF +F EY++ DFYI G+SYGGH
Sbjct  124   YLESPAGVGFSYSLNLSFYKTLNDEITARDSLVFLRRWFAKFPEYKNRDFYITGESYGGH  183

Query  585   LAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHL  758
               PQLAELI++            LKGIA+GNPLL+     N   E+ W +GIIS   Y +
Sbjct  184   YVPQLAELIIKSKVN------FNLKGIAIGNPLLDFDTDMNAVDEYYWSHGIISDYAYKI  237

Query  759   QKRQCDSTRMVQEILSGEMSEDCSDINVMISEE------------IGD-----DMHKDNL  887
             +   C+S+R+++E  SG++S+DC      +SEE            +G+     ++ +   
Sbjct  238   RTSLCNSSRVLREYFSGQISKDCLVAAQKVSEEYSFTNFIDPYYVVGEKCLSYNVSQAGF  297

Query  888   LFQSCQTDQYSSSQRH-CLGTET--AKADPCLLTWVDDYLSRPEVQEALHAN-ASTWDSI  1055
             L ++  +  +     H  L TE    + D C L + + YL+R +VQ+ALHA    T    
Sbjct  298   LRETLNSGMFQFRNSHYVLQTEEPDQQVDECNLKYSEMYLNRKDVQKALHARLVGTTKYR  357

Query  1056  FHGRNMILN----NLAIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRL  1223
                + +  N    N  I  +  +  L+K G+ +++YSGD+D  IP   TR L + LA  L
Sbjct  358   LCSKIVQTNYDPLNREIPTINVVGFLVKSGLRVIVYSGDQDSVIPFMGTRRLVDRLAKTL  417

Query  1224  NLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLF  1403
              L T      W+  KQ+GGW+Q +GN        +LT+ T+RG SH  P + P ++  LF
Sbjct  418   GLKTTLPYSAWFVDKQVGGWTQVYGN--------HLTYTTIRGASHGTPATQPKRSFVLF  469

Query  1404  KAFLKGSPPP  1433
              AFL+G P P
Sbjct  470   NAFLQGKPLP  479



>ref|NP_001242846.1| uncharacterized protein LOC100819443 precursor [Glycine max]
 gb|ACU18848.1| unknown [Glycine max]
Length=481

 Score =   310 bits (794),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 180/490 (37%), Positives = 270/490 (55%), Gaps = 51/490 (10%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEI--------IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYY  224
             W  L+ T+ +IS+ ++  +        + SLP Q S V F Q++G++       RALFYY
Sbjct  6     WIFLIATIIAISLFMSSLVESFPVADKVKSLPEQ-SPVSFQQFAGFVPVDDKNQRALFYY  64

Query  225   FAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNML  404
             F EA++    S PL LWL GG  C+S  +G F E+GPF   +   + KNQ+SWN  +N+L
Sbjct  65    FVEAETNPA-SKPLVLWLNGGPGCTSVGVGAFTEHGPFVTNQGEAIEKNQYSWNKEANIL  123

Query  405   YVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGH  584
             Y+++P GV FSYS   S YK  ++ +TAR++L FLR+WF +F EY++ DFYI G+SYGGH
Sbjct  124   YLESPAGVGFSYSLNLSFYKTLNNEITARDSLVFLRRWFAKFPEYKNRDFYITGESYGGH  183

Query  585   LAPQLAELILEYNRKPVHVRPIKLKGIALGNPLLEKMGLSNV--EHLWHYGIISTELYHL  758
               PQLAELI++            LKGIA+GNPLL+     N   E+ W +GIIS   Y +
Sbjct  184   YVPQLAELIIKSKVN------FNLKGIAIGNPLLDFDTDMNAVDEYYWSHGIISDYAYKI  237

Query  759   QKRQCDSTRMVQEILSGEMSEDCSDINVMISEE------------IGD-----DMHKDNL  887
             +   C+S+R+++E  SG++S+DC      +SEE            +G+     ++ +   
Sbjct  238   RTSLCNSSRVLREYFSGQISKDCLVAAQKVSEEYSFTNFIDPYYVVGEKCLSYNVSQAGF  297

Query  888   LFQSCQTDQYSSSQRH-CLGTET--AKADPCLLTWVDDYLSRPEVQEALHANASTWDSIF  1058
             L ++  +  +     H  L TE    + D C L + + YL+R +VQ+A HA         
Sbjct  298   LRETLNSGMFQFRNSHYVLQTEEPDQQVDECNLKYSEMYLNRKDVQKAPHARLEGTTKYR  357

Query  1059  HGRNMILNNL-----AIDILPTLSALLKRGIPLLIYSGDEDLRIPVSHTRELANVLATRL  1223
              G  ++  N       I  +  +  L+K G+ +++YSGD+D  IP   TR L + LA  L
Sbjct  358   LGSKIVQTNYDPLNREIPTINVVGFLVKSGLRVIVYSGDQDSVIPFMGTRRLVDRLAKTL  417

Query  1224  NLTTMEMNEPWYDGKQIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLF  1403
              L T      W+  KQ+GGW++ +GN        +LT+ T+RG SH  P + P ++  LF
Sbjct  418   GLKTTLPYSAWFVDKQVGGWTKVYGN--------HLTYTTIRGASHGTPATQPKRSFVLF  469

Query  1404  KAFLKGSPPP  1433
              AFL+G P P
Sbjct  470   NAFLQGKPLP  479



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4921153598812