BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18688_g1_i1 len=1733 path=[1699:0-602 4696:603-638 2338:639-679
3420:680-1097 2785:1098-1136 4302:1137-1280 2968:1281-1732]

Length=1733
                                                                      Score     E

ref|XP_006363923.1|  PREDICTED: serine carboxypeptidase-like 45-like    472   1e-157   
gb|KDO72510.1|  hypothetical protein CISIN_1g039529mg                   471   3e-157   
ref|XP_006431097.1|  hypothetical protein CICLE_v10013776mg             470   7e-157   
ref|XP_004228838.1|  PREDICTED: serine carboxypeptidase-like 45 i...    469   3e-156   
ref|XP_006482672.1|  PREDICTED: serine carboxypeptidase-like 46-like    468   5e-156   
ref|XP_009762845.1|  PREDICTED: serine carboxypeptidase-like 45         458   3e-152   
ref|XP_004228389.1|  PREDICTED: serine carboxypeptidase-like 45         458   6e-152   
ref|XP_006363922.1|  PREDICTED: serine carboxypeptidase-like 45-like    455   9e-151   
ref|XP_006363924.1|  PREDICTED: serine carboxypeptidase-like 45-like    453   4e-150   
ref|XP_009627244.1|  PREDICTED: serine carboxypeptidase-like 46         448   3e-148   
ref|XP_006431096.1|  hypothetical protein CICLE_v10013839mg             437   6e-144   
ref|XP_003633850.1|  PREDICTED: serine carboxypeptidase-like 46         436   9e-144   
ref|XP_010265020.1|  PREDICTED: serine carboxypeptidase-like 45         436   1e-143   
gb|KDO72509.1|  hypothetical protein CISIN_1g037032mg                   435   3e-143   
ref|XP_007046208.1|  Serine carboxypeptidase 46 isoform 1               435   4e-143   
ref|XP_002277201.1|  PREDICTED: serine carboxypeptidase-like 45 i...    432   6e-142   Vitis vinifera
emb|CBI22166.3|  unnamed protein product                                434   1e-141   
ref|XP_010256545.1|  PREDICTED: serine carboxypeptidase-like 45         429   9e-141   
gb|KCW64994.1|  hypothetical protein EUGRSUZ_G02536                     428   2e-140   
ref|XP_010068795.1|  PREDICTED: serine carboxypeptidase-like 45         428   2e-140   
ref|XP_010661029.1|  PREDICTED: serine carboxypeptidase-like 45 i...    427   4e-140   
ref|XP_010068797.1|  PREDICTED: serine carboxypeptidase-like 46         425   2e-139   
gb|KCW64996.1|  hypothetical protein EUGRSUZ_G02538                     424   8e-139   
ref|XP_010068798.1|  PREDICTED: serine carboxypeptidase-like 45         424   1e-138   
gb|KHG07552.1|  Serine carboxypeptidase-like 45                         423   1e-138   
ref|XP_007046207.1|  Serine carboxypeptidase 46                         416   1e-135   
ref|XP_006482671.1|  PREDICTED: serine carboxypeptidase-like 44-like    416   7e-135   
ref|XP_010322533.1|  PREDICTED: serine carboxypeptidase-like 45 i...    407   6e-133   
ref|XP_006838780.1|  hypothetical protein AMTR_s00002p00258640          402   3e-130   
ref|XP_007099702.1|  Serine carboxypeptidase 46                         394   4e-127   
ref|XP_010322561.1|  PREDICTED: serine carboxypeptidase-like 46 i...    385   7e-125   
ref|XP_006829355.1|  hypothetical protein AMTR_s02986p00003470          365   2e-116   
ref|XP_007162064.1|  hypothetical protein PHAVU_001G120600g             363   2e-115   
ref|XP_003531913.1|  PREDICTED: serine carboxypeptidase-like 45-l...    353   8e-112   
ref|XP_004492026.1|  PREDICTED: serine carboxypeptidase-like 45-like    353   1e-111   
ref|XP_003551804.1|  PREDICTED: serine carboxypeptidase-like 45-like    352   4e-111   
ref|XP_009143848.1|  PREDICTED: serine carboxypeptidase-like 46         351   7e-111   
gb|KDP23272.1|  hypothetical protein JCGZ_23105                         351   7e-111   
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45         351   1e-110   
ref|XP_010044871.1|  PREDICTED: serine carboxypeptidase-like 45         351   1e-110   
ref|XP_007139316.1|  hypothetical protein PHAVU_008G019100g             350   1e-110   
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45         350   1e-110   Vitis vinifera
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like    350   2e-110   
gb|AES77859.2|  serine carboxypeptidase-like protein                    350   2e-110   
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                   350   2e-110   
ref|XP_002512656.1|  serine carboxypeptidase, putative                  348   7e-110   Ricinus communis
gb|KHG09716.1|  Serine carboxypeptidase-like 45                         348   8e-110   
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg             348   9e-110   
ref|XP_009368797.1|  PREDICTED: serine carboxypeptidase-like 45         348   1e-109   
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...    348   1e-109   
gb|ABR16719.1|  unknown                                                 348   1e-109   Picea sitchensis
ref|XP_007043816.1|  Serine carboxypeptidase-like 45 isoform 1          347   2e-109   
ref|XP_006584695.1|  PREDICTED: serine carboxypeptidase-like 45-l...    347   2e-109   
ref|XP_010942380.1|  PREDICTED: serine carboxypeptidase-like 45         347   3e-109   
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...    346   5e-109   
emb|CDY19500.1|  BnaC04g10990D                                          346   7e-109   
ref|XP_008390188.1|  PREDICTED: serine carboxypeptidase-like 45         345   1e-108   
ref|XP_006304410.1|  hypothetical protein CARUB_v10010972mg             345   1e-108   
ref|XP_011036159.1|  PREDICTED: serine carboxypeptidase-like 45 i...    345   1e-108   
gb|KHN47533.1|  Serine carboxypeptidase-like 45                         345   2e-108   
ref|XP_008777393.1|  PREDICTED: serine carboxypeptidase-like 45 i...    345   2e-108   
ref|XP_010250555.1|  PREDICTED: serine carboxypeptidase-like 45         346   2e-108   
ref|XP_002297872.2|  serine carboxypeptidase S10 family protein         345   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_006415698.1|  hypothetical protein EUTSA_v10007573mg             345   2e-108   
ref|XP_011020860.1|  PREDICTED: serine carboxypeptidase-like 45         345   2e-108   
ref|XP_009334311.1|  PREDICTED: serine carboxypeptidase-like 45         344   3e-108   
ref|XP_011036160.1|  PREDICTED: serine carboxypeptidase-like 45 i...    344   5e-108   
gb|KEH35690.1|  serine carboxypeptidase-like protein                    343   5e-108   
gb|ABK25202.1|  unknown                                                 343   5e-108   Picea sitchensis
gb|KHN31265.1|  Serine carboxypeptidase-like 45                         343   6e-108   
ref|XP_007145476.1|  hypothetical protein PHAVU_007G242200g             343   9e-108   
ref|XP_009359890.1|  PREDICTED: serine carboxypeptidase-like 45         343   9e-108   
ref|XP_003532390.1|  PREDICTED: serine carboxypeptidase-like 45-l...    343   1e-107   
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like    343   1e-107   
ref|XP_007223033.1|  hypothetical protein PRUPE_ppa005360mg             343   1e-107   
ref|XP_009337518.1|  PREDICTED: serine carboxypeptidase-like 45         343   2e-107   
gb|KFK44682.1|  hypothetical protein AALP_AA1G289900                    342   2e-107   
ref|XP_010929656.1|  PREDICTED: serine carboxypeptidase-like 45         342   2e-107   
ref|XP_010549304.1|  PREDICTED: serine carboxypeptidase-like 45 i...    342   2e-107   
gb|AAG51475.1|AC069471_6  serine carboxypeptidase II, putative          342   2e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KHN08898.1|  Serine carboxypeptidase-like 45                         342   3e-107   
ref|XP_008369640.1|  PREDICTED: serine carboxypeptidase-like 45         342   3e-107   
ref|XP_011086871.1|  PREDICTED: serine carboxypeptidase-like 45         342   3e-107   
ref|XP_010509871.1|  PREDICTED: serine carboxypeptidase-like 46         342   3e-107   
ref|XP_007223032.1|  hypothetical protein PRUPE_ppa005360mg             342   4e-107   
ref|XP_004310134.1|  PREDICTED: serine carboxypeptidase-like 45-like    341   5e-107   
ref|XP_003554110.2|  PREDICTED: serine carboxypeptidase-like 45-like    341   5e-107   
ref|XP_007137891.1|  hypothetical protein PHAVU_009G164600g             341   7e-107   
ref|XP_008374178.1|  PREDICTED: serine carboxypeptidase-like 45         341   7e-107   
ref|XP_010549305.1|  PREDICTED: serine carboxypeptidase-like 45 i...    341   8e-107   
ref|XP_010478165.1|  PREDICTED: serine carboxypeptidase-like 45         341   1e-106   
gb|KDP37688.1|  hypothetical protein JCGZ_06345                         340   1e-106   
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249              340   1e-106   
ref|NP_564298.1|  serine carboxypeptidase-like 45                       340   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006844530.1|  hypothetical protein AMTR_s00016p00162700          340   2e-106   
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like    342   2e-106   
ref|XP_002893504.1|  SCPL45                                             340   2e-106   
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1         340   2e-106   
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45         340   2e-106   
gb|KHN13827.1|  Serine carboxypeptidase-like 45                         339   3e-106   
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like    339   4e-106   
ref|XP_011073181.1|  PREDICTED: serine carboxypeptidase-like 45         339   4e-106   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2         339   4e-106   
gb|KHN08897.1|  Serine carboxypeptidase-like 45                         338   5e-106   
emb|CDO98312.1|  unnamed protein product                                338   6e-106   
ref|XP_003554111.1|  PREDICTED: serine carboxypeptidase-like 45-like    338   6e-106   
ref|XP_010469459.1|  PREDICTED: serine carboxypeptidase-like 46         338   6e-106   
ref|XP_003528093.2|  PREDICTED: serine carboxypeptidase-like 45-like    338   7e-106   
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g             337   7e-106   Populus trichocarpa [western balsam poplar]
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45         339   7e-106   
gb|KHN30341.1|  Serine carboxypeptidase-like 45                         338   8e-106   
ref|XP_006410496.1|  hypothetical protein EUTSA_v10016623mg             338   8e-106   
ref|XP_010460580.1|  PREDICTED: serine carboxypeptidase-like 45         339   8e-106   
emb|CDY11750.1|  BnaC03g58280D                                          337   1e-105   
gb|AAB80670.1|  putative serine carboxypeptidase II                     337   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1          337   2e-105   
ref|XP_010499305.1|  PREDICTED: serine carboxypeptidase-like 45         338   2e-105   
gb|EYU21824.1|  hypothetical protein MIMGU_mgv1a006099mg                337   2e-105   
gb|KHN30340.1|  Serine carboxypeptidase-like 45                         337   3e-105   
emb|CDY61693.1|  BnaC05g51120D                                          336   3e-105   
ref|XP_008777392.1|  PREDICTED: serine carboxypeptidase-like 45 i...    337   3e-105   
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like    336   4e-105   
ref|XP_008791046.1|  PREDICTED: serine carboxypeptidase-like 45         336   4e-105   
ref|XP_009113703.1|  PREDICTED: serine carboxypeptidase-like 45         336   4e-105   
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor          336   7e-105   Zea mays [maize]
gb|EAY93940.1|  hypothetical protein OsI_15713                          336   7e-105   Oryza sativa Indica Group [Indian rice]
gb|KHN09723.1|  Serine carboxypeptidase-like 45                         335   8e-105   
ref|XP_003520486.1|  PREDICTED: serine carboxypeptidase-like 45-l...    335   8e-105   
ref|XP_004501743.1|  PREDICTED: serine carboxypeptidase-like 45-like    335   1e-104   
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580          335   2e-104   Sorghum bicolor [broomcorn]
ref|NP_850212.1|  serine carboxypeptidase-like 46                       335   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002280796.2|  PREDICTED: serine carboxypeptidase-like 45         334   2e-104   Vitis vinifera
ref|XP_002881286.1|  hypothetical protein ARALYDRAFT_482299             334   2e-104   
ref|XP_008454133.1|  PREDICTED: serine carboxypeptidase-like 45         334   2e-104   
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...    335   3e-104   
ref|XP_004298533.1|  PREDICTED: serine carboxypeptidase-like 45-like    334   4e-104   
ref|XP_009109757.1|  PREDICTED: serine carboxypeptidase-like 45         333   4e-104   
ref|XP_004152156.1|  PREDICTED: serine carboxypeptidase-like 45-like    333   4e-104   
gb|KHN07932.1|  Serine carboxypeptidase-like 45                         333   5e-104   
ref|XP_006294161.1|  hypothetical protein CARUB_v10023154mg             333   5e-104   
emb|CDX90124.1|  BnaA08g18600D                                          333   6e-104   
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...    335   6e-104   
ref|XP_006589008.1|  PREDICTED: serine carboxypeptidase-like 45-like    333   8e-104   
ref|XP_010413849.1|  PREDICTED: serine carboxypeptidase-like 46         333   8e-104   
ref|XP_009415855.1|  PREDICTED: serine carboxypeptidase-like 45         333   8e-104   
ref|XP_006662960.1|  PREDICTED: serine carboxypeptidase-like 45-like    333   1e-103   
ref|XP_009380118.1|  PREDICTED: serine carboxypeptidase-like 45 i...    332   1e-103   
ref|XP_010099600.1|  Serine carboxypeptidase-like 45                    332   2e-103   
ref|XP_003621641.1|  Serine carboxypeptidase-like protein               333   2e-103   
emb|CBI32795.3|  unnamed protein product                                331   3e-103   
ref|XP_011075459.1|  PREDICTED: serine carboxypeptidase-like 45         332   3e-103   
ref|NP_001052663.1|  Os04g0396800                                       332   3e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009380117.1|  PREDICTED: serine carboxypeptidase-like 45 i...    332   3e-103   
gb|KEH37845.1|  serine carboxypeptidase-like protein                    331   3e-103   
ref|XP_004136793.1|  PREDICTED: serine carboxypeptidase-like 45-like    332   4e-103   
ref|XP_002277400.2|  PREDICTED: serine carboxypeptidase-like 45         331   5e-103   Vitis vinifera
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g             331   5e-103   Populus trichocarpa [western balsam poplar]
ref|XP_007159978.1|  hypothetical protein PHAVU_002G282700g             330   7e-103   
ref|XP_007043818.1|  Serine carboxypeptidase-like 45 isoform 3          330   9e-103   
ref|XP_002520628.1|  serine carboxypeptidase, putative                  330   9e-103   Ricinus communis
ref|XP_010682654.1|  PREDICTED: serine carboxypeptidase-like 45         330   9e-103   
ref|XP_003577529.1|  PREDICTED: serine carboxypeptidase-like 45         330   1e-102   
emb|CBI32794.3|  unnamed protein product                                330   1e-102   
ref|XP_002307963.1|  hypothetical protein POPTR_0006s03490g             330   1e-102   Populus trichocarpa [western balsam poplar]
ref|XP_006652227.1|  PREDICTED: serine carboxypeptidase-like 45-like    330   1e-102   
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45         329   2e-102   
ref|XP_009404114.1|  PREDICTED: serine carboxypeptidase-like 45         329   3e-102   
ref|XP_006430527.1|  hypothetical protein CICLE_v10011695mg             328   3e-102   
gb|EYU28449.1|  hypothetical protein MIMGU_mgv1a004999mg                330   4e-102   
ref|XP_008239549.1|  PREDICTED: serine carboxypeptidase-like 45         328   5e-102   
ref|XP_007162065.1|  hypothetical protein PHAVU_001G120700g             328   8e-102   
ref|XP_004513403.1|  PREDICTED: serine carboxypeptidase-like 45-like    327   1e-101   
ref|XP_007209121.1|  hypothetical protein PRUPE_ppa005457mg             327   1e-101   
ref|XP_006482059.1|  PREDICTED: serine carboxypeptidase-like 45-like    327   1e-101   
ref|XP_008443350.1|  PREDICTED: serine carboxypeptidase-like 45         327   2e-101   
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...    327   2e-101   
ref|XP_002511104.1|  serine carboxypeptidase, putative                  327   2e-101   Ricinus communis
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45         327   2e-101   
gb|EEC68261.1|  hypothetical protein OsI_36290                          327   2e-101   Oryza sativa Indica Group [Indian rice]
gb|KEH33274.1|  serine carboxypeptidase-like protein                    327   2e-101   
ref|XP_011040748.1|  PREDICTED: serine carboxypeptidase-like 45 i...    327   2e-101   
ref|NP_001176565.1|  Os11g0522900                                       327   2e-101   
ref|XP_002517286.1|  serine carboxypeptidase, putative                  325   3e-101   Ricinus communis
ref|XP_007159977.1|  hypothetical protein PHAVU_002G282700g             327   3e-101   
ref|XP_006380972.1|  hypothetical protein POPTR_0006s03480g             326   3e-101   
ref|XP_007046209.1|  Serine carboxypeptidase 46 isoform 2               324   4e-101   
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like    326   5e-101   
ref|XP_007224935.1|  hypothetical protein PRUPE_ppa021576mg             325   6e-101   
ref|XP_009355265.1|  PREDICTED: serine carboxypeptidase-like 45         325   6e-101   
ref|XP_010678341.1|  PREDICTED: serine carboxypeptidase-like 45         325   8e-101   
ref|XP_002282978.2|  PREDICTED: serine carboxypeptidase-like 45         325   8e-101   Vitis vinifera
ref|NP_001151474.1|  LOC100285107 precursor                             325   1e-100   Zea mays [maize]
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...    325   1e-100   
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45         324   2e-100   
ref|XP_011040747.1|  PREDICTED: serine carboxypeptidase-like 45 i...    324   2e-100   
ref|XP_004503800.1|  PREDICTED: serine carboxypeptidase-like 45-like    323   4e-100   
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45         323   4e-100   
ref|XP_006380973.1|  hypothetical protein POPTR_0006s03480g             323   6e-100   
emb|CAN72076.1|  hypothetical protein VITISV_041583                     322   7e-100   Vitis vinifera
ref|XP_004979352.1|  PREDICTED: serine carboxypeptidase-like 45-like    323   7e-100   
ref|XP_004241645.1|  PREDICTED: serine carboxypeptidase-like 45         322   7e-100   
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45         323   9e-100   
ref|XP_011040750.1|  PREDICTED: serine carboxypeptidase-like 45         323   1e-99    
ref|XP_004136792.1|  PREDICTED: serine carboxypeptidase-like 45-like    321   1e-99    
ref|XP_011040753.1|  PREDICTED: serine carboxypeptidase-like 45         323   1e-99    
ref|XP_002307961.1|  hypothetical protein POPTR_0006s03440g             322   2e-99    Populus trichocarpa [western balsam poplar]
gb|EMS60816.1|  Serine carboxypeptidase-like 45                         323   2e-99    
ref|XP_008670742.1|  PREDICTED: serine carboxypeptidase-like 45         321   4e-99    
ref|XP_002517289.1|  serine carboxypeptidase, putative                  321   4e-99    Ricinus communis
gb|KDP37690.1|  hypothetical protein JCGZ_06347                         321   5e-99    
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45         320   6e-99    
ref|XP_007028221.1|  Serine carboxypeptidase 45                         320   7e-99    
ref|XP_009615670.1|  PREDICTED: serine carboxypeptidase-like 45 i...    320   9e-99    
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45         320   1e-98    
ref|XP_009355272.1|  PREDICTED: serine carboxypeptidase-like 45 i...    319   1e-98    
gb|EMS58238.1|  Serine carboxypeptidase-like 45                         317   8e-98    
ref|XP_003630573.1|  Serine carboxypeptidase                            317   8e-98    
gb|KEH40983.1|  serine carboxypeptidase-like protein                    316   9e-98    
ref|XP_004238587.1|  PREDICTED: putative serine carboxypeptidase-...    318   9e-98    
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45         315   4e-97    
ref|XP_008443351.1|  PREDICTED: serine carboxypeptidase-like 45         316   5e-97    
ref|XP_008378883.1|  PREDICTED: serine carboxypeptidase-like 45         315   7e-97    
ref|XP_009355270.1|  PREDICTED: serine carboxypeptidase-like 45 i...    315   8e-97    
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg             315   8e-97    
ref|XP_009355271.1|  PREDICTED: serine carboxypeptidase-like 45 i...    315   9e-97    
emb|CBI32802.3|  unnamed protein product                                324   9e-97    
ref|XP_006576775.1|  PREDICTED: serine carboxypeptidase-like 45-l...    313   1e-96    
ref|XP_010271869.1|  PREDICTED: serine carboxypeptidase-like 45 i...    314   1e-96    
ref|XP_009355269.1|  PREDICTED: serine carboxypeptidase-like 45         314   2e-96    
ref|XP_006354958.1|  PREDICTED: serine carboxypeptidase-like 40-like    315   2e-96    
ref|XP_010673054.1|  PREDICTED: serine carboxypeptidase-like 45         313   3e-96    
ref|XP_009355267.1|  PREDICTED: serine carboxypeptidase-like 45 i...    313   4e-96    
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...    313   5e-96    
ref|XP_008218862.1|  PREDICTED: serine carboxypeptidase-like 45         312   1e-95    
ref|XP_010271865.1|  PREDICTED: serine carboxypeptidase-like 45 i...    313   1e-95    
ref|XP_004159625.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    312   1e-95    
gb|ABK26025.1|  unknown                                                 308   2e-95    Picea sitchensis
ref|XP_010055754.1|  PREDICTED: serine carboxypeptidase-like 45         311   2e-95    
ref|XP_010271866.1|  PREDICTED: serine carboxypeptidase-like 45 i...    313   3e-95    
gb|KCW90016.1|  hypothetical protein EUGRSUZ_A02215                     310   5e-95    
gb|KHG30064.1|  Serine carboxypeptidase-like 45                         310   6e-95    
ref|XP_009355268.1|  PREDICTED: serine carboxypeptidase-like 45 i...    310   6e-95    
gb|KDP37687.1|  hypothetical protein JCGZ_06344                         309   1e-94    
gb|EYU18606.1|  hypothetical protein MIMGU_mgv1a004861mg                310   2e-94    
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme                308   2e-94    
gb|AIC80774.1|  serine carboxypeptidase                                 307   2e-94    
ref|XP_002972549.1|  serine carboxypeptidase-like enzyme                308   3e-94    
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme                308   3e-94    
ref|XP_004136677.1|  PREDICTED: serine carboxypeptidase-like 45-like    308   3e-94    
ref|XP_010023719.1|  PREDICTED: serine carboxypeptidase-like 45         308   7e-94    
emb|CAN70439.1|  hypothetical protein VITISV_011900                     306   7e-94    Vitis vinifera
ref|XP_002972012.1|  serine carboxypeptidase-like enzyme                306   1e-93    
ref|XP_009777076.1|  PREDICTED: putative serine carboxypeptidase-...    307   2e-93    
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          307   2e-93    
ref|XP_002990798.1|  serine carboxypeptidase-like enzyme                306   2e-93    
gb|KHN30339.1|  Serine carboxypeptidase-like 45                         306   3e-93    
ref|XP_006585840.1|  PREDICTED: serine carboxypeptidase-like 45-l...    303   6e-93    
ref|XP_002974500.1|  serine carboxypeptidase-like enzyme                305   6e-93    
gb|ABK25236.1|  unknown                                                 305   7e-93    Picea sitchensis
ref|XP_010653632.1|  PREDICTED: serine carboxypeptidase-like 45         303   1e-92    
gb|KEH35413.1|  serine carboxypeptidase-like protein                    304   1e-92    
ref|XP_002277420.3|  PREDICTED: serine carboxypeptidase-like 45         303   1e-92    Vitis vinifera
emb|CBI32801.3|  unnamed protein product                                301   3e-92    
gb|EMT30771.1|  Serine carboxypeptidase-like 45                         301   8e-92    
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g             302   1e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009607740.1|  PREDICTED: serine carboxypeptidase-like 40         301   1e-91    
ref|XP_010318664.1|  PREDICTED: serine carboxypeptidase-like 45 i...    300   1e-91    
ref|NP_001242846.1|  uncharacterized protein LOC100819443 precursor     301   2e-91    
ref|XP_010100042.1|  Serine carboxypeptidase-like 45                    298   7e-91    
ref|XP_004488543.1|  PREDICTED: serine carboxypeptidase-like 45-like    299   6e-90    
ref|XP_004148827.1|  PREDICTED: serine carboxypeptidase-like 42-like    297   1e-89    
ref|XP_002449560.1|  hypothetical protein SORBIDRAFT_05g019090          296   2e-89    Sorghum bicolor [broomcorn]
ref|XP_002314061.1|  hypothetical protein POPTR_0009s06080g             296   3e-89    Populus trichocarpa [western balsam poplar]
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42         295   4e-89    
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               295   7e-89    
ref|XP_009377698.1|  PREDICTED: serine carboxypeptidase-like 42         294   7e-89    
ref|XP_002517750.1|  serine carboxypeptidase, putative                  295   1e-88    Ricinus communis
ref|XP_004488374.1|  PREDICTED: serine carboxypeptidase-like 45-like    296   1e-88    
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         293   2e-88    
gb|ABR16596.1|  unknown                                                 295   3e-88    
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               293   5e-88    
gb|ABR16997.1|  unknown                                                 294   6e-88    
ref|XP_006351861.1|  PREDICTED: serine carboxypeptidase-like 42-like    291   8e-88    
ref|XP_010055765.1|  PREDICTED: serine carboxypeptidase-like 45         291   1e-87    
ref|NP_001150705.1|  LOC100284338 precursor                             290   3e-87    
ref|XP_007219043.1|  hypothetical protein PRUPE_ppa004618mg             290   4e-87    
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42         290   4e-87    
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme                289   7e-87    
ref|XP_011025504.1|  PREDICTED: serine carboxypeptidase-like 40 i...    290   7e-87    
ref|XP_004230572.1|  PREDICTED: serine carboxypeptidase-like 42 i...    289   8e-87    
emb|CDO99730.1|  unnamed protein product                                288   8e-87    
ref|XP_011008273.1|  PREDICTED: serine carboxypeptidase-like 40         289   1e-86    
gb|KCW90015.1|  hypothetical protein EUGRSUZ_A02214                     288   1e-86    
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme                288   1e-86    
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          289   1e-86    
gb|AES71588.2|  serine carboxypeptidase-like protein                    289   2e-86    
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3            289   2e-86    
ref|XP_011041420.1|  PREDICTED: serine carboxypeptidase-like 45         290   2e-86    
ref|XP_007137531.1|  hypothetical protein PHAVU_009G134900g             288   2e-86    
ref|XP_010055737.1|  PREDICTED: serine carboxypeptidase-like 45         288   3e-86    
ref|XP_010315077.1|  PREDICTED: serine carboxypeptidase-like 42 i...    288   3e-86    
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40-like    288   3e-86    
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    288   3e-86    
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    287   5e-86    
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         288   6e-86    
ref|XP_002298413.2|  putative serine carboxypeptidase family protein    287   6e-86    
ref|XP_009767155.1|  PREDICTED: serine carboxypeptidase-like 42 i...    286   7e-86    
emb|CDP08509.1|  unnamed protein product                                286   8e-86    
ref|XP_004229673.1|  PREDICTED: serine carboxypeptidase-like 40         287   1e-85    
ref|XP_009377728.1|  PREDICTED: serine carboxypeptidase-like 42         286   1e-85    
ref|XP_009586680.1|  PREDICTED: serine carboxypeptidase-like 42         286   1e-85    
gb|KEH17668.1|  serine carboxypeptidase-like protein                    286   1e-85    
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       286   1e-85    
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    285   1e-85    
ref|XP_010679983.1|  PREDICTED: serine carboxypeptidase-like 42         286   2e-85    
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       286   2e-85    
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         285   2e-85    
ref|XP_006473888.1|  PREDICTED: serine carboxypeptidase-like 40-like    286   2e-85    
gb|EMT29573.1|  Serine carboxypeptidase-like 45                         288   2e-85    
ref|XP_003527966.2|  PREDICTED: serine carboxypeptidase-like 42-l...    285   3e-85    
ref|XP_008373913.1|  PREDICTED: serine carboxypeptidase-like 42         285   3e-85    
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    284   4e-85    
ref|XP_009767156.1|  PREDICTED: serine carboxypeptidase-like 42 i...    283   5e-85    
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       285   6e-85    
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     284   7e-85    
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         283   7e-85    
gb|KGN59387.1|  hypothetical protein Csa_3G816000                       284   7e-85    
emb|CDP10248.1|  unnamed protein product                                283   8e-85    
ref|XP_006345395.1|  PREDICTED: serine carboxypeptidase-like 40-like    285   8e-85    
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                283   8e-85    
ref|XP_006858474.1|  hypothetical protein AMTR_s00071p00113850          283   9e-85    
ref|XP_006423055.1|  hypothetical protein CICLE_v10028330mg             284   9e-85    
ref|XP_009107652.1|  PREDICTED: serine carboxypeptidase-like 44 i...    283   1e-84    
ref|XP_009107653.1|  PREDICTED: serine carboxypeptidase-like 44 i...    283   1e-84    
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              283   1e-84    
ref|XP_004303115.1|  PREDICTED: serine carboxypeptidase-like 40-like    284   1e-84    
gb|KCW64995.1|  hypothetical protein EUGRSUZ_G02537                     283   2e-84    
emb|CDY48945.1|  BnaA08g04690D                                          283   2e-84    
ref|XP_009107650.1|  PREDICTED: serine carboxypeptidase-like 44 i...    283   2e-84    
ref|XP_010244030.1|  PREDICTED: serine carboxypeptidase-like 42 i...    283   2e-84    
emb|CBI29056.3|  unnamed protein product                                283   2e-84    
gb|KHN23425.1|  Serine carboxypeptidase-like 42                         282   2e-84    
gb|KCW90021.1|  hypothetical protein EUGRSUZ_A02221                     283   2e-84    
ref|XP_003522555.2|  PREDICTED: serine carboxypeptidase-like 42-l...    282   2e-84    
ref|XP_003602149.1|  Serine carboxypeptidase-like protein               282   3e-84    
ref|XP_003592242.1|  Serine carboxypeptidase-like protein               283   3e-84    
gb|EYU42662.1|  hypothetical protein MIMGU_mgv1a022120mg                283   3e-84    
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         283   3e-84    
ref|XP_007028219.1|  Serine carboxypeptidase-like 45                    285   3e-84    
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               282   3e-84    
ref|XP_010244029.1|  PREDICTED: serine carboxypeptidase-like 42 i...    283   4e-84    
ref|XP_009107648.1|  PREDICTED: serine carboxypeptidase-like 44 i...    282   4e-84    
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           281   5e-84    
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                281   5e-84    
ref|XP_010930631.1|  PREDICTED: serine carboxypeptidase-like 42         281   6e-84    
ref|XP_011088288.1|  PREDICTED: serine carboxypeptidase II-3-like       281   6e-84    
ref|XP_010245825.1|  PREDICTED: serine carboxypeptidase-like 42         281   7e-84    
gb|KEH30582.1|  serine carboxypeptidase-like protein                    281   7e-84    
ref|XP_009592794.1|  PREDICTED: serine carboxypeptidase-like 40         282   7e-84    
ref|XP_010067792.1|  PREDICTED: serine carboxypeptidase-like 40         281   9e-84    
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                280   9e-84    
ref|NP_194790.1|  serine carboxypeptidase 24                            281   1e-83    
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       281   1e-83    
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         280   1e-83    
ref|XP_009123167.1|  PREDICTED: serine carboxypeptidase-like 42         280   1e-83    
emb|CDP16360.1|  unnamed protein product                                281   1e-83    
ref|XP_004230806.1|  PREDICTED: serine carboxypeptidase II-3-like       281   1e-83    
ref|XP_002278193.1|  PREDICTED: serine carboxypeptidase-like 42 i...    280   1e-83    
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              280   1e-83    
ref|XP_002300939.1|  serine carboxypeptidase S10 family protein         280   2e-83    
gb|KCW90013.1|  hypothetical protein EUGRSUZ_A02209                     280   2e-83    
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         280   2e-83    
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    280   2e-83    
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             280   2e-83    
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         280   2e-83    
gb|KDP43605.1|  hypothetical protein JCGZ_16892                         281   2e-83    
gb|KDO49122.1|  hypothetical protein CISIN_1g044068mg                   280   2e-83    
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          281   2e-83    
ref|XP_003615811.1|  Serine carboxypeptidase-like protein               280   2e-83    
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       282   3e-83    
emb|CDY28004.1|  BnaC05g44060D                                          279   3e-83    
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       280   3e-83    
ref|XP_003599510.1|  Serine carboxypeptidase-like protein               280   3e-83    
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         279   3e-83    
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       280   3e-83    
ref|XP_010055727.1|  PREDICTED: serine carboxypeptidase-like 45         280   3e-83    
ref|XP_008220190.1|  PREDICTED: serine carboxypeptidase II-3-like       280   3e-83    
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    280   3e-83    
ref|XP_010468548.1|  PREDICTED: serine carboxypeptidase-like 43         279   4e-83    
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         279   4e-83    
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    280   4e-83    
gb|KHF97371.1|  Serine carboxypeptidase-like 42                         280   4e-83    
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             280   4e-83    
ref|XP_010062160.1|  PREDICTED: serine carboxypeptidase-like 42         279   5e-83    
ref|XP_004514571.1|  PREDICTED: serine carboxypeptidase-like 40-like    280   5e-83    
ref|XP_011088747.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    280   5e-83    
gb|KDP43043.1|  hypothetical protein JCGZ_25229                         280   5e-83    
ref|XP_004490638.1|  PREDICTED: serine carboxypeptidase-like 42-l...    279   6e-83    
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             278   6e-83    
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       279   6e-83    
emb|CDY23340.1|  BnaA08g12060D                                          278   7e-83    
ref|XP_007052442.1|  Serine carboxypeptidase-like 40                    281   7e-83    
ref|NP_187456.1|  serine carboxypeptidase-like 27                       278   7e-83    
ref|XP_004515138.1|  PREDICTED: serine carboxypeptidase-like 42-like    278   7e-83    
gb|AES59494.2|  serine carboxypeptidase-like protein                    279   8e-83    
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         278   8e-83    
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         278   1e-82    
gb|KHG19786.1|  Serine carboxypeptidase-like 40                         279   1e-82    
gb|EAY87844.1|  hypothetical protein OsI_09265                          278   1e-82    
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    278   1e-82    
ref|XP_011088748.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    278   1e-82    
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       278   1e-82    
ref|XP_009600050.1|  PREDICTED: serine carboxypeptidase-like 42         278   1e-82    
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1          278   2e-82    
emb|CDY35977.1|  BnaA05g29730D                                          277   2e-82    
ref|XP_006434388.1|  hypothetical protein CICLE_v10000998mg             278   2e-82    
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         277   2e-82    
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    278   2e-82    
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              277   2e-82    
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         277   2e-82    
ref|XP_011101717.1|  PREDICTED: serine carboxypeptidase-like 42         277   2e-82    
ref|XP_007224802.1|  hypothetical protein PRUPE_ppa023729mg             278   2e-82    
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             277   2e-82    
dbj|BAJ85578.1|  predicted protein                                      278   2e-82    
emb|CDY39224.1|  BnaA03g50360D                                          277   2e-82    
ref|XP_011091773.1|  PREDICTED: serine carboxypeptidase-like 40         278   2e-82    
ref|XP_006392053.1|  hypothetical protein EUTSA_v10023955mg             277   3e-82    
gb|EYU37705.1|  hypothetical protein MIMGU_mgv1a005479mg                277   3e-82    
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          277   3e-82    
ref|XP_011074776.1|  PREDICTED: serine carboxypeptidase-like 42         277   3e-82    
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       278   3e-82    
emb|CDP16358.1|  unnamed protein product                                278   3e-82    
ref|XP_008231545.1|  PREDICTED: serine carboxypeptidase-like 40         278   3e-82    
ref|XP_002463311.1|  hypothetical protein SORBIDRAFT_02g041610          278   3e-82    
ref|XP_010279514.1|  PREDICTED: serine carboxypeptidase-like 40         277   3e-82    
ref|XP_008802653.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    277   3e-82    
ref|XP_011027377.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    277   3e-82    
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       277   4e-82    
dbj|BAJ92218.1|  predicted protein                                      278   4e-82    
ref|XP_010685501.1|  PREDICTED: serine carboxypeptidase II-3-like       277   4e-82    
gb|KFK35499.1|  hypothetical protein AALP_AA5G292700                    277   5e-82    
emb|CDP16361.1|  unnamed protein product                                277   5e-82    
gb|AAD28662.1|  putative serine carboxypeptidase II                     276   6e-82    
ref|XP_009136205.1|  PREDICTED: serine carboxypeptidase-like 42         276   7e-82    
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         276   7e-82    
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             275   8e-82    
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    275   1e-81    
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             275   1e-81    
ref|XP_006472927.1|  PREDICTED: serine carboxypeptidase-like 42-like    276   1e-81    
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         275   1e-81    
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27-like    275   1e-81    
ref|XP_006292523.1|  hypothetical protein CARUB_v10018754mg             275   1e-81    
ref|XP_004292824.1|  PREDICTED: serine carboxypeptidase II-3-like       276   1e-81    
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         275   1e-81    
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179             275   1e-81    
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         275   2e-81    
emb|CAN63486.1|  hypothetical protein VITISV_017087                     275   2e-81    
ref|XP_006345490.1|  PREDICTED: serine carboxypeptidase-like 40-like    275   2e-81    
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    275   2e-81    
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         275   2e-81    
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              274   2e-81    
ref|XP_010694765.1|  PREDICTED: serine carboxypeptidase-like 40         276   2e-81    
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         275   2e-81    
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             275   3e-81    
ref|XP_004985385.1|  PREDICTED: serine carboxypeptidase II-3-like       274   3e-81    
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         274   3e-81    
gb|AAQ63884.1|  putative serine carboxypeptidase                        275   3e-81    
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    274   4e-81    
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               275   4e-81    
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             274   4e-81    
ref|XP_003557804.1|  PREDICTED: serine carboxypeptidase 24-like         275   4e-81    
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         274   4e-81    
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    273   4e-81    
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         273   5e-81    
ref|XP_003592367.1|  Serine carboxypeptidase-like protein               275   5e-81    
ref|XP_003542323.2|  PREDICTED: serine carboxypeptidase-like 40-l...    274   5e-81    
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          273   5e-81    
gb|KHN05141.1|  Serine carboxypeptidase II-3                            274   5e-81    
ref|NP_001060508.1|  Os07g0656900                                       273   5e-81    
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             273   5e-81    
emb|CBI19568.3|  unnamed protein product                                285   5e-81    
ref|XP_004237734.1|  PREDICTED: serine carboxypeptidase-like 42         273   6e-81    
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             274   6e-81    
ref|NP_199039.1|  serine carboxypeptidase-like 42                       273   6e-81    
ref|NP_001048377.1|  Os02g0794500                                       273   6e-81    
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         273   7e-81    
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       274   7e-81    
ref|XP_003589243.1|  Serine carboxypeptidase II-3                       274   8e-81    
gb|KDO53634.1|  hypothetical protein CISIN_1g0128612mg                  270   8e-81    
ref|XP_010530237.1|  PREDICTED: serine carboxypeptidase-like 42         273   8e-81    
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         273   8e-81    
emb|CDP16351.1|  unnamed protein product                                273   9e-81    
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         273   9e-81    
ref|XP_002449388.1|  hypothetical protein SORBIDRAFT_05g009120          273   1e-80    
gb|AES71590.2|  serine carboxypeptidase-like protein                    274   1e-80    
ref|XP_008786550.1|  PREDICTED: serine carboxypeptidase-like 42         273   1e-80    
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         273   1e-80    
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       273   1e-80    
ref|XP_008461495.1|  PREDICTED: serine carboxypeptidase-like 42 i...    273   1e-80    
ref|XP_004288721.1|  PREDICTED: serine carboxypeptidase 24-like         272   1e-80    



>ref|XP_006363923.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=480

 Score =   472 bits (1214),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/471 (51%), Positives = 322/471 (68%), Gaps = 16/471 (3%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             +L +   Y +  + + E+I SLPGQP ++ F QYSGYIVT+   GR+LFYYF EA SE+ 
Sbjct  4     WLCIFVSYLLFYKSSCELITSLPGQPPNIFFKQYSGYIVTNSQHGRSLFYYFVEADSENA  63

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S+PLTLWL GG  CSS   G F E+GPFRP +DG L+KN FSWNL SNMLYVD+PIGV 
Sbjct  64    ASLPLTLWLNGGPGCSSVGYGAFMEHGPFRPGKDGSLIKNNFSWNLESNMLYVDSPIGVG  123

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYSNTSSD+  W DT TA+ENL+F+ KWF +F  YR+ D Y+ G+SY GH  PQ A L+
Sbjct  124   FSYSNTSSDHINWDDTATAKENLQFILKWFKKFPRYRNSDVYLTGESYAGHYIPQFAVLL  183

Query  612   LEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTM  788
             L+ NR P +++PIKLK IALGNP+L+  +S+ + E+LW HG+IS+E+  M K +CN T  
Sbjct  184   LDYNRTP-NVKPIKLKSIALGNPLLDIDISVKSAEYLWAHGVISDELLDMHKTICNETKF  242

Query  789   IDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHY--LAT-----  947
             + E+   E S  C+ +    +EE+G+D+ + +++   C SSS +   +    LAT     
Sbjct  243   MIEYTHNETSNECAKVMEHKTEEMGNDIVRYDILLPKCVSSSAAGQLKALGNLATVHEKF  302

Query  948   -----ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI  1112
                  + ADPCL++W+  Y+N+P+VQKALHANTT   Y W   S        + + A DI
Sbjct  303   DKKVGKVADPCLKEWINLYLNKPEVQKALHANTTNLPYSWEVCS--GPLQYKMEDVATDI  360

Query  1113  LPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGG  1292
             +P LS +L   IP+L++SGDQD  +P++ TR++A +LA  LKL  L+  GPWYDG +IGG
Sbjct  361   IPLLSNILKQHIPILLFSGDQDSILPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGG  420

Query  1293  WSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             WSQ++G    G+ V  LTFATVRG +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  421   WSQSYGGVREGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  471



>gb|KDO72510.1| hypothetical protein CISIN_1g039529mg [Citrus sinensis]
Length=477

 Score =   471 bits (1212),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 235/461 (51%), Positives = 316/461 (69%), Gaps = 18/461 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQPS+V FNQYSGYIVT    GRALFYYFAEAQS D  S+PLTLWL GG  C
Sbjct  19    AELIKALPGQPSNVSFNQYSGYIVTDAEHGRALFYYFAEAQSPDHLSLPLTLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G+F E+GPF+P E+G+L+KN++SWNL SNMLYVD+PIGV +SYSNTSSDYK+W+D
Sbjct  79    SSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVDSPIGVGYSYSNTSSDYKLWND  138

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
               TA +NL+F+  WF EF +Y+D +F++AGDSY GH  PQLA LI++ N+ P ++RPIKL
Sbjct  139   AATAEDNLRFIVNWFKEFPQYKDSEFFLAGDSYAGHYVPQLATLIMKYNKQP-NIRPIKL  197

Query  657   KGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG-ELSEYCS  830
             +GIALGNP+L+  +S+   E+LW HG IS+E   ++K VCN +  + EF+ G   S+ C+
Sbjct  198   RGIALGNPLLDLDISVLGGEYLWSHGAISDETLMLEKTVCNDSKYLREFVHGNNHSQGCN  257

Query  831   DIEIMLSEEIGHDMDKENLV-------------FqscesssisssqqHYLATETADPCLR  971
              +   +SEE+G D+D+++L+             F+  +               T DPC+ 
Sbjct  258   QVFDRISEEVGADIDRQDLLSPFCIPISTSTEQFKPIDKHGKIHKTMARRGASTGDPCIY  317

Query  972   DWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIP  1151
               +  Y+N+P VQKALHANTT   + W+F            +F ++I+P +S LL   IP
Sbjct  318   GRIFTYLNKPKVQKALHANTTHLPFHWDFCDGPLVYQ--FEDFELNIIPLVSELLKEGIP  375

Query  1152  VLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEK  1331
             +L+YSGDQD +IP++ TR +A  LA  LKL  +   GPWY+ K++GGWSQ+FG    G+ 
Sbjct  376   ILLYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTTYGPWYNDKQVGGWSQSFGAFRDGKN  435

Query  1332  VANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1454
             V NLTFATVRGG+H VP +SPS+ALTLF++ L GSP P  H
Sbjct  436   VTNLTFATVRGGAHEVPFTSPSEALTLFRSLLTGSPLPRPH  476



>ref|XP_006431097.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
 gb|ESR44337.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
Length=477

 Score =   470 bits (1209),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 234/461 (51%), Positives = 315/461 (68%), Gaps = 18/461 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQPS+V FNQYSGYIVT    GRALFYYFAEAQS D  S+PLTLWL GG  C
Sbjct  19    AELIKALPGQPSNVSFNQYSGYIVTDAEHGRALFYYFAEAQSPDHLSLPLTLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G+F E+GPF+P E+G+L+KN++SWNL SNMLYVD+PIGV +SYSNTSSDYK+W+D
Sbjct  79    SSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVDSPIGVGYSYSNTSSDYKLWND  138

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
               TA +NL+F+  WF EF +Y+D +F++AGDSY GH  PQLA LI++ N+ P ++RPIKL
Sbjct  139   AATAEDNLRFIVNWFKEFPQYKDSEFFLAGDSYAGHYVPQLATLIMKYNKQP-NIRPIKL  197

Query  657   KGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG-ELSEYCS  830
             +GIALGNP+L+  +S+   E+LW HG IS+E   ++K VCN +  + EF+ G   S+ C+
Sbjct  198   RGIALGNPLLDLDISVLGGEYLWSHGAISDETLMLEKTVCNNSKYLREFVHGNNHSQGCN  257

Query  831   DIEIMLSEEIGHDMDKENLV-------------FqscesssisssqqHYLATETADPCLR  971
              +   +SEE+G D+D+++L+             F+  +               T DPC+ 
Sbjct  258   QVFDRISEEVGADIDRQDLLSPFCIPISTSTEQFKPIDKHGKIHKTMARRGASTGDPCIY  317

Query  972   DWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIP  1151
               +  Y+N+P VQKALHANTT   + W+F            +F ++I+P +S LL   IP
Sbjct  318   GRIFTYLNKPKVQKALHANTTHLPFHWDFCDGPLVYQ--FEDFELNIIPLVSELLKEGIP  375

Query  1152  VLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEK  1331
             +L+YSGDQD +IP++ TR +A  LA  LKL  +   GPWY+ K++GGWSQ+FG    G+ 
Sbjct  376   ILLYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTTYGPWYNDKQVGGWSQSFGAFRDGKN  435

Query  1332  VANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1454
             V NLTFAT RGG+H VP +SPS+ALTLF++ L GSP P  H
Sbjct  436   VTNLTFATARGGAHEVPFTSPSEALTLFRSLLTGSPLPRPH  476



>ref|XP_004228838.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=482

 Score =   469 bits (1206),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 237/464 (51%), Positives = 320/464 (69%), Gaps = 16/464 (3%)
 Frame = +3

Query  93    YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTL  272
             Y +  + + E+I SLPGQP ++ F QYSGYIVT+   GRALFYYF EA SE+  S+PLT+
Sbjct  13    YLLFYKSSCELITSLPGQPPNIFFKQYSGYIVTNSQHGRALFYYFVEADSENAASLPLTI  72

Query  273   WLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTS  452
             WL G   CSS   G F E+GPF+P +DG L+KN FSWNL SNMLYVD+PIGV FSYSNTS
Sbjct  73    WLNGAPGCSSLGYGAFMEHGPFQPGKDGRLIKNNFSWNLESNMLYVDSPIGVGFSYSNTS  132

Query  453   SDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNP  632
             SD   W DT TA+ENL+F+ KWF +F +YR+ D Y+ G+SY GH  PQ A L+L+ NR P
Sbjct  133   SDNINWDDTATAKENLQFILKWFKKFPQYRNSDVYLTGESYAGHYIPQFAVLLLDYNRTP  192

Query  633   AHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG  809
              +++PIKLK IALGNP+L+ ++S+ + E+LW HG+IS+E+  M K +CN T  + EF+  
Sbjct  193   -NVKPIKLKSIALGNPLLDIEISVKSAEYLWAHGVISDELLDMHKTICNETRYVMEFVHN  251

Query  810   ELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHY--LAT----------ET  953
             E S  C+ +  + +EE+G+D+ K +++   C SSS +   +    L T          + 
Sbjct  252   ETSNECAKVIELRTEEMGNDIVKYDVLLPKCVSSSAAGRLKALGNLTTVHGKFDKKVGKV  311

Query  954   ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  1133
             ADPCL +W+  Y+N+P+VQKALHANTT   Y W   S        + + AIDI+P LS +
Sbjct  312   ADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCS--GPLQYKMEDAAIDIIPLLSNI  369

Query  1134  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  1313
             L   IP+L++SGDQD  +P++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ++G 
Sbjct  370   LKQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYGG  429

Query  1314  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                G+ +  LTFATVRG +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  430   VREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  473



>ref|XP_006482672.1| PREDICTED: serine carboxypeptidase-like 46-like [Citrus sinensis]
Length=477

 Score =   468 bits (1204),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 233/461 (51%), Positives = 316/461 (69%), Gaps = 18/461 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQPS+V FNQYSGYIVT    GRALFYYFAEAQS D  S+PLTLWL GG  C
Sbjct  19    AELIKALPGQPSNVSFNQYSGYIVTDAEHGRALFYYFAEAQSPDHLSLPLTLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G+F E+GPF+P E+G+L+KN++SWNL SNMLYVD+PIGV +SYSNTSSDYK+W+D
Sbjct  79    SSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVDSPIGVGYSYSNTSSDYKLWND  138

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
               TA +NL+F+  WF EF +Y+D +F++AGDSY GH  PQLA LI++ N+ P ++RPIKL
Sbjct  139   AATAEDNLRFIVNWFKEFPQYKDSEFFLAGDSYAGHYVPQLATLIMKYNKQP-NIRPIKL  197

Query  657   KGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG-ELSEYCS  830
             +GIALGNP+L+  +S+   E+LW HG IS+E   +++ VCN +  + EF+ G   S+ C+
Sbjct  198   RGIALGNPLLDLDISVLGGEYLWSHGAISDETLMLERTVCNDSKYLREFVHGNNHSQGCN  257

Query  831   DIEIMLSEEIGHDMDKENLV-------------FqscesssisssqqHYLATETADPCLR  971
              +   +SEE+G D+D+++L+             F+  +               T DPC+ 
Sbjct  258   QVFDRISEEVGADIDRQDLLSPFCVPISTSTEQFKPIDKHGKIHKTMARRGASTGDPCIY  317

Query  972   DWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIP  1151
               +  Y+N+P VQKALHANTT   + W+F            +F ++I+P +S LL   IP
Sbjct  318   GRIFTYLNKPKVQKALHANTTHLPFHWDFCDGPLVYQ--FEDFELNIIPLVSELLKEGIP  375

Query  1152  VLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEK  1331
             +L+YSGDQD +IP++ TR +A  LA  LKL  + + GPWY+ K++GGWSQ+FG    G+ 
Sbjct  376   ILLYSGDQDTKIPLTQTRLIANSLAKDLKLLPVTIYGPWYNDKQVGGWSQSFGAFRDGKN  435

Query  1332  VANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1454
             V NLTFATVRGG+H VP +SPS+ALTLF++ L  SP P  H
Sbjct  436   VTNLTFATVRGGAHEVPFTSPSEALTLFRSLLTRSPLPRPH  476



>ref|XP_009762845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=486

 Score =   458 bits (1179),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 237/476 (50%), Positives = 319/476 (67%), Gaps = 25/476 (5%)
 Frame = +3

Query  69    WFLLVNTLYSI-SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             WF ++    S    + + E+I SLPGQP ++ F QYSGYIVT+   GRALFYYF EA SE
Sbjct  4     WFYVITIFSSFFYYKSSAELITSLPGQPPNIFFKQYSGYIVTNSQHGRALFYYFVEADSE  63

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             +  S+PLTLWL GG  CSS   G F E+GPF+P  DG L+KN++SWNL SNMLYV++PIG
Sbjct  64    NAASLPLTLWLNGGPGCSSVGFGAFMEHGPFQPGIDGNLMKNKYSWNLVSNMLYVESPIG  123

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAA  605
             V FSYSNTSSDY  W DT TA+ENL+F+  WF +F +YR+ D Y+AG+SY GH  PQL  
Sbjct  124   VGFSYSNTSSDYINWDDTATAKENLQFILNWFKKFPQYRNSDVYLAGESYAGHYIPQLTV  183

Query  606   LILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNAT  782
             L+L+ NR P ++ PI LK IALGNP+L+ ++S+ + ++LW HG IS+E+  M++ +CN T
Sbjct  184   LLLDYNRKP-NVEPINLKSIALGNPLLDLEISVKSAQYLWSHGAISDELLTMKRTICNET  242

Query  783   TMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLAT-----  947
               + E +   LS  C  +  +  EE+G D+D  +L+      SS ++ Q   LAT     
Sbjct  243   RFLLESIHNNLSNECKKVSELTDEEMGSDIDMGDLL-APTCVSSGTAKQLGALATIHGKF  301

Query  948   ------ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----N  1097
                   E ADPCL D +  Y+N+P+VQKALHANTT   Y W+F          LH    +
Sbjct  302   VKKAVGEVADPCLTDRINLYLNKPEVQKALHANTTYLPYAWDFCLGN------LHYRRED  355

Query  1098  FAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDG  1277
              A++ +P LS +L  +I VL++SGDQD +IP++ TR++A +LA  +KL  L+  G WYDG
Sbjct  356   LAVNTIPLLSNILKENIQVLLFSGDQDSKIPLTQTRKIAKLLARDVKLVALDKYGSWYDG  415

Query  1278  KEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              +IGGWSQ+FG    G+ +  LTFATVRG +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  416   LQIGGWSQSFGGLREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGHPPP  471



>ref|XP_004228389.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=490

 Score =   458 bits (1178),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 231/460 (50%), Positives = 313/460 (68%), Gaps = 13/460 (3%)
 Frame = +3

Query  93    YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTL  272
             Y +  + + E+I SLPGQP ++ F Q+SGYIVT+   GRALFYYF EA SE+  S+PLTL
Sbjct  11    YLLFYKSSCELITSLPGQPPNIFFKQHSGYIVTNSQNGRALFYYFVEADSENATSLPLTL  70

Query  273   WLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTS  452
             WL GG  CSS   G+F E+GPF+P +DG L+KN++SWNL SNMLYV++PIGV FSYSNTS
Sbjct  71    WLNGGPGCSSVGFGVFMEHGPFQPGKDGRLIKNKYSWNLESNMLYVESPIGVGFSYSNTS  130

Query  453   SDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNP  632
             SDY  W D  TA+ENL+FL  W  +F EYR+LD ++AG+SY GH  PQL  L+L+ NR P
Sbjct  131   SDYVNWDDVATAKENLQFLLNWLEKFPEYRNLDLFLAGESYAGHYIPQLTVLLLDYNRKP  190

Query  633   AHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG  809
              +++PIKLK IALGNP+L+ ++S+ + E+LW HG IS+E+  M++ +CN T ++ E +  
Sbjct  191   -NVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELLTMKRTICNETRLLLESIHH  249

Query  810   ELSEYCSDIEIMLSEEIGHDMDKENLV--FqscesssisssqqHYLAT-------ETADP  962
              +S  CS +  + +EE+G D D  +L+         +        LA+       E  DP
Sbjct  250   NMSNECSKVWDLTNEEMGSDTDTGDLLAPICVSSGVAGQLGVLGKLASIHEKDVREIGDP  309

Query  963   CLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMS  1142
             CL D +  Y+N+P+VQKALHANTT   Y W+F            + AI+++P LS +L  
Sbjct  310   CLTDRIYMYLNKPEVQKALHANTTHLPYAWDFCLGHLQYQR--GDLAINVIPLLSNILKE  367

Query  1143  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGG  1322
             +I VL+YSGDQD +IP++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ+FG    
Sbjct  368   NIQVLLYSGDQDTKIPLTQTRKIAKLLARDLKLVALDKYGPWYDGLQIGGWSQSFGGVRE  427

Query  1323  GEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPP  1442
             G+ V  LTFAT+RG +H VP +SPS+ALTLF+ FLKG  P
Sbjct  428   GKNVTYLTFATIRGAAHEVPYTSPSQALTLFRTFLKGQSP  467



>ref|XP_006363922.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=496

 Score =   455 bits (1171),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 320/469 (68%), Gaps = 15/469 (3%)
 Frame = +3

Query  72    FLLVNTLYS--ISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L + T++S  +  + + E+I SLPGQP ++ F QYSGYI+T+   GR+LFYYF EA SE
Sbjct  5     WLCIFTIFSSFLFYKTSCELITSLPGQPPNIIFKQYSGYIITNSQHGRSLFYYFVEADSE  64

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             +  S+PLTLWL GG  CSS   G F E+GPF+P +DG L+KN++SWNL SNMLYV++PIG
Sbjct  65    NATSLPLTLWLNGGPGCSSVGFGAFMEHGPFQPGKDGRLIKNKYSWNLESNMLYVESPIG  124

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAA  605
             V FSYSNTSSDY  W D  TA+ENL+F+  W  +F EY++ + ++AG+SY GH  PQL  
Sbjct  125   VGFSYSNTSSDYTNWDDVATAKENLQFILNWLEKFPEYKNSELFLAGESYAGHYIPQLTI  184

Query  606   LILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNAT  782
             L+L+ NR P +++PIKLK IALGNP+L+ ++S+ + E+LW HG IS+E+  M++ +CN T
Sbjct  185   LLLDYNRKP-NVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELLTMKRTICNET  243

Query  783   TMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLV--FqscesssisssqqHYLAT---  947
              ++ E +   +S  CS++  + +EE+G D D  +L+        ++        LAT   
Sbjct  244   RLLLESIHNNMSNECSEVWELTNEEMGSDTDMGDLLAPICVSSGAAGQLGVLGTLATIHK  303

Query  948   ----ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDIL  1115
                 +  DPCL D +  Y+N+P+VQKALHANTT   Y W+F            + AI+++
Sbjct  304   KDVRKIGDPCLTDRINMYLNKPEVQKALHANTTHLPYAWDFCLGHLQYQ--RGDLAINVI  361

Query  1116  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  1295
             P LS +L  +I VL+YSGDQD +IP++ TR++A +LA  LKL  L+  GPWYD  +IGGW
Sbjct  362   PLLSNILKENIQVLLYSGDQDTKIPLTQTRKIAKLLARDLKLVALDKYGPWYDDMQIGGW  421

Query  1296  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPP  1442
             SQ++G    G+ V  LTFATVRG +H VP +SPS+ALTLF+AFLKG PP
Sbjct  422   SQSYGGVIEGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLKGQPP  470



>ref|XP_006363924.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=493

 Score =   453 bits (1166),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 227/461 (49%), Positives = 315/461 (68%), Gaps = 13/461 (3%)
 Frame = +3

Query  93    YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTL  272
             Y +  + + E+I SLPGQP ++ F QYSGYIVT+   GR+LFYYF EA SE+  S+PLTL
Sbjct  11    YLLFYKSSCELITSLPGQPPNIFFKQYSGYIVTNSQHGRSLFYYFVEADSENATSLPLTL  70

Query  273   WLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTS  452
             WL GG  CSS   G F E+GPF+P +DG L+KN++SWNL SNMLY+++PI V FSYSNTS
Sbjct  71    WLNGGPGCSSVGFGAFKEHGPFQPGKDGRLIKNKYSWNLESNMLYIESPIRVGFSYSNTS  130

Query  453   SDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNP  632
             SDY  W D  TA+ENL+F+  W  +F EY++ + ++AG+SY GH  PQL  L+++ NR P
Sbjct  131   SDYTNWDDVATAKENLQFILNWLEKFPEYKNSELFLAGESYAGHYIPQLTILLIDYNRKP  190

Query  633   AHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG  809
              +++PIKLK IALGNP+L+ ++S+ + E+LW HG IS+E+  M++ +CN T ++ E +  
Sbjct  191   -NVKPIKLKSIALGNPLLDLEISVKSSEYLWSHGAISDELLTMKRTICNETRLLLESIHN  249

Query  810   ELSEYCSDIEIMLSEEIGHDMDKENLV--FqscesssisssqqHYLAT-------ETADP  962
              +S  CS++  + +EE+G D D  +L+        ++        LAT       ++ DP
Sbjct  250   NMSNDCSEVWELTNEEMGSDTDMGDLLAPICVSSGAAGQLGVLGKLATIHEKDVRKSGDP  309

Query  963   CLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMS  1142
             CL D +  Y+N+P+VQKALHANTT   Y W+F            + AI+++P LS +L  
Sbjct  310   CLTDRIYMYLNKPEVQKALHANTTHLPYAWDFCLGHLQYQR--GDLAINVIPLLSNILKE  367

Query  1143  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGG  1322
             +I VL+YSGDQD +IPV+ TR++A +LA  LKL  L+  GPWYD  +IGGWSQ++G    
Sbjct  368   NIQVLLYSGDQDTKIPVTQTRKIAKLLARDLKLVALDKYGPWYDDLQIGGWSQSYGGVRE  427

Query  1323  GEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             G+ V  LTFATVRG +H VP +SPS+ALTLF+AFLKG PPP
Sbjct  428   GKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLKGQPPP  468



>ref|XP_009627244.1| PREDICTED: serine carboxypeptidase-like 46 [Nicotiana tomentosiformis]
Length=479

 Score =   448 bits (1152),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 231/455 (51%), Positives = 312/455 (69%), Gaps = 24/455 (5%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I SLPGQP ++ F QYSGYIVT+   GRALFYYF +A SE+  S+PLT+WL GG  C
Sbjct  21    AELITSLPGQPPNIFFKQYSGYIVTNAQHGRALFYYFVDADSENAASLPLTVWLNGGPGC  80

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F E+GPF+P  DG L+KN++SWNL SNMLYV++PIGV FSYSNTSSDY  W D
Sbjct  81    SSVGFGAFMEHGPFQPRIDGSLIKNKYSWNLVSNMLYVESPIGVGFSYSNTSSDYTNWDD  140

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
             T TA+ENL+F+  WF +F +YR+ D Y+AG+SY GH  PQL  L+L+ NR P +++PIKL
Sbjct  141   TATAKENLQFILNWFKKFPQYRNSDVYLAGESYAGHYIPQLTVLLLDYNRKP-NVKPIKL  199

Query  657   KGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             K IALGNP+L+ ++S+ + E+LW HG IS+E+  M++K+CN T  + E +   +S  C+ 
Sbjct  200   KSIALGNPLLDLEISVKSSEYLWSHGAISDELLTMRRKICNETRFLLESIHNNVSNECTK  259

Query  834   IEIMLSEEIGHDMDKENLVFqscesssisssqqHYLAT-----------ETADPCLRDWV  980
             +  +  EE+G D+D  +L+      SS ++ Q   LAT           + A+ CL D +
Sbjct  260   VWELTDEEMGSDIDMGDLL-APTCVSSGTARQLGALATIHGKFVKHEVGKVAETCLTDRI  318

Query  981   GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAIDILPTLSALLMSDI  1148
               Y+N+P+VQKALHANTT   Y W+F          LH    + A++ +P LS +L  +I
Sbjct  319   NLYLNKPEVQKALHANTTYLPYAWDFCLG------YLHYRREDLAVNTIPLLSNILKENI  372

Query  1149  PVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGE  1328
              VL +SGDQD +IP++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ+FG    G+
Sbjct  373   QVLFFSGDQDSKIPLTQTRKIAKLLARDLKLVALDKYGPWYDGLQIGGWSQSFGGLREGK  432

Query  1329  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKG  1433
              V  LTFATVRG +H VP +SPS+ALTLF+AFL+G
Sbjct  433   NVTYLTFATVRGAAHEVPFTSPSQALTLFRAFLRG  467



>ref|XP_006431096.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
 gb|ESR44336.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
Length=473

 Score =   437 bits (1123),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 220/461 (48%), Positives = 314/461 (68%), Gaps = 17/461 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQP++V F QYSGYI+T    GRALFYYF EAQS +  S+PLTLWL GG  C
Sbjct  18    AELISALPGQPNNVPFKQYSGYILTDANHGRALFYYFVEAQSTNPLSLPLTLWLNGGPGC  77

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F E+GPF+P E+G+L+KN++SWNLASNMLYV++PIGV FSYSNTSSDY +W+D
Sbjct  78    SSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVESPIGVGFSYSNTSSDYNLWND  137

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
             + TA +NL+F+  W  EF +Y+D +F++ G+SY GH  PQLA L+L+ N+ P +++PIKL
Sbjct  138   SNTAGDNLRFIVNWLEEFPQYKDSEFFLTGESYAGHYVPQLATLVLQYNKQP-NVKPIKL  196

Query  657   KGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             K IALGNP+L+  +S+   + +W HG IS+E   ++K VCN +T + E ++ + S+ C+D
Sbjct  197   KSIALGNPLLDLDISVLTGDFMWSHGAISDETLMLEKTVCNGSTYLRELVNNQESKGCND  256

Query  834   IEIMLSEEIGHDMDKENLVFqscesssisssqqHYLA-----------TETADPCLRDWV  980
             +   ++EE G D+D  +L+  SC +S+ +   + +               + DPC+ D +
Sbjct  257   VFNRVNEEFG-DIDSGDLLLPSCLTSTSAQQFKLFGKHGKIPNMMVNFGASGDPCIGDRI  315

Query  981   GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  1160
               Y+N P VQ+ALHANTT   +PW F   G   D    +F ++I+P ++ L+M  +P+L+
Sbjct  316   FTYLNSPQVQEALHANTTHLPFPWEFC--GGPLDYQYKDFELNIIPQIADLIMEGVPILL  373

Query  1161  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVAN  1340
             +SGDQD +IP++ TR +A  LA  LKL        WYD +++GGWSQ+FG    G+ +  
Sbjct  374   FSGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFGAFRDGKNITY  433

Query  1341  LTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTHPDH  1463
             LT+ATVRG +H VP ++PS ALTLF++FL GSP PN  P H
Sbjct  434   LTYATVRGAAHEVPYTTPSPALTLFQSFLTGSPLPN-RPKH  473



>ref|XP_003633850.1| PREDICTED: serine carboxypeptidase-like 46 [Vitis vinifera]
 emb|CBI22165.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   436 bits (1122),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 229/490 (47%), Positives = 314/490 (64%), Gaps = 30/490 (6%)
 Frame = +3

Query  27    FIIDII*KIMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRG  206
             FI+++I  + +F L+F           +   E+I SLPGQP++V F QY+GYIVT    G
Sbjct  5     FILEVI-SLFLFFLYF-----------KSFAELITSLPGQPANVSFKQYAGYIVTDARHG  52

Query  207   RALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWN  386
             RALFYYF EA++ D  S PLTLW  GG  CSS   G F ENGPF+P E+G LVKN+ SWN
Sbjct  53    RALFYYFVEAKTADPLSRPLTLWFNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWN  112

Query  387   LASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAG  566
             L SNMLYV++PIGV FSYSNTSSDY  W+DT TA +NL+F+  W  EF  Y+D + ++ G
Sbjct  113   LESNMLYVESPIGVGFSYSNTSSDY-FWNDTRTAEDNLRFVINWLEEFPNYKDSELFLTG  171

Query  567   DSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISE  743
             +SY GH  PQLAALI+E N+ P ++RPIKLK IALGNP+L+  +S+   ++LW HG IS+
Sbjct  172   ESYAGHYIPQLAALIVEYNQKP-NIRPIKLKSIALGNPLLDLDISVLAADYLWAHGAISD  230

Query  744   EVYGMQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLV-----------  890
                 ++K VCN +  + E++ G+LSE C+++   +  EIG+D+ +++L+           
Sbjct  231   HTLMLEKTVCNYSKFLREYIHGQLSEGCNNVYNRVVNEIGNDVRQDDLLLPICLSSNSAQ  290

Query  891   -FqscesssisssqqHYLATET-ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTS  1064
              F+         +       ET  DPCL D +  Y+N P VQKALHANTT   Y W F +
Sbjct  291   QFKLKGQRGTIHAAIARRTRETIPDPCLSDRILTYLNNPQVQKALHANTTHLPYHWGFCA  350

Query  1065  PGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLT  1244
                  +  + N  ++++P +  L+   IP+L++SGDQD  IP++ TR +A  +A  LKL 
Sbjct  351   --GPLEYQIDNLDMNLIPLIEHLIKEGIPILLFSGDQDAIIPLTQTRIIANNVAKDLKLV  408

Query  1245  TLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAF  1424
                  G WYD K++GGW+Q+FG    G+ V  LTFATVRG +H VP +SPS+ALT+FK+F
Sbjct  409   PFTEYGTWYDKKQVGGWTQSFGGLREGKNVTLLTFATVRGAAHEVPFTSPSQALTMFKSF  468

Query  1425  LKGSPPPNTH  1454
             L GSP P  H
Sbjct  469   LSGSPLPRPH  478



>ref|XP_010265020.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=474

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 221/453 (49%), Positives = 297/453 (66%), Gaps = 23/453 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             + +LPGQP+ V F QYSGYIVT    GRALFYY  EA S    S PLTLWL GG  CSS 
Sbjct  27    VTTLPGQPTHVSFKQYSGYIVTDAAHGRALFYYLVEADSAHPLSRPLTLWLNGGPGCSSV  86

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G+  E+GPF+P ++  L KN++SWNL SNMLYVD+PIGV FSYSNTSSDY  ++DT T
Sbjct  87    GFGVLMEHGPFQPKDNRLLAKNKYSWNLESNMLYVDSPIGVGFSYSNTSSDYTSYNDTTT  146

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A +NLKFL  W  +F +Y++ D Y+AG+SY GH  PQLA+L+LE N+ P ++RPIKLKG+
Sbjct  147   AEDNLKFLLNWLEKFPKYKNSDLYLAGESYAGHFIPQLASLLLEYNKKP-NIRPIKLKGV  205

Query  666   ALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIEI  842
             ALGNP+L+  +S++  E+LW HG IS+E   ++K VC  +    EF+   LS+ CSD+  
Sbjct  206   ALGNPLLDLDISIAFAENLWSHGAISDETLMLEKTVCKISRYFKEFVHNNLSKECSDVFD  265

Query  843   MLSEEIGHDMDKENLVF------qscesssisssqqHY---LATETADPCLRDWVGEYIN  995
              +++E+G ++D+ +L+          E    + +  H    L     DPCL D +  Y+N
Sbjct  266   RINKEVGDELDRNDLLSLQCLPSTEAEQFRAAKAIMHSNIGLLRGAGDPCLPDRILAYLN  325

Query  996   RPDVQKALHANTTGWQY---PWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  1166
             +P VQKALHA  T W +   P  +          + + A +++P +S LL SDIP++ YS
Sbjct  326   KPVVQKALHAVPTNWSFCAGPLQYQ---------MESLATNMIPIISDLLKSDIPIMFYS  376

Query  1167  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLT  1346
             GDQD +IP++ TR +A  +A  LKL  L   GPWYD K++GGW+Q+FG    G+ V  LT
Sbjct  377   GDQDTKIPLTQTRIIANAMAKSLKLVPLTSYGPWYDNKQVGGWAQSFGKQREGKNVTYLT  436

Query  1347  FATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             FATVRGGSH VP +SPS+ LTLF+ FL GS  P
Sbjct  437   FATVRGGSHEVPYTSPSQTLTLFRVFLSGSLLP  469



>gb|KDO72509.1| hypothetical protein CISIN_1g037032mg [Citrus sinensis]
Length=473

 Score =   435 bits (1118),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 220/461 (48%), Positives = 313/461 (68%), Gaps = 17/461 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I +LPGQP++V   QYSGYI+T    GRALFYYF EAQS +  S+PLTLWL GG  C
Sbjct  18    AELISALPGQPNNVPVKQYSGYILTDANHGRALFYYFVEAQSTNPLSLPLTLWLNGGPGC  77

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F E+GPF+P E+G+L+KN++SWNLASNMLYV++PIGV FSYSNTSSDY +W+D
Sbjct  78    SSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVESPIGVGFSYSNTSSDYNLWND  137

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
             + TA +NL+F+  W  EF +Y+D +F++ G+SY GH  PQLA LIL+ N+ P +++PIKL
Sbjct  138   SNTAGDNLRFIVNWLEEFPQYKDSEFFLTGESYAGHYVPQLATLILQYNKQP-NVKPIKL  196

Query  657   KGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             K IALGNP+L+  +S+   + +W HG IS+E   ++K VCN +T + E ++ + S+ C+D
Sbjct  197   KSIALGNPLLDLDISVLTGDFMWSHGAISDETLMLEKTVCNGSTYLRELVNNQESKGCND  256

Query  834   IEIMLSEEIGHDMDKENLVFqscesssisssqqHYLA-----------TETADPCLRDWV  980
             +   ++EE G D+D  +L+  SC +S+ +   + +               + DPC+ D +
Sbjct  257   VFNRVNEEFG-DIDSGDLLLPSCLTSTSAQQFKLFGKHGKIPNMMVNFGASGDPCIGDRI  315

Query  981   GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  1160
               Y+N P VQ+ALHANTT   +PW F   G   D    +F ++I+P ++ L+M  +P+L+
Sbjct  316   FTYLNSPQVQEALHANTTHLPFPWEFC--GGPLDYQYKDFELNIIPQIADLIMEGVPILL  373

Query  1161  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVAN  1340
             +SGDQD +IP++ TR +A  LA  LKL        WYD +++GGWSQ+FG    G+ +  
Sbjct  374   FSGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFGAFRDGKNITY  433

Query  1341  LTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTHPDH  1463
             LT+ATVRG +H VP ++PS ALTLF++FL GSP PN  P H
Sbjct  434   LTYATVRGAAHEVPYTTPSPALTLFQSFLTGSPLPN-RPKH  473



>ref|XP_007046208.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
 gb|EOY02040.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
Length=488

 Score =   435 bits (1119),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 235/481 (49%), Positives = 313/481 (65%), Gaps = 18/481 (4%)
 Frame = +3

Query  48    KIMVFLLWFLLVNTLYSIS--IRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFY  221
             K M FLL F +++  +        + E+I +LPGQP++V F QYSGYIVT    GRALFY
Sbjct  3     KRMRFLLAFRVISCFFLFFFFCSASAELIKALPGQPANVTFKQYSGYIVTEPKHGRALFY  62

Query  222   YFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNM  401
             YF E  S +    PLTLWL GG  CSS   G F E+GPF+P E+G L+KN++SWNL SNM
Sbjct  63    YFVEVDSANPGLHPLTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNLESNM  122

Query  402   LYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGG  581
             LY+++PIGV FSYSNTSSDY   +DT+TA ENL F+  WF +F +YRD D Y++G+SY G
Sbjct  123   LYLESPIGVGFSYSNTSSDYLGVNDTITAGENLIFILNWFKKFPQYRDSDLYLSGESYAG  182

Query  582   HLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGM  758
             H  PQLAALIL  N+  +  RPIKLK IALGNP+L+ ++S++N E LW HG+IS+E+  +
Sbjct  183   HYIPQLAALILSYNKRFSG-RPIKLKAIALGNPLLDLEISVNNAEFLWSHGVISDEMLML  241

Query  759   QKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHY  938
             +K VC+ +  + E L   LS+ C D+     EEIG   D  +L+   C SS++     + 
Sbjct  242   RKTVCSESRSLKESLHRNLSKQCIDVLNKEQEEIGSYTDPGDLILPICLSSTVLGQTVYQ  301

Query  939   ---------LATETA---DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSD  1082
                      LA  +A   DPCL D + +Y+N P VQ+ALHANTT     W F   G    
Sbjct  302   GALNRLHAKLAMTSAVASDPCLGDRIYQYLNTPKVQEALHANTTHLPSDWEFC--GGHLV  359

Query  1083  VILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNG  1262
                 +  I+I+P LS LL   IP+L+++GDQD +IP++ TR +A +LA  LKL       
Sbjct  360   YQRESLEINIIPLLSKLLRRSIPILLFNGDQDSKIPLTQTRIIANMLAEELKLVPFGSYA  419

Query  1263  PWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPP  1442
             PWYD  ++GGW+Q+FG +  G+ V  LTFATVRG +H VP +SPS+ALTLF+AFL+GSP 
Sbjct  420   PWYDKTQVGGWTQSFGQARKGKNVTYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGSPL  479

Query  1443  P  1445
             P
Sbjct  480   P  480



>ref|XP_002277201.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Vitis 
vinifera]
Length=479

 Score =   432 bits (1110),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 305/469 (65%), Gaps = 21/469 (4%)
 Frame = +3

Query  90    LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLT  269
             LYS S     E+I +LPGQP++V F QYSGYI T    GRALFYYF EA++    S PLT
Sbjct  17    LYSKSF---AELITALPGQPANVSFKQYSGYIATDDQHGRALFYYFVEAETAHPLSRPLT  73

Query  270   LWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNT  449
             LWL GG  CSS   G F ENGPF+P E+G LVKN+ SWN+ SNMLYV++PIGV FSYSNT
Sbjct  74    LWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVESPIGVGFSYSNT  133

Query  450   SSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRN  629
             SS+Y  W+DT TA +NL+F+  WF EF  Y+D + ++ G+SY GH  PQLAAL++E N+ 
Sbjct  134   SSNY-FWNDTRTAEDNLRFIVNWFEEFPYYKDSELFLTGESYAGHYIPQLAALLVEYNKR  192

Query  630   PAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLS  806
             P ++RPIKLK IALGNP+L+  +S+   ++LW HG IS++   ++K VCN +  + E+  
Sbjct  193   P-NIRPIKLKAIALGNPLLDLDISVLAGDYLWSHGAISDDTLLLEKTVCNDSKYLREYYH  251

Query  807   GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqq-------------HYLAT  947
             G+LS+ C D+   + +EI  D++K +L+   C SS+ +   +                  
Sbjct  252   GQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFRLKGLQGKIYAEIDRRTRG  311

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  1127
                DPCL D +  Y+N P VQKALHANTT   Y W+F S      V   N  +D+LP ++
Sbjct  312   TIPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGPLVYQV--DNLDMDLLPLIA  369

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
              LL  +I +L+YSGDQD ++P++ TR +   LA  LKL      G WYD +++GGWSQ+F
Sbjct  370   YLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVGGWSQSF  429

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1454
             G    G  +  LTFATVRG +H VP +SPS+ALTLFK+FL GSPPP  H
Sbjct  430   GRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPPRLH  478



>emb|CBI22166.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   434 bits (1115),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 305/469 (65%), Gaps = 21/469 (4%)
 Frame = +3

Query  90    LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLT  269
             LYS S     E+I +LPGQP++V F QYSGYI T    GRALFYYF EA++    S PLT
Sbjct  88    LYSKSF---AELITALPGQPANVSFKQYSGYIATDDQHGRALFYYFVEAETAHPLSRPLT  144

Query  270   LWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNT  449
             LWL GG  CSS   G F ENGPF+P E+G LVKN+ SWN+ SNMLYV++PIGV FSYSNT
Sbjct  145   LWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVESPIGVGFSYSNT  204

Query  450   SSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRN  629
             SS+Y  W+DT TA +NL+F+  WF EF  Y+D + ++ G+SY GH  PQLAAL++E N+ 
Sbjct  205   SSNY-FWNDTRTAEDNLRFIVNWFEEFPYYKDSELFLTGESYAGHYIPQLAALLVEYNKR  263

Query  630   PAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLS  806
             P ++RPIKLK IALGNP+L+  +S+   ++LW HG IS++   ++K VCN +  + E+  
Sbjct  264   P-NIRPIKLKAIALGNPLLDLDISVLAGDYLWSHGAISDDTLLLEKTVCNDSKYLREYYH  322

Query  807   GELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqq-------------HYLAT  947
             G+LS+ C D+   + +EI  D++K +L+   C SS+ +   +                  
Sbjct  323   GQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFRLKGLQGKIYAEIDRRTRG  382

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  1127
                DPCL D +  Y+N P VQKALHANTT   Y W+F S      V   N  +D+LP ++
Sbjct  383   TIPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGPLVYQV--DNLDMDLLPLIA  440

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
              LL  +I +L+YSGDQD ++P++ TR +   LA  LKL      G WYD +++GGWSQ+F
Sbjct  441   YLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVGGWSQSF  500

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1454
             G    G  +  LTFATVRG +H VP +SPS+ALTLFK+FL GSPPP  H
Sbjct  501   GRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPPRLH  549



>ref|XP_010256545.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=471

 Score =   429 bits (1102),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 228/476 (48%), Positives = 300/476 (63%), Gaps = 28/476 (6%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             I++ +++F  +   +       GE+   LPGQP+ V F QYSGYIVT    GRALFYYF 
Sbjct  8     IVISIIYFFFLTKSF-------GELATILPGQPTHVSFKQYSGYIVTDAAHGRALFYYFV  60

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA S    S PLTLWL GG  CSS   G F ENGPF+  + G L KN +SWNL SNMLYV
Sbjct  61    EADSAHPLSRPLTLWLSGGPGCSSLGEGAFTENGPFQSKDSGHLAKNIYSWNLESNMLYV  120

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYSNTS DY  W+DT TA +NLKFL  W  +F +Y+  D Y+AGDSY GH  
Sbjct  121   ESPIGVGFSYSNTSLDYISWNDTTTAEDNLKFLLNWLEKFPKYKHSDLYLAGDSYAGHYV  180

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKK  767
             PQLA+L+LE NR P  +RPIKLKG+ALG+P+L   +S+ + + LW HG IS+E   ++K 
Sbjct  181   PQLASLLLEYNRKP-DIRPIKLKGVALGSPLLNLDISMESADDLWSHGAISDETLMLEKT  239

Query  768   VCNATTMIDE-FLSGELSEYCSDIEIMLSEEIGHDMDKENLV----Fqscesssisssqq  932
             +C   T   E F+   LS+ C D+   ++ EIG D+D+ +L+      S  +    +   
Sbjct  240   ICKIPTYYKELFVYKNLSKECIDVFDRINGEIGDDLDRNDLLSFKCLPSSRAEQFRARAT  299

Query  933   HYLA--TETADPCLRDWVGEYINRPDVQKALHANTTGWQY---PWNFTSPGKTSDVILHN  1097
             + +A  T  ADPCL D V  Y+NRP VQKALHA    W +   P  +          + N
Sbjct  300   NPMAKGTSAADPCLSDRVLAYLNRPKVQKALHAIPVNWSFCSGPLQYQ---------MDN  350

Query  1098  FAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDG  1277
               I+I+P +S LL S+I +++Y+GDQD ++ +S TR +A  +A  LKL  L   GPWYD 
Sbjct  351   VDINIIPVVSDLLKSNISIMLYNGDQDAKVSLSQTRIIANTIAKSLKLVPLTSYGPWYDN  410

Query  1278  KEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             K++GGW+Q+FG    G+ V  LTFATVRGGSH  P +SPS+ALTLF+AFL  S  P
Sbjct  411   KQVGGWAQSFGKLRYGKNVTYLTFATVRGGSHGAPYTSPSQALTLFRAFLSASSLP  466



>gb|KCW64994.1| hypothetical protein EUGRSUZ_G02536 [Eucalyptus grandis]
Length=480

 Score =   428 bits (1100),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 230/481 (48%), Positives = 312/481 (65%), Gaps = 23/481 (5%)
 Frame = +3

Query  63    LLWF--LLVNTLYSI--SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++W+  ++VN +  +  S     E+I  LPGQP  V F Q+SGYIVT   RG ALFYYF 
Sbjct  1     MIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYFV  60

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLYV
Sbjct  61    EADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYV  120

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH  
Sbjct  121   ESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHYV  180

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKK  767
             PQLAAL+L+ N+  +H +PIKLK IALGNP+L+ ++S+     LW HG+IS+E   +++ 
Sbjct  181   PQLAALVLDYNKQ-SHGKPIKLKAIALGNPLLDLRISVDGATFLWSHGVISDETLKLKET  239

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLAT  947
             VCN +    E +  ++S+ C+ +     EE+G+  D  +++  +C S + +       A 
Sbjct  240   VCNDSRYRTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPNCFSGTAAMQSASSSAW  299

Query  948   ET-----------ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTS--DVI  1088
             +             DPCL +++  Y+N P VQKALHANTT     W F S G  S  DV 
Sbjct  300   DAYHAKLARRMVLTDPCLWEYIFSYLNNPRVQKALHANTTKLPSVWQFCS-GLLSYHDV-  357

Query  1089  LHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPW  1268
               +  IDI P LSAL+   + VL++SGDQD +IP++ TR +A+++A  LK T+L    PW
Sbjct  358   --DIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRMIASMIARYLKFTSLGKYAPW  415

Query  1269  YDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             YD  ++GGW+Q+FG+S  G+ V +LTFATVRG +H VP +SPS+ALTLFKAFL+GS PP 
Sbjct  416   YDNMQVGGWTQSFGSSREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSPPK  475

Query  1449  T  1451
              
Sbjct  476   V  476



>ref|XP_010068795.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   428 bits (1100),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 230/482 (48%), Positives = 311/482 (65%), Gaps = 21/482 (4%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSI--SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             M+   + ++VN +  +  S     E+I  LPGQP  V F Q+SGYIVT   RG ALFYYF
Sbjct  1     MMIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYF  60

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLY
Sbjct  61    VEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLY  120

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             V++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH 
Sbjct  121   VESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHY  180

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQK  764
              PQLAAL+L+ N+  +H +PIKLK IALGNP+L+ ++S+     LW HG+IS+E   +++
Sbjct  181   VPQLAALVLDYNKQ-SHGKPIKLKAIALGNPLLDLRISVDGATFLWSHGVISDETLKLKE  239

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLA  944
              VCN +    E +  ++S+ C+ +     EE+G+  D  +++  +C S + +       A
Sbjct  240   TVCNDSRYRTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPNCFSGTAAMQSASSSA  299

Query  945   TET-----------ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTS--DV  1085
              +             DPCL +++  Y+N P VQKALHANTT     W F S G  S  DV
Sbjct  300   WDAYHAKLARRMVLTDPCLWEYIFSYLNNPRVQKALHANTTKLPSVWQFCS-GLLSYHDV  358

Query  1086  ILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGP  1265
                +  IDI P LSAL+   + VL++SGDQD +IP++ TR +A+++A  LK T+L    P
Sbjct  359   ---DIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRMIASMIARYLKFTSLGKYAP  415

Query  1266  WYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             WYD  ++GGW+Q+FG+S  G+ V +LTFATVRG +H VP +SPS+ALTLFKAFL+GS PP
Sbjct  416   WYDNMQVGGWTQSFGSSREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSPP  475

Query  1446  NT  1451
               
Sbjct  476   KV  477



>ref|XP_010661029.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Vitis 
vinifera]
Length=481

 Score =   427 bits (1098),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 229/471 (49%), Positives = 305/471 (65%), Gaps = 23/471 (5%)
 Frame = +3

Query  90    LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLT  269
             LYS S     E+I +LPGQP++V F QYSGYI T    GRALFYYF EA++    S PLT
Sbjct  17    LYSKSF---AELITALPGQPANVSFKQYSGYIATDDQHGRALFYYFVEAETAHPLSRPLT  73

Query  270   LWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNT  449
             LWL GG  CSS   G F ENGPF+P E+G LVKN+ SWN+ SNMLYV++PIGV FSYSNT
Sbjct  74    LWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVESPIGVGFSYSNT  133

Query  450   SSDYKIWSDTMT--ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDN  623
             SS+Y  W+DT T  A +NL+F+  WF EF  Y+D + ++ G+SY GH  PQLAAL++E N
Sbjct  134   SSNY-FWNDTRTVAAEDNLRFIVNWFEEFPYYKDSELFLTGESYAGHYIPQLAALLVEYN  192

Query  624   RNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEF  800
             + P ++RPIKLK IALGNP+L+  +S+   ++LW HG IS++   ++K VCN +  + E+
Sbjct  193   KRP-NIRPIKLKAIALGNPLLDLDISVLAGDYLWSHGAISDDTLLLEKTVCNDSKYLREY  251

Query  801   LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqq-------------HYL  941
               G+LS+ C D+   + +EI  D++K +L+   C SS+ +   +                
Sbjct  252   YHGQLSKECKDVFNRVLDEISGDVEKGDLLMPKCLSSNSAQQFRLKGLQGKIYAEIDRRT  311

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  1121
                  DPCL D +  Y+N P VQKALHANTT   Y W+F S      V   N  +D+LP 
Sbjct  312   RGTIPDPCLPDRIFTYLNNPQVQKALHANTTHLPYYWDFCSGPLVYQV--DNLDMDLLPL  369

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             ++ LL  +I +L+YSGDQD ++P++ TR +   LA  LKL      G WYD +++GGWSQ
Sbjct  370   IAYLLEQNIRILLYSGDQDAKVPLTQTRLITNNLAKDLKLVPFTKYGTWYDKEQVGGWSQ  429

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1454
             +FG    G  +  LTFATVRG +H VP +SPS+ALTLFK+FL GSPPP  H
Sbjct  430   SFGRLRDGMNLTLLTFATVRGAAHEVPFTSPSQALTLFKSFLSGSPPPRLH  480



>ref|XP_010068797.1| PREDICTED: serine carboxypeptidase-like 46 [Eucalyptus grandis]
Length=481

 Score =   425 bits (1093),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 226/481 (47%), Positives = 307/481 (64%), Gaps = 23/481 (5%)
 Frame = +3

Query  63    LLWFLLVNT-----LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             ++W+ +V       L+S S     E+I  LPGQP  V F Q+SGYI T   RG ALFYYF
Sbjct  2     MIWYFIVIVNGVIPLFS-SCTSTAELIKKLPGQPDGVSFKQHSGYITTDPRRGHALFYYF  60

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLY
Sbjct  61    VEADARDPLSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLY  120

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             V++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH 
Sbjct  121   VESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHY  180

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQK  764
              PQLAAL+L+ N+  +  + IKL+ IALGNP+L+ ++S+     LW HG+IS+E   +++
Sbjct  181   VPQLAALLLDYNKQ-SRGKLIKLRAIALGNPLLDIQISVDAATFLWSHGVISDETLKLKE  239

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLV---------Fqscesssi  917
              VCN +  + + +  ++S  C+++     EE+G+  D ++++              S S+
Sbjct  240   TVCNDSRYLTQQIHNKISMECAEVFQKQVEEMGNFTDPDDVLEPYCFSGTAVVQSASRSM  299

Query  918   sssqqHYLATETA--DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTS-PGKTSDVI  1088
               +    LA      DPCL D++  Y+N P VQKALHAN T     WNF S P    DV 
Sbjct  300   WDAYHAKLARRMVLTDPCLGDFIFSYLNNPQVQKALHANITKLPSVWNFCSGPLSYHDV-  358

Query  1089  LHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPW  1268
               +  IDI+P LSAL+   + VL++SGDQD ++P+  TR +A ++A  LK T+L    PW
Sbjct  359   --DIGIDIIPLLSALIEKHLRVLLFSGDQDSKVPLMQTRMIANMIAQDLKFTSLGKYAPW  416

Query  1269  YDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             YD  ++GGW+Q+FG+S  G+ V +LTFATVRG +H VP +SPS+ALTLFKAFL+GS PP 
Sbjct  417   YDKMQVGGWTQSFGSSREGKNVTHLTFATVRGAAHEVPYTSPSQALTLFKAFLEGSSPPK  476

Query  1449  T  1451
              
Sbjct  477   V  477



>gb|KCW64996.1| hypothetical protein EUGRSUZ_G02538 [Eucalyptus grandis]
Length=480

 Score =   424 bits (1090),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 228/481 (47%), Positives = 307/481 (64%), Gaps = 23/481 (5%)
 Frame = +3

Query  63    LLWF--LLVNTLYSI--SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++W+  ++VN +  +  S     E+I  LPGQP  V F Q+SGYIVT   RG ALFYYF 
Sbjct  1     MIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYFV  60

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLYV
Sbjct  61    EADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYV  120

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH  
Sbjct  121   ESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHYV  180

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKK  767
             PQLAAL+L+ N+  +H +PIKLK IALGNP+L+ ++S+     LW HG+IS+E   +++ 
Sbjct  181   PQLAALVLDYNKQ-SHGKPIKLKAIALGNPLLDLRLSVEGATFLWSHGVISDETLKLKET  239

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLAT  947
             VCN +    E +  ++S+ C+ +     EE+G+  D  +++   C S + +       A 
Sbjct  240   VCNDSRHWTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPYCFSGTAAMQSASSSAW  299

Query  948   ET-----------ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTS--DVI  1088
             +             DPCL D++  Y+N P VQKALHANTT     W F S G  S  DV 
Sbjct  300   DAYHAKLARRMVLTDPCLGDYIFSYLNNPQVQKALHANTTKLPSVWQFCS-GLLSYHDV-  357

Query  1089  LHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPW  1268
               +  IDI P LSAL+   + VL++SGDQD +IP++ TR +A ++A  LK T+L    PW
Sbjct  358   --DIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRIIANMIARELKFTSLGKYAPW  415

Query  1269  YDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             Y+ K++GGW+++FG S  G+   +LTFATVRG +H VP +SP +ALTLFKAFLKGS  P 
Sbjct  416   YNKKQVGGWTESFGRSRKGKNATHLTFATVRGAAHEVPYTSPEQALTLFKAFLKGSSLPK  475

Query  1449  T  1451
              
Sbjct  476   V  476



>ref|XP_010068798.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   424 bits (1089),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 228/482 (47%), Positives = 306/482 (63%), Gaps = 21/482 (4%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSI--SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             M+   + ++VN +  +  S     E+I  LPGQP  V F Q+SGYIVT   RG ALFYYF
Sbjct  1     MMIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYF  60

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA + D  S PLTLW  GG  CSS   G F E+GPFRP  DG L KN+FSWN  SNMLY
Sbjct  61    VEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLY  120

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             V++PIGV FSYSNT+SDY  W+D  TAR N++FL  W+ E+ EYRD D Y++G+SY GH 
Sbjct  121   VESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSGESYAGHY  180

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQK  764
              PQLAAL+L+ N+  +H +PIKLK IALGNP+L+ ++S+     LW HG+IS+E   +++
Sbjct  181   VPQLAALVLDYNKQ-SHGKPIKLKAIALGNPLLDLRLSVEGATFLWSHGVISDETLKLKE  239

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLA  944
              VCN +    E +  ++S+ C+ +     EE+G+  D  +++   C S + +       A
Sbjct  240   TVCNDSRHWTELIHHKISKECAGVLERQMEELGNFTDPGDVLAPYCFSGTAAMQSASSSA  299

Query  945   TET-----------ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTS--DV  1085
              +             DPCL D++  Y+N P VQKALHANTT     W F S G  S  DV
Sbjct  300   WDAYHAKLARRMVLTDPCLGDYIFSYLNNPQVQKALHANTTKLPSVWQFCS-GLLSYHDV  358

Query  1086  ILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGP  1265
                +  IDI P LSAL+   + VL++SGDQD +IP++ TR +A ++A  LK T+L    P
Sbjct  359   ---DIGIDITPLLSALIKKHLRVLLFSGDQDSKIPLTQTRIIANMIARELKFTSLGKYAP  415

Query  1266  WYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             WY+ K++GGW+++FG S  G+   +LTFATVRG +H VP +SP +ALTLFKAFLKGS  P
Sbjct  416   WYNKKQVGGWTESFGRSRKGKNATHLTFATVRGAAHEVPYTSPEQALTLFKAFLKGSSLP  475

Query  1446  NT  1451
               
Sbjct  476   KV  477



>gb|KHG07552.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=476

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 224/455 (49%), Positives = 292/455 (64%), Gaps = 16/455 (4%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             E+I +LPGQP++V F QYSGYI+     GRALFYYF EA S +  + PLTLWL GG  CS
Sbjct  21    EVIKALPGQPANVGFKQYSGYILVQPQHGRALFYYFVEADSANPLANPLTLWLNGGPGCS  80

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S   G F E+GPF+P EDG LVKNQ+SWNL SNMLY+++PIGV FSYSNTSSDY   +D 
Sbjct  81    SLGFGAFMEHGPFQPREDGHLVKNQYSWNLESNMLYLESPIGVGFSYSNTSSDYLGLNDA  140

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLK  659
              TA++N++FL  WF EF +YR+ D Y++G+SY GH  PQLA LIL+ N+  +  RPIKLK
Sbjct  141   TTAKDNMQFLLNWFEEFPQYRNSDLYLSGESYAGHYIPQLADLILDYNKRFSG-RPIKLK  199

Query  660   GIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
              IALGNP+L+  +S+ N E LW HG+IS+E   + K VCNA+  + E +   LS+ C  +
Sbjct  200   AIALGNPLLDPDISVINAEFLWSHGVISDETLLLSKTVCNASRHLKESIHQNLSKECIHV  259

Query  837   EIMLSEEIGHDMDKENLV----FqscesssisssqqH-----YLATETA---DPCLRDWV  980
                L EE+G   D  +L+    F             H      LA  +A   DPC  D +
Sbjct  260   LNKLEEEMGSYTDPGDLILPICFSPTLLGQTFFQGTHNRLHWKLAMSSAVATDPCRVDEI  319

Query  981   GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  1160
              +Y+N P VQ+ALHANTT     W F   G        +  I+I+P LS LL   IPVL+
Sbjct  320   RQYLNTPKVQEALHANTTHLSSVWEFC--GGHLSYQRESIGINIIPLLSKLLKRSIPVLL  377

Query  1161  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVAN  1340
             ++GDQD +IP++ TR +A +LA  LKL       PWYD K++GGW+Q+FG    G+ +  
Sbjct  378   FNGDQDSKIPLTQTRIIANMLAKELKLVPFGSYAPWYDKKQVGGWTQSFGKVRRGQNLTF  437

Query  1341  LTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             LTFATVRG +H VP +SP +ALTLF+AFL+ S  P
Sbjct  438   LTFATVRGAAHEVPYTSPFQALTLFQAFLRRSLLP  472



>ref|XP_007046207.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY02039.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=478

 Score =   416 bits (1068),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 221/466 (47%), Positives = 301/466 (65%), Gaps = 22/466 (5%)
 Frame = +3

Query  108   RINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGG  287
             + + E+I  LP QP++V F QYSGYIVT    GRALFYYF E  + D    PLTLWL GG
Sbjct  14    KASAELITRLPSQPANVGFKQYSGYIVTDAKHGRALFYYFVEVDAADPLLHPLTLWLNGG  73

Query  288   HDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKI  467
               CSS   G F E+GPF+P EDG LVKNQ+SWNL SNMLYV++PIGV FSYSNTSSDY  
Sbjct  74    PGCSSLGYGAFMEHGPFQPGEDGFLVKNQYSWNLESNMLYVESPIGVGFSYSNTSSDYIG  133

Query  468   WSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRP  647
              +DT TA ENL+FL  WF EF +YR+ D Y+ G+SY GH  PQLAAL+L+ N++ ++ +P
Sbjct  134   VNDTFTAEENLQFLVNWFKEFPQYRNSDLYLTGESYAGHYIPQLAALVLDYNKH-SNGKP  192

Query  648   IKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEY  824
             I+LK +ALGNP+L+ ++S+ N E  W HG+IS+E+  ++K VC+      E L   LS+ 
Sbjct  193   IRLKAVALGNPLLDWEISIDNTEFFWSHGLISDEMLMLRKTVCSRPRDAIESLHNNLSKE  252

Query  825   CSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLATET------------ADPCL  968
             C+D+      EIG      ++    C S S+     +    +T             DPC+
Sbjct  253   CTDVIHKQRAEIGSYTQYGDVTLPICTSRSLFGQTVYLRNFDTLDAELPMRSVIPGDPCI  312

Query  969   RDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH--NFAIDILPTLSALLMS  1142
              D + +Y+N+P+VQ+ALHANTT   Y W F +    +D++    N   +I+P L  LL S
Sbjct  313   EDRIHKYLNKPEVQEALHANTTHLPYRWEFCT---GTDLVYERKNLETNIIPLLLNLLRS  369

Query  1143  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNG---PWYDGKEIGGWSQTFGN  1313
              IP+L+Y+GDQD +IP++ TR +A +LA  + L      G   PW+D  ++GGW+Q+FG 
Sbjct  370   GIPILLYNGDQDAKIPLTQTRIIANMLAKEMNLVPFGNFGNYAPWFDNMQVGGWTQSFGQ  429

Query  1314  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             +  G+ +  LT+ATVRGG+H VP +SPS  LTLF+AF+KGSP P T
Sbjct  430   AKEGKNITFLTYATVRGGAHEVPYTSPSPGLTLFRAFVKGSPLPRT  475



>ref|XP_006482671.1| PREDICTED: serine carboxypeptidase-like 44-like [Citrus sinensis]
Length=552

 Score =   416 bits (1070),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 209/446 (47%), Positives = 300/446 (67%), Gaps = 16/446 (4%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             E+I +LPGQP++V   QYSGYI+T    GRALFYYF EAQS +  S+PLTLWL GG  CS
Sbjct  19    ELISALPGQPNNVPVKQYSGYILTDANHGRALFYYFVEAQSTNPLSLPLTLWLNGGPGCS  78

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S   G F E+GPF+P E+G+L+KN++SWNLASNMLYV++PIGV FSYSNTSSDY +W+D+
Sbjct  79    SLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVESPIGVGFSYSNTSSDYNLWNDS  138

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLK  659
              TA +NL+F+  W  EF +Y+D +F++ G+SY GH  PQLA LIL+ N+ P +++PIKLK
Sbjct  139   NTAGDNLRFIVNWLEEFPQYKDSEFFLTGESYAGHYVPQLATLILQYNKQP-NVKPIKLK  197

Query  660   GIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
              IALGNP+L+  +S+   + +W HG IS+E   ++K VCN +T + E ++ + S+ C+D+
Sbjct  198   SIALGNPLLDLDISVLTGDFMWSHGAISDETLMLEKTVCNGSTYLRELVNNQESKGCNDV  257

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHYLA-----------TETADPCLRDWVG  983
                ++EE G D+D  +L+  SC +S+ +   + +               + DPC+ D + 
Sbjct  258   FNRVNEEFG-DIDSGDLLLPSCLTSTSAQQFKLFGKHGKMPNMMVNFGASGDPCIGDRIF  316

Query  984   EYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIY  1163
              Y+N P VQ+ALHANTT   +PW F   G   D    +F ++I+P ++ L+M  +P+L++
Sbjct  317   TYLNSPQVQEALHANTTHLPFPWEFC--GGPLDYQYKDFELNIIPQIADLIMEGVPILLF  374

Query  1164  SGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANL  1343
             SGDQD +IP++ TR +A  LA  LKL        WYD +++GGWSQ+FG    G+ +  L
Sbjct  375   SGDQDTKIPLTQTRIIAKNLANDLKLFPTTNYANWYDKQQVGGWSQSFGAFRDGKNITYL  434

Query  1344  TFATVRGGSHFVPNSSPSKALTLFKA  1421
             T+ATVRG +H VP ++PS ALT    
Sbjct  435   TYATVRGAAHEVPYTTPSPALTFLSG  460



>ref|XP_010322533.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Solanum 
lycopersicum]
Length=447

 Score =   407 bits (1047),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 218/465 (47%), Positives = 298/465 (64%), Gaps = 53/465 (11%)
 Frame = +3

Query  93    YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTL  272
             Y +  + + E+I SLPGQP ++ F QYSGYIVT+   GRALFYYF EA SE+  S+PLT+
Sbjct  13    YLLFYKSSCELITSLPGQPPNIFFKQYSGYIVTNSQHGRALFYYFVEADSENAASLPLTI  72

Query  273   WLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTS  452
             WL G                                    SNMLYVD+PIGV FSYSNTS
Sbjct  73    WLNG-----------------------------------ESNMLYVDSPIGVGFSYSNTS  97

Query  453   SDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNP  632
             SD   W DT TA+ENL+F+ KWF +F +YR+ D Y+ G+SY GH  PQ A L+L+ NR P
Sbjct  98    SDNINWDDTATAKENLQFILKWFKKFPQYRNSDVYLTGESYAGHYIPQFAVLLLDYNRTP  157

Query  633   AHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG  809
              +++PIKLK IALGNP+L+ ++S+ + E+LW HG+IS+E+  M K +CN T  + EF+  
Sbjct  158   -NVKPIKLKSIALGNPLLDIEISVKSAEYLWAHGVISDELLDMHKTICNETRYVMEFVHN  216

Query  810   ELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHY--LAT----------ET  953
             E S  C+ +  + +EE+G+D+ K +++   C SSS +   +    L T          + 
Sbjct  217   ETSNECAKVIELRTEEMGNDIVKYDVLLPKCVSSSAAGRLKALGNLTTVHGKFDKKVGKV  276

Query  954   ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTS-PGKTSDVILHNFAIDILPTLSA  1130
             ADPCL +W+  Y+N+P+VQKALHANTT   Y W   S P +     + + AIDI+P LS 
Sbjct  277   ADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCSGPLQYK---MEDAAIDIIPLLSN  333

Query  1131  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  1310
             +L   IP+L++SGDQD  +P++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ++G
Sbjct  334   ILKQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYG  393

Query  1311  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                 G+ +  LTFATVRG +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  394   GVREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  438



>ref|XP_006838780.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
 gb|ERN01349.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
Length=478

 Score =   402 bits (1032),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 292/458 (64%), Gaps = 22/458 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             ++I  LPGQP +  FNQYSGYIVT    GRALFYYF EA +  + S PLTLWL GG  CS
Sbjct  29    DLIKRLPGQPPNPSFNQYSGYIVTDTHHGRALFYYFVEADTHHRASRPLTLWLNGGPGCS  88

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  IG   E+GP+   ++  LV N++SWNLASNMLYV++PIGV FSYSNTSSDY  W+DT
Sbjct  89    SLGIGALMEHGPYLVHDNSSLVNNKYSWNLASNMLYVESPIGVGFSYSNTSSDYINWNDT  148

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLK  659
              TA +NL+FL  WF +F  YR  D Y+ G+SY GH  PQLAAL++  N+       IKLK
Sbjct  149   KTAEDNLRFLINWFEKFPAYRGSDLYLTGESYAGHYIPQLAALLMAYNKKHT-TGAIKLK  207

Query  660   GIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
              IALGNP ++  +S+++ E+LW HG+IS++ + ++K +CN ++ +  F  GE SE C   
Sbjct  208   AIALGNPFVDMDISVNSGEYLWAHGLISDQTFELEKTLCNDSSYMRAFYRGEYSEPCIYT  267

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqq------------HYLATETADPCLRDWV  980
               M++EE+G ++D+ +++   C +S  S                      + D C  + +
Sbjct  268   FKMVAEEMGVNVDEGDILLPKCLTSVPSMQAVSRGLNGKIHAKISLSRMGSGDLCSWERI  327

Query  981   GEYINRPDVQKALHANTTGWQYPWNFTS-PGKTSDVILHNFAIDILPTLSALLMSDIPVL  1157
              +Y+NR DVQ+A HAN TG  Y W+  S P    D    N  IDI P + +LL  DIP+ 
Sbjct  328   FKYLNRADVQRAFHANATGLPYNWDSCSGPLVYQD---DNSEIDIRPLILSLLKEDIPIF  384

Query  1158  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVA  1337
             +YSGDQD +IP++ TR +A  LA RLKL+ +    PWYD K++GGW Q FG    G +  
Sbjct  385   LYSGDQDSKIPLTQTRIIANQLAKRLKLSPITKYAPWYDKKQVGGWVQAFGR---GNRTL  441

Query  1338  NLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
              LTFATVRG +H VP +SPS+ALTLF+AF+ GSP P +
Sbjct  442   -LTFATVRGAAHEVPFTSPSQALTLFRAFITGSPLPTS  478



>ref|XP_007099702.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY20317.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=475

 Score =   394 bits (1011),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 209/456 (46%), Positives = 290/456 (64%), Gaps = 17/456 (4%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
              E+I  LPGQ  +V FNQYSGYIVT    GRALFYYF EA S      PLTLWL GG  C
Sbjct  19    AELIHFLPGQHKNVSFNQYSGYIVTDARHGRALFYYFVEADSNTDELKPLTLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F E+GPF+P EDG L+KN++SWNL SNMLYV++PIGV FSYSNTS +Y +W+D
Sbjct  79    SSLGFGAFMEHGPFQPGEDGTLIKNEYSWNLESNMLYVESPIGVGFSYSNTSKNY-LWND  137

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
             T TA++NL F+  W  EF +Y++ DF++AG+SY GH  PQLAAL++E N+ P ++ P+ L
Sbjct  138   TQTAQDNLMFILNWLEEFPQYKESDFFLAGESYAGHYIPQLAALLVEHNKKP-NIEPVNL  196

Query  657   KGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             K IALGNP+L+  +S+   + LW HG IS+E   ++K VCN +  + E++  + SE C+D
Sbjct  197   KAIALGNPLLDLDISVLAGDFLWSHGAISDETLFLEKTVCNDSKYLREYVHDKWSEGCND  256

Query  834   IEIMLSEEIGHDMDKENLV--------FqscesssisssqqHYLATETA---DPCLRDWV  980
             +   + +E+G D+  ++L+        +           + H    + A   DPCL   +
Sbjct  257   VFNRVEDEVGVDVGLDDLLLPTCLSSSYAEQLKLKGKLGKIHSAVAKRAKKGDPCLEGRI  316

Query  981   GEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLI  1160
               Y+NR +VQKALH +TT     W F            N  ++++P +S L+   IPVL+
Sbjct  317   LTYLNRREVQKALHVSTTHHPSHWAFCEGPLVYQE--DNLDMNLIPLVSDLIKEAIPVLL  374

Query  1161  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVAN  1340
             Y+GDQD +IP++ TR +A  +A  LKL  L   G WYD K++GGW+++FG +   +  A 
Sbjct  375   YNGDQDAKIPLTQTRIIANNIAKDLKLVPLTEYGTWYDNKQVGGWTKSFGATEDRKNYAT  434

Query  1341  -LTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              LTFATVRG +H VP +S S+ALTLF +F+ G P P
Sbjct  435   YLTFATVRGAAHEVPFTSHSQALTLFHSFVNGIPLP  470



>ref|XP_010322561.1| PREDICTED: serine carboxypeptidase-like 46 isoform X3 [Solanum 
lycopersicum]
Length=394

 Score =   385 bits (988),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 195/387 (50%), Positives = 268/387 (69%), Gaps = 16/387 (4%)
 Frame = +3

Query  324   ENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLK  503
             E+GPF+P +DG L+KN FSWNL SNMLYVD+PIGV FSYSNTSSD   W DT TA+ENL+
Sbjct  2     EHGPFQPGKDGRLIKNNFSWNLESNMLYVDSPIGVGFSYSNTSSDNINWDDTATAKENLQ  61

Query  504   FLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALGNPI  683
             F+ KWF +F +YR+ D Y+ G+SY GH  PQ A L+L+ NR P +++PIKLK IALGNP+
Sbjct  62    FILKWFKKFPQYRNSDVYLTGESYAGHYIPQFAVLLLDYNRTP-NVKPIKLKSIALGNPL  120

Query  684   LE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEI  860
             L+ ++S+ + E+LW HG+IS+E+  M K +CN T  + EF+  E S  C+ +  + +EE+
Sbjct  121   LDIEISVKSAEYLWAHGVISDELLDMHKTICNETRYVMEFVHNETSNECAKVIELRTEEM  180

Query  861   GHDMDKENLVFqscesssisssqqHY--LAT----------ETADPCLRDWVGEYINRPD  1004
             G+D+ K +++   C SSS +   +    L T          + ADPCL +W+  Y+N+P+
Sbjct  181   GNDIVKYDVLLPKCVSSSAAGRLKALGNLTTVHGKFDKKVGKVADPCLNEWINLYLNKPE  240

Query  1005  VQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLR  1184
             VQKALHANTT   Y W   S        + + AIDI+P LS +L   IP+L++SGDQD  
Sbjct  241   VQKALHANTTYLPYSWEVCS--GPLQYKMEDAAIDIIPLLSNILKQHIPILLFSGDQDSV  298

Query  1185  IPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRG  1364
             +P++ TR++A +LA  LKL  L+  GPWYDG +IGGWSQ++G    G+ +  LTFATVRG
Sbjct  299   LPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGGWSQSYGGVREGKNITYLTFATVRG  358

Query  1365  GSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              +H VP +SPS+ALTLF+AFL+G PPP
Sbjct  359   AAHEVPYTSPSQALTLFRAFLRGYPPP  385



>ref|XP_006829355.1| hypothetical protein AMTR_s02986p00003470, partial [Amborella 
trichopoda]
 gb|ERM96771.1| hypothetical protein AMTR_s02986p00003470, partial [Amborella 
trichopoda]
Length=442

 Score =   365 bits (936),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 190/425 (45%), Positives = 270/425 (64%), Gaps = 33/425 (8%)
 Frame = +3

Query  105   IRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGG  284
             I  N ++I  LPGQP +  F QYSGY++T    GRALFYYF EA + D  S PLTLWL G
Sbjct  19    IPFNSDLITQLPGQPPNSSFKQYSGYVLTDTNHGRALFYYFVEADAHDSISRPLTLWLNG  78

Query  285   GHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYK  464
             G  CSS   G F E+GPF+P ++  L+ N++SWNL SN+LYV++PIGV FSYSNTSSDY 
Sbjct  79    GPGCSSLGFGAFMEHGPFQPGDNFTLIHNKYSWNLESNVLYVESPIGVGFSYSNTSSDYI  138

Query  465   IWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLR  644
              W+DT TA++NL+FL  WF +F  YRD D Y+ G+SY GH  PQLA L+++ N+ P ++R
Sbjct  139   HWNDTTTAKDNLRFLINWFEKFPAYRDSDLYLTGESYAGHYIPQLATLLVDYNKQP-NIR  197

Query  645   PIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSE  821
             PIKLK IALGNP+L+  +S+++ + LW HG+IS+    +QK VCN +T +  ++  + S+
Sbjct  198   PIKLKAIALGNPLLDLDISVNSEDFLWAHGVISDSALKLQKTVCNISTYLRFYVHDQYSQ  257

Query  822   YCSDIEIMLSEEIGHDMDKENLVFqscesssis------------ssqqHYLATETADPC  965
              C+D+  ++++E+G D D+ +++   C S+  S               +  L+  + DPC
Sbjct  258   ACNDVFNIVNDELGPDTDRGDILLPICLSNGSSLQGVFPKGIHGKIQAKRSLSIRSGDPC  317

Query  966   LRDWVGEYINRPDVQKALHANTTGWQYPWNFTS-----------PG------KTSDVILH  1094
             L D V  Y+N+P+VQKALHAN T   + W+F S           PG      K   ++  
Sbjct  318   LGDRVFAYLNKPEVQKALHANITHLPFHWDFCSGSLSLSYKKSLPGELIFLSKFRPLVYQ  377

Query  1095  --NFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPW  1268
               N  +D++P +  LL  +IPVL+YSGDQD +IP++ TR +A  LA  LKL ++    PW
Sbjct  378   EDNLDMDVMPLMVHLLNENIPVLLYSGDQDAKIPLTQTRIIANQLANTLKLFSITKYAPW  437

Query  1269  YDGKE  1283
             YD K+
Sbjct  438   YDKKQ  442



>ref|XP_007162064.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
 gb|ESW34058.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
Length=459

 Score =   363 bits (931),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/474 (42%), Positives = 279/474 (59%), Gaps = 31/474 (7%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  +  +LV TL S+S     + I SLPGQP  V F QYSGYI       RALFYYF E
Sbjct  8     MIATIIIVLVQTLVSVSSLPEADKISSLPGQP-HVKFQQYSGYITVDDQHQRALFYYFVE  66

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             AQ +D  S P+ LWL GG  CSS  +G   E+GPF+P +   LVKN +SWN  +N+LY++
Sbjct  67    AQ-KDPTSKPVVLWLNGGPGCSSIGVGALIEHGPFKPRDSNVLVKNHYSWNKVANVLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+ +S Y + +D +TAR+NL FL++WFIEF EY + DF+I G+SY GH AP
Sbjct  126   SPAGVGFSYSSNTSFYTLVTDEITARDNLVFLQRWFIEFPEYSNNDFFITGESYAGHYAP  185

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSL-SNVEHLWYHGIISEEVYGMQKK  767
             QLA LI++   N      I LKGIA+GNP++E    L S  E LW HG+IS+  YG+  +
Sbjct  186   QLAQLIVQTKTN------INLKGIAIGNPLMEFDTDLNSKAEFLWSHGLISDSTYGLFTR  239

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYL  941
             VCN +T+  + +SG LSE C +I  ++  E+ + +D+ ++        ++  +       
Sbjct  240   VCNYSTIRRQMISGNLSEICDNINTLVFTELSNYIDQYDVTLDVCLSSANQQAYVLNQMQ  299

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAID  1109
               +  D C+ D    Y+NR DVQKALHA   G        S   T   +LH    N  I 
Sbjct  300   KIQKIDVCVDDKAVNYLNRKDVQKALHAKLVG-------VSKWLTCSRVLHYDRTNLEIP  352

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              +  L +L+ S I VL+YSGDQD  IP+  +R +   LA  L L T      W++GK++G
Sbjct  353   TISILGSLVNSKIRVLVYSGDQDSVIPLMGSRSLVNGLAKELGLNTTVAYRAWFEGKQVG  412

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             GW+Q +G+         L++AT+RG SH  P + P ++L L KAFL+G P P+ 
Sbjct  413   GWTQVYGDI--------LSYATIRGASHEAPFNQPRRSLGLLKAFLEGKPLPDV  458



>ref|XP_003531913.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   353 bits (907),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 193/445 (43%), Positives = 263/445 (59%), Gaps = 21/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F+Q+SGY+       RALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP   G LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+  +D +T
Sbjct  90    GVGAFSENGPFRPKGKG-LVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYEGVNDKIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WFI+F EYR+   +I G+SY GH  PQLA L+L+ N+     +   LKGI
Sbjct  149   ARDNLVFLQSWFIKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  205

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +T + E+ +G +S  CS + 
Sbjct  206   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPICSSVM  265

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++          S +        TET D C+ D    Y+NR DVQ 
Sbjct  266   SQVTTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  325

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             A+HA+  G Q    +++     D  L +  I  +  +  L+   IPVL+YSGDQD  IP+
Sbjct  326   AMHAHLVGVQ---RWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQDSVIPL  382

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA  L L T      W++ +++GGW+Q +GN         L+FAT+RG SH
Sbjct  383   TGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI--------LSFATIRGASH  434

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPN  1448
               P S P ++L LFK+FL+G P P 
Sbjct  435   EAPFSQPERSLVLFKSFLEGGPLPQ  459



>ref|XP_004492026.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 270/462 (58%), Gaps = 22/462 (5%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             FLL    + +S+     II  LPGQP +V+FN +SGY+       +ALF+YF EAQ +D 
Sbjct  16    FLLQLRSFGVSLSHPYRIIH-LPGQP-NVEFNHFSGYVNVDDKNNKALFFYFVEAQ-QDS  72

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP  +G LV+NQFSWN  +NMLY+++PIGV 
Sbjct  73    VSKPLVLWLNGGPGCSSIGVGAFSENGPFRPKGEG-LVRNQFSWNTEANMLYLESPIGVG  131

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYS  +S Y   +D +TAR+NL FL+ WF++F +YR+   +I G+SY GH  PQLA L+
Sbjct  132   FSYSTDTSSYGGVNDKITARDNLIFLQNWFVQFPQYRNRSLFIVGESYAGHYVPQLAELM  191

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATT  785
             L+ N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y M   VCN + 
Sbjct  192   LQFNKKE---KLFNLKGIALGNPVLEFSADFNSRAEFFWSHGLISDLTYKMFTSVCNYSR  248

Query  786   MIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETAD  959
              + E+ +G +S  CS +   +S E    +DK ++          S +        TET D
Sbjct  249   YVREYYNGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTKILNPKQVTETID  308

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
              C+ D    Y+NR DVQ ALHA   G Q    +T      D  LH+  I  +  +  L+ 
Sbjct  309   VCVEDETVNYLNRKDVQSALHARLVGVQ---RWTPCSNVLDYDLHDLEIPTITVVGKLVK  365

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             + IPVL+YSGDQD  IP++ +R +   LA  L++ T      W+  +++GGW+Q +GN  
Sbjct  366   AGIPVLVYSGDQDSVIPLTGSRTLVHQLAKELRMNTTVPYRVWFQKQQVGGWTQVYGNI-  424

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                    L+FATVRG SH  P S P ++L LFK+FL+G P P
Sbjct  425   -------LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  459



>ref|XP_003551804.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   352 bits (903),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 194/445 (44%), Positives = 262/445 (59%), Gaps = 21/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F+Q+SGY+       RALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +G LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+  +D +T
Sbjct  90    GVGAFSENGPFRPKGEG-LVRNQFSWNKEANMLYLETPIGVGFSYSTDTSSYEGVNDKIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A +NL FL+ WF++F EYR+   +I G+SY GH  PQLA L+L  NR     +   LKGI
Sbjct  149   AGDNLVFLQNWFMKFPEYRNRSLFIVGESYAGHYVPQLAELMLRFNRKE---KLFNLKGI  205

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +T + E+ +G +S  CS + 
Sbjct  206   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPICSSVM  265

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++          S +        TET D C+ D    Y+NR DVQ 
Sbjct  266   SQVSTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  325

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA+  G Q    +++     D  L +  I  +  +  L+   IPVL+YSGDQD  IP+
Sbjct  326   ALHAHLVGVQ---RWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQDSVIPL  382

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA  L L T      W++ +++GGW+Q +GN         L+FAT+RG SH
Sbjct  383   TGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI--------LSFATIRGASH  434

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPN  1448
               P S P ++L LFK+FL+G P P 
Sbjct  435   EAPFSQPERSLVLFKSFLEGGPLPQ  459



>ref|XP_009143848.1| PREDICTED: serine carboxypeptidase-like 46 [Brassica rapa]
 emb|CDY17183.1| BnaA05g10050D [Brassica napus]
Length=462

 Score =   351 bits (901),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 201/468 (43%), Positives = 274/468 (59%), Gaps = 21/468 (4%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             MV  L  L   TL S ++    + I SLPGQP  V F QYSGY+   + + RALFYY AE
Sbjct  9     MVTCLILLQALTLVSSTVMSRADRITSLPGQP-KVVFQQYSGYVSIDEKKQRALFYYLAE  67

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+++   S PL LWL GG  CSS  +G F ENGPFRP +   LV+NQ SWN  +NMLY++
Sbjct  68    AETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHEANMLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP+GV FSY+  SS Y+  +D +TA++NL FL+KWF  F +Y +   +I G+SY GH  P
Sbjct  126   TPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITGESYAGHYVP  185

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA L+++ N+   HL    LKGIALGNP+LE  +   S  E+ W HG+IS+  Y M   
Sbjct  186   QLAQLMIQYNKK-HHL--FNLKGIALGNPVLEFSTDFNSRAEYFWSHGLISDPTYKMFTS  242

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYL  941
              CN +  + E+  GE+S  CS +   +S E    +DK ++    C     S S       
Sbjct  243   YCNYSRFVSEYYRGEVSSMCSKVMSQVSTETSRFVDKYDVTLDLCIPSVLSQSKVVSPQQ  302

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  1121
               ET D C+ D    Y+NR DVQKALHA   G +  W   S     D  L +  +  +  
Sbjct  303   VGETVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWAVCS--NVLDYELLDVEVPTINV  359

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             + +L+ + +PVL+YSGDQD  IP++ +R +   LA +L L+T      W+ G+++GGW+Q
Sbjct  360   VGSLIKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAQQLGLSTTVPYRVWFAGQQVGGWTQ  419

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              +GN         L FATVRG +H VP S P ++L LFKAFL G+P P
Sbjct  420   VYGNV--------LAFATVRGAAHEVPFSQPERSLVLFKAFLGGNPLP  459



>gb|KDP23272.1| hypothetical protein JCGZ_23105 [Jatropha curcas]
Length=463

 Score =   351 bits (901),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 197/445 (44%), Positives = 266/445 (60%), Gaps = 23/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY++      RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  34    ITQLPGQP-QVGFQQYSGYVIVDNKEQRALFYYFAEAET-DPASKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LVKNQ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  92    GVGAFSENGPFRPS--GEVLVKNQHSWNREANMLYLETPIGVGFSYSTDTSSYETVNDKI  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+KWFI+F +YR+   +I+G+SY GH  PQLA L+LE N+     +   LKG
Sbjct  150   TARDNLVFLQKWFIKFPQYRNRSLFISGESYAGHYVPQLAELMLEFNKKH---KLFNLKG  206

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+L+  +   S  E  W HG+IS+  Y M   VCN +  ++E+  G +S  CS +
Sbjct  207   IALGNPVLDFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSRYVNEYYRGSVSPICSRV  266

Query  837   EIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                +S E    +DK ++          + S++       +  D C+ D    Y+NR DVQ
Sbjct  267   MGQVSRETSRFVDKYDVTLDVCISSVLAQSNALSPKQVGDNIDVCVEDETVNYLNRQDVQ  326

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +    +T      D  L +  I  +  +  L+ + IPVL+YSGDQD  IP
Sbjct  327   KALHARLVGVR---RWTVCSNILDYELLDLEIPTIAIVGRLIRAGIPVLVYSGDQDSVIP  383

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA +L L T      W+ G+++GGW+Q +GN         L+FAT+RG S
Sbjct  384   LTGSRTLVRGLAEKLGLKTSVPYRVWFGGQQVGGWTQVYGNI--------LSFATIRGAS  435

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFKAFL+G P P
Sbjct  436   HEAPFSQPERSLVLFKAFLEGRPLP  460



>ref|XP_009378815.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   351 bits (900),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 204/448 (46%), Positives = 268/448 (60%), Gaps = 27/448 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+     + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  35    ITGLPGQPP-VGFQQYSGYVTVDAKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  93    GVGAFSENGPFRP--KGEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVADHI  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+KWF +F +YR+   YI G+SY GH  PQLA L+L+   +  H     LKG
Sbjct  151   TARDNLLFLQKWFEKFPQYRNRSLYITGESYAGHFVPQLAELMLQFKEH--HF---NLKG  205

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G +S  CS +
Sbjct  206   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYKMFSSVCNYSRFVSEYYRGSVSPICSRV  265

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADP---CLRDWVGEYINRPDV  1007
                +S E    +DK ++    C SS  S S+   L  + AD    C+ D V  Y+NRPDV
Sbjct  266   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKA-LLPQQVADSIDVCVEDEVVNYLNRPDV  324

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRI  1187
             QKALHA   G +  W   S     D  + +  I  +  +  L+ + IPVL+YSGDQD  I
Sbjct  325   QKALHARLVGVR-QWAVCS--NILDYQVLDVEIPTITIVGKLIKAGIPVLVYSGDQDSVI  381

Query  1188  PVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGG  1367
             P++ +R +   LA +L+L T      W++G+++GGW+Q +GN         L+FATVRG 
Sbjct  382   PLTGSRTLVHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATVRGA  433

Query  1368  SHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             SH  P S P ++L LFK+FLKG P P  
Sbjct  434   SHEAPFSQPERSLVLFKSFLKGRPLPEV  461



>ref|XP_010044871.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW86989.1| hypothetical protein EUGRSUZ_B03549 [Eucalyptus grandis]
Length=473

 Score =   351 bits (900),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 193/444 (43%), Positives = 263/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  44    IPRLPGQPP-VGFRQYSGYVTVDEKQQRALFYYFAEAEL-DPASKPLVLWLNGGPGCSSL  101

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ D  LV+N++SWN  +NMLY++ PIGV FSYS  +S Y+  +D +T
Sbjct  102   GVGAFSENGPFRPSGDA-LVRNEYSWNREANMLYLEAPIGVGFSYSTDTSSYEAVNDKIT  160

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WF++F +Y++ + +I G+SY GH  PQLA L+L+ NR     +   LKGI
Sbjct  161   ARDNLVFLQGWFVKFPQYKNSNLFITGESYAGHYVPQLAELMLQINRKE---KMFNLKGI  217

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y M   +CN +  + E+  G +S  CS + 
Sbjct  218   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSICNYSRYVREYAEGSVSPICSRVM  277

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +++E    +D  ++          S S        T+T D C+ D    Y+NR DVQK
Sbjct  278   SQVNKETSKFVDNYDVTLDVCIASVMSQSRRLSPQQVTDTIDVCVEDETVNYLNRQDVQK  337

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D  L N  I  +  L  L+ + IPVL+YSGDQD  IP+
Sbjct  338   ALHARLVGVR-KWAVCS--DVLDYDLTNLEIPTITILGKLIKAGIPVLVYSGDQDSVIPL  394

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA +L L T      W+ G+++GGW+Q +GN         L+FAT+RG SH
Sbjct  395   TGSRRLVHGLAEKLGLNTTIPYRVWFQGQQVGGWTQVYGNV--------LSFATIRGASH  446

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
               P S P ++L LFK+FL+G P P
Sbjct  447   EAPFSQPQRSLVLFKSFLQGQPLP  470



>ref|XP_007139316.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
 gb|ESW11310.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
Length=461

 Score =   350 bits (899),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 191/445 (43%), Positives = 262/445 (59%), Gaps = 21/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F Q+SGY+       +ALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITHLPGQP-QVEFQQFSGYVTVDDRNQQALFFYFAEAE-KDAASKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +  LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+  +D +T
Sbjct  90    GVGAFSENGPFRPKGEA-LVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYEGVNDEIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WFI+F EYR+   +I G+SY GH  PQLA L+L+ N+     +   LKGI
Sbjct  149   ARDNLVFLKNWFIKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  205

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y +   VCN +  + E+ +G +S  CS + 
Sbjct  206   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKVFTSVCNYSRYVREYYNGAVSPVCSSVM  265

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++          S +        TET D C+ D    Y+NR DVQ 
Sbjct  266   SQVSTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  325

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G Q    +++     D  L +  I  +  +  L+   IPVL+YSGDQD  IP+
Sbjct  326   ALHARLVGVQ---RWSACSNVLDYELRDLEIPTITVVGKLVQEGIPVLVYSGDQDSVIPL  382

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA +L L T      W++ +++GGW+Q +G+         L+FAT+RG SH
Sbjct  383   TGSRTLVHKLAKKLGLKTTVPYRVWFEKQQVGGWTQVYGDI--------LSFATIRGASH  434

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPN  1448
               P S P +AL LFK+FL+G P P 
Sbjct  435   EAPFSQPERALVLFKSFLEGRPMPQ  459



>ref|XP_002268172.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI35664.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   350 bits (899),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 196/455 (43%), Positives = 268/455 (59%), Gaps = 24/455 (5%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             S+ ++ +I++ LPGQP  V F QYSGY+   + + RALFYYFAEA+++     PL LWL 
Sbjct  27    SLSLSDKILE-LPGQP-QVGFQQYSGYVAVDEKQQRALFYYFAEAETDPAIK-PLVLWLN  83

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGEL-VKNQFSWNLASNMLYVDTPIGVAFSYSNTSSD  458
             GG  CSS  +G F ENGPFRP+  GEL V+N++SWN  +NMLY++TPIGV FSYS  SS 
Sbjct  84    GGPGCSSLGVGAFSENGPFRPS--GELLVRNEYSWNREANMLYLETPIGVGFSYSTDSSS  141

Query  459   YKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAH  638
             Y   +D +TAR+NL FL+KW ++F +Y++ D +I G+SY GH  PQLA L+L+ N+    
Sbjct  142   YAAVNDKITARDNLVFLQKWLLKFPQYKNRDLFITGESYAGHYVPQLAELMLQFNKKE--  199

Query  639   LRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGE  812
              +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y M    CN +  + E+  G 
Sbjct  200   -KLFNLKGIALGNPVLEFATDLNSRAEFFWSHGLISDSTYKMFTSFCNYSRYVSEYYRGS  258

Query  813   LSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGE  986
             +S  CS +   +  E    +DK ++          S S        TET D C+ D    
Sbjct  259   VSSICSRVMSQVGRETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTETIDVCVEDETES  318

Query  987   YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYS  1166
             Y+NR DVQKALHA   G    W+  S     D  L +  I  +  +  L+ + IPVL+YS
Sbjct  319   YLNRRDVQKALHARLVGVN-KWSVCS--NILDYELLDLEIPTISIVGKLIKAGIPVLVYS  375

Query  1167  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLT  1346
             GDQD  IP++ +R +   LA  L L T      W++GK++GGW+Q +GN         L+
Sbjct  376   GDQDSVIPLTGSRTLVHGLAEELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LS  427

Query  1347  FATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             FAT+RG SH  P S P ++L LF+AFL G P P  
Sbjct  428   FATIRGASHEAPFSQPERSLVLFRAFLGGRPLPQA  462



>ref|XP_006483005.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=464

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 196/466 (42%), Positives = 272/466 (58%), Gaps = 27/466 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L++    I +     ++D   +LPGQP  V F QYSGY+   + + RALFYYFAEA++ 
Sbjct  14    ILIHICLRIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPI  422
             D  S PL LWL GG  CSS  +G F ENGPFRP  +G+ LV+N++SWN  +NML+++TPI
Sbjct  72    DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLETPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS  +S Y+   D +TAR+NL FL+ WF++F +YR+   +I G+SY GH  PQLA
Sbjct  130   GVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGESYAGHYIPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              L+LE N+         LKGIALGNP+LE  +   S  E  W HG+IS+  Y M    CN
Sbjct  190   DLMLEFNKKEELF---NLKGIALGNPVLEFATDFNSRAEFFWSHGLISDATYTMFTSFCN  246

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLAT  947
              +  + E+  G +S  CS +  ++S E    +DK ++   V  S   S         +  
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGE  306

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  1127
              T D C+ D    Y+NR DVQKALHA   G +  W   S     D  L +  I  +  + 
Sbjct  307   TTVDVCVEDETVNYLNRKDVQKALHARLVGVR-SWAVCS--NILDYELLDLEIPTITVVG  363

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
              L+ + IPV++YSGDQD  IP++ +R++   LA  LKL T      W++G+++GGW+Q +
Sbjct  364   KLVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPYRVWFEGQQVGGWTQVY  423

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GN         L+FAT+RG SH  P S P ++L LFKAFL   P P
Sbjct  424   GNI--------LSFATIRGASHEAPFSQPERSLVLFKAFLDSRPLP  461



>gb|AES77859.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=460

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 193/444 (43%), Positives = 268/444 (60%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  VDF+Q+SGY+       +ALF+YF EA++ D  S PL LWL GG  CSS 
Sbjct  31    ITNLPGQP-HVDFHQFSGYVNVDDQNKKALFFYFVEAKN-DAVSKPLVLWLNGGPGCSSL  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +  LVKNQFSWN  +NMLY+++PIGV FSYS  +S Y+  +D +T
Sbjct  89    GVGAFSENGPFRPKGEA-LVKNQFSWNTEANMLYLESPIGVGFSYSTDTSSYEGVNDKIT  147

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WF++F EYR+   +I G+SY GH  PQLA L+L+ N+     +   LKGI
Sbjct  148   ARDNLIFLQNWFVKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  204

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  + M   VCN +  + E+ +G +S  CS + 
Sbjct  205   ALGNPVLEFATDFNSRAEFFWSHGLISDLTFKMFTSVCNYSRYVREYYNGAVSPVCSSVM  264

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++          S ++       TET D C+ D    Y+NR DVQ 
Sbjct  265   SQVSTETSRFVDKYDVTLDVCISSVFSQTNVLNPQQVTETIDVCVEDETVNYLNRKDVQS  324

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA+  G  + W+  S     D  L +  I  +  +  L+ + IPVL+YSGDQD  IP+
Sbjct  325   ALHAHLIG-VHRWSPCS--SVLDYELRDLEIPTITVVGKLVKAGIPVLVYSGDQDSVIPL  381

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA +L++ T      W+ G+++GGW+Q +GN         L+FATVRG SH
Sbjct  382   TGSRTLVHQLAKQLRMNTTVPYRVWFAGQQVGGWTQVYGNI--------LSFATVRGASH  433

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
              VP S P ++L LFK+FL+G P P
Sbjct  434   EVPFSQPERSLVLFKSFLEGRPLP  457



>gb|KDO83181.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=464

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 196/466 (42%), Positives = 272/466 (58%), Gaps = 27/466 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L++    I +     ++D   +LPGQP  V F QYSGY+   + + RALFYYFAEA++ 
Sbjct  14    ILIHICLRIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPI  422
             D  S PL LWL GG  CSS  +G F ENGPFRP  +G+ LV+N++SWN  +NML+++TPI
Sbjct  72    DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLETPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS  +S Y+   D +TAR+NL FL+ WF++F +YR+   +I G+SY GH  PQLA
Sbjct  130   GVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGESYAGHYIPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              L+LE N+         LKGIALGNP+LE  +   S  E  W HG+IS+  Y M    CN
Sbjct  190   DLMLEFNKKEELF---NLKGIALGNPVLEFATDFNSRAEFFWSHGLISDATYTMFTSFCN  246

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLAT  947
              +  + E+  G +S  CS +  ++S E    +DK ++   V  S   S         +  
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGE  306

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  1127
              T D C+ D    Y+NR DVQKALHA   G +  W   S     D  L +  I  +  + 
Sbjct  307   TTVDVCVEDETVNYLNRKDVQKALHARLVGVR-SWAVCS--NILDYELLDLEIPTITIVG  363

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
              L+ + IPV++YSGDQD  IP++ +R++   LA  LKL T      W++G+++GGW+Q +
Sbjct  364   KLVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPYRVWFEGQQVGGWTQVY  423

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GN         L+FAT+RG SH  P S P ++L LFKAFL   P P
Sbjct  424   GNI--------LSFATIRGASHEAPFSQPERSLVLFKAFLDSRPLP  461



>ref|XP_002512656.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF50108.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score =   348 bits (894),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 199/474 (42%), Positives = 278/474 (59%), Gaps = 28/474 (6%)
 Frame = +3

Query  48    KIMVFLLWFLLVNTLYSISIRINGEIIDS---LPGQPSDVDFNQYSGYIVTHKFRGRALF  218
             +IM F +  +L+   + + +  N  + D    LPGQP  + F+QYSGY+   + + RALF
Sbjct  2     EIMAFAV--VLLQICFLMGVNSNPSLFDKIVKLPGQP-QIGFHQYSGYVTVDEKKQRALF  58

Query  219   YYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASN  398
             YYFAEA++ D  S PL LWL GG  CSS  +G F ENGPFRP+    LVKNQ+SWN  +N
Sbjct  59    YYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNQYSWNREAN  116

Query  399   MLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYG  578
             MLY+++PIGV FSYS  +S Y+  +D  TAR+NL FL+KWF++F +YR+   +I G+SY 
Sbjct  117   MLYLESPIGVGFSYSVDTSFYEAVNDKTTARDNLVFLQKWFVKFPQYRNRSLFITGESYA  176

Query  579   GHLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVY  752
             GH  PQLA L+LE N+     +   LKG+ALGNP+LE  +   S  E  W HG+IS+  Y
Sbjct  177   GHYVPQLAQLMLEFNKKQ---KLFNLKGVALGNPVLEFATDFNSRAEFFWSHGLISDTTY  233

Query  753   GMQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssiss  923
              +   VCN +  + E+  G +S  CS +   +S E    +DK ++   V  S   S    
Sbjct  234   KLFTSVCNYSRYVSEYYRGSVSPLCSRVMGQVSRETSKFVDKYDVTLDVCISSVLSQSKI  293

Query  924   sqqHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFA  1103
                H +A +  D C+ D    Y+NR DVQ ALHA   G  + W   S     D  L +  
Sbjct  294   LSPHVIA-DNVDVCVEDETVNYLNRLDVQMALHARLVG-VHQWTVCS--SILDYELLDLE  349

Query  1104  IDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKE  1283
             I  +  +  L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W++G++
Sbjct  350   IPTISIVGKLIEAGVPVLVYSGDQDSVIPLTGSRTLVHGLAEELGLKTTVPYRVWFEGQQ  409

Query  1284  IGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +GGW+Q +GN         L+FAT+RG SH  P S P ++L LFKAFL+G P P
Sbjct  410   VGGWTQVYGNI--------LSFATIRGASHEAPFSQPERSLVLFKAFLEGQPLP  455



>gb|KHG09716.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=462

 Score =   348 bits (894),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 194/470 (41%), Positives = 274/470 (58%), Gaps = 28/470 (6%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             +++  LWF + +++       + + I  LPGQP  + F Q+SGY+     + +ALFYYF 
Sbjct  13    LLLIELWFTIESSV------AHPDKIVKLPGQPPRLSFQQFSGYVTVDYKKHKALFYYFV  66

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             EA++ D  S PL LWL GG  CSS  +G F ENGPFRP  +GE LVKN +SWN  +NMLY
Sbjct  67    EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGEFLVKNDYSWNREANMLY  123

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TPIGV FSYS  +S Y+   D +TAR+NL FL+ W+ +F  YR  D YI G+SY GH 
Sbjct  124   LETPIGVGFSYSTNTSSYEAVDDEITARDNLVFLQNWYNKFPNYRHRDLYITGESYAGHY  183

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQ  761
              PQLA L++E N+         LKGIALGNP++E  +   S  E+ W HG+IS+  Y M 
Sbjct  184   IPQLAKLMVEFNKKQNLF---NLKGIALGNPVMEFATDFNSRAEYFWSHGLISDSTYKMF  240

Query  762   KKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqH  935
               VCN +  + E+    +S  CS +   +S E    +DK ++          S S +   
Sbjct  241   TSVCNYSRYVSEYYRDSVSPSCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSMAINP  300

Query  936   YLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDIL  1115
                +E  D C+ D +  Y+N+ DVQKALHA   G +    +T      D  L N  +  +
Sbjct  301   QQVSERVDVCVEDKIVNYLNQKDVQKALHARLVGVR---RWTVCSNILDYQLLNLEMPTI  357

Query  1116  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  1295
               + +L+ S IPVL+YSGDQD  IP++ +R + + LA  L+L T      W++GK++GGW
Sbjct  358   SIVGSLIKSGIPVLVYSGDQDSVIPLTGSRSLVSRLAKELELETTVPYRVWFEGKQVGGW  417

Query  1296  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +Q +GN         L+FAT+RG SH  P S P ++L LFK+FL+G P P
Sbjct  418   TQVYGNI--------LSFATIRGASHEAPFSQPERSLMLFKSFLEGKPLP  459



>ref|XP_006438864.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52104.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=464

 Score =   348 bits (894),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 272/466 (58%), Gaps = 27/466 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L++    I +     ++D   +LPGQP  V F QYSGY+   + + RALFYYFAEA++ 
Sbjct  14    ILIHICLCIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPI  422
             D  S PL LWL GG  CSS  +G F ENGPFRP  +G+ LV+N++SWN  +NML+++TPI
Sbjct  72    DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLETPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS  +S Y+   D +TAR+NL FL+ WF++F +YR+   +I G+SY GH  PQLA
Sbjct  130   GVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGESYAGHYIPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              L+LE N+         LKGIALGNP+LE  +   S  E  W HG+IS+  Y M    CN
Sbjct  190   DLMLEFNKKEELF---NLKGIALGNPVLEFATDFNSRAEFFWSHGLISDATYTMFTSFCN  246

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLAT  947
              +  + E+  G +S  CS +  ++S E    +DK ++   V  S   S         +  
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQSKVLTPKQVGE  306

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  1127
              T D C+ D    Y+NR DVQKALHA   G +  W   S     D  L +  I  +  + 
Sbjct  307   TTVDVCVEDETVNYLNRKDVQKALHARLVGVR-GWAVCS--NILDYELLDLEIPTITVVG  363

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
              L+ + IPV++YSGDQD  IP++ +R++   LA  LKL T      W++G+++GGW+Q +
Sbjct  364   KLVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLETTVPYRVWFEGQQVGGWTQVY  423

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GN         L+FAT+RG SH  P S P ++L LF+AFL   P P
Sbjct  424   GNI--------LSFATIRGASHEAPFSQPERSLVLFEAFLDSRPLP  461



>ref|XP_009368797.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=467

 Score =   348 bits (894),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 198/445 (44%), Positives = 269/445 (60%), Gaps = 24/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI       +ALFYYFAEA+  +  S PL LWL GG  CSS 
Sbjct  39    ITSLPGQP-HVGFQQFSGYITVDDHNHKALFYYFAEAEI-NPASKPLVLWLNGGPGCSSL  96

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  DGE LV+N++SWN  +NMLY++TP+GV FSYS ++S Y    D  
Sbjct  97    GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYSKSNSSYMAVDDEA  154

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL++WF +F +YR +D ++AG+SY GH  PQLA LI+E NR         LKG
Sbjct  155   TARDNLVFLQRWFNKFPQYRHMDLFLAGESYAGHYIPQLAKLIVEINRK----EKFNLKG  210

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E LW HG+IS+  Y M   VCN +  + E+    +S  CS +
Sbjct  211   IALGNPVLEFATDLNSQAEFLWSHGLISDSTYNMFTSVCNYSRYVSEYYRHSVSPVCSRV  270

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssq--qHYLATETADPCLRDWVGEYINRPDVQ  1010
                +++E    +DK ++    C SS +S S+       TE  D C+ D    Y+NR DVQ
Sbjct  271   MSQVTKETSQFVDKYDVTLDVCISSVLSQSKFISPNQMTERIDVCVEDKTVNYLNRKDVQ  330

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W+  S     +  + N  +  +  + +L+   I VL+YSGDQD  IP
Sbjct  331   KALHARLVGVR-RWDVCS--SILEYQMLNLEVPTISLVGSLVKQGIQVLVYSGDQDSVIP  387

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R + + LA  L+L T      W++GK++GGW+Q +GN         L+FAT+RG S
Sbjct  388   LTGSRRLVSRLARELELNTTVPYRVWFEGKQVGGWTQVYGNI--------LSFATIRGAS  439

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFK+FL+G P P
Sbjct  440   HEAPFSQPERSLRLFKSFLEGRPLP  464



>ref|XP_008222370.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Prunus 
mume]
Length=465

 Score =   348 bits (893),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 197/450 (44%), Positives = 264/450 (59%), Gaps = 26/450 (6%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             +II  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CS
Sbjct  35    DIIALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCS  92

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S  +G F ENGPFRP+  GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D
Sbjct  93    SLGVGAFSENGPFRPS--GEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVND  150

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
              +TAR+NL FL+KW  +F +Y++   +I G+SY GH  PQLA L+L+            L
Sbjct  151   HITARDNLLFLQKWLEKFPQYKNRSLFITGESYAGHYVPQLAELMLQYKD-----YQFNL  205

Query  657   KGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             KGIALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G +S  CS
Sbjct  206   KGIALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICS  265

Query  831   DIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRP  1001
              +   +S E    +DK ++   V  S   S           TE  D C+ D +  Y+NRP
Sbjct  266   RVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQQVTEAIDVCVEDEIVNYLNRP  325

Query  1002  DVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDL  1181
             DVQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+YSGDQD 
Sbjct  326   DVQKALHARLVGVR-QWAVCS--NILDYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQDS  382

Query  1182  RIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVR  1361
              IP++ +R +   LA +L L T      W++G+++GGW+Q +GN         L+FAT+R
Sbjct  383   VIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNM--------LSFATIR  434

Query  1362  GGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             G SH  P S P ++L LFK+FL+G P P  
Sbjct  435   GASHEAPFSQPERSLVLFKSFLEGQPLPEV  464



>gb|ABR16719.1| unknown [Picea sitchensis]
Length=460

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 199/475 (42%), Positives = 279/475 (59%), Gaps = 33/475 (7%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             ++ +L FL +  L +      G +++ LPGQP+ V F QY+GYI  ++   RALFYYF E
Sbjct  6     LLIILAFLFIKVLSAPE----GHVVNRLPGQPA-VTFKQYAGYITVNEKSDRALFYYFVE  60

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A++E     PL +WL GG  CSS  +G   ENGPF P + G+L++N  SWN  +NMLY++
Sbjct  61    AETEPDLK-PLVVWLNGGPGCSSFGVGALSENGPFYP-KAGKLIRNSCSWNKEANMLYLE  118

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYSN  S Y   +D+ TA +NL FL  WF +F EY+  + Y+ G+SY GH  P
Sbjct  119   SPAGVGFSYSNDPSYYMGANDSKTAVDNLLFLHGWFNKFPEYKTRELYLTGESYAGHYIP  178

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMSLSN--VEHLWYHGIISEEVYGMQKK  767
             QLA LI+E+NR     +   LKGI++GNP+L+ ++  N   E LW HG++S+  Y M K 
Sbjct  179   QLAELIVEENRKK---KSFNLKGISIGNPLLDFITDLNARAEFLWSHGLVSDPTYNMMKT  235

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYL--  941
              CN + ++DE   G +S  C  I + +S EI   +DK ++  +SC SS +    +  +  
Sbjct  236   GCNYSRLLDEAFRGGVSSTCEHIYLTVSMEISKFIDKYDVTLESCLSSLLMQKSKMMIGV  295

Query  942   ---ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH---NFA  1103
                AT   D C++D    Y+N  DVQKA HA   G    W        SDV+ +   N+ 
Sbjct  296   TRTATVKPDVCVQDEATSYLNMADVQKAFHARLVGNVKTWE-----ACSDVLEYDDLNWE  350

Query  1104  IDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKE  1283
             I  +P L  L+ + I VLIYSGDQD  IP++ TR +   LA  L+L T      W+ GK+
Sbjct  351   IPTIPLLGKLVKAGIRVLIYSGDQDSIIPLTGTRTLVNNLAASLQLNTTVPYRVWFQGKQ  410

Query  1284  IGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             + GW Q +GN+        L+FATVRG  H VP S P ++L LFKAFL+G PPP+
Sbjct  411   VAGWVQVYGNT--------LSFATVRGAGHEVPFSQPERSLVLFKAFLQGQPPPS  457



>ref|XP_007043816.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 ref|XP_007043817.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99647.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99648.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 196/469 (42%), Positives = 271/469 (58%), Gaps = 28/469 (6%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEA  236
             L F+++   + + +  +  + D    LPGQP  V F QYSGY+   + + RALFYYFAEA
Sbjct  11    LGFIVLEVWFCVQVECSLALFDRITQLPGQPK-VGFQQYSGYVTVDEKKQRALFYYFAEA  69

Query  237   QSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVD  413
             +  D  S PL LWL GG  CSS  +G F ENGPFRP+  GE LVKN++SWN  +NMLY++
Sbjct  70    EV-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPS--GEVLVKNEYSWNREANMLYLE  126

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
              PIGV FSYS  +S Y+   D +TAR+NL F++ WF++F +YR+   +I G+SY GH  P
Sbjct  127   APIGVGFSYSTDASSYEAVDDKITARDNLVFMQNWFLKFPQYRNRSLFITGESYAGHYIP  186

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMSL---SNVEHLWYHGIISEEVYGMQK  764
             QLA L+L+ NR     +   LKGIALGNP+LE  ++   S  E  W HG+IS+  Y M  
Sbjct  187   QLAELMLQFNRKD---KLFNLKGIALGNPVLE-FAIDFNSRAEFFWSHGLISDSTYKMFT  242

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHY  938
               CN +  + E+    +S  CS +   +S E    +DK ++          S S      
Sbjct  243   TSCNYSRYVSEYYRDAVSPICSRVMRQVSTETSRFVDKYDVTLDVCISSMLSQSKVLTPQ  302

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILP  1118
                ET D C+ D    Y+NR DVQKALHA   G +  W   S     D  L +  I  + 
Sbjct  303   QVGETIDVCVEDETANYLNRQDVQKALHARLVGVR-KWAVCS--NVLDYELLDLEIPTIT  359

Query  1119  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  1298
              + +L+ + IPV++YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+
Sbjct  360   IVGSLVKAGIPVMVYSGDQDSVIPLTGSRTLVNRLAKELGLKTTVTYRVWFEGQQVGGWT  419

Query  1299  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             Q +GN         L+FAT+RG SH  P S P ++L LFKAFL+G P P
Sbjct  420   QVYGNI--------LSFATIRGASHEAPFSQPERSLVLFKAFLEGRPLP  460



>ref|XP_006584695.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=468

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 196/472 (42%), Positives = 277/472 (59%), Gaps = 25/472 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             I V LL       ++ +S   + + I  LPGQP ++ F Q+SGY+     + +ALFYYF 
Sbjct  12    ITVVLLQLSFSLEIFCLSY--HADRIVRLPGQP-NIGFQQFSGYVTVDDMKHKALFYYFV  68

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             E+++ D  S PL LWL GG  CSS  +G F ENGPFRP  +GE L+KN++SWN  +NMLY
Sbjct  69    ESET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGEVLIKNEYSWNRETNMLY  125

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TP+GV FSY+   S Y   +D  TAR+NL FL++WF +F  YR  D ++AG+SY GH 
Sbjct  126   LETPVGVGFSYAKGGSSYDTVNDETTARDNLVFLQRWFNKFPHYRHTDLFLAGESYAGHY  185

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQ  761
              PQLA L++E N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y + 
Sbjct  186   VPQLAKLMIEINKKE---KMFNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYKLF  242

Query  762   KKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqq---  932
                CN +  + E+    +S  CS +   +S E    +DK ++    C SS +S S+    
Sbjct  243   TTGCNYSRYVSEYYRDSISPLCSKVMKQVSRETSKFVDKYDVTLDVCISSVLSQSKAICP  302

Query  933   -HYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAID  1109
                   E+ D C+ D V  Y+NR DVQ+ALHA   G Q  WN  S     D  + N  + 
Sbjct  303   QSQQTNESIDVCVDDKVTNYLNRKDVQEALHAKLVGVQ-KWNVCSTNSILDYDMLNLEVP  361

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              LP + +L+ + + VLIYSGDQD  IP++ +R +   LA +L+L T      W++G+++G
Sbjct  362   TLPIVGSLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLRLNTTIHYRVWFEGQQVG  421

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GW+Q +GN         L+FATVRG SH  P S P ++L LFK+FL+  P P
Sbjct  422   GWTQVYGNI--------LSFATVRGASHEAPFSQPERSLVLFKSFLEDRPLP  465



>ref|XP_010942380.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   347 bits (890),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 194/446 (43%), Positives = 262/446 (59%), Gaps = 21/446 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  VDF Q+SGY+     + RALFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  34    ISKLPGQP-QVDFQQFSGYVTIDDRKQRALFYYFAEAEL-DPPTKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+E   LV+N++SWN  +NMLY++TP GV FSY+N +S Y+  +D MT
Sbjct  92    GVGAFSENGPFRPSEQ-VLVRNEYSWNEEANMLYLETPAGVGFSYANDTSCYEGVNDKMT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL +WF +F +Y+D D YI G+SY GH  PQLA L+++ N+         LKGI
Sbjct  151   ARDNLVFLLRWFTKFPQYKDRDLYITGESYAGHYVPQLADLMVKFNKKKKI---FNLKGI  207

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G LS  C+ + 
Sbjct  208   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYKIFTLACNYSRYVSEYYRGSLSSVCARVM  267

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +++E    +DK ++          S S        TE  D C+ D    Y+NR DVQ 
Sbjct  268   GQVTKETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDETVNYLNRKDVQD  327

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA  TG    W   S     +  L N  +  +  + +L+ S IP+L+YSGDQD  IP+
Sbjct  328   ALHARLTGVP-KWTVCS--SVLEYELLNLEVPTISVVGSLVRSGIPILVYSGDQDSVIPL  384

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA  LKL T      W+ GK++GGW+Q +G+         LTFAT+RG SH
Sbjct  385   TGSRTLVQRLAKELKLNTTVPYRVWFVGKQVGGWTQVYGDI--------LTFATIRGASH  436

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPNT  1451
               P S P ++L LF+AFL+G P P T
Sbjct  437   EAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_008222371.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Prunus 
mume]
Length=464

 Score =   346 bits (888),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 267/449 (59%), Gaps = 25/449 (6%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             +II  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CS
Sbjct  35    DIIALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCS  92

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S  +G F ENGPFRP+  GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D
Sbjct  93    SLGVGAFSENGPFRPS--GEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVND  150

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
              +TAR+NL FL+KW  +F +Y++   +I G+SY GH  PQLA L+L+            L
Sbjct  151   HITARDNLLFLQKWLEKFPQYKNRSLFITGESYAGHYVPQLAELMLQYKD-----YQFNL  205

Query  657   KGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             KGIALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G +S  CS
Sbjct  206   KGIALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICS  265

Query  831   DIEIMLSEEIGHDMDKENLVFqscesssisssqqHY--LATETADPCLRDWVGEYINRPD  1004
              +   +S E    +DK ++    C SS  S S+       TE  D C+ D +  Y+NRPD
Sbjct  266   RVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQVTEAIDVCVEDEIVNYLNRPD  325

Query  1005  VQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLR  1184
             VQKALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+YSGDQD  
Sbjct  326   VQKALHARLVGVR-QWAVCS--NILDYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQDSV  382

Query  1185  IPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRG  1364
             IP++ +R +   LA +L L T      W++G+++GGW+Q +GN         L+FAT+RG
Sbjct  383   IPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNM--------LSFATIRG  434

Query  1365  GSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
              SH  P S P ++L LFK+FL+G P P  
Sbjct  435   ASHEAPFSQPERSLVLFKSFLEGQPLPEV  463



>emb|CDY19500.1| BnaC04g10990D [Brassica napus]
Length=463

 Score =   346 bits (887),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 274/468 (59%), Gaps = 21/468 (4%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             +V  L  L   +L S ++    + I SLPGQP  V F QYSGY+   + + RALFYY AE
Sbjct  10    IVTALILLHALSLVSSTVMSRADRITSLPGQP-KVGFQQYSGYVSIDEKKQRALFYYLAE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+++   S PL LWL GG  CSS  +G F ENGPFRP +   LV+NQ SWN  +NMLY++
Sbjct  69    AEAK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHEANMLYLE  126

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP+GV FSY+  SS Y+  +D +TA++NL FL+KWF  F +Y +   +I G+SY GH  P
Sbjct  127   TPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITGESYAGHYVP  186

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA L+++ N+   HL    LKGIALGNP+LE  +   S  E+ W HG+IS+  Y M   
Sbjct  187   QLAQLMIQYNKK-HHL--FNLKGIALGNPVLEFSTDFNSRAEYFWSHGLISDPTYRMFTS  243

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYL  941
              CN +  + E+  G++S  CS +   +S E    +DK ++    C     S S       
Sbjct  244   YCNYSRFVSEYYRGDVSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPQQ  303

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  1121
               ET D C+ D    Y+NR DVQKALHA   G +  W   S     D  L +  +  +  
Sbjct  304   VGETVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWAVCS--NVLDYELLDVEVPTINI  360

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             + +L+ + +PVL+YSGDQD  IP++ +R +   LA +L L+T      W+ G+++GGW+Q
Sbjct  361   VGSLIKAGVPVLVYSGDQDSVIPLTGSRTLVKQLAQQLGLSTTVPYRVWFAGQQVGGWTQ  420

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              +GN         L FATVRG +H VP S P ++L LFKAFL G+P P
Sbjct  421   VYGNV--------LAFATVRGAAHEVPFSQPERSLVLFKAFLGGNPLP  460



>ref|XP_008390188.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score =   345 bits (886),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 201/448 (45%), Positives = 268/448 (60%), Gaps = 27/448 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F  YSGY+     + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  35    ITGLPGQPP-VGFQHYSGYVTVDAKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  93    GVGAFSENGPFRP--KGEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVTDHI  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+KWF +F +YR+   YI G+SY GH  PQLA L+L+   +  H     LKG
Sbjct  151   TARDNLLFLQKWFEKFPQYRNRSLYITGESYAGHYVPQLAELMLQFKEH--HF---NLKG  205

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G +S  CS +
Sbjct  206   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYKMFSSVCNYSRFVSEYYRGSVSPICSRV  265

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADP---CLRDWVGEYINRPDV  1007
                +S E    +DK ++    C SS  S S+   L  + AD    C+ D V  Y+NRPDV
Sbjct  266   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKA-LLPQQVADSIDVCVEDEVVNYLNRPDV  324

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRI  1187
             QKALHA   G ++ W   S      V+  +  I  +  +  L+ + IPVL+YSGDQD  I
Sbjct  325   QKALHARLVGVRH-WAVCSNILGYQVL--DVEIPTITIVGKLIKAGIPVLVYSGDQDSVI  381

Query  1188  PVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGG  1367
             P++ +R +   LA +L+L T      W++G+++GGW+Q +GN         L+FAT+RG 
Sbjct  382   PLTGSRTLIHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNM--------LSFATIRGA  433

Query  1368  SHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             SH  P S P ++L LFK+FL+G P P  
Sbjct  434   SHEAPFSQPERSLVLFKSFLEGRPLPEV  461



>ref|XP_006304410.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
 gb|EOA37308.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
Length=459

 Score =   345 bits (885),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 196/462 (42%), Positives = 273/462 (59%), Gaps = 21/462 (5%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             F L+  L S ++  + + +  LPGQP  V F QYSGY+     + RALFYYFAEA++ D 
Sbjct  12    FALILFLSSSTVLSHSDRVTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAET-DP  69

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV 
Sbjct  70    TSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLETPVGVG  128

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYS  SS Y+  +D +TAR+NL FL++WF++F  Y +   +I G+SY GH  PQLA L+
Sbjct  129   FSYSTQSSSYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLM  188

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATT  785
             ++ N+   HL    L+GIA+GNP+LE  +   S  E+ W HG+IS+  Y M    CN + 
Sbjct  189   IQYNKK-HHL--FNLRGIAIGNPVLEFETDFNSRAEYFWSHGLISDSTYKMFTSYCNYSR  245

Query  786   MIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETAD  959
              + E+  G +S  CS +   +S E    +DK ++    C     S S         E+ D
Sbjct  246   YVSEYYRGSMSSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVD  305

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
              C+ D   +Y+NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L+ 
Sbjct  306   VCVEDETVKYLNRRDVQEALHARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVR  362

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             + +PVL+YSGDQD  IP++ +R + + LA +L L T      W+ G+++GGW+Q +GN  
Sbjct  363   AGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLGLRTTVPYRVWFAGQQVGGWTQVYGNV-  421

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                    L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  422   -------LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  456



>ref|XP_011036159.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=463

 Score =   345 bits (885),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 194/445 (44%), Positives = 260/445 (58%), Gaps = 22/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+       +ALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  33    ITQLPGQPP-VWFQQYSGYVTVDDKNQKALFYYFAEAEI-DCASKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +G LVKNQ+SWN  +NMLY++TPIGV FSYS  +S Y+   D +T
Sbjct  91    GVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLETPIGVGFSYSTNTSSYEGVDDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F +Y+    +I G+SY GH  PQLA L+L+ N+     +   LKGI
Sbjct  150   ARDNLVFLQRWFVKFPQYKSRSLFITGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  206

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E LW HG+IS+  Y M   VCN +  + E+  G +S  CS + 
Sbjct  207   ALGNPVLEYSTDFNSRAEFLWSHGLISDTTYKMFTTVCNYSRYVSEYYRGSVSPQCSRVM  266

Query  840   IMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
               ++ E    +DK ++   V  S   S            +  D C+ D    Y+NRPDVQ
Sbjct  267   NQVTRETSRFVDKYDVTLDVCISSVLSQSKVLTPQQQVGDNVDVCVEDETVNYLNRPDVQ  326

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
              ALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+YSGDQD  IP
Sbjct  327   MALHARLVGVRR-WAVCS--NILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDSVIP  383

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   L+  L L T      W++G+++GGW+Q +GN         L+FAT+RG S
Sbjct  384   LTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGAS  435

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFKAFL G P P
Sbjct  436   HEAPFSQPERSLVLFKAFLGGQPLP  460



>gb|KHN47533.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 191/445 (43%), Positives = 259/445 (58%), Gaps = 28/445 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F+Q+SGY+       RALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP   G LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+       
Sbjct  90    GVGAFSENGPFRPKGKG-LVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYE-------  141

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WFI+F EYR+   +I G+SY GH  PQLA L+L+ N+     +   LKGI
Sbjct  142   ARDNLVFLQSWFIKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  198

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +T + E+ +G +S  CS + 
Sbjct  199   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPICSSVM  258

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++          S +        TET D C+ D    Y+NR DVQ 
Sbjct  259   SQVTTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  318

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             A+HA+  G Q    +++     D  L +  I  +  +  L+   IPVL+YSGDQD  IP+
Sbjct  319   AMHAHLVGVQ---RWSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQDSVIPL  375

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA  L L T      W++ +++GGW+Q +GN         L+FAT+RG SH
Sbjct  376   TGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI--------LSFATIRGASH  427

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPN  1448
               P S P ++L LFK+FL+G P P 
Sbjct  428   EAPFSQPERSLVLFKSFLEGGPLPQ  452



>ref|XP_008777393.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Phoenix 
dactylifera]
Length=463

 Score =   345 bits (885),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/446 (43%), Positives = 258/446 (58%), Gaps = 21/446 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  VDF Q+SGYI     + RALFYYF EA+  D  + PL LWL GG  CSS 
Sbjct  34    ISKLPGQP-QVDFQQFSGYITVDDRKQRALFYYFTEAEL-DPSAKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+E   LV+N++SWN  +NMLY++TP GV FSY+N +S Y+   D MT
Sbjct  92    GVGAFSENGPFRPSEQ-VLVRNEYSWNKEANMLYLETPAGVGFSYANDTSCYEGVDDKMT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL +WF +F +Y+  D YI G+SY GH  PQLA L+++ N+         LKG 
Sbjct  151   ARDNLVFLLRWFSKFPQYKVRDLYITGESYAGHYVPQLAELMVKFNKKK---NIFNLKGA  207

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G LS  C+ + 
Sbjct  208   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTLACNYSRYVSEYYRGSLSAVCARVM  267

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +++E    +DK ++          S S        TE  D C+ D    Y+NR DVQ 
Sbjct  268   GQVTQETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDETVNYLNRKDVQD  327

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G    W+  S     +  L N  I  +  + +L+ S IPVL+YSGDQD  IP+
Sbjct  328   ALHARLAGVP-KWSVCS--SVLEYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDSVIPL  384

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA  LKL T      W+ GK++GGW+Q +G+         LTFAT+RG SH
Sbjct  385   TGSRTLVQRLAKELKLKTTVPYRVWFAGKQVGGWTQVYGDI--------LTFATIRGASH  436

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPNT  1451
               P S P ++L LF+AFL+G P P T
Sbjct  437   EAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_010250555.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=498

 Score =   346 bits (888),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 201/468 (43%), Positives = 274/468 (59%), Gaps = 28/468 (6%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             L  F+ +    S+S RI       LPGQP  V F Q+SGY+     R R LFYYFAEA+ 
Sbjct  53    LFQFMGIAASLSLSDRIT-----ELPGQP-QVSFQQFSGYVTVDDKRRRDLFYYFAEAEI  106

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTP  419
              D  S PL LWL GG  CSS  +G F ENGPFRP+  GE LV+N++SWN  +NMLY++TP
Sbjct  107   -DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPS--GEVLVRNEYSWNREANMLYLETP  163

Query  420   IGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQL  599
             +GV FSYS  +S Y    D +TAR+NL FL++WF++F +Y+  D +I G+SY GH  PQL
Sbjct  164   VGVGFSYSTDTSSYVAVDDKITARDNLVFLQRWFLKFPQYKHKDLFITGESYAGHYVPQL  223

Query  600   AALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVC  773
             A LI++ N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y +    C
Sbjct  224   AELIIQFNKKE---KLFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDSTYKLFTSAC  280

Query  774   NATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqq--HYLAT  947
             N +  + E+  G +S  CS +   +S+E    +DK ++    C SS +S S+       T
Sbjct  281   NYSRYVGEYYRGSISSVCSRVMSRVSKETSRFVDKYDVTLDVCISSVLSQSKVLNPQQVT  340

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  1127
             E  D C+ D    Y+NR DVQKALHA   G +  W   S     D  L N  I  +  + 
Sbjct  341   ERIDVCVEDETVNYLNRRDVQKALHARLVGVRR-WAVCS--NILDYELLNLEIPTISIVG  397

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
             +L+ + IPVL+YSGDQD  IP++ +R +   LA+ L L T      W+ G+++GGW+Q +
Sbjct  398   SLVKAGIPVLVYSGDQDSVIPLTGSRTLVHELAMELGLNTTVPYRVWFAGQQVGGWTQDY  457

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             GN         L+FAT+RG SH  P S P ++L LFK+FL+G P P  
Sbjct  458   GNI--------LSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLPEV  497



>ref|XP_002297872.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE82677.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=454

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/444 (43%), Positives = 258/444 (58%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+       +ALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  25    ITQLPGQPP-VWFQQYSGYVTVDDKNQKALFYYFAEAEI-DCASKPLVLWLNGGPGCSSL  82

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +G LVKNQ+SWN  +NMLY++TPIGV FSYS  +S Y+   D +T
Sbjct  83    GVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLETPIGVGFSYSTNTSSYEGVDDKIT  141

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F +YR    +I G+SY GH  PQLA L+L+ N+     +   LKGI
Sbjct  142   ARDNLVFLQRWFVKFPQYRSRSLFITGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  198

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G +S  CS + 
Sbjct  199   ALGNPVLEYSTDFNSRAEFFWSHGLISDTTYKMFTSVCNYSRYVSEYYRGSVSPLCSRVM  258

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++          S S         +  D C+ D    Y+NRPDVQ 
Sbjct  259   SQVTRETSRFVDKYDVTLDVCISSVLSQSKVLTPQQVGDNVDVCVEDETVNYLNRPDVQM  318

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+YSGDQD  IP+
Sbjct  319   ALHARLVGVRR-WAVCS--NILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDSVIPL  375

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   L+  L L T      W++G+++GGW+Q +GN         L+FAT+RG SH
Sbjct  376   TGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGASH  427

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
               P S P ++L LFKAFL G P P
Sbjct  428   EAPFSQPERSLVLFKAFLGGQPLP  451



>ref|XP_006415698.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
 gb|ESQ34051.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
Length=463

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 198/464 (43%), Positives = 273/464 (59%), Gaps = 23/464 (5%)
 Frame = +3

Query  72    FLLVNTLYSISIRI--NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
              +L +TL S S  +  + + +  LPGQP  V F QYSGY+     + RALFYYFAEA+  
Sbjct  14    LILFHTLLSSSSTVLPHSDRVTRLPGQPR-VGFQQYSGYVTVDDRKQRALFYYFAEAEI-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+G
Sbjct  72    DPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLETPVG  130

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAA  605
             V FSYS  SS Y+  +D +TA++NL FL++WF++F  Y +   +I G+SY GH  PQLA 
Sbjct  131   VGFSYSTQSSSYEGVTDKITAKDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQ  190

Query  606   LILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNA  779
             L++E N+   HL    L+GIA+GNP+LE  +   S  E+ W HG+IS+  Y M    CN 
Sbjct  191   LMIEYNKK-HHL--FNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDPTYKMFTSYCNY  247

Query  780   TTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATET  953
             +  + E+  G +S  CS +   +S E    +DK ++    C     S S         E+
Sbjct  248   SRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGES  307

Query  954   ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  1133
              D C+ D   +Y+NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L
Sbjct  308   VDVCVEDETVKYLNRRDVQEALHARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSL  364

Query  1134  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  1313
             + + +PVL+YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN
Sbjct  365   VQAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGN  424

Query  1314  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                      L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  425   V--------LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  460



>ref|XP_011020860.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 196/445 (44%), Positives = 259/445 (58%), Gaps = 22/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + +ALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  33    ITQLPGQPP-VWFQQYSGYVTVDEKKQKALFYYFAEAEL-DCASKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+    LVKNQ+SWN  +NMLY++TPIGV FSYS  +S Y+  +D +T
Sbjct  91    GVGAFSENGPFRPSGQ-VLVKNQYSWNREANMLYLETPIGVGFSYSANASSYEGVNDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+KWF+ F  YR+   +I G+SY GH  PQLA L+L+ NR     +   LKGI
Sbjct  150   ARDNLVFLQKWFVNFPHYRNRSLFITGESYAGHYVPQLADLMLQFNRKE---KLFNLKGI  206

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G +S  CS + 
Sbjct  207   AMGNPVLEYSTDFNSRAEFFWSHGLISDTTYKMFTTVCNYSRYVSEYYRGSVSPQCSRVM  266

Query  840   IMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
               ++ E    +DK ++   V  S   S            +  D C+ D    Y+NRPDVQ
Sbjct  267   NQVTRETSRFVDKYDVTLDVCISSALSQSKILSPQQQLGDNIDVCVEDETVNYLNRPDVQ  326

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+YSGDQD  IP
Sbjct  327   KALHARLVGVRR-WAVCS--NILDYELLDLEIPTISIVGRLIKAGIPVLVYSGDQDSVIP  383

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W+ G+++GGW+Q +GN         L+FAT+RG S
Sbjct  384   LTGSRTLVHGLAEELGLQTTVPYRVWFGGQQVGGWTQVYGNI--------LSFATIRGAS  435

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFKAFL G P P
Sbjct  436   HEAPFSQPERSLVLFKAFLGGQPLP  460



>ref|XP_009334311.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=459

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 194/445 (44%), Positives = 259/445 (58%), Gaps = 23/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F  +SGYI       +ALFYYFAEA+     S PL LWL GG  CSS 
Sbjct  30    ITSLPGQPP-VGFQHFSGYITVDDHNHKALFYYFAEAEITPA-SKPLVLWLNGGPGCSSL  87

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  DGE LV+N++SWN  +NMLY++TP+GV FSY+ +SS Y    D  
Sbjct  88    GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYAKSSSSYIAVDDEA  145

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL++WF +F +Y+  D ++ G+SY GH  PQLA L++E NR     +   LKG
Sbjct  146   TARDNLVFLQRWFNKFPQYKQRDLFLTGESYAGHYIPQLAKLMIEINRKE---KSFNLKG  202

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+    +S  CS +
Sbjct  203   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYNMFTSVCNYSRYVSEYYRDSMSPVCSRV  262

Query  837   EIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                +S+E    +DK ++          S S        TE  D C+ D    Y+NR DVQ
Sbjct  263   MSQVSKETSKFVDKYDVTIDVCISSVLSQSKVISPNQMTERIDVCVEDKTVNYLNRKDVQ  322

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W+  S     D  + N  I  +  + +L+   IPVL+YSGDQD  IP
Sbjct  323   KALHARLVGVRR-WDVCS--NILDYQVLNLEIPTISLVGSLVKQGIPVLVYSGDQDSVIP  379

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W++GK++GGW+Q +GN         L+FAT+RG S
Sbjct  380   LTGSRSLVYRLATELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LSFATIRGAS  431

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFK+FL+G P P
Sbjct  432   HEAPFSQPGRSLRLFKSFLEGRPLP  456



>ref|XP_011036160.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=462

 Score =   344 bits (882),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 193/444 (43%), Positives = 259/444 (58%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+       +ALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  33    ITQLPGQPP-VWFQQYSGYVTVDDKNQKALFYYFAEAEI-DCASKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +G LVKNQ+SWN  +NMLY++TPIGV FSYS  +S Y+   D +T
Sbjct  91    GVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLETPIGVGFSYSTNTSSYEGVDDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F +Y+    +I G+SY GH  PQLA L+L+ N+     +   LKGI
Sbjct  150   ARDNLVFLQRWFVKFPQYKSRSLFITGESYAGHYVPQLAELMLQFNKKE---KLFNLKGI  206

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E LW HG+IS+  Y M   VCN +  + E+  G +S  CS + 
Sbjct  207   ALGNPVLEYSTDFNSRAEFLWSHGLISDTTYKMFTTVCNYSRYVSEYYRGSVSPQCSRVM  266

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++          S S         +  D C+ D    Y+NRPDVQ 
Sbjct  267   NQVTRETSRFVDKYDVTLDVCISSVLSQSKVLTPQQVGDNVDVCVEDETVNYLNRPDVQM  326

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+YSGDQD  IP+
Sbjct  327   ALHARLVGVRR-WAVCS--NILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDSVIPL  383

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   L+  L L T      W++G+++GGW+Q +GN         L+FAT+RG SH
Sbjct  384   TGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGASH  435

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
               P S P ++L LFKAFL G P P
Sbjct  436   EAPFSQPERSLVLFKAFLGGQPLP  459



>gb|KEH35690.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=448

 Score =   343 bits (880),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 194/459 (42%), Positives = 276/459 (60%), Gaps = 23/459 (5%)
 Frame = +3

Query  90    LYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLT  269
             ++  S   + + I +LPGQP ++ F Q+SGY+     + ++LFYYFAE+++ D  S PL 
Sbjct  3     VFCFSPHFHADKIVTLPGQPQNIAFQQFSGYVTVDNKKHKSLFYYFAESET-DPSSKPLV  61

Query  270   LWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNT  449
             LWL GG  CSS  +G F ENGPFRP  D  L+KN+ SWN  +NMLY++TP GV FSY   
Sbjct  62    LWLNGGPGCSSLGVGAFSENGPFRPNGDF-LIKNEHSWNKEANMLYLETPAGVGFSYVKG  120

Query  450   SSDYKIW-SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNR  626
             SS Y    +D  TAR+NL FL +WF +F +YR+ D ++ G+SY GH  PQLA L++E N+
Sbjct  121   SSAYTTTVNDDETARDNLVFLERWFNKFPQYRNRDLFLTGESYAGHYVPQLAKLMIEMNK  180

Query  627   NPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEF  800
                  +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y M  +VCN +  + E+
Sbjct  181   RN---KIFNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDATYNMFTRVCNYSRYVSEY  237

Query  801   LSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssq----qHYLATETADPCL  968
                 +S  CS +  ++S+E    +DK ++    C SS +S S+    Q   A E  D C+
Sbjct  238   NRDSVSPLCSKVMGLVSKETSRFVDKYDVTLDVCISSVLSQSKVISPQPQQANEMIDVCV  297

Query  969   RDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDI  1148
              D V  Y+NR DVQ+ALHA   G +  W+  S     DV+  N  +  LP + +L+ + +
Sbjct  298   DDKVTNYLNRRDVQEALHAKLVGVR-KWDVCSNVLDYDVL--NLEVPTLPVVGSLIKAGV  354

Query  1149  PVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGE  1328
              VLIYSGDQD  IP++ +R +   LA +L L T      W++G+++GGW+Q +GN     
Sbjct  355   KVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGNV----  410

Query  1329  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                 L+FATVRG +H  P S P ++L LFK+FL+G P P
Sbjct  411   ----LSFATVRGAAHEAPFSQPERSLVLFKSFLEGRPLP  445



>gb|ABK25202.1| unknown [Picea sitchensis]
Length=462

 Score =   343 bits (881),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 192/451 (43%), Positives = 258/451 (57%), Gaps = 25/451 (6%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             +++D LPGQP+ V F QY+GY+   +  GRALFYYF EA+++     PL +WL GG  CS
Sbjct  24    DLVDRLPGQPA-VTFKQYAGYVTVDEKSGRALFYYFVEAETDSNLK-PLVVWLNGGPGCS  81

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G   ENGPF P   G+L  N++SWN  +NMLY++TP GV FSYSN ++ Y   +D 
Sbjct  82    SFGVGALSENGPFHP-RGGKLFGNEYSWNKEANMLYLETPAGVGFSYSNDTTYYLGANDA  140

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLK  659
              TA +NL+FL  WF +F EY+  D Y+ G+SY GH  PQ A LI+E NR     +   LK
Sbjct  141   KTAEDNLQFLHGWFDKFPEYKTRDLYLTGESYAGHYIPQWAELIVEANRKE---KIFNLK  197

Query  660   GIALGNPILEKMSLSN--VEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             GIA+GNP+L+  +  N   E+LW HG+IS+  Y   K  CN T  +DE+  G +S  C D
Sbjct  198   GIAIGNPLLDFFTDFNARAEYLWSHGLISDPTYNNMKTGCNYTRYVDEYYRGTVSSTCED  257

Query  834   IEIMLSEEIGHDMDKE----NLVFqscesssisssqqHYLATETA---DPCLRDWVGEYI  992
             +   +S E+   +D+     ++   S  +          + T  A   D C+ +    Y+
Sbjct  258   VYSTVSMELSQYIDRYDVTLDICLSSVGTQKSKMLGVKTIGTRLAVQPDVCVENEATAYL  317

Query  993   NRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGD  1172
             N  DVQKA HA   G    W+  S   T D   HN  I  +P L  L M+ I VLIYSGD
Sbjct  318   NMVDVQKAFHARLVGNVKRWDSCSDVLTYD--HHNLEIPTVPLLGKLAMTGIRVLIYSGD  375

Query  1173  QDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFA  1352
             QD  IP++ TR +   LA  LKL +      W+ GK++ GW Q +GN         L+FA
Sbjct  376   QDSVIPLTGTRTLVNNLAASLKLNSTVPYSVWFQGKQVAGWVQVYGNI--------LSFA  427

Query  1353  TVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             TVRG SH VP S P ++L LFKAFL+G  PP
Sbjct  428   TVRGASHEVPFSQPERSLVLFKAFLQGQTPP  458



>gb|KHN31265.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   343 bits (881),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 196/453 (43%), Positives = 272/453 (60%), Gaps = 25/453 (6%)
 Frame = +3

Query  114   NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHD  293
             + + I +LPGQP  V F Q+SGY+     + ++LFYYFAEA++ D  S PL LWL GG  
Sbjct  22    HADTIAALPGQP-HVGFQQFSGYVTVDDKKQKSLFYYFAEAET-DPASKPLVLWLNGGPG  79

Query  294   CSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
             CSS  +G F ENGPFRP  +GE L+KN +SWN  +NMLY++TP+GV FSY+  SS Y   
Sbjct  80    CSSLGVGAFSENGPFRP--NGEFLIKNYYSWNKEANMLYLETPVGVGFSYAKGSSSYMTV  137

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPI  650
             +D  TAR+NL FL +WF +F +YR  D ++ G+SY GH  PQLA LI+E N      +  
Sbjct  138   NDEATARDNLIFLLRWFNKFPQYRSRDLFLTGESYAGHYVPQLAKLIIEMNTKN---KIF  194

Query  651   KLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEY  824
              LKGIALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+    +S  
Sbjct  195   NLKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYYRDSVSPL  254

Query  825   CSDIEIMLSEEIGHDMDKENLVFqscesssisssq----qHYLATETADPCLRDWVGEYI  992
             CS +   +S E    +DK ++    C SS +S S+    Q   A E+ D C+ D V  Y+
Sbjct  255   CSKVMGQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYL  314

Query  993   NRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGD  1172
             NR DVQ+ALHA   G +  W+  S     D  + N  +  LP + +L+ + + VLIYSGD
Sbjct  315   NRRDVQEALHAKLVGIR-KWDVCS--NILDYDMLNLEVPTLPVVGSLIKAGVKVLIYSGD  371

Query  1173  QDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFA  1352
             QD  IP++ +R +   LA +L L +      W++G+++GGW+Q +GN         L+FA
Sbjct  372   QDSVIPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQVYGNI--------LSFA  423

Query  1353  TVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             TVRG SH  P S P ++L LFK+FL+G P P+ 
Sbjct  424   TVRGASHEAPFSQPERSLVLFKSFLEGRPLPDA  456



>ref|XP_007145476.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
 gb|ESW17470.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
Length=465

 Score =   343 bits (880),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 197/470 (42%), Positives = 270/470 (57%), Gaps = 33/470 (7%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             L F++  ++  ++     + I +LPGQP  V F QY+GYI   + + RALFYYF EA+ E
Sbjct  13    LLFVIAQSVVGVNSASQADKITTLPGQPP-VKFQQYAGYITVDEKQKRALFYYFVEAEVE  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
                S PL LWL GG  CSS   G F E+GPF+P+E+G L+KN+FSWN  +NMLY+++P G
Sbjct  72    PA-SKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEFSWNKEANMLYLESPAG  129

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAA  605
             V FSYS   S Y   +D MTAR+NL FL++WF +F E+++ DF+I G+SY GH  PQLA 
Sbjct  130   VGFSYSANKSFYDYVNDEMTARDNLVFLQRWFTKFPEFKNSDFFITGESYAGHYVPQLAQ  189

Query  606   LILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNA  779
             LI++            LKGIALGNP+LE  +   S  E  W HG+IS+  Y +  KVCN 
Sbjct  190   LIVQTKTK------FNLKGIALGNPLLEFNTDFNSRAEFFWSHGLISDSTYEIFTKVCNY  243

Query  780   TTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLATE---  950
             + +  +  SG+L+  CS +  ++S E+   +D  ++    C SS    +      T+   
Sbjct  244   SQIRRQHQSGKLTPICSGVNKLVSTEVSRYVDTYDVTLDVCLSSVDQQAYVLNQLTQLQE  303

Query  951   --TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDIL  1115
                 D C+ D    Y+NR DVQ+ALHA   G       TS    SD +   L N  I  +
Sbjct  304   GGKIDVCVEDETTAYLNRKDVQEALHAKLEG------ITSWSVCSDTLGYDLQNLEIPTI  357

Query  1116  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  1295
             P L AL  S I VL+YSGDQD  IP+  TR +   LA    L T      W++GK++ GW
Sbjct  358   PILGALAKSGIRVLVYSGDQDSVIPLIGTRSLVNGLAKDFGLNTTVSYRTWFEGKQVAGW  417

Query  1296  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +Q +G+         L+FATVRG +H  P S P ++L L KAFL+G P P
Sbjct  418   TQEYGDI--------LSFATVRGAAHEAPFSQPERSLVLLKAFLEGKPLP  459



>ref|XP_009359890.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   343 bits (880),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 201/452 (44%), Positives = 272/452 (60%), Gaps = 34/452 (8%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + R +A+FYY AEA+  D  S PL LWL GG  CSS 
Sbjct  35    ITGLPGQPP-VGFQQYSGYVTVDEKRQKAMFYYLAEAEI-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  93    GVGAFSENGPFRP--KGEVLVRNEHSWNTEANMLYLETPIGVGFSYSTDTSSYEGVTDRI  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+KW  +F +YR+   YI G+SY GH  PQLA L+L+  +         LKG
Sbjct  151   TARDNLLFLQKWLEKFPQYRNRSLYITGESYAGHYVPQLAELMLQFKKE----YQFNLKG  206

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G LS  C+ +
Sbjct  207   IALGNPVLEFATDFNSRAEFFWSHGLISDATYNMFTSVCNYSRYVSEYYRGSLSPICAMV  266

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADP---CLRDWVGEYINRPDV  1007
                +S E    +DK ++    C SS +S S+   L  E AD    C+ D +  Y+NRPDV
Sbjct  267   MSQVSRETSKFVDKYDVTLDVCISSVVSQSKA-LLPQEVADTIDVCVDDEIVNYLNRPDV  325

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLS---ALLMSDIPVLIYSGDQ  1175
             QKALHA   G +  W   S       IL    +D+ +PT++    L+ + IPVL+YSGDQ
Sbjct  326   QKALHARLVGVR-QWAVCS------TILDYQQLDVEIPTITIVGKLIKAGIPVLVYSGDQ  378

Query  1176  DLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFAT  1355
             D  IP++ +R++   LA +L+L+T      W+ G+++GGW+Q +GN         L+FAT
Sbjct  379   DSVIPLTGSRKLVNGLAEQLRLSTTVPYRVWFGGQQVGGWTQVYGNM--------LSFAT  430

Query  1356  VRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             +RG SH  P S P ++L LFK+FL+G P P  
Sbjct  431   IRGASHEAPFSQPERSLVLFKSFLEGRPLPEV  462



>ref|XP_003532390.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
 gb|KHN16877.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=466

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 196/472 (42%), Positives = 278/472 (59%), Gaps = 27/472 (6%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             I V LL       ++ +S   + + I  LPGQP ++ F Q+SGY+     + +ALFYYF 
Sbjct  12    ITVVLLQLSFSLEIFCLSY--HADRIVRLPGQP-NIGFQQFSGYVTVDDMKHKALFYYFV  68

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             E+++ D  S PL LWL GG  CSS  +G F ENGPFRP  +GE L+KN++SWN  +NMLY
Sbjct  69    ESET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGEVLIKNEYSWNRETNMLY  125

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TP+GV FSY+   S Y   +D  TAR+NL FL++WF +F  YR  D ++AG+SY GH 
Sbjct  126   LETPVGVGFSYAKGGSSYDTVNDETTARDNLVFLQRWFNKFPHYRHTDLFLAGESYAGHY  185

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQ  761
              PQLA L++E N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y + 
Sbjct  186   VPQLAKLMIEINKKE---KMFNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYKLF  242

Query  762   KKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqq---  932
                CN +  + E+    +S  CS +   +S E    +DK ++    C SS +S S+    
Sbjct  243   TTGCNYSRYVSEYYRDSISPLCSKVMKQVSRETSKFVDKYDVTLDVCISSVLSQSKAICP  302

Query  933   -HYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAID  1109
                   E+ D C+ D V  Y+NR DVQ+ALHA   G Q  WN  S     D++  N  + 
Sbjct  303   QSQQTNESIDVCVDDKVTNYLNRKDVQEALHAKLVGVQ-KWNVCSTILDYDML--NLEVP  359

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              LP + +L+ + + VLIYSGDQD  IP++ +R +   LA +L+L T      W++G+++G
Sbjct  360   TLPIVGSLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLRLNTTIHYRVWFEGQQVG  419

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GW+Q +GN         L+FATVRG SH  P S P ++L LFK+FL+  P P
Sbjct  420   GWTQVYGNI--------LSFATVRGASHEAPFSQPERSLVLFKSFLEDRPLP  463



>ref|XP_006578724.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=469

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 196/452 (43%), Positives = 272/452 (60%), Gaps = 25/452 (6%)
 Frame = +3

Query  114   NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHD  293
             + + I +LPGQP  V F Q+SGY+     + ++LFYYFAEA++ D  S PL LWL GG  
Sbjct  34    HADTIAALPGQP-HVGFQQFSGYVTVDDKKQKSLFYYFAEAET-DPASKPLVLWLNGGPG  91

Query  294   CSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
             CSS  +G F ENGPFRP  +GE L+KN +SWN  +NMLY++TP+GV FSY+  SS Y   
Sbjct  92    CSSLGVGAFSENGPFRP--NGEFLIKNYYSWNKEANMLYLETPVGVGFSYAKGSSSYMTV  149

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPI  650
             +D  TAR+NL FL +WF +F +YR  D ++ G+SY GH  PQLA LI+E N      +  
Sbjct  150   NDEATARDNLIFLLRWFNKFPQYRSRDLFLTGESYAGHYVPQLAKLIIEMNTKN---KIF  206

Query  651   KLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEY  824
              LKGIALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+    +S  
Sbjct  207   NLKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYYRDSVSPL  266

Query  825   CSDIEIMLSEEIGHDMDKENLVFqscesssisssq----qHYLATETADPCLRDWVGEYI  992
             CS +   +S E    +DK ++    C SS +S S+    Q   A E+ D C+ D V  Y+
Sbjct  267   CSKVMGQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYL  326

Query  993   NRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGD  1172
             NR DVQ+ALHA   G +  W+  S     D  + N  +  LP + +L+ + + VLIYSGD
Sbjct  327   NRRDVQEALHAKLVGIR-KWDVCS--NILDYDMLNLEVPTLPVVGSLIKAGVKVLIYSGD  383

Query  1173  QDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFA  1352
             QD  IP++ +R +   LA +L L +      W++G+++GGW+Q +GN         L+FA
Sbjct  384   QDSVIPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQVYGNI--------LSFA  435

Query  1353  TVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             TVRG SH  P S P ++L LFK+FL+G P P+
Sbjct  436   TVRGASHEAPFSQPERSLVLFKSFLEGRPLPD  467



>ref|XP_007223033.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24232.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=465

 Score =   343 bits (879),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 195/448 (44%), Positives = 260/448 (58%), Gaps = 26/448 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  37    IALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCSSL  94

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  95    GVGAFSENGPFRPS--GEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVNDHI  152

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+ W  +F +Y++   +I G+SY GH  PQLA L+L+            LKG
Sbjct  153   TARDNLLFLQNWLEKFPQYKNRSLFITGESYAGHYVPQLAELMLQYKE-----YQFNLKG  207

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G +S  CS +
Sbjct  208   IALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICSRV  267

Query  837   EIMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRPDV  1007
                +S E    +DK ++   V  S   S           TE  D C+ D +  Y+NRPDV
Sbjct  268   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQQVTEAIDVCVEDEIVNYLNRPDV  327

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRI  1187
             QKALHA   G +  W   S     D  L +  I     +  L+ + IPVL+YSGDQD  I
Sbjct  328   QKALHARLVGVR-QWAVCS--NILDYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQDSVI  384

Query  1188  PVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGG  1367
             P++ +R +   LA +L L T      W++G+++GGW+Q +GN         L+FAT+RG 
Sbjct  385   PLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNI--------LSFATIRGA  436

Query  1368  SHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             SH  P S P ++L LFK+FL+G P P  
Sbjct  437   SHEAPFSQPERSLVLFKSFLEGRPLPEV  464



>ref|XP_009337518.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=468

 Score =   343 bits (879),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 193/445 (43%), Positives = 259/445 (58%), Gaps = 23/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F  +SGYI       ++LFYYFAEA+     S PL LWL GG  CSS 
Sbjct  39    ITSLPGQPP-VRFQHFSGYITVDDHNHKSLFYYFAEAEITPA-SKPLVLWLNGGPGCSSL  96

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  DGE LV+N++SWN  +NMLY++TP+GV FSY+ +SS Y    D  
Sbjct  97    GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYAKSSSSYIAVDDEA  154

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL++WF +F +Y+  D ++ G+SY GH  PQLA L++E NR     +   LKG
Sbjct  155   TARDNLVFLQRWFNKFPQYKHRDLFLTGESYAGHYIPQLAKLMIEINRKE---KSFNLKG  211

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+    +S  CS +
Sbjct  212   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYNMFTSVCNYSRYVSEYYRDSMSPVCSRV  271

Query  837   EIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                +S+E    +DK ++          S S        TE  D C+ D    Y+NR DVQ
Sbjct  272   MSQVSKETSKFVDKYDVTLDVCISSVLSQSKVISPNQMTERIDVCVEDKTVNYLNRKDVQ  331

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W+  S     D  + N  I  +  + +L+   IPVL+YSGDQD  IP
Sbjct  332   KALHARLVGVRR-WDVCS--NILDYQVLNLEIPTISLVGSLVKQGIPVLVYSGDQDSVIP  388

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W++GK++GGW+Q +GN         L+FAT+RG S
Sbjct  389   LTGSRSLVYRLATELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LSFATIRGAS  440

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFK+FL+G P P
Sbjct  441   HEAPFSQPGRSLRLFKSFLEGRPLP  465



>gb|KFK44682.1| hypothetical protein AALP_AA1G289900 [Arabis alpina]
Length=463

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 191/444 (43%), Positives = 262/444 (59%), Gaps = 20/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+   + + RALFYYFAEA++ +  S PL LWL GG  CSS 
Sbjct  33    VTRLPGQPL-VGFEQYSGYVTVDETKQRALFYYFAEAET-NPTSKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  91    GVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A++NL FL++WF++F  Y +   +I G+SY GH  PQLA L+++ N+   HL    L+GI
Sbjct  150   AKDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMIQYNKKHHHL--FNLRGI  207

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+  G +S  CS + 
Sbjct  208   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSMCSKVM  267

Query  840   IMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++    C     S S         E+ D C+ D    Y+NR DVQ 
Sbjct  268   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVSYLNRRDVQA  327

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D  L +     +  + +L+ + +PVL+YSGDQD  IP+
Sbjct  328   ALHARLIGVR-EWTVCS--NVLDYELLDVEKPTINIVGSLVKAGVPVLVYSGDQDSVIPL  384

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R + + LA RL L T      W+ G+++GGW+Q +GN         L+FATVRG SH
Sbjct  385   TGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASH  436

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
              VP S P ++L LFKAFL G P P
Sbjct  437   EVPFSQPERSLVLFKAFLDGHPLP  460



>ref|XP_010929656.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 193/446 (43%), Positives = 256/446 (57%), Gaps = 21/446 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGYI     + RALFYYFAEA+  D ++ PL LWL GG  CSS 
Sbjct  34    ITKLPGQP-QVSFQQFSGYITVDDRKQRALFYYFAEAEL-DPYTKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+    LV+N+FSWN  +NMLY++TP GV FSY+  SS Y    D MT
Sbjct  92    GVGAFSENGPFRPSGQ-VLVRNEFSWNKEANMLYLETPAGVGFSYATDSSYYDGVDDKMT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL +WF +F +Y+D D YI G+SY GH  PQLA L++  N+         LKGI
Sbjct  151   ARDNLVFLLRWFTKFPQYKDRDLYITGESYAGHYVPQLAELMVLFNKKK---NVFNLKGI  207

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G LS  C+ + 
Sbjct  208   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTYACNYSRYVSEYYRGSLSPVCARVM  267

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++          S S         E  D C+ D    Y+NR DVQ 
Sbjct  268   GQVTRETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVPEHIDVCVEDETVNYLNRKDVQD  327

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             A+HA  TG    W+  S     +  L N  I  +  + +L+ S IPVL+YSGDQD  IP+
Sbjct  328   AMHARLTGVP-KWSVCS--SVLEYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDSVIPL  384

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA  LKL T      W++ K++GGW+Q +G+         LTFAT+RG SH
Sbjct  385   TGSRTLVQRLAKELKLKTTVPYRVWFEDKQVGGWTQVYGDI--------LTFATIRGASH  436

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPNT  1451
               P S P ++L LF+AFL+G P P T
Sbjct  437   EAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_010549304.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Tarenaya 
hassleriana]
Length=467

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 190/445 (43%), Positives = 259/445 (58%), Gaps = 22/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  37    VAQLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAEA-DPASKPLVLWLNGGPGCSSL  94

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN+ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  95    GVGAFSENGPFRP-KGPILVKNEHSWNKEANMLYLETPVGVGFSYSTDSSSYEGVNDKIT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F +Y +   +I G+SY GH  PQLA L+++ N+     +   L+GI
Sbjct  154   ARDNLVFLQRWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKH---KLFNLRGI  210

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y M    CN +  + E+  G +S  CS + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGTVSAMCSKVM  270

Query  840   IMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
               +S E    +DK ++   V      S            ET D C+ D    Y+NR DVQ
Sbjct  271   SQVSVETSRFVDKYDVTLDVCIPSVLSQSKVVSPQQQVGETVDVCVEDETVSYLNRRDVQ  330

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             ++LHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+YSGDQD  IP
Sbjct  331   RSLHARLVGVR-KWAVCS--NVLDYELLDVEIPTITVVGNLVKAGIPVLVYSGDQDSVIP  387

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L+L T      W+ G+++GGW+Q +GN         L+FATVRG S
Sbjct  388   LTGSRTLVNRLAEELRLRTTVPYRVWFAGQQVGGWTQVYGNI--------LSFATVRGAS  439

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H VP S P ++L LFKAF+ G P P
Sbjct  440   HEVPFSQPQRSLVLFKAFINGHPLP  464



>gb|AAG51475.1|AC069471_6 serine carboxypeptidase II, putative [Arabidopsis thaliana]
Length=456

 Score =   342 bits (876),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 194/442 (44%), Positives = 266/442 (60%), Gaps = 22/442 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++    S PL LWL GG  CSS 
Sbjct  32    VTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAETNPS-SKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  90    GVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVNDKIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLA L+++ N+   HL    L+GI
Sbjct  149   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAELMIQYNKK-HHL--FNLRGI  205

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+  G +S  CS + 
Sbjct  206   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSMCSKVM  265

Query  840   IMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
               +S E    +DK ++    C  S +S S+Q     E+ D C+ D    Y+NR DVQ+AL
Sbjct  266   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKQ---VGESVDVCVEDETVNYLNRRDVQEAL  322

Query  1020  HANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSH  1199
             HA   G +  W   S     D  L +  I  +  + +L+ + +PVL+YSGDQD  IP++ 
Sbjct  323   HARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPLTG  379

Query  1200  TREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1379
             +R + + LA +L L T      W+ G+++GGW+Q +GN         L+FATVRG SH V
Sbjct  380   SRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASHEV  431

Query  1380  PNSSPSKALTLFKAFLKGSPPP  1445
             P S P ++L LFKAFL G P P
Sbjct  432   PFSQPERSLVLFKAFLDGHPLP  453



>gb|KHN08898.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=453

 Score =   342 bits (876),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 187/473 (40%), Positives = 270/473 (57%), Gaps = 31/473 (7%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++  ++  +L  TL  +      + I +LPGQP  V+F QYSGY+       RALFYYF 
Sbjct  1     MIATIIIIVLAQTLVGVISLPEADKISNLPGQP-QVEFQQYSGYVTVDDQHQRALFYYFV  59

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA+ ED  S PL LWL GG  CSS  +G F E+GPFRP+++  L +N +SWN  +N+LY+
Sbjct  60    EAE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDYSWNKVANVLYL  118

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++P GV FSYS+  S Y   +D +TAR+NL FL++WF +F EY + DF+I G+SYGGH  
Sbjct  119   ESPAGVGFSYSSNKSFYASVTDEITARDNLVFLQRWFTKFPEYSNNDFFITGESYGGHYV  178

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQK  764
             PQL+ LI++   N        LKGIA+GNP+LE  +   S  E+ W HG+IS+  Y +  
Sbjct  179   PQLSQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYFWSHGLISDSTYEVLT  232

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHY  938
             +VCN +++  +  +G L   C     +L+ EI + +DK ++         +  +      
Sbjct  233   RVCNFSSIRRQIQNGNLRGVCVKANKLLNTEISNFIDKYDVTLDVCLSSVNQQAYVLNQL  292

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAI  1106
               T+  D C+ D    Y+NR  VQKALHAN  G        +   T   +LH    N  I
Sbjct  293   QETQKIDVCIGDKTTTYLNRKQVQKALHANLVG-------VTKWSTCSSVLHYDYQNLEI  345

Query  1107  DILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEI  1286
               +P L +L+ S I VL+YSGDQD  IP+  +R +   LA  + L T      W++GK++
Sbjct  346   PTIPILGSLVKSGIKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLDTTVAYRAWFEGKQV  405

Query  1287  GGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              GW++ +GN         L++AT+RG SH  P S P ++L L KAFL+G P P
Sbjct  406   AGWTKVYGNI--------LSYATIRGASHEAPFSQPQRSLLLLKAFLEGKPLP  450



>ref|XP_008369640.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=463

 Score =   342 bits (877),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 201/450 (45%), Positives = 271/450 (60%), Gaps = 34/450 (8%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + +ALFYY AEA+  D  S PL LWL GG  CSS 
Sbjct  35    ITGLPGQPP-VGFQQYSGYVTVDEKKQKALFYYLAEAEI-DPASKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  93    GVGAFSENGPFRP--QGEVLVRNEHSWNTEANMLYLETPIGVGFSYSTDTSSYEGVTDHI  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+KW  +F +YR+   YI G+SY GH  PQLA L+L+  +         LKG
Sbjct  151   TARDNLLFLQKWLEKFPQYRNRSLYITGESYAGHYVPQLAELMLQFKKE----YQFNLKG  206

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G LS  C+ +
Sbjct  207   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYNMFTSVCNYSRYVSEYYRGSLSPICARV  266

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADP---CLRDWVGEYINRPDV  1007
                +S E    +DK ++    C SS  S S+   L  E AD    C+ D +  Y+NRPDV
Sbjct  267   MSQVSTETSKFVDKYDVTLDVCISSVFSQSKA-LLPQEVADTIDVCVEDEIVNYLNRPDV  325

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLSA---LLMSDIPVLIYSGDQ  1175
             QKALHA   G +  W   S       IL    +D+ +PT++    L+ + IPVL+YSGDQ
Sbjct  326   QKALHARLVGVR-QWAVCS------TILDYQHLDVEIPTITIIGNLIKAGIPVLVYSGDQ  378

Query  1176  DLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFAT  1355
             D  IP++ +R++   LA +L+L+T      W+ G+++GGW+Q +GN         L+FAT
Sbjct  379   DSVIPLTGSRKLVNGLAEQLRLSTTVPYRVWFGGQQVGGWTQVYGNM--------LSFAT  430

Query  1356  VRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +RG SH  P S P ++L LFK+FL+G P P
Sbjct  431   IRGASHEAPFSQPERSLVLFKSFLEGRPLP  460



>ref|XP_011086871.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=466

 Score =   342 bits (877),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 190/444 (43%), Positives = 258/444 (58%), Gaps = 20/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+   +   RALFYYF EA++ D  S PL LWL GG  CSS 
Sbjct  36    ISQLPGQPR-VSFQQFSGYVNVDEKEERALFYYFVEAET-DPASKPLVLWLNGGPGCSSL  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +N+LY+++PIGV FSYS  SS Y+  +D +T
Sbjct  94    GVGAFSENGPFRPSGNAALVRNEYSWNKEANILYLESPIGVGFSYSVNSSSYEGVNDKIT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WF++F +YR+   YI G+SY GH  PQLA L+L  N+     +   LKGI
Sbjct  154   ARDNLVFLQNWFLKFPQYRNRSLYITGESYAGHYIPQLAELMLHFNKKE---KIFNLKGI  210

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G LS  CS + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKLFTSACNYSRYVSEYYRGSLSPICSKVM  270

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
              +++ E    +DK ++          S S        TE  D C+ D    Y+NR DV+ 
Sbjct  271   SLVTTETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDETVNYLNRRDVRN  330

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G    W   S     D  L +  I  +  +  ++ + IPVL+YSGDQD  IP+
Sbjct  331   ALHARLVGVN-RWLVCS--NILDYELLDIEIPTINVVGRIIEAGIPVLVYSGDQDSVIPL  387

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R++   LA  LKL T      W+ G ++GGW+Q +GN         L+FATVRG SH
Sbjct  388   TGSRKLVHRLARELKLRTTTPYRVWFAGMQVGGWTQVYGNI--------LSFATVRGASH  439

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
               P S P ++L LFKAFL+G P P
Sbjct  440   EAPFSQPERSLVLFKAFLEGRPLP  463



>ref|XP_010509871.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   342 bits (876),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 195/468 (42%), Positives = 275/468 (59%), Gaps = 23/468 (5%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             L+ FL   +L S ++    + I  LPGQP  V F QYSGY+   + + RALFYY AEA++
Sbjct  13    LILFLQTLSLVSSTVLSRADRITRLPGQP-QVGFQQYSGYVTVDEKKQRALFYYLAEAET  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             +   S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+
Sbjct  72    K-PISKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPV  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSY+  SS Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA
Sbjct  130   GVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              L+++ N+         LKGIA+GNP++E  +   S  E+ W HG+IS+  Y M    CN
Sbjct  190   QLMIQYNK---QHNLFNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCN  246

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssq----qHYLA  944
              +  + E+  G +S  C+ +   +S E    +DK ++    C  S +S S+    Q    
Sbjct  247   YSRYVSEYYRGTVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSKRVNPQPQEM  306

Query  945   TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  1124
              ET D C+ D    Y+NR DVQKALHA   G +  W+  S     D  + +  +  +  +
Sbjct  307   GETVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWSVCS--NVLDYEVLDVEVPTINIV  363

Query  1125  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  1304
               L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q 
Sbjct  364   GTLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQV  423

Query  1305  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             +GN         L FATVRG +H VP S P++AL LFKAFL G P P+
Sbjct  424   YGNI--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGLPLPD  463



>ref|XP_007223032.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24231.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=464

 Score =   342 bits (876),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 197/447 (44%), Positives = 263/447 (59%), Gaps = 25/447 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  37    IALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCSSL  94

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LV+N+ SWN  +NMLY++TPIGV FSYS  +S Y+  +D +
Sbjct  95    GVGAFSENGPFRPS--GEVLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVNDHI  152

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+ W  +F +Y++   +I G+SY GH  PQLA L+L+            LKG
Sbjct  153   TARDNLLFLQNWLEKFPQYKNRSLFITGESYAGHYVPQLAELMLQYKE-----YQFNLKG  207

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G +S  CS +
Sbjct  208   IALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICSRV  267

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHY--LATETADPCLRDWVGEYINRPDVQ  1010
                +S E    +DK ++    C SS  S S+       TE  D C+ D +  Y+NRPDVQ
Sbjct  268   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQVTEAIDVCVEDEIVNYLNRPDVQ  327

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W   S     D  L +  I     +  L+ + IPVL+YSGDQD  IP
Sbjct  328   KALHARLVGVR-QWAVCS--NILDYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQDSVIP  384

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA +L L T      W++G+++GGW+Q +GN         L+FAT+RG S
Sbjct  385   LTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNI--------LSFATIRGAS  436

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             H  P S P ++L LFK+FL+G P P  
Sbjct  437   HEAPFSQPERSLVLFKSFLEGRPLPEV  463



>ref|XP_004310134.1| PREDICTED: serine carboxypeptidase-like 45-like [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   341 bits (875),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 194/445 (44%), Positives = 262/445 (59%), Gaps = 24/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F  YSGY+   + + RALFYYFAEA+ E   S PL LWL GG  CSS 
Sbjct  30    ITRLPGQP-QVGFQHYSGYVTVDEKKQRALFYYFAEAEVEPA-SKPLVLWLNGGPGCSSL  87

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LV+N++SWN  +NMLY++TPIGV FSYS  ++ Y+  +D +
Sbjct  88    GVGAFSENGPFRPS--GEVLVRNEYSWNREANMLYLETPIGVGFSYSTDTASYESVNDRI  145

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+KW  +F +YR+   +I G+SY GH  PQLA L+L+ ++   H     LKG
Sbjct  146   TARDNLMFLQKWLDKFPQYRNRSLFITGESYAGHYVPQLAELMLQFSKE-YHF---NLKG  201

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+  G +S  CS +
Sbjct  202   IALGNPVLEYATDFNSRSEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICSKV  261

Query  837   EIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                +S E    +DK ++          S S        TE+ D C+ D    Y+NR DVQ
Sbjct  262   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLSPQQVTESIDVCVEDETVNYLNRLDVQ  321

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W   S     D  L +  I  +  +  L+ + I VL+YSGDQD  IP
Sbjct  322   KALHARLVGVR-KWAVCS--NVLDYELLDLEIPTISIVGKLIKAGISVLVYSGDQDSVIP  378

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  LKL T      W++G+++GGW+Q +GN         L+FAT+RG S
Sbjct  379   LTGSRTLVHGLAEELKLNTTVPYRVWFEGQQVGGWTQVYGNM--------LSFATIRGAS  430

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFK+FL+G P P
Sbjct  431   HEAPFSQPERSLVLFKSFLEGRPLP  455



>ref|XP_003554110.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   341 bits (875),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 194/484 (40%), Positives = 274/484 (57%), Gaps = 39/484 (8%)
 Frame = +3

Query  18    AFTFIIDII*KIMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHK  197
             +FT I  II  I+V      L  TL  +      + I +LPGQP  V+F QYSGY+    
Sbjct  7     SFTMIATII--IIV------LAQTLVGVISLPEADKISNLPGQP-QVEFQQYSGYVTVDD  57

Query  198   FRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQF  377
                RALFYYF EA+ ED  S PL LWL GG  CSS  +G F E+GPFRP+++  L +N +
Sbjct  58    QHQRALFYYFVEAE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDY  116

Query  378   SWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFY  557
             SWN  +N+LY+++P GV FSYS+  S Y   +D +TAR+NL FL++WF +F EY + DF+
Sbjct  117   SWNKVANVLYLESPAGVGFSYSSNKSFYASVTDEITARDNLVFLQRWFTKFPEYSNNDFF  176

Query  558   IAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHG  731
             I G+SYGGH  PQL+ LI++   N        LKGIA+GNP+LE  +   S  E+ W HG
Sbjct  177   ITGESYGGHYVPQLSQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYFWSHG  230

Query  732   IISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qsce  905
             +IS+  Y +  +VCN +++  +  +G L   C     +L+ EI + +DK ++        
Sbjct  231   LISDSTYEVLTRVCNFSSIRRQIQNGNLRGVCVKANKLLNTEISNFIDKYDVTLDVCLSS  290

Query  906   sssisssqqHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDV  1085
              +  +        T+  D C+ D    Y+NR  VQKALHAN  G        +   T   
Sbjct  291   VNQQAYVLNQLQETQKIDVCIGDKTTTYLNRKQVQKALHANLVG-------VTKWSTCSS  343

Query  1086  ILH----NFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLE  1253
             +LH    N  I  +P L +L+ S I VL+YSGDQD  IP+  +R +   LA  + L T  
Sbjct  344   VLHYDYQNLEIPTIPILGSLVKSGIKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLDTTV  403

Query  1254  MNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKG  1433
                 W++GK++ GW++ +GN         L++AT+RG SH  P S P ++L L KAFL+G
Sbjct  404   AYRAWFEGKQVAGWTKVYGNI--------LSYATIRGASHEAPFSQPQRSLLLLKAFLEG  455

Query  1434  SPPP  1445
              P P
Sbjct  456   KPLP  459



>ref|XP_007137891.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
 gb|ESW09885.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
Length=467

 Score =   341 bits (874),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 270/447 (60%), Gaps = 25/447 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             ID LPGQP  V F Q+SGY+     + ++LFYYFAE+++ D  S PL LWL GG  CSS 
Sbjct  36    IDELPGQPY-VGFQQFSGYVTVDDKKHKSLFYYFAESET-DPASKPLVLWLNGGPGCSSL  93

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE L+KN++SWN  +NMLY++TP+GV FSY+  SS Y   +D  
Sbjct  94    GVGAFSENGPFRP--NGEFLIKNEYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVNDEA  151

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL +WF +F +YR  D ++ G+SY GH  PQLA L+++ N      +   LKG
Sbjct  152   TARDNLVFLLRWFNKFPQYRSRDLFLTGESYAGHYVPQLAKLMIKMNTKK---KIFNLKG  208

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +  + E+    +S  CS +
Sbjct  209   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYYRDSISPLCSKV  268

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssq----qHYLATETADPCLRDWVGEYINRPD  1004
                +S E    +DK ++    C SS +S S     +   A+E+ D C+ D V  Y+NR D
Sbjct  269   MGQVSRETSKFVDKYDVTLDVCISSVLSQSNVISPKTQEASESIDVCVDDKVTNYLNRRD  328

Query  1005  VQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLR  1184
             VQ+ALHA   G +  W+  S     D++  N  +  LP + +L+ + + VLIYSGDQD  
Sbjct  329   VQEALHAKLVGVR-KWDVCSNVLNYDML--NLEVPTLPVVGSLIKAGVRVLIYSGDQDSV  385

Query  1185  IPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRG  1364
             IP++ +R +   L  +L L T      W++G+++GGW+Q  GN+        L+FATVRG
Sbjct  386   IPLTGSRTLVQKLGRQLGLNTTVPYRVWFEGQQVGGWTQVHGNT--------LSFATVRG  437

Query  1365  GSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              SH VP S P ++L LFK+FLKG   P
Sbjct  438   ASHEVPFSQPRRSLVLFKSFLKGISLP  464



>ref|XP_008374178.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=467

 Score =   341 bits (874),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 197/445 (44%), Positives = 264/445 (59%), Gaps = 24/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGYI       +ALFYYFAEA   +  S PL LWL GG  CSS 
Sbjct  39    ITRLPGQP-HVGFQQFSGYITVDDHNHKALFYYFAEADI-NPASKPLVLWLNGGPGCSSL  96

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  DGE LV+N++SWN  +NMLY++TP+GV FSYS ++S Y    D  
Sbjct  97    GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYSKSNSSYMAVDDEA  154

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR NL FL++W  +F +YR +D ++AG+SY GH  PQLA LI+E NR         LKG
Sbjct  155   TARXNLVFLQRWLNKFPQYRHMDLFLAGESYAGHYIPQLAKLIVEINRK----EKFNLKG  210

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E LW HG+IS+  Y M   VCN +  + E+    +S  CS +
Sbjct  211   IALGNPVLEFATDLNSQAEFLWSHGLISDSTYNMFTSVCNYSRYVSEYYRRSVSPVCSRV  270

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssq--qHYLATETADPCLRDWVGEYINRPDVQ  1010
                +++E    +DK ++    C SS +S S+       TE  D C+ D    Y+NR DVQ
Sbjct  271   VSQVTKETSQFVDKYDVTLDVCISSVLSQSKFISPNQMTERIDVCVEDKTVIYLNRKDVQ  330

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W+  S     +  + N  I  +  + +L+   I VL+YSGDQD  IP
Sbjct  331   KALHARLVGVR-RWDVCS--SILEYQMLNLEIPTISLVGSLVKQGIQVLVYSGDQDSVIP  387

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R + + LA  L L T      W++GK++GGW+Q +GN         L+FAT+RG S
Sbjct  388   LTGSRRLVSRLARELGLNTTVPYRVWFEGKQVGGWTQVYGNI--------LSFATIRGAS  439

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFK+FL+G P P
Sbjct  440   HEAPFSQPERSLRLFKSFLEGRPLP  464



>ref|XP_010549305.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score =   341 bits (874),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 191/444 (43%), Positives = 260/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  37    VAQLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAEA-DPASKPLVLWLNGGPGCSSL  94

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN+ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  95    GVGAFSENGPFRP-KGPILVKNEHSWNKEANMLYLETPVGVGFSYSTDSSSYEGVNDKIT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F +Y +   +I G+SY GH  PQLA L+++ N+     +   L+GI
Sbjct  154   ARDNLVFLQRWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKH---KLFNLRGI  210

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y M    CN +  + E+  G +S  CS + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGTVSAMCSKVM  270

Query  840   IMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++    C     S S         ET D C+ D    Y+NR DVQ+
Sbjct  271   SQVSVETSRFVDKYDVTLDVCIPSVLSQSKVVSPQQVGETVDVCVEDETVSYLNRRDVQR  330

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             +LHA   G +  W   S     D  L +  I  +  +  L+ + IPVL+YSGDQD  IP+
Sbjct  331   SLHARLVGVR-KWAVCS--NVLDYELLDVEIPTITVVGNLVKAGIPVLVYSGDQDSVIPL  387

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA  L+L T      W+ G+++GGW+Q +GN         L+FATVRG SH
Sbjct  388   TGSRTLVNRLAEELRLRTTVPYRVWFAGQQVGGWTQVYGNI--------LSFATVRGASH  439

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
              VP S P ++L LFKAF+ G P P
Sbjct  440   EVPFSQPQRSLVLFKAFINGHPLP  463



>ref|XP_010478165.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   341 bits (875),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 193/444 (43%), Positives = 262/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             + SLPGQP  V F QYSGY+     + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  62    VTSLPGQP-QVGFQQYSGYVTVDDKKQRALFYYFAEAET-DPTSKPLVLWLNGGPGCSSL  119

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN  SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  120   GVGAFSENGPFRP-KGPILVKNHHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDKIT  178

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F  Y +   YI G+SY GH  PQLA L+++ N+   HL    L+GI
Sbjct  179   ARDNLVFLQRWFLKFPHYLNRSLYITGESYAGHYVPQLAQLMIQYNKK-HHL--FNLRGI  235

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+  G +S  CS + 
Sbjct  236   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSICSKVM  295

Query  840   IMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++    C     S S         E+ D C+ D    Y+NR DVQ+
Sbjct  296   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQE  355

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D  L +     +  + +L+ + +PVL+YSGDQD  IP+
Sbjct  356   ALHARLIGVR-EWTVCS--NVLDYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQDSVIPL  412

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R + + LA +L L T      W+ G+++GGW+Q +GN         L+FATVRG SH
Sbjct  413   TGSRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASH  464

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
              VP S P ++L LFKAFL G P P
Sbjct  465   EVPFSQPERSLVLFKAFLGGHPLP  488



>gb|KDP37688.1| hypothetical protein JCGZ_06345 [Jatropha curcas]
Length=468

 Score =   340 bits (873),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 188/461 (41%), Positives = 270/461 (59%), Gaps = 42/461 (9%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GY+  ++ + RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  25    ILSLPGQPK-VSFKQYAGYVTINERQQRALFYYFVEAE-RDTASKPLVLWLNGGPGCSSL  82

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+  G LV+N++SWN  +N++Y+++P+GV FSYS  +S Y   +DT+T
Sbjct  83    GAGAFSEHGPFRPSGKGNLVRNEYSWNKEANIIYLESPVGVGFSYSANASFYDSVNDTIT  142

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A++N  F++KWFI+F EYR+ D +IAG+SY GH  PQLA L+++            LKGI
Sbjct  143   AQDNFIFMQKWFIKFPEYRNRDLFIAGESYAGHYVPQLAELVVQSGLQ------FNLKGI  196

Query  666   ALGNPILE--KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDE-FLSGELSEYCSDI  836
             ALGNP+L+  + S S  ++ W HG+IS+  + +   +CNA+ ++ E  + G LS  C  +
Sbjct  197   ALGNPLLDFSRDSNSRGDYYWSHGLISDSTHQLLNSICNASQLLREGIIIGSLSPACKTV  256

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqH-------YL-------------ATETA  956
              + LS+EI   ++  ++    C S   S  + H       +L             A E  
Sbjct  257   TVQLSKEISDSINGYDVTADVCISYENSKLKLHNDLLRPEFLVSLSTQLPNHPTKAPENI  316

Query  957   DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  1136
             D C+ +   EY+N+ DVQ+ALHA   G    W F SP    D+   N  I ++  + +L+
Sbjct  317   DLCVEEKALEYLNKKDVQEALHAKLVGVT-NWTFCSPVLQYDI--ENLEISMIDVVGSLV  373

Query  1137  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  1316
              S I V++YSGDQD  +P + TR +   LA +L+L T      W + K++GGW+Q +G  
Sbjct  374   TSGIQVMVYSGDQDSVVPFTGTRTLVNDLAKKLRLNTTTTYRAWLEDKQVGGWTQVYGEI  433

Query  1317  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSP  1439
                     L FAT+RGGSH  P SSP ++L LFK F+ G P
Sbjct  434   --------LRFATIRGGSHMTPLSSPKRSLALFKTFVTGDP  466



>tpg|DAA38059.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=466

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 197/463 (43%), Positives = 269/463 (58%), Gaps = 23/463 (5%)
 Frame = +3

Query  75    LLVNTLYSISIRINGE--IIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSED  248
             LL+   +S+S +   E   I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D
Sbjct  21    LLLGDAWSVSAQAAAEEDKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-D  78

Query  249   KFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGV  428
               + PL LWL GG  CSS  +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV
Sbjct  79    PAAKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGV  137

Query  429   AFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAAL  608
              FSYS   + Y+   D+MTAR+NLKFL+ WF  F +Y+  D YI G+SY GH  PQLA  
Sbjct  138   GFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGESYAGHYVPQLAQR  197

Query  609   ILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNAT  782
             ++E N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y +   VCN +
Sbjct  198   MVEFNKKE---KLFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYS  254

Query  783   TMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADP  962
               + E+  G LS  C  +   ++ E    +DK ++    C SS +  SQQ    +   D 
Sbjct  255   RYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQQ---GSRELDV  311

Query  963   CLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMS  1142
             C+ D    Y+NR DVQ+A+HA   G Q  W   S     +    +  I  + T+ AL+ +
Sbjct  312   CVEDETMRYLNRKDVQQAMHARLDGVQR-WTVCS--SVLEYKQLDLQIPTVNTVGALVKA  368

Query  1143  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGG  1322
              IP L+YSGDQD  IP++ +R +   LA RL+L        W+ GK++GGW+Q FG  GG
Sbjct  369   GIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG--GG  426

Query  1323  GEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
                   L+FATVRG SH  P S P ++L LF+AFL G   P +
Sbjct  427   A-----LSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  464



>ref|NP_564298.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 ref|NP_973926.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 sp|Q93Y09.1|SCP45_ARATH RecName: Full=Serine carboxypeptidase-like 45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL24336.1| serine carboxypeptidase II, putative [Arabidopsis thaliana]
 gb|AAP49525.1| At1g28110 [Arabidopsis thaliana]
 gb|AEE30918.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 gb|AEE30919.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
Length=461

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 262/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++    S PL LWL GG  CSS 
Sbjct  32    VTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAETNPS-SKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  90    GVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVNDKIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLA L+++ N+   HL    L+GI
Sbjct  149   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAELMIQYNKK-HHL--FNLRGI  205

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+  G +S  CS + 
Sbjct  206   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSMCSKVM  265

Query  840   IMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++    C     S S         E+ D C+ D    Y+NR DVQ+
Sbjct  266   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQE  325

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+YSGDQD  IP+
Sbjct  326   ALHARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPL  382

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R + + LA +L L T      W+ G+++GGW+Q +GN         L+FATVRG SH
Sbjct  383   TGSRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASH  434

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
              VP S P ++L LFKAFL G P P
Sbjct  435   EVPFSQPERSLVLFKAFLDGHPLP  458



>ref|XP_006844530.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
 gb|ERN06205.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
Length=460

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 188/446 (42%), Positives = 265/446 (59%), Gaps = 22/446 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP+ ++F Q++GYI   + + RALFYYFAEA++ D    PL +WL GG  CSS 
Sbjct  31    ITSLPGQPT-INFQQFAGYITVDEAKPRALFYYFAEAET-DPVLKPLVIWLNGGPGCSSL  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LVKN +SWN  +NMLY++TP GV FSYS   S Y+   D  T
Sbjct  89    GVGAFSENGPFRPSGN-VLVKNHYSWNREANMLYIETPAGVGFSYSTDISFYEGVDDEKT  147

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WFI+F EYR  D +I G+SY GH  PQLA L++E N+     +   LKGI
Sbjct  148   ARDNLVFLKRWFIKFPEYRTRDLFITGESYAGHYIPQLAELMIEANKGE---KLFNLKGI  204

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+L+  +   S  E  W HG+IS+  Y +    CN +  + E+    +S  CS + 
Sbjct  205   ALGNPLLDFSTDFNSRAEFFWSHGLISDPAYRIFTSSCNYSRYVSEYYRENVSPICSRVM  264

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
              ++S E    +DK ++            S + +    +E  D C+ D    Y+NR DVQ+
Sbjct  265   SLVSRETSKFVDKYDVTLDVCISSILMQSKALRPMQVSEPIDVCVEDETVNYLNRKDVQR  324

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA  +G +  W+  S    + +   N  I  +  L  ++ S IPVL+YSGDQD  IP+
Sbjct  325   ALHARLSGDE-TWSVCSSMNYNRL---NLEIPTISLLGLVVKSGIPVLVYSGDQDSVIPL  380

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA +L L T      W++G+++GGW+Q +GN         L+FAT+RG SH
Sbjct  381   TGSRTLVHGLAAKLHLNTTVPYRVWFEGEQVGGWTQVYGNI--------LSFATIRGASH  432

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPNT  1451
               P S P ++L LF+AFL+G P P T
Sbjct  433   EAPFSQPQRSLGLFRAFLQGRPLPET  458



>ref|XP_004975453.1| PREDICTED: serine carboxypeptidase-like 45-like [Setaria italica]
Length=522

 Score =   342 bits (876),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 192/446 (43%), Positives = 263/446 (59%), Gaps = 19/446 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QY+GY+       R+LFYYFAEA++ D  + PL LWL GG  CSS 
Sbjct  90    IGGLPGQPP-VGFAQYAGYVPVDDAGKRSLFYYFAEAEA-DPAAKPLVLWLNGGPGCSSV  147

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +NMLY+++P GV FSYS   S Y+   D+MT
Sbjct  148   GVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYQGVGDSMT  206

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NLKFL+ WF +F +Y+  D YI G+SY GH  PQLA  ++E N+     +   LKGI
Sbjct  207   ARDNLKFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  263

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y +   VCN +  + E+  G LS  C  + 
Sbjct  264   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYSRYVSEYYHGSLSASCDRVM  323

Query  840   IMLSEEIGHDMDKENLVFqscesssisssq--qHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++    C SS +  SQ       +   D C+ D    Y+NR DVQ+
Sbjct  324   SQVTRETSRFVDKYDVTLDVCISSVLMQSQILSPQQGSRELDVCVEDETMSYLNRKDVQQ  383

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             A+HA  +G    W   S     +    +  I  + T+ AL+ S IPVL+YSGDQD  IP+
Sbjct  384   AMHARLSGGVQRWTVCS--SVLEYKQLDLQIPTINTVGALVKSGIPVLVYSGDQDSVIPL  441

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R + + LA RL+L        W+ GK++GGW++ FG  GG      L+FATVRG SH
Sbjct  442   TGSRTLVSRLASRLRLNATAPYRAWFQGKQVGGWTRVFG--GGA-----LSFATVRGASH  494

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPNT  1451
               P S P ++L LF+AFL G P P +
Sbjct  495   EAPFSQPERSLGLFRAFLAGRPLPES  520



>ref|XP_002893504.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69763.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 263/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             +  LPGQP  V F QYSGY+     + RALFYYFAEA++    S PL LWL GG  CSS 
Sbjct  33    VTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAETNPS-SKPLVLWLNGGPGCSSL  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  91    GVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVNDKIT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLA L+++ N+   HL    L+GI
Sbjct  150   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMIQYNKK-HHL--FNLRGI  206

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+  G +S  CS + 
Sbjct  207   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSMCSKVM  266

Query  840   IMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++    C     S S         E+ D C+ D    Y+NR DVQ+
Sbjct  267   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQE  326

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+YSGDQD  IP+
Sbjct  327   ALHARLIGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPL  383

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R + + LA +L L T      W+ G+++GGW+Q +GN         L+FATVRG SH
Sbjct  384   TGSRILVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASH  435

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
              VP S P+++L LFKAFL G P P
Sbjct  436   EVPFSQPARSLVLFKAFLDGHPLP  459



>ref|XP_008667417.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA38060.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=472

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 194/468 (41%), Positives = 266/468 (57%), Gaps = 27/468 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGE--IIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSED  248
             LL+   +S+S +   E   I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D
Sbjct  21    LLLGDAWSVSAQAAAEEDKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-D  78

Query  249   KFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGV  428
               + PL LWL GG  CSS  +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV
Sbjct  79    PAAKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGV  137

Query  429   AFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAAL  608
              FSYS   + Y+   D+MTAR+NLKFL+ WF  F +Y+  D YI G+SY GH  PQLA  
Sbjct  138   GFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGESYAGHYVPQLAQR  197

Query  609   ILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNAT  782
             ++E N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y +   VCN +
Sbjct  198   MVEFNKKE---KLFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYS  254

Query  783   TMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETA  956
               + E+  G LS  C  +   ++ E    +DK ++            S        +   
Sbjct  255   RYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSREL  314

Query  957   DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH---NFAIDILPTLS  1127
             D C+ D    Y+NR DVQ+A+HA   G Q  W   S    S V+ +   +  I  + T+ 
Sbjct  315   DVCVEDETMRYLNRKDVQQAMHARLDGVQR-WTVCS----SSVLEYKQLDLQIPTVNTVG  369

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
             AL+ + IP L+YSGDQD  IP++ +R +   LA RL+L        W+ GK++GGW+Q F
Sbjct  370   ALVKAGIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVF  429

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             G  GG      L+FATVRG SH  P S P ++L LF+AFL G   P +
Sbjct  430   G--GGA-----LSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  470



>ref|XP_010239839.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=465

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 189/450 (42%), Positives = 261/450 (58%), Gaps = 26/450 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F QYSGY+     R R+LFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  32    IRGLPGQPP-VSFAQYSGYVAVDAARKRSLFYYFAEAEL-DPATKPLVLWLNGGPGCSSV  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +NMLY+++P GV FSYS   S Y    D+MT
Sbjct  90    GVGAFSENGPFRPSGNA-LVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYGGVGDSMT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NLKFL+ WF +F  Y+  D YI G+SY GH  PQLA  I+E N+     +   LKGI
Sbjct  149   ARDNLKFLQGWFAKFPRYKGRDLYITGESYAGHYVPQLAQRIVEFNKKE---KLFNLKGI  205

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y +  +VCN +  + E+  G +S  C  + 
Sbjct  206   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFSRVCNYSRYVSEYYHGSISPVCDRVM  265

Query  840   IMLSEEIGHDMDKENLVF------qscesssisssqqHYLATETADPCLRDWVGEYINRP  1001
               ++ E    +DK ++           +S +++      L+ E  D C+ D    Y+NR 
Sbjct  266   SQVTRETSRFVDKYDVTLDVCISSVLAQSKTLTPQSTQQLSREL-DVCVEDETMNYLNRK  324

Query  1002  DVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDL  1181
             DVQ+A+HA   G    W   S     +    +  I  + T+  L+ S IPVL+YSGDQD 
Sbjct  325   DVQQAMHARLNGVP-KWTVCS--SVLEYKQLDLQIPTINTVGMLVKSGIPVLVYSGDQDS  381

Query  1182  RIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVR  1361
              IP++ +R +   LA RL+L        W++GK++GGW+Q FG++        L+FAT+R
Sbjct  382   VIPLTGSRTLVHRLAKRLRLNATVPYRVWFEGKQVGGWTQVFGDA--------LSFATIR  433

Query  1362  GGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             G SH  P S P ++L LF+AFL G P P +
Sbjct  434   GASHEAPFSQPERSLVLFRAFLAGRPLPES  463



>gb|KHN13827.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   339 bits (869),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 190/445 (43%), Positives = 257/445 (58%), Gaps = 28/445 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F+Q+SGY+       RALF+YFAEA+ +D  S PL LWL GG  CSS 
Sbjct  32    ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +G LV+NQFSWN  +NMLY++TPIGV FSYS  +S Y+       
Sbjct  90    GVGAFSENGPFRPKGEG-LVRNQFSWNKEANMLYLETPIGVGFSYSTDTSSYE-------  141

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A +NL FL+ WF++F EYR+   +I G+SY GH  PQLA L+L  NR     +   LKGI
Sbjct  142   AGDNLVFLQNWFMKFPEYRNRSLFIVGESYAGHYVPQLAELMLRFNRKE---KLFNLKGI  198

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y M   VCN +T + E+ +G +S  CS + 
Sbjct  199   ALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPTCSSVM  258

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    ++K ++          S +        TET D C+ D    Y+NR DVQ 
Sbjct  259   SQVSTETSRFVEKYDVTLDVCLSSVFSQTKVLNPQQVTETIDVCVEDETVNYLNRKDVQS  318

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA+  G Q    +++     D  L +     +  +  L+   IPVL+YSGDQD  IP+
Sbjct  319   ALHAHLVGVQ---RWSACSNVLDYELRDLETPTITVVGKLVKEGIPVLVYSGDQDSVIPL  375

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA  L L T      W++ +++GGW+Q +GN         L+FAT+RG SH
Sbjct  376   TGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNI--------LSFATIRGASH  427

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPN  1448
               P S P ++L LFK+FL+G P P 
Sbjct  428   EAPFSQPERSLVLFKSFLEGGPLPQ  452



>ref|XP_003520484.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 268/472 (57%), Gaps = 31/472 (7%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  L  +L  TL  +S     + I +LPGQP  V F QYSGY+       RALFYYF E
Sbjct  10    MIATLIIVLAQTLVGVSSLPEADKIINLPGQPK-VKFQQYSGYVTVDDQHQRALFYYFVE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+ ED  S PL LWL GG  CSS   G F E+GPFRP+++  L KN +SWN A+NMLY++
Sbjct  69    AE-EDPSSKPLVLWLNGGPGCSSIGTGAFTEHGPFRPSDNNLLEKNDYSWNKAANMLYLE  127

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS   S Y + +D +TAR+NL FL++WF +F EY   DF+I G+SYGGH  P
Sbjct  128   SPAGVGFSYSRNKSFYALVTDEITARDNLLFLQRWFTKFPEYSKRDFFITGESYGGHYVP  187

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA LI++   N        LKGIA+GNP+LE  +   S  E+ W HG+IS+  Y +  +
Sbjct  188   QLAQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYFWSHGLISDPTYEVLTR  241

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsces--ssisssqqHYL  941
              CN +++  ++ +G L   C     +L  E+ + +D+ ++    C S  +  +       
Sbjct  242   DCNFSSIRRQWQNGNLRGVCEKANKLLDSEVSYYVDEYDVTLDVCLSPVNQQAYVLNQLQ  301

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAID  1109
              T+  D C+ D    Y+N  +VQ+ALHAN  G        +   T   +LH    N  + 
Sbjct  302   ETQKIDVCVGDKTTTYLNTKEVQEALHANLVG-------VAKWSTCSSVLHYDYQNLEVP  354

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              +P L +L+ S I VL+YSGDQD  IP+  +R +   LA  + L T     PW+  K++ 
Sbjct  355   TIPILGSLVKSSIRVLVYSGDQDSVIPLLGSRSLVNGLAKEIGLNTTVAYRPWFGEKQVA  414

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GW+Q +G+         L++ATVRG SH  P S P ++L L KAFL+G P P
Sbjct  415   GWTQVYGDI--------LSYATVRGASHEAPFSQPQRSLVLLKAFLEGKPLP  458



>ref|XP_011073181.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=458

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 188/446 (42%), Positives = 265/446 (59%), Gaps = 23/446 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F  +SGY+   + + +ALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  29    ITQLPGQPP-VEFQHFSGYVTVDEKKEKALFYYFVEAEI-DPLSKPLVLWLNGGPGCSSI  86

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +G+ L++N++SWN  +NMLY+DTPIGV FSYS  +S Y   +D M
Sbjct  87    GVGAFSENGPFRP--NGQVLLRNEYSWNREANMLYLDTPIGVGFSYSTGASSYVTVNDEM  144

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TA++NL FL++WF++F +YR+   +I G+SY GH  PQLA L++E N+     + I LKG
Sbjct  145   TAKDNLVFLQRWFLKFPQYRNSSLFITGESYAGHYVPQLAKLVIELNKKR---KMINLKG  201

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E+ W HG+IS+  Y +   VCN +  + E+    LS  CS +
Sbjct  202   IALGNPLLEFTTDYNSRAEYFWSHGLISDSTYNLFTSVCNYSRYVREYYRDSLSVLCSRV  261

Query  837   EIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
               +++ E    ++K ++    C     S S        +E  D C+ D    Y+NR DVQ
Sbjct  262   MSLVNRESSRFVNKYDVTLDVCIPSVLSQSKIIAPQRNSERIDVCVEDETVSYLNRRDVQ  321

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W+  S     D  + +  I  +  + +L+   IPVLIYSGDQD  IP
Sbjct  322   KALHARLVGVRR-WDVCS--NILDYDMLDLEIPTISIIGSLIKEGIPVLIYSGDQDSVIP  378

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA +L L T      W++G+++GGW+Q +GN         L+FAT+RG S
Sbjct  379   LTGSRTLVHRLAKQLGLNTTVPYRVWFEGQQVGGWTQVYGNL--------LSFATIRGAS  430

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPPN  1448
             H  P S P ++  LFK+FL G P P 
Sbjct  431   HEAPFSQPERSFVLFKSFLDGRPLPQ  456



>ref|XP_008667418.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF78622.1| unknown [Zea mays]
 gb|ACF84275.1| unknown [Zea mays]
 tpg|DAA38061.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=471

 Score =   339 bits (870),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 263/465 (57%), Gaps = 22/465 (5%)
 Frame = +3

Query  75    LLVNTLYSISIRINGE--IIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSED  248
             LL+   +S+S +   E   I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D
Sbjct  21    LLLGDAWSVSAQAAAEEDKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-D  78

Query  249   KFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGV  428
               + PL LWL GG  CSS  +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV
Sbjct  79    PAAKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGV  137

Query  429   AFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAAL  608
              FSYS   + Y+   D+MTAR+NLKFL+ WF  F +Y+  D YI G+SY GH  PQLA  
Sbjct  138   GFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITGESYAGHYVPQLAQR  197

Query  609   ILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNAT  782
             ++E N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y +   VCN +
Sbjct  198   MVEFNKKE---KLFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYS  254

Query  783   TMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETA  956
               + E+  G LS  C  +   ++ E    +DK ++            S        +   
Sbjct  255   RYVSEYYRGSLSTACDRVMSQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSREL  314

Query  957   DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALL  1136
             D C+ D    Y+NR DVQ+A+HA   G Q  W   S     +    +  I  + T+ AL+
Sbjct  315   DVCVEDETMRYLNRKDVQQAMHARLDGVQR-WTVCS--SVLEYKQLDLQIPTVNTVGALV  371

Query  1137  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  1316
              + IP L+YSGDQD  IP++ +R +   LA RL+L        W+ GK++GGW+Q FG  
Sbjct  372   KAGIPALVYSGDQDSVIPLTGSRTLVGRLAARLRLNATAPYRAWFQGKQVGGWTQVFG--  429

Query  1317  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             GG      L+FATVRG SH  P S P ++L LF+AFL G   P +
Sbjct  430   GGA-----LSFATVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  469



>gb|KHN08897.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=451

 Score =   338 bits (867),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 193/472 (41%), Positives = 271/472 (57%), Gaps = 32/472 (7%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  +  +L  TL  ++     + I +LPGQP  V F QYSGY        RALFYYF E
Sbjct  1     MIATIIIVLAQTLVGVNSLPEADKISNLPGQP-HVKFQQYSGYFSVDNQNQRALFYYFVE  59

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+     S P+ LWL GG  CSS  +G   E+GPF+P +   LVKN FSWN  +N+LY++
Sbjct  60    AEKHPT-SKPVVLWLNGGPGCSSIGVGALVEHGPFKP-DSNVLVKNHFSWNKVANVLYLE  117

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+ +S Y + +D +TAR+NL FL++WF EF EY + DF+I G+SY GH AP
Sbjct  118   SPAGVGFSYSSNASFYTLVTDEITARDNLVFLQRWFTEFPEYSNNDFFITGESYAGHYAP  177

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA LI++   N        LKGIA+GNP++E  +   S  E LW HG+IS+  Y +  +
Sbjct  178   QLAQLIVQTKTN------FNLKGIAIGNPLMEFDTDLNSKAEFLWSHGLISDSTYDLFTR  231

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisss--qqHYL  941
             VCN +T+  + + G LS+ C+ I  ++  E+ + +D+ ++    C SS+   S       
Sbjct  232   VCNYSTIRRQTIHGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSSANQQSYELNQMQ  291

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAID  1109
              T+  D C+ D    Y+NR DVQKALHA   G        S   T   +LH    N  I 
Sbjct  292   ETQKIDVCVDDKAVTYLNRKDVQKALHAKLVG-------VSKWSTCSRVLHYDRRNLEIP  344

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              +  L AL+ S+I VL+YSGDQD  IP+  +R +   LA  L L T      W++GK++ 
Sbjct  345   TISILGALVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFEGKQVA  404

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GW+Q +G          L++AT+RG SH  P + P ++L L KAFL+G P P
Sbjct  405   GWTQVYG--------GMLSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLP  448



>emb|CDO98312.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   338 bits (867),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 185/448 (41%), Positives = 260/448 (58%), Gaps = 21/448 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             ++I  LPGQP  V F Q+SGY+     +G+ALFYYF EA+  D  S PL LWL GG  CS
Sbjct  23    DMITQLPGQP-QVGFQQFSGYVTVDDKKGKALFYYFVEAEI-DCASKPLVLWLNGGPGCS  80

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G F ENGPFRP   G LV+N+ SWN  +N+LY++TP+GV FS+++ SS Y   SD 
Sbjct  81    SLGVGAFSENGPFRPNGQG-LVRNEHSWNREANVLYLETPVGVGFSFADDSSSYDAVSDA  139

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLK  659
             +TAR+NL FL++WF++F +YRD + +I G+SY GH  PQLA L+++ N+     +   LK
Sbjct  140   ITARDNLVFLQRWFLQFPQYRDRNLFITGESYAGHYVPQLAELMIQFNKKE---KLFNLK  196

Query  660   GIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             GIALGNP+LE  +   S  E+ W HG+IS+  Y +    CN +  + E+    +S  CS 
Sbjct  197   GIALGNPVLEYATDLNSRAEYFWSHGLISDSTYKLFTSFCNYSRYVSEYYRDAVSPICSK  256

Query  834   IEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDV  1007
             +   +S E    +DK ++          S S         E  D C+ D    Y+NR DV
Sbjct  257   VMSQVSRETSRFVDKYDVTLDVCISSVLSQSRIISPQQNAERIDVCIEDETVNYLNRQDV  316

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRI  1187
             QKALHA   G +  W   S     D  L +  I  +  + +L+   I VL+YSGDQD  I
Sbjct  317   QKALHARLVGVRR-WLVCS--DILDYQLLDIEIPTISIVGSLIKEGITVLVYSGDQDSVI  373

Query  1188  PVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGG  1367
             P++ +R +   LA +L+L        W+ G+++GGW+Q +GN         L+FAT+RG 
Sbjct  374   PLTGSRSLVHGLAKQLRLNATTPYRVWFAGQQVGGWTQVYGNL--------LSFATIRGA  425

Query  1368  SHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             SH  P S P ++L LFK+FL+G P P  
Sbjct  426   SHEAPFSQPERSLVLFKSFLEGRPLPEV  453



>ref|XP_003554111.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=460

 Score =   338 bits (868),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 192/472 (41%), Positives = 271/472 (57%), Gaps = 32/472 (7%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  +  +L  TL  ++     + I +LPGQP  V F QYSGY        RALFYYF E
Sbjct  10    MIATIIIVLAQTLVGVNSLPEADKISNLPGQP-HVKFQQYSGYFSVDNQNQRALFYYFVE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+     S P+ LWL GG  CSS  +G   E+GPF+P +   LVKN FSWN  +N+LY++
Sbjct  69    AEKHPT-SKPVVLWLNGGPGCSSIGVGALVEHGPFKP-DSNVLVKNHFSWNKVANVLYLE  126

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+ +S Y + +D +TAR+NL FL++WF EF EY + DF+I G+SY GH AP
Sbjct  127   SPAGVGFSYSSNASFYTLVTDEITARDNLVFLQRWFTEFPEYSNNDFFITGESYAGHYAP  186

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA LI++   N        LKGIA+GNP++E  +   S  E LW HG+IS+  Y +  +
Sbjct  187   QLAQLIVQTKTN------FNLKGIAIGNPLMEFDTDLNSKAEFLWSHGLISDSTYDLFTR  240

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisss--qqHYL  941
             VCN +T+  + + G LS+ C+ I  ++  E+ + +D+ ++    C SS+   +       
Sbjct  241   VCNYSTIRRQTIHGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSSANQQAYELNQMQ  300

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAID  1109
              T+  D C+ D    Y+NR DVQKALHA   G        S   T   +LH    N  I 
Sbjct  301   ETQKIDVCVDDKAVTYLNRKDVQKALHAKLVG-------VSKWSTCSRVLHYDRRNLEIP  353

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              +  L AL+ S+I VL+YSGDQD  IP+  +R +   LA  L L T      W++GK++ 
Sbjct  354   TISILGALVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFEGKQVA  413

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GW+Q +G          L++AT+RG SH  P + P ++L L KAFL+G P P
Sbjct  414   GWTQVYG--------GMLSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLP  457



>ref|XP_010469459.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=466

 Score =   338 bits (868),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 191/467 (41%), Positives = 271/467 (58%), Gaps = 23/467 (5%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             L+ FL   +L S ++    + I  LPGQP  V F QYSGY+   + + RALFYY AEA++
Sbjct  14    LILFLQTLSLVSSTVLSRADRITRLPGQPR-VGFQQYSGYVNIDEKKQRALFYYLAEAET  72

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             +   S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+
Sbjct  73    K-PISKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPV  130

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSY+  SS Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA
Sbjct  131   GVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLA  190

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              L+++ N+         LKGIA+GNP++E  +   S  E+ W HG+IS+  Y M    CN
Sbjct  191   QLMIQYNKKHNLF---NLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCN  247

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFq----scesssisssqqHYLA  944
              +  + E+  G +S  C+ +   +S E    +DK ++       S  S S   + Q    
Sbjct  248   YSRYVSEYYRGTVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSKRVNPQPQQV  307

Query  945   TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  1124
              E  D C+ D    Y+NR DVQKALHA   G +   N+       D  + +  +  +  +
Sbjct  308   GEAVDVCVEDETVNYLNRRDVQKALHARLVGTR---NWAVCSNVLDYEVLDVEVPTINIV  364

Query  1125  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  1304
              +L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q 
Sbjct  365   GSLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQV  424

Query  1305  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +GN         L FATVRG +H VP S P++AL LFKAF+ G P P
Sbjct  425   YGNI--------LAFATVRGAAHEVPFSQPARALVLFKAFMGGRPLP  463



>ref|XP_003528093.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=470

 Score =   338 bits (868),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 192/451 (43%), Positives = 269/451 (60%), Gaps = 23/451 (5%)
 Frame = +3

Query  114   NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHD  293
             + + I  LPGQP  V F Q+SGY+     + ++LFYYFAEA++ D  S PL LWL GG  
Sbjct  35    HADTIALLPGQP-HVSFQQFSGYVTVDDKKHKSLFYYFAEAET-DPSSKPLVLWLNGGPG  92

Query  294   CSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWS  473
             CSS  +G F ENGPFRP E+  L+KN +SWN  +NMLY++TP+GV FSY+  SS Y   +
Sbjct  93    CSSLGVGAFSENGPFRPNEEF-LIKNDYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVN  151

Query  474   DTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIK  653
             D  TAR+NL FL +WF +F +Y+  D ++ G+SY GH  PQLA L++E N      +   
Sbjct  152   DEATARDNLVFLLRWFNKFPQYKSRDLFLTGESYAGHYVPQLAKLMVEMNTKN---KIFN  208

Query  654   LKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYC  827
             LKGIALGNP+LE  +   S  E  W HG+IS+  Y M  +VCN +  + E+    +S  C
Sbjct  209   LKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTRVCNYSRYVSEYYRDSVSPLC  268

Query  828   SDIEIMLSEEIGHDMDKENLVFqscesssisssq----qHYLATETADPCLRDWVGEYIN  995
             S +   +S E    +DK ++    C SS +S S+    Q   A E+ D C+ D V  Y+N
Sbjct  269   SKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLN  328

Query  996   RPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQ  1175
             R DVQ+ALHA   G +  W   S     D  + N  +  L  + +L+ + + VLIYSGDQ
Sbjct  329   RRDVQEALHAKLVGVR-KWEVCS--NILDYDMLNLEVPTLLVVGSLIKAGVKVLIYSGDQ  385

Query  1176  DLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFAT  1355
             D  IP++ +R +   LA +L L +      W++G+++GGW+Q +GN         L+FAT
Sbjct  386   DSVIPLTGSRTLVQKLARKLGLNSTVPYRVWFEGQQVGGWTQGYGNI--------LSFAT  437

Query  1356  VRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             VRG SH  P S P ++L LFK+FL+G P P+
Sbjct  438   VRGASHEAPFSQPERSLVLFKSFLEGRPLPD  468



>ref|XP_002322611.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
 gb|EEF04372.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
Length=442

 Score =   337 bits (865),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 192/460 (42%), Positives = 263/460 (57%), Gaps = 27/460 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L  T + I   ++    D   SLPGQP  V F QY+GY+   + + RALFYYF EA++ 
Sbjct  3     VLCATFFQICRAVDSSADDKLLSLPGQPR-VSFQQYAGYVTVDENQDRALFYYFVEAET-  60

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS   G F E+GPFRP+  G LV+N +SWN  +NMLY+++P G
Sbjct  61    DPASKPLVLWLNGGPGCSSVGAGAFSEHGPFRPSGGGSLVRNDYSWNKEANMLYLESPAG  120

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAA  605
             V FSYS   S Y + +DT+T ++N  FL+ WF++F EY++ D +I G+SY GH  PQLA 
Sbjct  121   VGFSYSANQSFYDLVNDTITVQDNFVFLQNWFLKFPEYKNRDLFITGESYAGHYVPQLAD  180

Query  606   LILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNVE--HLWYHGIISEEVYGMQKKVCNA  779
             LI++            LKGIALGNP+LE  +  N E    W HG+IS   Y +   VCN 
Sbjct  181   LIVKSGLK------FNLKGIALGNPLLEFSTDFNSEGDFYWSHGLISNPTYELLSAVCNT  234

Query  780   TTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLATETAD  959
             + +  E +   LS  CS +   L+ EI   +DK ++    C S   S   +   A E  D
Sbjct  235   SQLWRERIGNSLSASCSKVNDQLNAEIPDAIDKYDVTANVCLSFGASLLGK---AQENID  291

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
             PC+++    Y+NR DVQ++ HA   G    W F S     D  L N  I  +  + +L+ 
Sbjct  292   PCVQEETFVYLNRKDVQESFHAKLVG-TPKWTFCSGVVNYD--LRNLEIPTIDVVGSLVN  348

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             S + VL+YSGDQD  IP + +R +   LA +L L       PW++ K++GGW+Q +GN  
Sbjct  349   SGVRVLVYSGDQDSVIPFTGSRTLVEGLAKKLGLNATVPYTPWFEDKQVGGWTQVYGNI-  407

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSP  1439
                    LTF+T+RGGSH  P SSP ++L LF AFL G P
Sbjct  408   -------LTFSTIRGGSHMAPFSSPGRSLALFAAFLSGKP  440



>ref|XP_010249188.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=494

 Score =   339 bits (870),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 190/445 (43%), Positives = 262/445 (59%), Gaps = 23/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  V F Q+SGY+   + + RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  65    IIALPGQP-QVGFQQFSGYVTVDEKKERALFYYFVEAEI-DPSSKPLVLWLNGGPGCSSL  122

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  GE LV+N++SWN  +NMLY++TP+GV FSYS  +S Y    D +
Sbjct  123   GVGAFSENGPFRPS--GEVLVRNEYSWNSEANMLYLETPVGVGFSYSTDTSSYVAVDDKI  180

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL++WF++F +Y+  D +I G+SY GH  PQLA L+++ N+     +   LKG
Sbjct  181   TARDNLVFLQRWFLKFPQYKHRDLFITGESYAGHYIPQLADLMIQFNKKE---KLFNLKG  237

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G +S  CS +
Sbjct  238   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYRLFTSACNYSRYVSEYYRGSVSSVCSKV  297

Query  837   EIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                +S+E    +DK ++          S S        TE  D C+ D    Y+NR DVQ
Sbjct  298   MNQVSKETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTERIDVCVEDETVNYLNRRDVQ  357

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W   S     +  L N  I  +  + +L+ + IPVL+YSGDQD  IP
Sbjct  358   KALHARLVGVRR-WAVCS--NILNYELLNLEIPTISIVGSLVKAGIPVLVYSGDQDSVIP  414

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W+ G+++GGW+Q +GN         L+FAT+RG S
Sbjct  415   LTGSRTLVHGLAKDLGLNTTVPYRVWFAGQQVGGWTQVYGNV--------LSFATIRGAS  466

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFK+FL+G P P
Sbjct  467   HEAPFSQPERSLVLFKSFLEGRPLP  491



>gb|KHN30341.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=459

 Score =   338 bits (867),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 268/472 (57%), Gaps = 31/472 (7%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  L  +L  TL  +S     + I +LPGQP  V F QYSGY+       RALFYYF E
Sbjct  8     MIATLIIVLAQTLVGVSSLPEADKIINLPGQPK-VKFLQYSGYVTVDDQHQRALFYYFVE  66

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+ ED  S PL LWL GG  CSS   G F E+GPFRP+++  L KN +SWN A+NMLY++
Sbjct  67    AE-EDPSSKPLVLWLNGGPGCSSIGTGAFTEHGPFRPSDNNLLEKNDYSWNKAANMLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS   S Y + +D +TAR+NL FL++WF +F EY   DF+I G+SYGGH  P
Sbjct  126   SPAGVGFSYSRNKSFYALVTDEITARDNLVFLQRWFTKFPEYSKRDFFITGESYGGHYVP  185

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA LI++   N        LKGIA+GNP+LE  +   S  E+ W HG+IS+  Y +  +
Sbjct  186   QLAQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYFWSHGLISDSTYEVLTR  239

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsces--ssisssqqHYL  941
              CN +++  ++ +G L   C     +L  E+ + +D+ ++    C S  +  +       
Sbjct  240   DCNFSSIRRQWQNGNLRGVCEKANKLLDSEVSYYVDEYDVTLDVCLSPVNQQAYVLNQLQ  299

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAID  1109
              T+  D C+ D    Y+N  +VQ+ALHAN  G        +   T   +LH    N  + 
Sbjct  300   ETQKIDVCVGDKTTTYLNTKEVQEALHANLVG-------VAKWSTCSSVLHYDYQNLEVP  352

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              +P L +L+ S I VL+YSGDQD  IP+  +R +   LA  + L T     PW+  K++ 
Sbjct  353   TIPILGSLVKSSIRVLVYSGDQDSVIPLLGSRSLVNGLAKEIGLNTTVAYRPWFGEKQVA  412

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GW+Q +G+         L++ATVRG SH  P S P ++L L KAFL+G P P
Sbjct  413   GWTQVYGDI--------LSYATVRGASHEAPFSQPQRSLVLLKAFLEGKPLP  456



>ref|XP_006410496.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
 gb|ESQ51949.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
Length=462

 Score =   338 bits (867),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 191/468 (41%), Positives = 269/468 (57%), Gaps = 21/468 (4%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M   L+ L   +  S +++   + I  LPGQP  V F QYSGY+   + + RALFYY AE
Sbjct  9     MATALFLLQALSSVSSTVQSRADQITRLPGQPR-VGFQQYSGYVSIDEKKQRALFYYLAE  67

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A++E   S  L LWL GG  CSS  +G F ENGPFRP +  +LV+NQ SWNL +NMLY++
Sbjct  68    AETE-PISKSLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSDLVRNQHSWNLEANMLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP+GV FSY+  SS Y+  +D +TA++NL FL+KWF+ F +Y +   ++ G+SY GH  P
Sbjct  126   TPVGVGFSYATESSLYEGVNDKITAKDNLVFLQKWFLRFPQYLNRSLFLTGESYAGHYVP  185

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA L+++ N+         LKGIA+GNP++E  +   S  E+ W HG+IS+  Y M   
Sbjct  186   QLAELMIQYNKKH---NLFNLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDSTYKMFTS  242

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYL  941
              CN +  + E+  G++S  CS +   +S E    +DK ++    C     S S       
Sbjct  243   YCNYSRYVSEYYRGQVSSMCSKVMTQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVNPQQ  302

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  1121
               ET D C+ D    Y+NR DVQKALHA   G +  W   S     D  L +  +  +  
Sbjct  303   VGETVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWAVCS--NVLDYELLDVEVPTVNI  359

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             + +L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q
Sbjct  360   VGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQ  419

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              +G          L FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  420   VYGEI--------LAFATVRGAAHEVPFSQPERSLVLFKAFLGGRPLP  459



>ref|XP_010460580.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   339 bits (869),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 192/444 (43%), Positives = 262/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             + SLPGQP  V F QYSGY+     + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  62    VTSLPGQP-QVGFQQYSGYVTVDDKKQRALFYYFAEAET-DPTSKPLVLWLNGGPGCSSL  119

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN  SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  120   GVGAFSENGPFRP-KGPILVKNYHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDKIT  178

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLA L+++ N+   HL    L+GI
Sbjct  179   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMIQYNKK-HHL--FNLRGI  235

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+  G +S  CS + 
Sbjct  236   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSICSKVM  295

Query  840   IMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++    C     S S         E+ D C+ D    Y+NR DVQ+
Sbjct  296   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQE  355

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D  L +     +  + +L+ + +PVL+YSGDQD  IP+
Sbjct  356   ALHARLIGVR-EWTVCS--NVLDYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQDSVIPL  412

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R + + LA +L L T      W+ G+++GGW+Q +GN         L+FATVRG SH
Sbjct  413   TGSRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASH  464

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
              VP S P ++L LFKAFL G P P
Sbjct  465   EVPFSQPERSLVLFKAFLNGHPLP  488



>emb|CDY11750.1| BnaC03g58280D [Brassica napus]
Length=461

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 189/462 (41%), Positives = 269/462 (58%), Gaps = 21/462 (5%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             F L+  L S ++  + +++  LPGQP  V F QYSGY+   + +  ALFYYFAEA++E  
Sbjct  14    FALIFFLSSATVLSHSDLVTRLPGQP-QVGFKQYSGYVTVDEKKHSALFYYFAEAETEPT  72

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV 
Sbjct  73    -SKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYS  SS Y+  +D +TAR+NL FL +WF++F  Y +   +I G+SY GH  PQLA L+
Sbjct  131   FSYSTQSSSYESVNDKITARDNLVFLERWFLKFPHYLNRSLFITGESYAGHYVPQLADLM  190

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATT  785
             ++ N+   HL    L+GIA+GNP+LE  +   S  E+ W HG+IS+  + +    CN + 
Sbjct  191   IQYNKK-HHL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTFKLFTSYCNYSR  247

Query  786   MIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETAD  959
              + E+  G +S  CS +   ++ E    +DK ++          S S         E+ D
Sbjct  248   YVSEYYRGSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSKVVSPNQVGESVD  307

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
              C+ D    Y+NR DVQ+AL A   G +  W   S     D  + +     +  + +L+ 
Sbjct  308   VCVEDETVNYLNRRDVQEALQARLVGVR-EWTVCS--NVLDYQMLDVEKPTINIVGSLVE  364

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             + +PVL+YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN  
Sbjct  365   AGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV-  423

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                    L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  424   -------LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  458



>gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=458

 Score =   337 bits (864),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 190/452 (42%), Positives = 269/452 (60%), Gaps = 22/452 (5%)
 Frame = +3

Query  96    SISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLW  275
             S +I    + I  LPGQP  V F QYSGY+   + + RALFYY AEA+++   S PL LW
Sbjct  24    SSTILSRADRITRLPGQPR-VGFQQYSGYVTIDEKKQRALFYYLAEAETK-PISKPLVLW  81

Query  276   LGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSS  455
             L GG  CSS  +G F ENGPFRP +   LV+NQ SWN  +NMLY++TP+GV FSY+N SS
Sbjct  82    LNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQEANMLYLETPVGVGFSYANESS  140

Query  456   DYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPA  635
              Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA L+++ N+   
Sbjct  141   SYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKHN  200

Query  636   HLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG  809
                   LKGIA+GNP++E  +   S  E+ W HG+IS+  Y +    CN +  + E+  G
Sbjct  201   LF---NLKGIAIGNPVMEFATDFNSRAEYFWSHGLISDPTYKLFTSSCNYSRFLSEYHRG  257

Query  810   ELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEY  989
              +S  C+ +   +  E    +DK ++    C  S +S S+Q     ET D CL D    Y
Sbjct  258   SVSSMCTKVLSQVGIETSRFIDKYDVTLDVCIPSVLSQSKQ---VGETVDVCLEDETVNY  314

Query  990   INRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSG  1169
             +NR DVQKALHA   G +  W   S     +V+  +  +  +  + +L+ + +PV +YSG
Sbjct  315   LNRRDVQKALHARLVGTR-KWTVCSDVLDYEVL--DVEVPTINIVGSLVKAGVPVFVYSG  371

Query  1170  DQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTF  1349
             DQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +GN+        L F
Sbjct  372   DQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNT--------LAF  423

Query  1350  ATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             ATVRG +H VP S P++AL LFKAFL G P P
Sbjct  424   ATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  455



>ref|XP_007038110.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOY22611.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 193/448 (43%), Positives = 257/448 (57%), Gaps = 25/448 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+   + + + LFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  34    IVRLPGQPR-VGFQQFSGYVTVDEKKHKVLFYYFVEAEI-DPASKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE LV+N +SWN  +NMLY++TPIGV FSYS  SS Y    D  
Sbjct  92    GVGAFSENGPFRP--NGEVLVRNDYSWNREANMLYLETPIGVGFSYSTNSSSYVAVDDET  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL++W+ +F  YR  D +I G+SY GH  PQLA L++E N+         LKG
Sbjct  150   TARDNLVFLQRWYHKFPNYRQRDLFITGESYAGHYIPQLAKLMVELNKKQNLF---NLKG  206

Query  663   IALGNPILEKMSL---SNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             IALGNP+LE  ++   S  E+ W HG+IS+  Y M   VCN +  + E+    +S  CS 
Sbjct  207   IALGNPVLE-FAIDFNSRAEYFWSHGLISDSTYRMFTSVCNYSRYVSEYYRDSVSPSCSR  265

Query  834   IEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDV  1007
             +   +S E    +DK ++          S S        +E  D C+ D +  Y+NR DV
Sbjct  266   VMSQVSRETSKFVDKYDVTLDVCISSVLSQSMVLNPQQVSERVDVCVEDKIVNYLNRKDV  325

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRI  1187
             QKALHA   G +  W   S     D  L N  I  +  + +L+ + IPVL+YSGDQD  I
Sbjct  326   QKALHALLVGVRR-WAVCS--NILDYQLLNLEIPTISIVGSLIKAGIPVLVYSGDQDSVI  382

Query  1188  PVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGG  1367
             P++ +R +   LA  L L T      W++GK++GGW+Q +GN         L FAT+RG 
Sbjct  383   PLTGSRTLVRGLAKELGLETTVPYRVWFEGKQVGGWTQVYGNI--------LAFATIRGA  434

Query  1368  SHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             SH  P S P ++L LFK+FL+G P P  
Sbjct  435   SHEAPFSQPERSLMLFKSFLEGKPLPEV  462



>ref|XP_010499305.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
 ref|XP_010499306.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=489

 Score =   338 bits (867),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 191/444 (43%), Positives = 262/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             + SLPGQP  V F QYSGY+     + RA+FYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  60    VTSLPGQP-QVGFQQYSGYVTVDDKKQRAMFYYFAEAET-DPTSKPLVLWLNGGPGCSSL  117

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN  SWN  +NMLY++TP+GV FSYS  SS Y+  +D +T
Sbjct  118   GVGAFSENGPFRP-KGPILVKNLHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDKIT  176

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL++WF++F  Y +   +I G+SY GH  PQLA L+++ N+   HL    L+GI
Sbjct  177   ARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMMQYNKK-HHL--FNLRGI  233

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+  G +S  CS + 
Sbjct  234   AIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSICSKVM  293

Query  840   IMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               +S E    +DK ++    C     S S         E+ D C+ D    Y+NR DVQ 
Sbjct  294   SQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQG  353

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D  L +     +  + +L+ + +PVL+YSGDQD  IP+
Sbjct  354   ALHARLVGVR-EWTVCS--NVLDYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQDSVIPL  410

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R + + LA +L L+T      W+ G+++GGW+Q +GN         L+FATVRG SH
Sbjct  411   TGSRTLVSRLAKQLGLSTSVPYRVWFAGQQVGGWTQVYGNV--------LSFATVRGASH  462

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
              VP S P ++L LFKAFL G P P
Sbjct  463   EVPFSQPERSLVLFKAFLGGHPLP  486



>gb|EYU21824.1| hypothetical protein MIMGU_mgv1a006099mg [Erythranthe guttata]
Length=457

 Score =   337 bits (864),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 187/444 (42%), Positives = 264/444 (59%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  VDF Q+SGY+   + R +ALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  28    IARLPGQPP-VDFQQFSGYVSVDEKREKALFYYFVEAEI-DPPSKPLVLWLNGGPGCSSI  85

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +  L++N++SWN  +NMLY+DTP+GV FSYS  +S Y+  +D +T
Sbjct  86    GVGAFSENGPFRPNVE-VLLRNEYSWNREANMLYLDTPVGVGFSYSTGASSYETVNDEIT  144

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A++NL FL+KWF++F +YR+   +I G+SY GH  PQLA LI++ N+     + I L GI
Sbjct  145   AKDNLVFLQKWFLDFPQYRNSSLFITGESYAGHYVPQLANLIIQLNKKK---KIINLTGI  201

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E+ W HG+IS+  Y +    CN +  + E+    +S  CS + 
Sbjct  202   ALGNPLLEFSTDYNSRAEYFWSHGLISDSTYNVFTSGCNYSRYVSEYYRDSVSVLCSRVM  261

Query  840   IMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
              +++ E    +DK ++    C     S S     +  +E  D C+ D + +Y+NR DVQ 
Sbjct  262   SLVNRESSRFVDKYDVTLDVCIPSVLSQSKIIAPHQNSERIDVCVEDEITKYLNRRDVQM  321

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W+  S     D  + +  I  +  + +L+   IPVLIYSGDQD  IP+
Sbjct  322   ALHARLVGVR-KWDVCS--NILDYDMLDLEIPTISIIGSLVKEGIPVLIYSGDQDSVIPL  378

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + TR +   LA +L L T      W++G+++GGW+Q +GN         L+F TVRG SH
Sbjct  379   TGTRTLVHKLAKQLGLNTTVTYRVWFEGQQVGGWTQVYGNI--------LSFGTVRGASH  430

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
               P S P ++  LFK+FL G P P
Sbjct  431   EAPFSQPERSFVLFKSFLSGKPLP  454



>gb|KHN30340.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=460

 Score =   337 bits (863),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 187/473 (40%), Positives = 270/473 (57%), Gaps = 31/473 (7%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++  L+   L  TL  +S     + I +LPGQP  V+F QYSGY+       RALFYYF 
Sbjct  8     MIATLIIIFLAQTLVGVSSLPEADKITNLPGQPR-VEFQQYSGYVTVDDQNQRALFYYFV  66

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA+ E+  S PL LWL GG  CSS  +G F E+GPFRP+++  L  N  SWN  +N+LY+
Sbjct  67    EAE-ENPSSKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEINDKSWNKVANVLYL  125

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++P GV FSYS+  S Y + +D +TAR+NL FL++WF +F EY + DF+I+G+SYGGH  
Sbjct  126   ESPAGVGFSYSSNESFYALVTDEITARDNLVFLQRWFTKFPEYSNNDFFISGESYGGHYV  185

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQK  764
             PQLA LI++   N        LKGIA+GNP+LE  +   S  E+LW HG+IS+  Y +  
Sbjct  186   PQLAQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYLWSHGLISDSTYEVLT  239

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHY  938
             +VCN +++  +  +G L   C     +L  EI + +D+ ++         +  +      
Sbjct  240   RVCNFSSIRRQMQNGNLRGVCGKANKLLDSEISNYVDEYDVTLDVCLSSVNQQAYVLNQL  299

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAI  1106
               T+  D C+ D    Y+N  +VQ+ALHAN  G        +   T   +LH    N  I
Sbjct  300   QETQKIDVCIGDKTTTYLNTKEVQEALHANLVG-------VAKWSTCSSVLHYDYQNLEI  352

Query  1107  DILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEI  1286
               +P L +L+ S I VL+YSGDQD  +P+  +R +   LA  + L T      W++GK++
Sbjct  353   PTIPILGSLVNSGIRVLVYSGDQDSVLPLLGSRSLVNGLAKEIGLDTTVAYRAWFEGKQV  412

Query  1287  GGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              GW+Q +GN         L++AT+RG SH  P S P ++L L KAFL+G P P
Sbjct  413   AGWTQVYGNI--------LSYATIRGASHEAPFSQPQRSLGLLKAFLEGKPLP  457



>emb|CDY61693.1| BnaC05g51120D [Brassica napus]
Length=456

 Score =   336 bits (862),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 194/469 (41%), Positives = 273/469 (58%), Gaps = 24/469 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             +  F + F +V  L   S+  + + I  LPGQP  V F QYSGY+   + + RALFYY A
Sbjct  5     LQCFTISFAIVLFLSFSSVLSHSDRITRLPGQPR-VGFQQYSGYVTVDENKQRALFYYLA  63

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA++ D  + PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY+
Sbjct  64    EAET-DPINKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYL  121

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             +TP+GV FSYS   + Y+  +D +TAR+NL FL++WF++F  Y +   +I G+SY GH  
Sbjct  122   ETPVGVGFSYS---TQYESVNDEITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYV  178

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQK  764
             PQLA L+++ N+   HL    L+GIA+GNP+LE  +   S  E+ W HG+IS+  Y M  
Sbjct  179   PQLAELMIQYNQK-HHL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTYKMFT  235

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHY  938
               CN +  + E+  G +S  C+ +   +S E    +DK ++    C     S S      
Sbjct  236   SYCNYSRYVSEYYRGSMSSICAKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPN  295

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILP  1118
                E+ D C+ D   +Y+NR DVQ+ALHA   G +  W   S     D  L +  I  + 
Sbjct  296   QVGESVDVCVEDETVKYLNRRDVQEALHARLVGVR-EWTVCS--NVLDYQLLDVEIPTIN  352

Query  1119  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  1298
              + +L+ + +PVL+YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+
Sbjct  353   IVGSLVQAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWT  412

Query  1299  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             Q +GN         L+FATVRG SH VP S P ++L LFKAFL   P P
Sbjct  413   QVYGNV--------LSFATVRGASHEVPFSQPQRSLVLFKAFLDSHPLP  453



>ref|XP_008777392.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   337 bits (864),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 191/454 (42%), Positives = 257/454 (57%), Gaps = 26/454 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  VDF Q+SGYI     + RALFYYF EA+  D  + PL LWL GG  CSS 
Sbjct  34    ISKLPGQP-QVDFQQFSGYITVDDRKQRALFYYFTEAEL-DPSAKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+E   LV+N++SWN  +NMLY++TP GV FSY+N +S Y+   D MT
Sbjct  92    GVGAFSENGPFRPSEQ-VLVRNEYSWNKEANMLYLETPAGVGFSYANDTSCYEGVDDKMT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRN--------PAHL  641
             AR+NL FL +WF +F +Y+  D YI G+SY GH  PQLA L+++ N+          A +
Sbjct  151   ARDNLVFLLRWFSKFPQYKVRDLYITGESYAGHYVPQLAELMVKFNKKKNIFNLKGAAPI  210

Query  642   RPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGEL  815
              P       LGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G L
Sbjct  211   FPFSRCTWQLGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTLACNYSRYVSEYYRGSL  270

Query  816   SEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEY  989
             S  C+ +   +++E    +DK ++          S S        TE  D C+ D    Y
Sbjct  271   SAVCARVMGQVTQETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVTENIDVCVEDETVNY  330

Query  990   INRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSG  1169
             +NR DVQ ALHA   G    W+  S     +  L N  I  +  + +L+ S IPVL+YSG
Sbjct  331   LNRKDVQDALHARLAGVP-KWSVCS--SVLEYELLNLEIPTISVVGSLVRSGIPVLVYSG  387

Query  1170  DQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTF  1349
             DQD  IP++ +R +   LA  LKL T      W+ GK++GGW+Q +G+         LTF
Sbjct  388   DQDSVIPLTGSRTLVQRLAKELKLKTTVPYRVWFAGKQVGGWTQVYGDI--------LTF  439

Query  1350  ATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             AT+RG SH  P S P ++L LF+AFL+G P P T
Sbjct  440   ATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  473



>ref|XP_003521119.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   336 bits (862),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 187/473 (40%), Positives = 270/473 (57%), Gaps = 31/473 (7%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++  L+   L  TL  +S     + I +LPGQP  V+F QYSGY+       RALFYYF 
Sbjct  10    MIATLIIIFLAQTLVGVSSLPEADKITNLPGQPR-VEFQQYSGYVTVDDQNQRALFYYFV  68

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA+ E+  S PL LWL GG  CSS  +G F E+GPFRP+++  L  N  SWN  +N+LY+
Sbjct  69    EAE-ENPSSKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEINDKSWNKVANVLYL  127

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++P GV FSYS+  S Y + +D +TAR+NL FL++WF +F EY + DF+I+G+SYGGH  
Sbjct  128   ESPAGVGFSYSSNESFYALVTDEITARDNLVFLQRWFTKFPEYSNNDFFISGESYGGHYV  187

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQK  764
             PQLA LI++   N        LKGIA+GNP+LE  +   S  E+LW HG+IS+  Y +  
Sbjct  188   PQLAQLIVQTKTN------FNLKGIAIGNPLLEFNTDFNSRSEYLWSHGLISDSTYEVLT  241

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHY  938
             +VCN +++  +  +G L   C     +L  EI + +D+ ++         +  +      
Sbjct  242   RVCNFSSIRRQMQNGNLRGVCGKANKLLDSEISNYVDEYDVTLDVCLSSVNQQAYVLNQL  301

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAI  1106
               T+  D C+ D    Y+N  +VQ+ALHAN  G        +   T   +LH    N  I
Sbjct  302   QETQKIDVCIGDKTTTYLNTKEVQEALHANLVG-------VAKWSTCSSVLHYDYQNLEI  354

Query  1107  DILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEI  1286
               +P L +L+ S I VL+YSGDQD  +P+  +R +   LA  + L T      W++GK++
Sbjct  355   PTIPILGSLVNSGIRVLVYSGDQDSVLPLLGSRSLVNGLAKEIGLDTTVAYRAWFEGKQV  414

Query  1287  GGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              GW+Q +GN         L++AT+RG SH  P S P ++L L KAFL+G P P
Sbjct  415   AGWTQVYGNI--------LSYATIRGASHEAPFSQPQRSLGLLKAFLEGKPLP  459



>ref|XP_008791046.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
 ref|XP_008791047.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
Length=463

 Score =   336 bits (862),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 192/447 (43%), Positives = 256/447 (57%), Gaps = 23/447 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGYI     + RALFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  34    ITKLPGQP-QVSFQQFSGYITVDDRKQRALFYYFAEAEL-DPSTKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGEL-VKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP+  G+L V+N++SWN  +NMLY++TP GV FSY+  SS Y+  +D M
Sbjct  92    GVGAFSENGPFRPS--GQLLVRNEYSWNKEANMLYLETPAGVGFSYATDSSYYEGVNDKM  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL +WF +F +Y+D D YI G+SY GH  PQLA L++  N+         LKG
Sbjct  150   TARDNLVFLLRWFTKFPQYKDRDLYITGESYAGHYVPQLAELMVLFNKKN---NVFNLKG  206

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G LS  C+ +
Sbjct  207   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYRIFTSACNYSRYVSEYYRGSLSPVCARV  266

Query  837   EIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                ++ E    +DK ++          S S         E  D C+ D    Y+NR DVQ
Sbjct  267   MGQVTRETSRFVDKYDVTLDVCISSVLSQSKVLSPQQVAERIDVCVEDETVNYLNRKDVQ  326

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
              ALHA  TG    W   S     +  L N     +  + +L+ S IPVL+YSGDQD  IP
Sbjct  327   DALHARLTGVP-KWTVCS--SVLEYELLNLENPTISVVGSLVSSGIPVLVYSGDQDSVIP  383

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  LKL T      W++GK++GGW+Q +G+         L FAT+RG S
Sbjct  384   LTGSRTLVQRLANELKLKTTVPYRVWFEGKQVGGWTQVYGDI--------LAFATIRGAS  435

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             H  P S P ++L LF+AFL+  P P T
Sbjct  436   HEAPFSQPERSLVLFRAFLQRRPLPET  462



>ref|XP_009113703.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
 emb|CDY46627.1| BnaA09g27540D [Brassica napus]
Length=454

 Score =   336 bits (861),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 192/452 (42%), Positives = 266/452 (59%), Gaps = 24/452 (5%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             S+  + + I  LPGQP  V F QYSGY+   + + RALFYY AEA++ D  + PL LWL 
Sbjct  20    SVLSHSDRITRLPGQPR-VGFQQYSGYVTVDEKKQRALFYYLAEAET-DPINKPLVLWLN  77

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDY  461
             GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSYS   + Y
Sbjct  78    GGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLETPVGVGFSYS---TQY  133

Query  462   KIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHL  641
             +  +D +TAR+NL FL++WF++F  Y +   +I G+SY GH  PQLA L+++ N+   HL
Sbjct  134   ESVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAELMIQYNQK-HHL  192

Query  642   RPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGEL  815
                 L+GIA+GNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+  G +
Sbjct  193   --FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSM  250

Query  816   SEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEY  989
             S  CS +   +S E    +DK ++    C     S S         E+ D C+ D   +Y
Sbjct  251   SSICSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVKY  310

Query  990   INRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSG  1169
             +NR DVQ+ALHA   G +  W   S     D  L +  I  +  + +L+ + +PVL+YSG
Sbjct  311   LNRRDVQEALHARLVGVR-EWTVCS--NVLDYQLLDVEIPTINIVGSLVQAGVPVLVYSG  367

Query  1170  DQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTF  1349
             DQD  IP++ +R +   LA RL L T      W+ G+++GGW+Q +GN         L+F
Sbjct  368   DQDSVIPLTGSRTLVNRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV--------LSF  419

Query  1350  ATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             ATVRG SH VP S P ++L LFKAFL G P P
Sbjct  420   ATVRGASHEVPFSQPHRSLVLFKAFLDGHPLP  451



>ref|NP_001150027.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG37565.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=471

 Score =   336 bits (861),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 187/446 (42%), Positives = 255/446 (57%), Gaps = 20/446 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D  + PL LWL GG  CSS 
Sbjct  40    ISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-DPAAKPLVLWLNGGPGCSSV  97

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV FSYS   + Y+   D+MT
Sbjct  98    GVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGVGFSYSTDPAFYEGVGDSMT  156

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NLKFL+ WF  F +Y+  D YI G+SY GH  PQLA  ++E N+     +   LKGI
Sbjct  157   ARDNLKFLQGWFARFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  213

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y +   VCN +  + E+  G LS  C  + 
Sbjct  214   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYSRYVSEYYRGSLSTACDRVM  273

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++            S        +   D C+ D    Y+NR DVQ+
Sbjct  274   SQVARETSRFVDKYDVTLDVCISSVLMQSQVLVPQQGSRELDVCVEDETMRYLNRKDVQQ  333

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             A+HA   G Q  W   S     +    +  I  + T+ AL+ + IP L+YSGDQD  IP+
Sbjct  334   AMHARLDGVQR-WTVCS--SVLEYKQLDLQIPTVNTVGALVKAGIPALVYSGDQDSVIPL  390

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA RL+L +      W+ GK++GGW+Q FG  GG      L+FATVRG SH
Sbjct  391   TGSRTLVGRLAARLRLNSTAPYRAWFQGKQVGGWTQVFG--GGA-----LSFATVRGASH  443

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPNT  1451
               P S P ++L LF+AFL G   P +
Sbjct  444   EAPFSQPERSLGLFRAFLAGQQLPES  469



>gb|EAY93940.1| hypothetical protein OsI_15713 [Oryza sativa Indica Group]
Length=470

 Score =   336 bits (861),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 192/451 (43%), Positives = 262/451 (58%), Gaps = 28/451 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP +V F QYSGY+     R R LFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  37    IVALPGQP-NVSFAQYSGYVTVDAARRRELFYYFAEAEL-DPATKPLVLWLNGGPGCSSV  94

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +NMLY+++P GV FSYS   S Y    D+ T
Sbjct  95    GVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYGGVGDSRT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL+FL+ WF +F +Y+  D YI G+SY GH  PQLA  ++E N+     +   LKGI
Sbjct  154   ARDNLRFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  210

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y     VCN +  + E+  G LS  C  + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDSTYHSFTTVCNYSRYVSEYYHGSLSSACDTVM  270

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++            S S      +   D C+ D    Y+NR DVQ+
Sbjct  271   TQVARETSRFVDKYDVTLDVCVSSVLMQSKSLAPQRGSRELDVCVEDETMGYLNRKDVQE  330

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLS---ALLMSDIPVLIYSGDQDL  1181
             A+HA   G    W   S       +L    +D+ +PT++    L+ S +PVL+YSGDQD 
Sbjct  331   AMHARLEGGVPKWTVCSS------VLEYKQLDLQIPTINIVGGLVKSGVPVLVYSGDQDS  384

Query  1182  RIPVSHTREVATVLAVRLKL-TTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATV  1358
              IP++ +R V   LA RL+L TT      W++G+++GGW+Q+FG  GG      L+FATV
Sbjct  385   VIPLTGSRTVVQRLAGRLRLGTTAAGYRVWFEGRQVGGWTQSFG--GGA-----LSFATV  437

Query  1359  RGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             RG SH  P S P ++L LF AFL G P P++
Sbjct  438   RGASHEAPFSQPERSLVLFAAFLAGRPLPDS  468



>gb|KHN09723.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   335 bits (860),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 192/452 (42%), Positives = 268/452 (59%), Gaps = 23/452 (5%)
 Frame = +3

Query  114   NGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHD  293
             + + I  LPGQP  V F Q+SGY+     + ++LFYYFAEA++ D  S PL LWL GG  
Sbjct  22    HADTIALLPGQP-HVSFQQFSGYVTVDDKKHKSLFYYFAEAET-DPSSKPLVLWLNGGPG  79

Query  294   CSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWS  473
             CSS  +G F ENGPFRP E+  L+KN +SWN  +NMLY++TP+GV FSY+  SS Y   +
Sbjct  80    CSSLGVGAFSENGPFRPNEEF-LIKNDYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVN  138

Query  474   DTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIK  653
             D  TAR+NL FL +WF +F +Y+  D ++ G+SY GH  PQLA L++E N      +   
Sbjct  139   DEATARDNLVFLLRWFNKFPQYKSRDLFLTGESYAGHYVPQLAKLMVEMNTKN---KIFN  195

Query  654   LKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYC  827
             LKGIALGNP+LE  +   S  E  W HG+IS+  Y M  KVC  +  + E+    +S  C
Sbjct  196   LKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTKVCYYSRYVSEYYRDLVSPLC  255

Query  828   SDIEIMLSEEIGHDMDKENLVFqscesssisssq----qHYLATETADPCLRDWVGEYIN  995
             S +   +S E    +DK ++    C SS +S S+    Q   A E+ D C+ D V  Y+N
Sbjct  256   SKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLN  315

Query  996   RPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQ  1175
             R DVQ+ALHA   G +  W   S     D  + N  +  L  + +L+ + + VLIYSGDQ
Sbjct  316   RRDVQEALHAKLVGVR-KWEVCS--NILDYDMLNLEVPTLLVVGSLIKAGVKVLIYSGDQ  372

Query  1176  DLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFAT  1355
             D  IP++ +R +   LA +L L +      W++G+++GGW+Q +GN         L+FAT
Sbjct  373   DSVIPLTGSRTLVQKLARKLGLNSTVPYRVWFEGQQVGGWTQGYGNI--------LSFAT  424

Query  1356  VRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             VRG SH  P S P ++L LFK+FL+G P P+ 
Sbjct  425   VRGASHEAPFSQPERSLVLFKSFLEGRPLPDA  456



>ref|XP_003520486.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   335 bits (860),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 186/473 (39%), Positives = 267/473 (56%), Gaps = 31/473 (7%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  L  +L  TL  ++     + I +LPGQP  V F QYSGYI       RALFYYF E
Sbjct  10    MIVTLIIVLAQTLVVVNSLPEADKITNLPGQP-HVKFQQYSGYITVDDQNQRALFYYFVE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+     S P+ LWL GG  CSS  +G   E+GPF+P ++  LVKN +SWN  +N+LY++
Sbjct  69    AEKHPT-SKPVVLWLNGGPGCSSIGVGALVEHGPFKPGDNNVLVKNHYSWNKVANVLYLE  127

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+ +S Y + +D +TAR+NL FL++WF EF EY   DF+I G+SY GH AP
Sbjct  128   SPAGVGFSYSSNTSFYTLVTDEITARDNLIFLQRWFTEFPEYSKNDFFITGESYAGHYAP  187

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSL-SNVEHLWYHGIISEEVYGMQKK  767
             QLA LI++   N        LKG+A+GNP++E    L S  E  W HG+IS+  Y +  +
Sbjct  188   QLAQLIVQTKTN------FNLKGVAIGNPLMEFDTDLNSKAEFFWSHGLISDSTYDLFTR  241

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYL  941
             VCN +T+  + + G LS+ C+ I  ++  E+ + +D+ ++        ++  +       
Sbjct  242   VCNYSTIRRQTIQGNLSDVCAKINGLVFTEVSNYIDQYDVTLDVCLSSANQQAYVLNQMQ  301

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAID  1109
              T+  D C+ D    Y+NR DVQKALHA            S       +LH    N  I 
Sbjct  302   ETQKIDVCVDDKAVTYLNRKDVQKALHAKLVE-------VSKWSACSRVLHYDRRNLEIP  354

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              +  L +L+ S+I VL+YSGDQD  IP+  +R +   LA  L L T      W++ K++ 
Sbjct  355   TVSILGSLVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFERKQVA  414

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             GW+Q +G          L++AT+RG SH  P + P ++L L KAFL+G P PN
Sbjct  415   GWTQVYGEL--------LSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLPN  459



>ref|XP_004501743.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=470

 Score =   335 bits (859),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 201/475 (42%), Positives = 284/475 (60%), Gaps = 28/475 (6%)
 Frame = +3

Query  51    IMVFL-LWFLLVNTL-YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYY  224
             +++FL L FL +    +S     + + I  LPGQP  + F Q+SGY+     + ++LFYY
Sbjct  11    MLIFLHLSFLSLKVFCFSSQHHSHADRIVGLPGQP-HITFQQFSGYVSVDDKKNKSLFYY  69

Query  225   FAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNM  401
             F E++  D  S PL LWL GG  CSS  +G F ENGPFRP  +GE L+KN+ SWN  +NM
Sbjct  70    FVESEI-DPPSKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGEFLIKNEHSWNKEANM  126

Query  402   LYVDTPIGVAFSYSNTSSDYKIW-SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYG  578
             LY++TPIGV FSY+  SS Y    +D  TAR+NL FL++WF +F +YR+ D ++ G+SY 
Sbjct  127   LYLETPIGVGFSYAKGSSSYTTTVNDEETARDNLVFLQRWFNKFPQYRNRDLFLTGESYA  186

Query  579   GHLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVY  752
             GH  PQLA L++E N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y
Sbjct  187   GHYVPQLAKLMIEMNKRN---KIFNLKGIALGNPVLEYATDFNSRAEFFWSHGLISDSTY  243

Query  753   GMQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssq-  929
              M   VCN +  + E+    +S  CS +  ++S+E    +DK ++    C SS +S S+ 
Sbjct  244   NMFTTVCNYSRYVSEYNRDSVSPLCSKVMGLVSKETSKFVDKYDVTLDVCISSVLSQSKV  303

Query  930   ---qHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNF  1100
                Q   A E  D C+ D V  Y+NR DVQ+ALHA   G +  W+  S     DV+  N 
Sbjct  304   INPQPQQANERIDVCVDDKVTNYLNRRDVQEALHAKLVGVR-KWDVCSNILDYDVL--NL  360

Query  1101  AIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGK  1280
              +  LP + +L+ S + VLIYSGDQD  IP++ +R +   LA +L L T      W++ +
Sbjct  361   EVPTLPIVGSLIKSGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVSYRVWFESQ  420

Query  1281  EIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             ++GGW+Q +GN         L+FATVRG +H VP S P ++L LFK+FL+G P P
Sbjct  421   QVGGWTQVYGNM--------LSFATVRGAAHEVPFSQPERSLVLFKSFLEGRPLP  467



>ref|XP_002446348.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
 gb|EES10676.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
Length=474

 Score =   335 bits (859),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 195/453 (43%), Positives = 265/453 (58%), Gaps = 32/453 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  V F QYSGYI       R+LFYYFAEA++ D  + PL LWL GG  CSS 
Sbjct  41    ISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-DPAAKPLVLWLNGGPGCSSV  98

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  L +N++SWN  +NMLY+++P GV FSYS   + Y+   D+MT
Sbjct  99    GVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGVGFSYSTDPAFYEGVGDSMT  157

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NLKFL+ WF +F +Y+  D YI G+SY GH  PQLA  ++E N+     +   LKGI
Sbjct  158   ARDNLKFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  214

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y +   VCN +  + E+  G LS  C  + 
Sbjct  215   ALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYSRYVSEYYHGSLSTACDRVM  274

Query  840   IMLSEEIGHDMDKENLVFqscesssisssqqHYLATETA----DPCLRDWVGEYINRPDV  1007
               ++ E    +DK ++        S    Q   LA +      D C+ D    Y+NR DV
Sbjct  275   SQVTRETSRFVDKYDVTL--DVCISSVLMQSQILAPQQGSRELDVCVEDETMNYLNRKDV  332

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLS---ALLMSDIPVLIYSGDQ  1175
             Q+A+HA  T     W   S       +L    +D+ +PT++   AL+ S IPVL+YSGDQ
Sbjct  333   QQAMHARLTDGVQRWTVCSS------VLEYKQLDLQIPTVNIVGALVKSGIPVLVYSGDQ  386

Query  1176  DLRIPVSHTREVATVLAVRLKL-TTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFA  1352
             D  IP++ +R + + LA RL+L TT      W+ GK++GGW+Q FG  GG      L+FA
Sbjct  387   DSVIPLTGSRTLVSRLAGRLRLNTTAAPYRAWFQGKQVGGWTQVFG--GGA-----LSFA  439

Query  1353  TVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             TVRG SH  P S P ++L LF+AFL G   P +
Sbjct  440   TVRGASHEAPFSQPERSLGLFRAFLAGQQLPES  472



>ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
 sp|Q8VY01.1|SCP46_ARATH RecName: Full=Serine carboxypeptidase-like 46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL67013.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC08849.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
Length=465

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 193/459 (42%), Positives = 269/459 (59%), Gaps = 29/459 (6%)
 Frame = +3

Query  96    SISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLW  275
             S +I    + I  LPGQP  V F QYSGY+   + + RALFYY AEA+++   S PL LW
Sbjct  24    SSTILSRADRITRLPGQPR-VGFQQYSGYVTIDEKKQRALFYYLAEAETK-PISKPLVLW  81

Query  276   LGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSS  455
             L GG  CSS  +G F ENGPFRP +   LV+NQ SWN  +NMLY++TP+GV FSY+N SS
Sbjct  82    LNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQEANMLYLETPVGVGFSYANESS  140

Query  456   DYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPA  635
              Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA L+++ N+   
Sbjct  141   SYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKHN  200

Query  636   HLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG  809
                   LKGIA+GNP++E  +   S  E+ W HG+IS+  Y +    CN +  + E+  G
Sbjct  201   LF---NLKGIAIGNPVMEFATDFNSRAEYFWSHGLISDPTYKLFTSSCNYSRFLSEYHRG  257

Query  810   ELSEYCSDIEIMLSEEIGHDMDKENLVFq----scesssisssqqHYLATETADPCLRDW  977
              +S  C+ +   +  E    +DK ++       S  S S   S Q     ET D CL D 
Sbjct  258   SVSSMCTKVLSQVGIETSRFIDKYDVTLDVCIPSVLSQSKVVSPQPQQVGETVDVCLEDE  317

Query  978   VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS---ALLMSDI  1148
                Y+NR DVQKALHA   G +  W        SDV+ +      +PT++   +L+ + +
Sbjct  318   TVNYLNRRDVQKALHARLVGTR-KWTV-----CSDVLDYEVLDVEVPTINIVGSLVKAGV  371

Query  1149  PVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGE  1328
             PV +YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +GN+    
Sbjct  372   PVFVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNT----  427

Query  1329  KVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                 L FATVRG +H VP S P++AL LFKAFL G P P
Sbjct  428   ----LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  462



>ref|XP_002280796.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinifera]
 emb|CBI15743.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 195/469 (42%), Positives = 272/469 (58%), Gaps = 28/469 (6%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             +VF L FLL     S+S   + + I  LPGQP  V F Q+SGY+     + RALFYYF E
Sbjct  14    VVFQLCFLL-KAHPSLS---HPDKIIQLPGQP-QVGFQQFSGYVSLDDKKQRALFYYFVE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYV  410
             A+S D  S PL LWL GG  CSS  +G F ENGPFRP  +GE L++N++SWN  +NMLY+
Sbjct  69    AES-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGEFLLRNEYSWNREANMLYL  125

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             +TP+GV FSYS + + Y    D +TAR+NL FL++WF++F +Y+  D +I G+SY GH  
Sbjct  126   ETPVGVGFSYS-SDTPYVTVDDKITARDNLAFLQRWFLKFPQYKHRDLFITGESYAGHYV  184

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQK  764
             PQLA L++  N+     +   LKGIALGNP+LE  +   S  E+ W HG+IS+  Y +  
Sbjct  185   PQLAELMIRFNKKE---KLFNLKGIALGNPVLEFATDLNSRAEYFWSHGLISDSTYRLFT  241

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHY  938
               CN +  + E+    +S  CS +   +S E    +DK ++          S S      
Sbjct  242   SACNYSRYVSEYYRDSVSSVCSRVMAQVSRETSKFVDKYDVTLDVCLSSVLSQSKVISPQ  301

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILP  1118
                ET D C+ D    Y+NR DVQKALHA   G +   ++T      D  L N  I  + 
Sbjct  302   QVAETIDVCIDDKTVNYLNRKDVQKALHARLVGIR---SWTVCSDILDYELLNLEIPTIS  358

Query  1119  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  1298
              + +L+ + IPVL+YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW+
Sbjct  359   IVGSLIKAGIPVLVYSGDQDSVIPLTGSRTLVHNLAKELGLNTTVPYRVWFEGKQVGGWT  418

Query  1299  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             + +GN         L+FAT+RG SH  P S P ++L LFK+FL+  P P
Sbjct  419   RVYGNI--------LSFATIRGASHEAPFSQPERSLVLFKSFLEARPLP  459



>ref|XP_002881286.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57545.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 192/470 (41%), Positives = 270/470 (57%), Gaps = 23/470 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M   L  L   +L S +I    + I  LPGQP  V F QYSGY+     + RALFYY AE
Sbjct  1     MATALILLQALSLVSSTILSRADRITRLPGQPR-VGFQQYSGYVTIDDKKQRALFYYLAE  59

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+++   S PL LWL GG  CSS  +G F ENGPFRP +   LV+N  SWN  +NMLY++
Sbjct  60    AETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNLHSWNQEANMLYLE  117

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP+GV FSY+  SS Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  P
Sbjct  118   TPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVP  177

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKK  767
             QLA L+++ N+         LKGIA+GNP++E  +  N   E+ W HG+IS+  Y M   
Sbjct  178   QLAQLMIQYNKKHNLF---NLKGIAIGNPVMEFATDFNSRGEYFWSHGLISDPTYKMFTS  234

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFq----scesssisssqqH  935
              CN +  + E+  G +S  C+ +   +S E    +DK ++       S  S S   + Q 
Sbjct  235   YCNYSRYVSEYYRGSVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSKVVNPQP  294

Query  936   YLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDIL  1115
                 ET D C+ D    Y+NR DVQ+ALHA   G +  W   S     D  + +  +  +
Sbjct  295   QQVGETVDVCVEDETVNYLNRRDVQRALHARLVGTR-KWAVCS--NVLDYEVLDVEVPTI  351

Query  1116  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  1295
               + +L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW
Sbjct  352   NIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGW  411

Query  1296  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +Q +GN+        L FATVRG +H VP S P++AL LFKAFL G P P
Sbjct  412   TQVYGNT--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  453



>ref|XP_008454133.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=456

 Score =   334 bits (856),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 193/445 (43%), Positives = 261/445 (59%), Gaps = 25/445 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F  YSGYI       +ALFYYFAEAQ  D  S PL LWL GG  CSS 
Sbjct  29    ISSLPGQPL-VGFRHYSGYINVGDRNQKALFYYFAEAQV-DPPSKPLVLWLNGGPGCSSL  86

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TP+GV FSYS  +S Y+   D +
Sbjct  87    GVGAFSENGPFRPR--GEVLVRNEHSWNTEANMLYLETPVGVGFSYSTDTSSYEAVGDKI  144

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL+FL KWF+ F  YR+   +I G+SY GH  PQLA L+++ N+   +LR     G
Sbjct  145   TARDNLEFLEKWFVRFPHYRNRSLFITGESYAGHYVPQLAELMVQSNKTSFNLR-----G  199

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IA+GNP+LE  +   S  E LW HG+IS+  + M   +CN +  + E+  G +S  CS +
Sbjct  200   IAIGNPVLEFATDFNSRAEFLWSHGLISDSTFKMFTSMCNYSRYVGEYYRGSVSPICSRV  259

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqq--HYLATETADPCLRDWVGEYINRPDVQ  1010
                +S+E    +DK ++    C SS  S S+       TE+ D C+ D    Y+NR DV 
Sbjct  260   MSQVSKETSRFVDKYDVTLDVCISSVFSQSKILNPQQVTESVDVCVEDETVNYLNRQDVH  319

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W   S     D  L +  +  +  +  L+ + I VL+YSGDQD  IP
Sbjct  320   KALHARLVGVRR-WAVCS--SILDYELLDLEVPTINIVGKLINAGIQVLVYSGDQDSVIP  376

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W++G+++GGW+Q +GN         L+FAT+RG S
Sbjct  377   LTGSRTLVHKLAKELGLQTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGAS  428

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFK+FL+  P P
Sbjct  429   HEAPFSQPERSLVLFKSFLQSQPLP  453



>ref|XP_010271867.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Nelumbo 
nucifera]
Length=504

 Score =   335 bits (860),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 186/445 (42%), Positives = 263/445 (59%), Gaps = 21/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V+F QYSGYI   + + RALFYYF EA++ +  S PL LW+ GG  CSS 
Sbjct  73    IIKLPGQP-EVNFQQYSGYITVDEEQQRALFYYFVEAET-NPASKPLVLWVNGGPGCSSI  130

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV+N++SWN  +NMLY++TP GV FSYS  +S Y   +D MT
Sbjct  131   GTGAFSEHGPFRPS-GKNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVNDEMT  189

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL F+++W  +F E+++ D +I G+SY GH  PQLA L+++ N      +   LKGI
Sbjct  190   ARDNLVFMQRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQFNDQ----KLFNLKGI  245

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E LW HG+IS+  YG     CN +  + ++  G +S  C  + 
Sbjct  246   ALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFLSKYYRGSVSSVCLRVV  305

Query  840   IMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
              +++ EI   +D+ ++   V  S   S   +        E+ D C+ D    Y+NR DVQ
Sbjct  306   SLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQQKVVESTDVCVEDETYNYLNRDDVQ  365

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             K+LHA+  G    W   +  +     + N  +  +P LS+L  S I +L+YSGDQD  IP
Sbjct  366   KSLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILVYSGDQDSIIP  424

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ TR +   LA  L L T      W++GK++GGW+Q +G+         LTFAT+RGGS
Sbjct  425   LTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI--------LTFATIRGGS  476

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LF +FLKG P P
Sbjct  477   HEAPFSQPQRSLVLFNSFLKGKPLP  501



>ref|XP_004298533.1| PREDICTED: serine carboxypeptidase-like 45-like [Fragaria vesca 
subsp. vesca]
Length=466

 Score =   334 bits (856),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 272/469 (58%), Gaps = 26/469 (6%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVT--HKFRGRALFYYFAEAQ  239
             L F+ +  + S S   + +I+  LPGQP +V F  +SGYI    H+   +ALFYYF EA+
Sbjct  16    LCFIAMEVVESSSHHHDHKIV-RLPGQP-NVGFQHFSGYISVGDHQKNHKALFYYFVEAE  73

Query  240   SEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDT  416
               +  S PL LWL GG  CSS  +G F ENGPFRP  DG+ LV+N++SWN  +NMLY++T
Sbjct  74    I-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGQVLVRNEYSWNREANMLYLET  130

Query  417   PIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQ  596
             PIGV FS S  SS+Y    D  TAR+NL FL++WF +F +Y+  D ++ G+SY GH  PQ
Sbjct  131   PIGVGFSNSRHSSNYVAVDDKATARDNLVFLQRWFNKFPQYKHRDLFLTGESYAGHYIPQ  190

Query  597   LAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKV  770
             LA L++E NR     +   LKG+ALGNP+LE  +   S  E+ W HG+IS+  Y M   V
Sbjct  191   LAKLMVEANRKE---KLFNLKGLALGNPVLEYATDFNSRAEYFWSHGLISDSTYRMFTSV  247

Query  771   CNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLA  944
             CN +  + E+    +S  CS +  ++S E    +DK ++          S S +      
Sbjct  248   CNYSRYVSEYYRDSVSPVCSRVMSLVSRETSKFVDKYDVTLDVCISSVLSQSKAISPNQM  307

Query  945   TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  1124
             TE  D C+ D +  Y+NR DVQ ALHA   G +  W+  S     D  + +  I  +  +
Sbjct  308   TERIDVCVEDKIVNYLNRKDVQNALHAKLVGVRR-WDVCS--NILDYQMLDLEIPTISLV  364

Query  1125  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  1304
              +++ + IPVL+YSGDQD  IP++ +R +   LA  L L T      W+ GK++GGW+Q 
Sbjct  365   GSIVKAGIPVLVYSGDQDSVIPLTGSRTLVDRLARELGLNTTVPYRVWFQGKQVGGWTQV  424

Query  1305  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             +GN         L+FAT+RG SH  P S P ++L LFK+FL+G P P  
Sbjct  425   YGNI--------LSFATIRGASHEAPFSQPERSLVLFKSFLQGRPLPQV  465



>ref|XP_009109757.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
Length=460

 Score =   333 bits (855),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 190/462 (41%), Positives = 269/462 (58%), Gaps = 22/462 (5%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             F L+  L S ++  + ++I  LPGQP  V F QYSGY+   + + RALFYYFAEA++ + 
Sbjct  14    FALIFFLSSSTVLSHSDLITRLPGQPR-VGFQQYSGYVTLDEKKQRALFYYFAEAET-NP  71

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV 
Sbjct  72    TSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYS T   Y+   D +TAR+NL FL +WF++F  Y +   +I G+SY GH  PQLA L+
Sbjct  131   FSYS-TQRSYESVDDKITARDNLVFLERWFLKFPHYLNRSLFITGESYAGHYVPQLADLM  189

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATT  785
             ++ N+   HL    L+GIA+GNP+LE  +   S  E+ W HG+IS+  + +    CN + 
Sbjct  190   IQYNKK-HHL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTFKLFTSYCNYSR  246

Query  786   MIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETAD  959
              + E+  G +S  CS +   ++ E    +DK ++          S S         E+ D
Sbjct  247   YVSEYYRGSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSKVVSPNQVGESVD  306

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
              C+ D    Y+NR DVQ+ALHA   G +  W   S     D  + +     +  + +L+ 
Sbjct  307   VCVEDETVNYLNRRDVQEALHARLVGVR-EWTVCS--NVLDYQMLDVEKPTINIVGSLVE  363

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             + +PVL+YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN  
Sbjct  364   AGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV-  422

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                    L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  423   -------LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  457



>ref|XP_004152156.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 ref|XP_004169817.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 gb|KGN52977.1| hypothetical protein Csa_4G008800 [Cucumis sativus]
Length=456

 Score =   333 bits (855),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 192/445 (43%), Positives = 261/445 (59%), Gaps = 25/445 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F  YSGY+       +ALFYYFAEAQ  D  S PL LWL GG  CSS 
Sbjct  29    ISSLPGQPL-VGFRHYSGYVNVGDRNQKALFYYFAEAQV-DPPSKPLVLWLNGGPGCSSL  86

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N+ SWN  +NMLY++TP+GV FSYS  +S Y+   D +
Sbjct  87    GVGAFSENGPFRPR--GEVLVRNEHSWNTEANMLYLETPVGVGFSYSTDTSSYEAVGDKI  144

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL+FL KWF+ F  YR+   +I G+SY GH  PQLA L+++ N+   +LR     G
Sbjct  145   TARDNLEFLEKWFVRFPHYRNRSLFITGESYAGHYVPQLAELMVQSNKTSFNLR-----G  199

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IA+GNP+LE  +   S  E LW HG+IS+  + M   +CN +  + E+  G +S  CS +
Sbjct  200   IAIGNPVLEFATDFNSRAEFLWSHGLISDSTFKMFTSMCNYSRYVGEYYRGSVSPICSRV  259

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqq--HYLATETADPCLRDWVGEYINRPDVQ  1010
                +S+E    +DK ++    C SS  S S+       TE+ D C+ D    Y+NR DV 
Sbjct  260   MSQVSKETSRFVDKYDVTLDVCISSVFSQSKILNPQQVTESVDVCVEDETVNYLNRQDVH  319

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W   S     D  L +  +  +  +  L+ + I VL+YSGDQD  IP
Sbjct  320   KALHARLVGVRR-WAVCS--SILDYELLDLEVPTINIVGKLINAGIQVLVYSGDQDSVIP  376

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W++G+++GGW+Q +GN         L+FAT+RG S
Sbjct  377   LTGSRTLVHKLAKELGLQTTVPYRVWFEGQQVGGWTQVYGNI--------LSFATIRGAS  428

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFK+FL+  P P
Sbjct  429   HEAPFSQPERSLVLFKSFLQSQPLP  453



>gb|KHN07932.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=464

 Score =   333 bits (855),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 191/471 (41%), Positives = 267/471 (57%), Gaps = 33/471 (7%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             LL F++   +  ++     + I +LPGQP  V F QY+GYI     + RALFYYF EA+ 
Sbjct  13    LLLFVIAQCVVGVNSLSQADKISTLPGQPP-VKFQQYAGYITVDDKQKRALFYYFVEAEV  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             E   S PL LWL GG  CSS   G F E+GPF+P+E+G L+KN+ SWN  +NMLY+++P 
Sbjct  72    EPA-SKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKEANMLYLESPA  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS   S Y   +D MTAR+NL FL++WF +F E ++ DF+I G+SY GH  PQLA
Sbjct  130   GVGFSYSANKSFYDFVNDEMTARDNLVFLQRWFTKFPELKNNDFFITGESYAGHYVPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              LI++            LKGIA+GNP++E  +   S  E  W HG+IS+  Y +  KVCN
Sbjct  190   QLIVQTKTK------FNLKGIAIGNPLVEFNTDFNSRAEFFWSHGLISDSTYEIFTKVCN  243

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLATE--  950
              + +  +   G L+  CS +  ++S E+   +D  ++    C SS+   +      T+  
Sbjct  244   YSQIRRQHQGGTLTPICSGVNRLVSTEVSRYIDTYDVTLDVCLSSADQQAYVPNQLTQLQ  303

Query  951   ---TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDI  1112
                  D C+ D    Y+NR DVQ+ALHA   G       TS    SDV+   + N  I  
Sbjct  304   EGAKIDVCVEDETIAYLNRKDVQEALHAKLVG------ITSWSTCSDVLKYDMQNLEIPT  357

Query  1113  LPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGG  1292
             +  L AL  S I VL+YSGDQD  IP++ TR +   LA    L T      W++G+++ G
Sbjct  358   ISILGALAKSGIRVLVYSGDQDSVIPLTGTRSLVNGLAKDFGLNTTVSYRAWFEGRQVAG  417

Query  1293  WSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             W+Q +G+         L+FAT+RG +H  P S P ++L L KAFL+G P P
Sbjct  418   WTQVYGDI--------LSFATIRGAAHEAPFSQPERSLVLLKAFLEGKPLP  460



>ref|XP_006294161.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
 gb|EOA27059.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
Length=465

 Score =   333 bits (855),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 193/468 (41%), Positives = 271/468 (58%), Gaps = 26/468 (6%)
 Frame = +3

Query  72    FLLVNTL---YSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
              +L+ TL    S ++    + I  LPGQP  V F QYSGY+     + RALFYY AEA++
Sbjct  13    LILLQTLSLTVSSTVLSRADRITRLPGQPR-VGFQQYSGYVNIDDKKQRALFYYLAEAET  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             +   S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+
Sbjct  72    K-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSILVKNQHSWNQEANMLYLETPV  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSY+  SS Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA
Sbjct  130   GVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              L+++ N+         LKGIA+GNP++E  +   S  E+ W HG+IS+  Y M    CN
Sbjct  190   QLMIQYNKKHNLF---NLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDLTYKMFTSYCN  246

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFq----scesssisssqqHYLA  944
              +  + E+  G +S  C+ +   +S E    +DK ++       S  S S   + Q    
Sbjct  247   YSRYVSEYYRGTVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSKVVNPQPQQM  306

Query  945   TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL  1124
              ET D C+ D    Y+NR DVQKALHA   G +  W   S     D  + +  +  +  +
Sbjct  307   GETVDVCVEDETVNYLNRRDVQKALHARLVGTR-KWAVCS--NVLDYEVLDVEVPTINIV  363

Query  1125  SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQT  1304
              +L+ + +PVL+YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q 
Sbjct  364   GSLVKARVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTGPYRVWFAGQQVGGWTQV  423

Query  1305  FGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             +GN         L FATVRG +H VP S P++AL LFKAFL G P P+
Sbjct  424   YGNI--------LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLPD  463



>emb|CDX90124.1| BnaA08g18600D [Brassica napus]
Length=460

 Score =   333 bits (854),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 189/462 (41%), Positives = 269/462 (58%), Gaps = 22/462 (5%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             F L+  L S ++  + +++  LPGQP  V F QYSGY+   + + RALFYYFAEA++ + 
Sbjct  14    FALIFFLSSSTVLSHSDLVTRLPGQPR-VGFQQYSGYVTLDEKKQRALFYYFAEAET-NP  71

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV 
Sbjct  72    TSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYS T   Y+   D +TAR+NL FL +WF++F  Y +   +I G+SY GH  PQLA L+
Sbjct  131   FSYS-TQRSYESVDDKITARDNLVFLERWFLKFPHYLNRSLFITGESYAGHYVPQLADLM  189

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATT  785
             ++ N+   HL    L+GIA+GNP+LE  +   S  E+ W HG+IS+  + +    CN + 
Sbjct  190   IQYNKK-HHL--FNLRGIAIGNPVLEFSTDFNSRAEYFWSHGLISDSTFKLFTSYCNYSR  246

Query  786   MIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETAD  959
              + E+  G +S  CS +   ++ E    +DK ++          S S         E+ D
Sbjct  247   YVSEYYRGSMSSICSKVMSQVNTETSRFVDKYDVTLDVCISSVLSQSKVVSPNQVGESVD  306

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
              C+ D    Y+NR DVQ+ALHA   G +  W   S     D  + +     +  + +L+ 
Sbjct  307   VCVEDETVNYLNRRDVQEALHARLVGVR-EWTVCS--NVLDYQMLDVEKPTINIVGSLVE  363

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             + +PVL+YSGDQD  IP++ +R + + LA RL L T      W+ G+++GGW+Q +GN  
Sbjct  364   AGVPVLVYSGDQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNV-  422

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                    L+FATVRG +H VP S P ++L LFKAFL G P P
Sbjct  423   -------LSFATVRGAAHEVPFSQPERSLVLFKAFLDGHPLP  457



>ref|XP_010271868.1| PREDICTED: serine carboxypeptidase-like 45 isoform X4 [Nelumbo 
nucifera]
Length=503

 Score =   335 bits (858),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 188/444 (42%), Positives = 265/444 (60%), Gaps = 20/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V+F QYSGYI   + + RALFYYF EA++ +  S PL LW+ GG  CSS 
Sbjct  73    IIKLPGQP-EVNFQQYSGYITVDEEQQRALFYYFVEAET-NPASKPLVLWVNGGPGCSSI  130

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV+N++SWN  +NMLY++TP GV FSYS  +S Y   +D MT
Sbjct  131   GTGAFSEHGPFRPS-GKNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVNDEMT  189

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL F+++W  +F E+++ D +I G+SY GH  PQLA L+++ N      +   LKGI
Sbjct  190   ARDNLVFMQRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQFNDQ----KLFNLKGI  245

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E LW HG+IS+  YG     CN +  + ++  G +S  C  + 
Sbjct  246   ALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFLSKYYRGSVSSVCLRVV  305

Query  840   IMLSEEIGHDMDKENLVFqscess--sisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
              +++ EI   +D+ ++    C SS  S S +       E+ D C+ D    Y+NR DVQK
Sbjct  306   SLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQKVVESTDVCVEDETYNYLNRDDVQK  365

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             +LHA+  G    W   +  +     + N  +  +P LS+L  S I +L+YSGDQD  IP+
Sbjct  366   SLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILVYSGDQDSIIPL  424

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + TR +   LA  L L T      W++GK++GGW+Q +G+         LTFAT+RGGSH
Sbjct  425   TGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI--------LTFATIRGGSH  476

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
               P S P ++L LF +FLKG P P
Sbjct  477   EAPFSQPQRSLVLFNSFLKGKPLP  500



>ref|XP_006589008.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=464

 Score =   333 bits (854),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 191/471 (41%), Positives = 267/471 (57%), Gaps = 33/471 (7%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             LL F++   +  ++     + I +LPGQP  V F QY+GYI     + RALFYYF EA+ 
Sbjct  13    LLLFVIAQCVVGVNSLSQADKISTLPGQPP-VKFQQYAGYITVDDKQKRALFYYFVEAEV  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             E   S PL LWL GG  CSS   G F E+GPF+P+E+G L+KN+ SWN  +NMLY+++P 
Sbjct  72    EPA-SKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKEANMLYLESPA  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS   S Y   +D MTAR+NL FL++WF +F E ++ DF+I G+SY GH  PQLA
Sbjct  130   GVGFSYSANKSFYDFVNDEMTARDNLVFLQRWFTKFPELKNNDFFITGESYAGHYVPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              LI++            LKGIA+GNP++E  +   S  E  W HG+IS+  Y +  KVCN
Sbjct  190   QLIVQTKTK------FNLKGIAIGNPLVEFNTDFNSRAEFFWSHGLISDSTYEIFTKVCN  243

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLATE--  950
              + +  +   G L+  CS +  ++S E+   +D  ++    C SS+   +      T+  
Sbjct  244   YSQIRRQHQGGTLTPICSGVNRLVSTEVSRYIDTYDVTLDVCLSSADQQAYVLNQLTQLQ  303

Query  951   ---TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDI  1112
                  D C+ D    Y+NR DVQ+ALHA   G       TS    SDV+   + N  I  
Sbjct  304   EGAKIDVCVEDETIAYLNRKDVQEALHAKLVG------ITSWSTCSDVLKYDMQNLEIPT  357

Query  1113  LPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGG  1292
             +  L AL  S I VL+YSGDQD  IP++ TR +   LA    L T      W++G+++ G
Sbjct  358   ISILGALAKSGIRVLVYSGDQDSVIPLTGTRSLVNGLAKDFGLNTTVSYRAWFEGRQVAG  417

Query  1293  WSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             W+Q +G+         L+FAT+RG +H  P S P ++L L KAFL+G P P
Sbjct  418   WTQVYGDI--------LSFATIRGAAHEAPFSQPERSLVLLKAFLEGKPLP  460



>ref|XP_010413849.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   333 bits (854),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 189/456 (41%), Positives = 265/456 (58%), Gaps = 23/456 (5%)
 Frame = +3

Query  96    SISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLW  275
             S ++    + I  LPGQP  V F QYSGY+   + + RALFYY AEA+++   S PL LW
Sbjct  24    SSTVLSRADRITRLPGQPR-VGFQQYSGYVTVDEKQQRALFYYLAEAETK-PISKPLVLW  81

Query  276   LGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSS  455
             L GG  CSS  +G F ENGPFRP +   LVKNQ SWN  +NMLY++TP+GV FSY+  SS
Sbjct  82    LNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVGFSYATESS  140

Query  456   DYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPA  635
              Y+  +D +TA++NL FL+KWF++F +Y +   +I G+SY GH  PQLA L+++ N+   
Sbjct  141   SYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKHN  200

Query  636   HLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG  809
                   LKGIA+GNP++E  +   S  E+ W HG+IS+  Y M    CN +  + E+  G
Sbjct  201   LF---NLKGIAIGNPVMEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCNYSRYVSEYYRG  257

Query  810   ELSEYCSDIEIMLSEEIGHDMDKENLVFq----scesssisssqqHYLATETADPCLRDW  977
              +S  C+ +   +S E    +DK ++       S  S S   + Q     E  D C+ D 
Sbjct  258   TVSSMCTKVMSQVSIETSRFVDKYDVTLDVCIPSVLSQSKRVNPQPQQMGEAVDVCVEDE  317

Query  978   VGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVL  1157
                Y+NR DVQKALHA   G +  W+  S     D  + +  +  +  +  L+ + +PVL
Sbjct  318   TVNYLNRRDVQKALHARLVGTR-KWSVCS--NVLDYEVLDVEVPTINIVGRLVKAGVPVL  374

Query  1158  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVA  1337
             +YSGDQD  IP++ +R +   LA  L L T      W+ G+++GGW+Q +GN        
Sbjct  375   VYSGDQDSVIPLTGSRTLVKRLADELGLRTTVPYRVWFAGQQVGGWTQVYGNI-------  427

Query  1338  NLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              L FATVRG +H VP S P++AL LFKAFL G P P
Sbjct  428   -LAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  462



>ref|XP_009415855.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   333 bits (854),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 190/466 (41%), Positives = 264/466 (57%), Gaps = 24/466 (5%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEI---IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +LV   +S  ++ N  +   I  LPGQP  V F Q+SGYI   + + RALFYYF EA+  
Sbjct  14    ILVQVCFSRGLQPNPAVPDRITKLPGQP-QVTFQQFSGYITVDELQKRALFYYFVEAEM-  71

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS  +G F ENGPFRP+    LV+N++SWN  +NMLY++ P G
Sbjct  72    DPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVRNEYSWNKEANMLYLEAPAG  130

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAA  605
             V FSYS  SS Y   +D  TA +NL FL++WF +F  Y++ D YI G+SY GH  PQLA 
Sbjct  131   VGFSYSGDSSFYDGVNDKKTAWDNLVFLQRWFNKFPGYKNRDLYITGESYAGHYVPQLAQ  190

Query  606   LILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNA  779
             L++E N+     +   LKGIA+GNP+LE  +   S  E  W HG+IS+  Y +    CN 
Sbjct  191   LMVEFNKKA---KIFNLKGIAMGNPVLEFATDFNSRAEFFWSHGLISDSTYRIFTSACNY  247

Query  780   TTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATET  953
             +  + E+  G LS  C+ +   ++ E    +DK ++          S S         E 
Sbjct  248   SRYVSEYYRGSLSPVCARVMSQVTRETSRFVDKYDVTLDVCISSVLSQSLVLSPQQVPEN  307

Query  954   ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  1133
              D C+ D    Y+NR DVQ ALHA  TG    W   S     +++  N  I  +  + +L
Sbjct  308   IDVCIEDETVNYLNRKDVQDALHARLTGVT-KWTVCSSVLQYELL--NLEIPTITLVGSL  364

Query  1134  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  1313
             L + IPVL+YSGDQD  IP++ +R +   LA  + L T      W++GK++GGW+Q +G+
Sbjct  365   LKARIPVLVYSGDQDSVIPLTGSRTLVQKLANEMGLKTTVPYRVWFEGKQVGGWTQVYGD  424

Query  1314  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
                      L+FAT+RG SH  P S P ++L LF++FL+G P P T
Sbjct  425   I--------LSFATIRGASHEAPFSQPERSLVLFRSFLQGRPLPET  462



>ref|XP_006662960.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=470

 Score =   333 bits (854),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 187/472 (40%), Positives = 273/472 (58%), Gaps = 22/472 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++V  L  LL+  L+ +     G+ I  LPGQP +V F QY+GYI       RALFYYF 
Sbjct  14    VVVSSLQLLLIAALFHLGSCNGGDRITRLPGQP-EVSFGQYAGYIGVDDKGKRALFYYFV  72

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA+  D  + PL LWL GG  CSS  +G F ENGPFRP+    LVKN++SWN  +N++Y+
Sbjct  73    EAEL-DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYL  130

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             +TP GV +SYS+ ++ Y+   D MTA +N+ FL++W  +F +Y+  + YI+G+SY GH  
Sbjct  131   ETPAGVGYSYSSDAAYYQGVDDKMTAMDNMVFLQRWLEKFPQYKGRELYISGESYAGHYI  190

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQK  764
             PQLA +++E N+     +   LKGIALGNP+LE  +   S  E+ W HG+IS+  Y +  
Sbjct  191   PQLAEVMVEFNKKN---KIFNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDSTYRIFT  247

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqqH  935
              VCN +  + E+  G L+  C+ +   ++ E    +DK ++   V  S   S       H
Sbjct  248   SVCNYSRYVTEYYGGSLTPLCTRVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILTPH  307

Query  936   YLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDIL  1115
               A +  D C+ D    Y+NR DVQ+ALHA   G +   N+       +  L N  I  +
Sbjct  308   QQAGQRIDVCVEDETVNYLNRKDVQEALHAKLIGVK---NWAVCSSVLEYELLNLQIPTI  364

Query  1116  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  1295
               + +L+ S I VL+YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW
Sbjct  365   NIVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLARNLGLKTTVPYRVWFEGQQVGGW  424

Query  1296  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             +Q +G+         L+FAT+RG SH  P S P ++L LF+AFL+G P P T
Sbjct  425   TQVYGDM--------LSFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  468



>ref|XP_009380118.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=467

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 193/447 (43%), Positives = 261/447 (58%), Gaps = 23/447 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  34    IVKLPGQP-QVSFQQFSGYVTVDERKHRALFYYFAEAEM-DPSSKPLVLWLNGGPGCSSV  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N++SWN  +NMLY++TP GV FS+S+ SSDY+  +D +
Sbjct  92    GVGAFSENGPFRP--KGEVLVRNEYSWNKEANMLYLETPAGVGFSFSSDSSDYEGVNDRI  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL++WF +F  Y+  D YI G+SY GH  PQLA L+++ N+     +   LKG
Sbjct  150   TARDNLVFLQRWFTKFPRYKGRDLYITGESYAGHYVPQLAQLMVDFNKKE---KVFNLKG  206

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G LS  C  +
Sbjct  207   IALGNPVLEFSTDFNSRAEFFWSHGLISDTTYRIFTSACNYSRYVSEYYRGSLSSICQRV  266

Query  837   EIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                ++ E    +DK ++          S S        TE  D C+ D    Y+NR DVQ
Sbjct  267   MSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQQVTERVDVCVEDETVSYLNRKDVQ  326

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
              ALHAN  G    W   S     +  L N  +  +  + +L+ S IPVL+YSGDQD  IP
Sbjct  327   AALHANLVGVT-KWTVCS--SVIEYELLNLEVPTISIVGSLVKSGIPVLVYSGDQDSVIP  383

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W++G+++GGW+Q +G+         L+FATVRG S
Sbjct  384   LTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYGDV--------LSFATVRGAS  435

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             H  P S P ++L LF+AFL+G P P T
Sbjct  436   HEAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_010099600.1| Serine carboxypeptidase-like 45 [Morus notabilis]
 gb|EXB79994.1| Serine carboxypeptidase-like 45 [Morus notabilis]
Length=464

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 190/448 (42%), Positives = 266/448 (59%), Gaps = 26/448 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+     +  +LFYYF EA+ +D  S PL LWL GG  CSS 
Sbjct  32    IHELPGQP-QVGFQQFSGYVKVDAQKNTSLFYYFVEAE-KDPSSKPLVLWLNGGPGCSSL  89

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +G+ L++N++SWN  +NMLY++TP+GV FSYS  SS Y    D  
Sbjct  90    GVGAFSENGPFRP--NGKILLRNKYSWNREANMLYLETPVGVGFSYSTNSSSYVAVDDKA  147

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR NL FLR WF +F +YR  D ++ G+SY GH  PQLA L++E NR     +   LKG
Sbjct  148   TARANLIFLRGWFRKFPQYRKRDLFLTGESYAGHYIPQLAKLMVEVNR---KRKVFNLKG  204

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E+LW HG+IS+  Y M   VCN +  + E+    +S  C  +
Sbjct  205   IALGNPVLEYATDFNSRAEYLWSHGLISDTTYKMFNSVCNYSRYVSEYYRDAVSPTCLRV  264

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqq-----HYLATETADPCLRDWVGEYINRP  1001
                ++ E  + +DK ++    C SS +S S+        ++ +T D C+ D V +Y+NR 
Sbjct  265   INQVNAETSNFVDKYDVTLDVCISSVLSQSKVLNPKPQKVSDQTIDVCVDDKVVKYLNRR  324

Query  1002  DVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDL  1181
             DVQ+ALHA   G +  W+  S     D  + N  +  +  + +L+ + I VL+YSGDQD 
Sbjct  325   DVQRALHARLVGVR-QWDACS--NILDYEVLNVELPTISIVGSLVKAGISVLVYSGDQDS  381

Query  1182  RIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVR  1361
              IP+  +R +   LA  L L T      W+ GK++GGW+Q +GN+        L+FAT+R
Sbjct  382   VIPLMGSRTLVDKLASELGLKTTVPYRVWFQGKQVGGWTQVYGNA--------LSFATIR  433

Query  1362  GGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
               SH  P S P ++L LFK+FL+G+P P
Sbjct  434   DASHEAPFSQPERSLILFKSFLQGNPLP  461



>ref|XP_003621641.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=489

 Score =   333 bits (853),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 192/473 (41%), Positives = 267/473 (56%), Gaps = 50/473 (11%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP  VDF+Q+SGY+       +ALF+YF EA++ D  S PL LWL GG  CSS 
Sbjct  31    ITNLPGQP-HVDFHQFSGYVNVDDQNKKALFFYFVEAKN-DAVSKPLVLWLNGGPGCSSL  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP  +  LVKNQFSWN  +NMLY+++PIGV FSYS  +S Y+  +D +T
Sbjct  89    GVGAFSENGPFRPKGEA-LVKNQFSWNTEANMLYLESPIGVGFSYSTDTSSYEGVNDKIT  147

Query  486   A-----------------------------RENLKFLRKWFIEFSEYRDLDFYIAGDSYG  578
                                           R+NL FL+ WF++F EYR+   +I G+SY 
Sbjct  148   GKFSIFILLFDLRMILNFILLNGQAPFNSTRDNLIFLQNWFVKFPEYRNRSLFIVGESYA  207

Query  579   GHLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVY  752
             GH  PQLA L+L+ N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  +
Sbjct  208   GHYVPQLAELMLQFNKKE---KLFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDLTF  264

Query  753   GMQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisss  926
              M   VCN +  + E+ +G +S  CS +   +S E    +DK ++          S ++ 
Sbjct  265   KMFTSVCNYSRYVREYYNGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTNV  324

Query  927   qqHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAI  1106
                   TET D C+ D    Y+NR DVQ ALHA+  G  + W+  S     D  L +  I
Sbjct  325   LNPQQVTETIDVCVEDETVNYLNRKDVQSALHAHLIG-VHRWSPCS--SVLDYELRDLEI  381

Query  1107  DILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEI  1286
               +  +  L+ + IPVL+YSGDQD  IP++ +R +   LA +L++ T      W+ G+++
Sbjct  382   PTITVVGKLVKAGIPVLVYSGDQDSVIPLTGSRTLVHQLAKQLRMNTTVPYRVWFAGQQV  441

Query  1287  GGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GGW+Q +GN         L+FATVRG SH VP S P ++L LFK+FL+G P P
Sbjct  442   GGWTQVYGNI--------LSFATVRGASHEVPFSQPERSLVLFKSFLEGRPLP  486



>emb|CBI32795.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   331 bits (849),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 183/442 (41%), Positives = 260/442 (59%), Gaps = 25/442 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  29    ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTTLKPLVVWFSGGPGCSSV  87

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  88    GGGAFAQHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  146

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA LILE            LKGI
Sbjct  147   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESRVK------FNLKGI  200

Query  666   ALGNPILE-KMSLSNVEHL-WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
              +G+P+++   + ++V H  W HG+IS+  Y +    CN + M  E  SG LS  C  + 
Sbjct  201   LMGDPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  260

Query  840   IMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
                S+E+G  +D+    F    +S + S       TE  D C+ D V +Y+NR DVQK+L
Sbjct  261   SQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVNKYLNREDVQKSL  316

Query  1020  HANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSH  1199
             HA   G    W+  S     ++   +  I ++P + +L+ S I   +YSGDQD  IP+  
Sbjct  317   HARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFG  373

Query  1200  TREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1379
             TR +   LA  L+L T      W++G+++GGW+Q +G+         L+FATVRGGSH V
Sbjct  374   TRTLVDGLAKELRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTV  425

Query  1380  PNSSPSKALTLFKAFLKGSPPP  1445
             P + P++AL LF AFLKG PPP
Sbjct  426   PGTQPARALVLFTAFLKGQPPP  447



>ref|XP_011075459.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=472

 Score =   332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 194/470 (41%), Positives = 272/470 (58%), Gaps = 30/470 (6%)
 Frame = +3

Query  57    VFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEA  236
             V  + F+L   + +   +  G+ I SLPGQP  V F QYSGYI+    + R+ FYYF EA
Sbjct  10    VLAMIFVLQIYVAAGKAQNQGDKIVSLPGQP-KVSFQQYSGYIIIGGKQQRSYFYYFVEA  68

Query  237   QSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDT  416
             ++E   S PL LWL GG  CSS   G F E+GPF+P+ +  LV+N +SWN A+NMLY+++
Sbjct  69    ETEPA-SKPLVLWLNGGPGCSSVGAGAFSEHGPFQPSGN-VLVRNNYSWNKAANMLYLES  126

Query  417   PIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQ  596
             P GV FSYS   S Y+   D MTAR+NL FL KWF +F EY++ +FYI G+SYGGH  PQ
Sbjct  127   PAGVGFSYSANKSFYESVDDEMTARDNLNFLEKWFDKFPEYKNREFYITGESYGGHYVPQ  186

Query  597   LAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKV  770
             LA LI++            LKGIA+GNP+LE  +   S  E LW HG+IS+  Y     V
Sbjct  187   LANLIIQSKAK------FNLKGIAIGNPLLEFDTDFNSRAEFLWSHGLISDATYYQFTSV  240

Query  771   CNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLATE  950
             CN + +  +  SG L+  CS +  ++S EI   +D  ++    C SS +  ++      +
Sbjct  241   CNYSQIRRQAASGALTPVCSRVIKLVSSEISRFIDTYDVTLDVCLSSVMLQAEVLNQVQD  300

Query  951   --TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDIL  1115
                 D C+ D    Y+NR DVQ+ALHA   G    W+       SD++   + N  I  +
Sbjct  301   EPKIDVCVEDEANAYLNRKDVQQALHARLVGVSR-WSI-----CSDILHYEMQNLEIPTI  354

Query  1116  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  1295
               L  L+ S + VL+YSGDQD  +P++ TR +   LA  LKL T E  G W++G+++ GW
Sbjct  355   GILGLLVKSGVRVLVYSGDQDSVLPLTGTRALVNGLAKDLKLNTSEPYGAWFEGRQVAGW  414

Query  1296  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +Q++G          L+FAT+RG SH  P S P ++L LF +F+ G P P
Sbjct  415   TQSYGEF--------LSFATIRGASHEAPFSQPERSLVLFSSFVGGKPLP  456



>ref|NP_001052663.1| Os04g0396800 [Oryza sativa Japonica Group]
 emb|CAE05146.2| OSJNBa0039C07.2 [Oryza sativa Japonica Group]
 dbj|BAF14577.1| Os04g0396800 [Oryza sativa Japonica Group]
 gb|EAZ30581.1| hypothetical protein OsJ_14632 [Oryza sativa Japonica Group]
 dbj|BAG91822.1| unnamed protein product [Oryza sativa Japonica Group]
Length=470

 Score =   332 bits (850),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 191/451 (42%), Positives = 261/451 (58%), Gaps = 28/451 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP +V F QYSGY+     R R LFYYFAEA+  D  + PL LWL GG  CSS 
Sbjct  37    IVALPGQP-NVSFAQYSGYVTVDAARRRELFYYFAEAEL-DPATKPLVLWLNGGPGCSSV  94

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV+N++SWN  +NMLY+++P GV FSYS   S Y    D+ T
Sbjct  95    GVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYGGVGDSRT  153

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL+FL+ WF +F +Y+  D YI G+SY GH  PQLA  ++E N+     +   LKGI
Sbjct  154   ARDNLRFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLKGI  210

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E  W HG+IS+  Y     VCN +  + E+  G LS  C  + 
Sbjct  211   ALGNPVLEFATDFNSRAEFFWSHGLISDSTYHSFTTVCNYSRYVSEYYHGSLSSACDTVM  270

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++            S S      +   D C+ D    Y+NR DVQ+
Sbjct  271   TQVARETSRFVDKYDVTLDVCVSSVLMQSKSLAPQRGSRELDVCVEDETMGYLNRKDVQE  330

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDI-LPTLS---ALLMSDIPVLIYSGDQDL  1181
             A+HA   G    W   S       +L    +D+ +PT++    L+ S +PVL+YSGDQD 
Sbjct  331   AMHARLEGGVPKWTVCSS------VLEYKQLDLQIPTINIVGGLVKSGVPVLVYSGDQDS  384

Query  1182  RIPVSHTREVATVLAVRLKL-TTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATV  1358
              IP++ +R V   LA  L+L TT      W++G+++GGW+Q+FG  GG      L+FATV
Sbjct  385   VIPLTGSRTVVQRLAGWLRLGTTAAGYRVWFEGRQVGGWTQSFG--GGA-----LSFATV  437

Query  1359  RGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             RG SH  P S P ++L LF AFL G P P++
Sbjct  438   RGASHEAPFSQPERSLVLFAAFLAGRPLPDS  468



>ref|XP_009380117.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   332 bits (852),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 193/447 (43%), Positives = 261/447 (58%), Gaps = 23/447 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+   + + RALFYYFAEA+  D  S PL LWL GG  CSS 
Sbjct  56    IVKLPGQP-QVSFQQFSGYVTVDERKHRALFYYFAEAEM-DPSSKPLVLWLNGGPGCSSV  113

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP   GE LV+N++SWN  +NMLY++TP GV FS+S+ SSDY+  +D +
Sbjct  114   GVGAFSENGPFRP--KGEVLVRNEYSWNKEANMLYLETPAGVGFSFSSDSSDYEGVNDRI  171

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL++WF +F  Y+  D YI G+SY GH  PQLA L+++ N+     +   LKG
Sbjct  172   TARDNLVFLQRWFTKFPRYKGRDLYITGESYAGHYVPQLAQLMVDFNKKE---KVFNLKG  228

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G LS  C  +
Sbjct  229   IALGNPVLEFSTDFNSRAEFFWSHGLISDTTYRIFTSACNYSRYVSEYYRGSLSSICQRV  288

Query  837   EIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                ++ E    +DK ++          S S        TE  D C+ D    Y+NR DVQ
Sbjct  289   MSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQQVTERVDVCVEDETVSYLNRKDVQ  348

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
              ALHAN  G    W   S     +  L N  +  +  + +L+ S IPVL+YSGDQD  IP
Sbjct  349   AALHANLVGVT-KWTVCS--SVIEYELLNLEVPTISIVGSLVKSGIPVLVYSGDQDSVIP  405

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W++G+++GGW+Q +G+         L+FATVRG S
Sbjct  406   LTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYGDV--------LSFATVRGAS  457

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             H  P S P ++L LF+AFL+G P P T
Sbjct  458   HEAPFSQPERSLVLFRAFLQGRPLPET  484



>gb|KEH37845.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=464

 Score =   331 bits (849),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 189/446 (42%), Positives = 257/446 (58%), Gaps = 27/446 (6%)
 Frame = +3

Query  132   SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAI  311
             +LP QP  VDF QY  YI   +   R LFYYF E+ + D  S PL LWL GG  CSS   
Sbjct  40    TLPDQPRVVDFEQYGNYITVDENHQRKLFYYFVESTT-DPASKPLVLWLNGGPGCSSIGQ  98

Query  312   GMFYENGPFRPTEDG-ELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTA  488
             G F E+GPF+PT  G  LV+N +SWN  +NMLY+D+P GV FSYS  SSDY + +D MTA
Sbjct  99    GAFTEHGPFKPTAMGLGLVENPYSWNRVANMLYLDSPTGVGFSYSANSSDYYLVNDEMTA  158

Query  489   RENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIA  668
             R+N+ FL  WF +F +Y++ +F+I G+SY GH APQLA LIL+   N      IKLKGI 
Sbjct  159   RDNMMFLLGWFSKFPKYQNSEFFITGESYAGHYAPQLAQLILQTQPN------IKLKGIM  212

Query  669   LGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIEI  842
             +GNP+L+  +   S  E+LW HG+IS+  Y    K CN  T   +   G +S  CSD+  
Sbjct  213   IGNPLLDFDTDFNSRAEYLWSHGLISDSTYSRFTKACNFATYKRQKRIGNISTICSDVYH  272

Query  843   MLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKALH  1022
              +       +D  ++    C     +    H  + E  D CL D   +Y+NR DVQKALH
Sbjct  273   EVVTSTSRFIDTFDVTSDVCLDFLQAHRLLHPHSGEKMDVCLEDHTAKYLNRQDVQKALH  332

Query  1023  ANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS---ALLMSDIPVLIYSGDQDLRIPV  1193
             +   G  Y W+       + V+L++F     PTLS    L+ + + VL YSGDQD  IP+
Sbjct  333   SRVVGMPY-WS-----TCTSVMLYDFQNLENPTLSLLGTLVKAGVRVLAYSGDQDSFIPL  386

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + TR +   LA  L L T E+   W+DGK++ GW++ +G          L+FAT+RG +H
Sbjct  387   TGTRTLVKGLAKDLGLNTTEVYRVWFDGKQVAGWTEVYG--------GFLSFATIRGAAH  438

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPNT  1451
               P S P + L LFK+F++G  PP +
Sbjct  439   AAPFSQPERLLVLFKSFVEGKSPPTS  464



>ref|XP_004136793.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 ref|XP_004159657.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
Length=475

 Score =   332 bits (850),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 196/478 (41%), Positives = 278/478 (58%), Gaps = 36/478 (8%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEI--IDSLPGQPSD--VDFNQYSGYIVTHKFRGRALFYYFAEAQ  239
              LLV  +    I  + E   I  LPGQPS   V+F Q+SGYI    ++ RALFYYF EA 
Sbjct  13    LLLVGVILCSRIECSKESDRILRLPGQPSSSTVNFQQFSGYITVDDYQNRALFYYFVEAY  72

Query  240   SEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTP  419
             + D  S PL LWL GG  CSS  +G F E+GPFRP  D  L+ N+FSWN  +N+LYV++P
Sbjct  73    T-DPSSKPLLLWLDGGPGCSSLGVGAFVEHGPFRPEGD-VLIHNRFSWNNVANILYVESP  130

Query  420   IGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQL  599
              GV FS+S   + Y   +DT+TA++NL FL +WF +F EY++ DF+I+G+SY GH  PQL
Sbjct  131   AGVGFSFSENITFYTTVNDTITAQDNLVFLERWFKKFPEYKNRDFFISGESYAGHYVPQL  190

Query  600   AALILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVC  773
             A LIL+     + L    LK IA+GNP+LE  +  N   E+LW HG+IS+  Y +  KVC
Sbjct  191   ATLILQ-----SKLSIFNLKAIAIGNPLLEFYTDFNARGEYLWTHGLISDSTYKLLNKVC  245

Query  774   NATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLATET  953
             N + +  + +   +S  CS ++  +S+E    ++  ++    C SS++S +   +L+  T
Sbjct  246   NISEITRQSILHNVSTSCSFVDNSVSKEYSEFINLYSVNLDVCTSSTLSQAASSFLSKRT  305

Query  954   ---------------ADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI  1088
                             D C+ D V  Y+NR DVQKALHA+  G    W+F S     D  
Sbjct  306   PRKTLPQYSVLQSGKIDVCIADEVSSYLNREDVQKALHAHLLGGLSNWSFCSFVLKYDK-  364

Query  1089  LHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPW  1268
               N  I  + TL +L+ S I VL+YSGD+D  IP+  +R +   LA  L+L T     PW
Sbjct  365   -KNLLIPTIDTLGSLVHSGIRVLVYSGDEDAVIPLIGSRRLVNKLAKSLRLNTTLPYSPW  423

Query  1269  YDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPP  1442
             +   ++GGW +T+G         +L+FATVRGG+H  P ++P ++LTL  AFL+G+ P
Sbjct  424   FYNHQVGGWVETYGEKN------SLSFATVRGGAHQAPYTAPQRSLTLITAFLQGTNP  475



>ref|XP_002277400.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=455

 Score =   331 bits (848),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 183/442 (41%), Positives = 260/442 (59%), Gaps = 25/442 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  35    ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTTLKPLVVWFSGGPGCSSV  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  94    GGGAFAQHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  152

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA LILE            LKGI
Sbjct  153   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESRVK------FNLKGI  206

Query  666   ALGNPILE-KMSLSNVEHL-WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
              +G+P+++   + ++V H  W HG+IS+  Y +    CN + M  E  SG LS  C  + 
Sbjct  207   LMGDPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  266

Query  840   IMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
                S+E+G  +D+    F    +S + S       TE  D C+ D V +Y+NR DVQK+L
Sbjct  267   SQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVNKYLNREDVQKSL  322

Query  1020  HANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSH  1199
             HA   G    W+  S     ++   +  I ++P + +L+ S I   +YSGDQD  IP+  
Sbjct  323   HARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFG  379

Query  1200  TREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1379
             TR +   LA  L+L T      W++G+++GGW+Q +G+         L+FATVRGGSH V
Sbjct  380   TRTLVDGLAKELRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTV  431

Query  1380  PNSSPSKALTLFKAFLKGSPPP  1445
             P + P++AL LF AFLKG PPP
Sbjct  432   PGTQPARALVLFTAFLKGQPPP  453



>ref|XP_002318164.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
 gb|EEE96384.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
Length=463

 Score =   331 bits (848),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 191/445 (43%), Positives = 256/445 (58%), Gaps = 23/445 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+     + RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  34    IAGLPGQP-HVGFQQFSGYVTVDGNKHRALFYYFVEAEI-DPASKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +G  L++N+ SWN  +NMLY++TP+GV FSYS  +S Y    D  
Sbjct  92    GVGAFSENGPFRP--NGRVLIRNEHSWNREANMLYLETPVGVGFSYSTDNSSYVAVDDEA  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+ WF +F +YR+ D +I G+SY GH  PQLA L++E N+     R + LKG
Sbjct  150   TARDNLVFLQGWFHKFPQYRNKDLFITGESYAGHYIPQLAKLMVEINKKE---RLVNLKG  206

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+    +S  CS +
Sbjct  207   IALGNPVLEFATDLNSRAEYFWSHGLISDSTYKMFTSACNYSRYVSEYYRDSVSSVCSLV  266

Query  837   EIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                +S E    +DK ++    C     S S        +E  D C+ D    Y+NR DV+
Sbjct  267   MKQVSTETSRFVDKYDVTLDVCIPSVLSQSKVISPKQVSERIDVCIEDETVNYLNREDVR  326

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KALHA   G +  W   S     D  + N  I  +  + +L+ + IPVLIYSGDQD  IP
Sbjct  327   KALHARLIGVRR-WEVCS--NILDYEVLNIEIPTINIVGSLIKAGIPVLIYSGDQDSVIP  383

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W+ GK++GGW+Q +GN         L+FAT+RG S
Sbjct  384   LTGSRTLVHRLAKELGLNTTVPYRAWFAGKQVGGWTQVYGNI--------LSFATIRGAS  435

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LFK+FL+G   P
Sbjct  436   HEAPFSQPERSLMLFKSFLQGKHLP  460



>ref|XP_007159978.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31972.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=468

 Score =   330 bits (847),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 184/447 (41%), Positives = 265/447 (59%), Gaps = 23/447 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +  F Q+SGY+     + +ALFYYF E+++    S PL LWL GG  CSS 
Sbjct  35    IVRLPGQP-NTGFQQFSGYVTVDDLKHKALFYYFVESETHPA-SKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE L+KN++SWN  +NMLY++TP+GV FSY+   S Y+  +D  
Sbjct  93    GVGAFSENGPFRP--NGEVLIKNEYSWNRETNMLYLETPVGVGFSYAKGGSSYETVNDET  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL++WF +F ++R+ D ++AG+SY GH  PQLA L++E N+     +   LKG
Sbjct  151   TARDNLVFLQRWFNKFPQFRNRDLFLAGESYAGHYVPQLAKLMIEINKKE---KLFNLKG  207

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+    +S  CS +
Sbjct  208   IALGNPVLEYATDLNSRAEFFWSHGLISDSTYKLFTTGCNYSRYVSEYYRDSISPVCSKV  267

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqq----HYLATETADPCLRDWVGEYINRPD  1004
                ++ E    +DK ++    C SS +S S+          E+ D C+ D V  Y+NR D
Sbjct  268   LRHVARETSRFVDKYDVTLDVCISSVLSQSKAICPQGQKINESIDVCVDDKVTNYLNRKD  327

Query  1005  VQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLR  1184
             VQ+ALHA   G +  W+  S     D  + N     LP + +L+ + + VLIYSGDQD  
Sbjct  328   VQEALHAKLVGVR-KWDVCSNNSILDYDMLNLEKPTLPVVGSLIKAGVRVLIYSGDQDSV  386

Query  1185  IPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRG  1364
             IP++ +R +   LA +L L T      W++G+++GGW+Q +G+         L+FATVRG
Sbjct  387   IPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGSI--------LSFATVRG  438

Query  1365  GSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              SH  P S P ++  LFK+FL+  P P
Sbjct  439   ASHEAPFSQPERSFVLFKSFLEDRPLP  465



>ref|XP_007043818.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 ref|XP_007043819.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99649.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99650.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
Length=462

 Score =   330 bits (846),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 195/469 (42%), Positives = 268/469 (57%), Gaps = 29/469 (6%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEA  236
             L F+++   + + +  +  + D    LPGQP  V F QYSGY+   + + RALFYYFAEA
Sbjct  11    LGFIVLEVWFCVQVECSLALFDRITQLPGQPK-VGFQQYSGYVTVDEKKQRALFYYFAEA  69

Query  237   QSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVD  413
             +  D  S PL LWL GG  CSS  +G F ENGPFRP+  GE LVKN++SWN  +NMLY++
Sbjct  70    EV-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPS--GEVLVKNEYSWNREANMLYLE  126

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
              PIGV FSYS  +S Y+   D +TAR+NL F++ WF++F +YR+   +I G+SY GH  P
Sbjct  127   APIGVGFSYSTDASSYEAVDDKITARDNLVFMQNWFLKFPQYRNRSLFITGESYAGHYIP  186

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMSL---SNVEHLWYHGIISEEVYGMQK  764
             QLA L+L+ NR     +   LKGIALGNP+LE  ++   S  E  W HG+IS+  Y M  
Sbjct  187   QLAELMLQFNRKD---KLFNLKGIALGNPVLE-FAIDFNSRAEFFWSHGLISDSTYKMFT  242

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHY  938
               CN +  + E+    +S  CS +   +S E    +DK ++          S S      
Sbjct  243   TSCNYSRYVSEYYRDAVSPICSRVMRQVSTETSRFVDKYDVTLDVCISSMLSQSKVLTPQ  302

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILP  1118
                ET D C+ D    Y+NR DVQKALHA   G +  W   S     + +L N    I+ 
Sbjct  303   QVGETIDVCVEDETANYLNRQDVQKALHARLVGVR-KWAVCSNVLDYE-LLENTEHVIVI  360

Query  1119  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  1298
              L  +L++   VL  SGDQD  IP++ +R +   LA  L L T      W++G+++GGW+
Sbjct  361   WLIVVLIT--YVLKCSGDQDSVIPLTGSRTLVNRLAKELGLKTTVTYRVWFEGQQVGGWT  418

Query  1299  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             Q +GN         L+FAT+RG SH  P S P ++L LFKAFL+G P P
Sbjct  419   QVYGNI--------LSFATIRGASHEAPFSQPERSLVLFKAFLEGRPLP  459



>ref|XP_002520628.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF41764.1| serine carboxypeptidase, putative [Ricinus communis]
Length=467

 Score =   330 bits (847),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 198/479 (41%), Positives = 269/479 (56%), Gaps = 41/479 (9%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEI---------IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFY  221
             W ++V    ++ I+ N  +         I SLP QP  V F QY+GYI   + + RALFY
Sbjct  6     WIVMVVICITLIIKCNAAVGSSSKEDDKIVSLPRQP-QVSFQQYAGYITIDEKQQRALFY  64

Query  222   YFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNM  401
             YF EA++ D  S PL LWL GG  CSS   G F E+GPFRP+    LV N++SWN  +NM
Sbjct  65    YFVEAET-DPASKPLVLWLNGGPGCSSLGAGAFSEHGPFRPSSGESLVINEYSWNKEANM  123

Query  402   LYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGG  581
             LY++TP GV FSYS  +S Y   +DT+TA++NL FL++WF++F EY   DF+I G+SY G
Sbjct  124   LYLETPAGVGFSYSVNTSFYDNVNDTITAQDNLVFLQQWFLKFPEYMSRDFFITGESYAG  183

Query  582   HLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNVE--HLWYHGIISEEVYG  755
             H  PQLA LIL+            LKGIA+GNP+LE  +  N E    W HG+IS+  Y 
Sbjct  184   HYVPQLANLILQSGLK------FNLKGIAIGNPLLEFNTDFNSEGDFYWSHGLISDYTYV  237

Query  756   MQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMD----KENLVFqscesssiss  923
             +    CN + ++ E++SG LS  C  +   LS EI   +D      ++     ++ ++  
Sbjct  238   LVNTACNISQLMREYMSGSLSSGCELVADQLSIEIPDAIDDYDVTSDVCPSYLQAVTLLK  297

Query  924   sqqHYLAT-------ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSD  1082
             S  H L +       E  D C+++   EY+N  DVQ ALHA   G    W F S     D
Sbjct  298   SFNHPLISKFQLSPLENIDLCVQEKSFEYLNNKDVQDALHAKLVGIS-NWTFCSRVMYYD  356

Query  1083  VILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNG  1262
                 NF I  +  + +L+ S I VL+YSGDQD  IP   +R +   LA +LKL       
Sbjct  357   --RRNFEIPTIDVVGSLVSSGIRVLVYSGDQDSVIPFIGSRTLVNGLATKLKLNATTTYS  414

Query  1263  PWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSP  1439
              W   K++GGW+Q +G+         LT+AT+RGGSH  P SSP ++L LFKAFL GSP
Sbjct  415   GWLVDKQVGGWTQVYGDI--------LTYATIRGGSHMAPWSSPKRSLALFKAFLSGSP  465



>ref|XP_010682654.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score =   330 bits (847),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 191/478 (40%), Positives = 271/478 (57%), Gaps = 31/478 (6%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIV--------THKFRG  206
             + + L+  +++     + +    + I SLPGQPS V+F  YSGY+         T+    
Sbjct  11    VKMLLVLHVVIKIGSVMMLEFEADKITSLPGQPS-VNFQHYSGYVYVSFANQTQTNHNNQ  69

Query  207   RALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWN  386
             +A+FYYF EA++E   S PL LWL GG  CSS  +G F ENGPFRP  +  L+ N +SWN
Sbjct  70    KAMFYYFVEAETE-PVSKPLVLWLNGGPGCSSLGVGAFSENGPFRPAGN-RLIINHYSWN  127

Query  387   LASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAG  566
               +NMLY++TP GV FS+S   S Y+  +D  TAR+NLKFL+KWF++F  Y++   YI G
Sbjct  128   KEANMLYLETPAGVGFSHSTNISSYETANDHTTARDNLKFLQKWFLKFPHYQNRSLYITG  187

Query  567   DSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIIS  740
             +SY GH  PQLA L+L+ N+     +   LKGIALGNP+LE ++   S  E+ W HG+IS
Sbjct  188   ESYAGHYVPQLAELMLQFNKKE---KLFNLKGIALGNPVLEFITDFNSRAEYFWSHGLIS  244

Query  741   EEVYGMQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscess  911
             +  Y +    CN +  + E+  G +S  CS +  ++S E    +DK ++   V      S
Sbjct  245   DSTYNVFTSACNYSRYVGEYYRGFVSPMCSKVMSLVSRETSRFVDKYDVTLDVCLPSIFS  304

Query  912   sisssqqHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVIL  1091
                    H +  ET D C+ D    Y+NR DVQKALHA   G    W   S  +  D  +
Sbjct  305   QSKFLTPHQVG-ETIDVCVEDETVGYLNRRDVQKALHARLVGVN-SWTVCS--RILDYEM  360

Query  1092  HNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWY  1271
              +     +  +  L+ + IPVLIYSGDQD  +P++ +R +   LA  LKL T      W+
Sbjct  361   LDLERPTIHLIGNLVKAGIPVLIYSGDQDSVVPLTGSRTLVKRLAEELKLNTTVPYRVWF  420

Query  1272  DGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              GK++GGW++  G+         L+FATVRG SH  P S P ++L LFK+FL+G P P
Sbjct  421   VGKQVGGWTEVHGDL--------LSFATVRGASHEAPFSQPERSLVLFKSFLEGKPLP  470



>ref|XP_003577529.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=468

 Score =   330 bits (846),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 188/469 (40%), Positives = 269/469 (57%), Gaps = 22/469 (5%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             MV LL    +  L S +    G+ I  LPGQP +V F QYSGYI       RALFYYF E
Sbjct  13    MVSLLLIAALCHLGSCNGGGRGDRITKLPGQP-EVSFGQYSGYIGVDGKGSRALFYYFVE  71

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+  D  S PL LWL GG  CSS  +G F ENGPFRP+    LVKN++SWN  +N++Y++
Sbjct  72    AEL-DPISKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLE  129

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             TP GV +SYS  ++ Y+  +D MTA +N+ F+++W  +F +Y+  + YIAG+SY GH  P
Sbjct  130   TPAGVGYSYSADAAYYQGVNDKMTAMDNMVFMQRWLEKFPQYKGRELYIAGESYAGHYIP  189

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA +++E N+N    +   LKG+ALGNP+LE  +   S  E+ W HG+IS+  Y +   
Sbjct  190   QLAEVMVEFNKNE---KIFNLKGLALGNPVLEFTTDFNSRAEYFWSHGLISDSTYRIFTS  246

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqqHY  938
             VCN +  + E+  G LS  C+ +   ++ E    +DK ++   V  +   S       H 
Sbjct  247   VCNYSQYVSEYYGGSLSPLCARVMNQVTRETSRFVDKYDVTLDVCLASVLSQSMILSPHR  306

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILP  1118
                +  D C+ D    Y+NR DVQ+ALHA   G +   N+          L N  I  + 
Sbjct  307   HVGQRIDVCIEDETVNYLNRKDVQEALHAKLIGVK---NWAVCSSVLQYELLNLQIPTIN  363

Query  1119  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  1298
              + +L+ S I VL+YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW+
Sbjct  364   IVGSLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLAHDLGLKTSTPYRVWFEGKQVGGWT  423

Query  1299  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             Q +G+         L+FAT+RG SH  P S P ++L L++AFL+G P P
Sbjct  424   QVYGDM--------LSFATIRGASHEAPFSQPKRSLVLYRAFLQGRPLP  464



>emb|CBI32794.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 188/462 (41%), Positives = 265/462 (57%), Gaps = 26/462 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKF  254
              L+    ++    + + I SLPGQP  V F Q++GYI   + + R LFYYF EA++ D  
Sbjct  7     FLIQICLTVESPPSADKIVSLPGQP-QVGFQQFAGYITVDEKQQRHLFYYFVEAET-DPA  64

Query  255   SMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVA  431
             S PL LWL GG  CSS   G F E+GPF+P+  GE LV N +SWN  +NMLY+++P GV 
Sbjct  65    SKPLVLWLNGGPGCSSIGAGAFCEHGPFKPS--GEILVNNDYSWNKVANMLYLESPAGVG  122

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYS  +S Y   +D MTAR+NLKFL++WF++F EY++ D ++ G+SY GH  PQLA LI
Sbjct  123   FSYSANTSFYAFVNDEMTARDNLKFLQRWFLKFPEYKNRDLFLTGESYAGHYVPQLAQLI  182

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATT  785
             ++            LKG+A+GNP+LE  +   S  E++W HG+IS+  Y     +CN + 
Sbjct  183   VQSKVK------FNLKGVAIGNPLLEFNTDFNSRAEYMWSHGLISDITYEAFTVICNYSQ  236

Query  786   MIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETAD  959
             +  E + G LS  CS +   +S E+G  +D  ++    C     S S        TE  D
Sbjct  237   VRREIVMGSLSPACSGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSERLNQPRGTEKID  296

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
              C+ D   +Y+NR DVQKALHA+  G    W+  S  +       N  I  +  + A+L 
Sbjct  297   VCVEDETIKYLNRKDVQKALHAHLKGVSR-WSICS--EVLKYEYRNLEIPTIHVVGAVLK  353

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             S I VL+YSGDQD  +P++ TR +   LA  L L T      W+ G+++GGW+Q +G+  
Sbjct  354   SGIRVLVYSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYGD--  411

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                    L+FAT+RG SH  P S P ++L LF  FL+G P P
Sbjct  412   ------KLSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLP  447



>ref|XP_002307963.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
 gb|EEE91486.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
Length=459

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 197/461 (43%), Positives = 264/461 (57%), Gaps = 35/461 (8%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             SI   G+I+ +LPGQP+ V F QY+GYI   + + RALFYYFAEA+  D  + PL LWL 
Sbjct  24    SISEAGKIV-ALPGQPT-VSFQQYAGYITIDEQQKRALFYYFAEAEI-DPATKPLVLWLN  80

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSD  458
             GG  CSS   G F E+GPF+P+  GE L+KN +SWN  +NMLY+++P GV FSYS   S 
Sbjct  81    GGPGCSSIGAGAFCEHGPFKPS--GEILLKNDYSWNKEANMLYLESPAGVGFSYSANDSF  138

Query  459   YKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAH  638
             Y   +D +TA++NL FL +WF EF EY+  DF+I G+SY GH  PQLA LI++       
Sbjct  139   YTYVTDGITAQDNLVFLERWFDEFPEYKGRDFFITGESYAGHYVPQLATLIVQSKAK---  195

Query  639   LRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGE  812
                  LKGIA+GNP+LE  +   S  E LW HG+IS+  Y +   VCN + +  ++ SG 
Sbjct  196   ---FNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDNTYEIFTTVCNYSQIRRQYQSGS  252

Query  813   LSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGE  986
             LS  CS +   +S E+   +D  ++          S S   +    T T D C+ D   +
Sbjct  253   LSLPCSAVNSQVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQMEYTGTIDVCVEDETIK  312

Query  987   YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDIPVL  1157
             Y+NR DV +ALHA   G    W        SDV+   + N  I  +P L+ LL S I V 
Sbjct  313   YLNRKDVLEALHAQLVGVD-QWTV-----CSDVVKYEMENLEISTVPLLAKLLKSGIRVH  366

Query  1158  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVA  1337
             +YSGDQD  IP++ TR V   LA  L L T      W+ GK++ GW+Q +GN        
Sbjct  367   VYSGDQDSVIPLTGTRTVVNGLAKELGLNTTVPYRTWFQGKQVAGWTQVYGNI-------  419

Query  1338  NLTFATVRGGSHFVPNSSPSKALTLFKAFLKGS--PPPNTH  1454
              L+FAT+RG SH  P S P ++  LF AFL+G   PPP  +
Sbjct  420   -LSFATIRGASHEAPFSQPERSFVLFNAFLEGKQLPPPTVY  459



>ref|XP_006652227.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=467

 Score =   330 bits (846),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 189/448 (42%), Positives = 257/448 (57%), Gaps = 20/448 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKF--RGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I +LPGQP +V F QYSGYI       + R LFYYFAEA+  D  + PL LWL GG  CS
Sbjct  32    IGALPGQP-NVSFAQYSGYITVDAAAAKKRELFYYFAEAEL-DPDTKPLVLWLNGGPGCS  89

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G F ENGPFRP+ +  LV+N++SWN  +NM+Y+++P GV FSYS   S Y    D+
Sbjct  90    SVGVGAFSENGPFRPSGN-VLVRNEYSWNKEANMMYLESPAGVGFSYSTDPSFYGGVGDS  148

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLK  659
              TAR+NL+FL+ WF +F +Y+  D YI G+SY GH  PQLA  ++E N+     +   LK
Sbjct  149   RTARDNLRFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKKE---KLFNLK  205

Query  660   GIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             GIALGNP+LE  +   S  E  W HG+IS+  Y     VCN +  + E+  G LS  C  
Sbjct  206   GIALGNPVLEFATDFNSRAEFFWSHGLISDATYRSFTAVCNYSRYVSEYYRGSLSAACDA  265

Query  834   IEIMLSEEIGHDMDKENLVFqscesssisssqqH--YLATETADPCLRDWVGEYINRPDV  1007
             +    + E    +DK ++    C SS    S        +   D C+ D    Y+NR DV
Sbjct  266   VMGAGATETSRFVDKYDVTLDVCVSSLSMQSLSLAPQRGSRELDVCVEDETMGYLNRKDV  325

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRI  1187
             Q+A+HA   G    W   S     +    +  I  + T+  L+ S +PVL+YSGDQD  I
Sbjct  326   QEAMHARLDGGVAKWTVCS--SVLEYRQLDLQIPTINTVGGLVKSGVPVLVYSGDQDSVI  383

Query  1188  PVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGG  1367
             P++ +R +   LA RL+L T      W+ G+++GGW+Q +G  GGG     L FATVRG 
Sbjct  384   PLTGSRTLVQRLAARLRLNTTAPYRVWFQGRQVGGWTQAYG--GGG----TLAFATVRGA  437

Query  1368  SHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             SH  P S P ++L LF+AFL G P P++
Sbjct  438   SHEAPFSQPERSLVLFRAFLAGRPLPDS  465



>ref|XP_010653629.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=461

 Score =   329 bits (844),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 188/462 (41%), Positives = 265/462 (57%), Gaps = 26/462 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKF  254
              L+    ++    + + I SLPGQP  V F Q++GYI   + + R LFYYF EA++ D  
Sbjct  15    FLIQICLTVESPPSADKIVSLPGQP-QVGFQQFAGYITVDEKQQRHLFYYFVEAET-DPA  72

Query  255   SMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVA  431
             S PL LWL GG  CSS   G F E+GPF+P+  GE LV N +SWN  +NMLY+++P GV 
Sbjct  73    SKPLVLWLNGGPGCSSIGAGAFCEHGPFKPS--GEILVNNDYSWNKVANMLYLESPAGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYS  +S Y   +D MTAR+NLKFL++WF++F EY++ D ++ G+SY GH  PQLA LI
Sbjct  131   FSYSANTSFYAFVNDEMTARDNLKFLQRWFLKFPEYKNRDLFLTGESYAGHYVPQLAQLI  190

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATT  785
             ++            LKG+A+GNP+LE  +   S  E++W HG+IS+  Y     +CN + 
Sbjct  191   VQSKVK------FNLKGVAIGNPLLEFNTDFNSRAEYMWSHGLISDITYEAFTVICNYSQ  244

Query  786   MIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETAD  959
             +  E + G LS  CS +   +S E+G  +D  ++    C     S S        TE  D
Sbjct  245   VRREIVMGSLSPACSGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSERLNQPRGTEKID  304

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
              C+ D   +Y+NR DVQKALHA+  G    W+  S  +       N  I  +  + A+L 
Sbjct  305   VCVEDETIKYLNRKDVQKALHAHLKGVSR-WSICS--EVLKYEYRNLEIPTIHVVGAVLK  361

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             S I VL+YSGDQD  +P++ TR +   LA  L L T      W+ G+++GGW+Q +G+  
Sbjct  362   SGIRVLVYSGDQDSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYGD--  419

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                    L+FAT+RG SH  P S P ++L LF  FL+G P P
Sbjct  420   ------KLSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLP  455



>ref|XP_009404114.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   329 bits (843),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 191/448 (43%), Positives = 259/448 (58%), Gaps = 21/448 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             ++I  LPGQP  V F Q+SGYI   +   RALFYYFAEA+  D  + PL LWL GG  CS
Sbjct  32    DMIMKLPGQPP-VSFQQFSGYITVDQLDRRALFYYFAEAEV-DPSTKPLVLWLNGGPGCS  89

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G F ENGPFRP +   LV+N++SWN  +NMLY++TP GV FSYS+ SS Y+  +D 
Sbjct  90    SVGVGAFSENGPFRP-KGAVLVRNEYSWNKEANMLYLETPAGVGFSYSSDSSYYEGVNDR  148

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLK  659
             MTA +NL FL++WF +F +Y   D YIAG+SY GH  PQLA L++E +      R   LK
Sbjct  149   MTATDNLVFLQRWFTKFPQYEGRDLYIAGESYAGHYVPQLAQLMVESDDKQ---RVFNLK  205

Query  660   GIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             GIALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+  G LS  C  
Sbjct  206   GIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTSACNYSRYVSEYYRGSLSSVCQR  265

Query  834   IEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDV  1007
             +   ++ E    +DK ++          S S        TE  D C+ D    Y+NR DV
Sbjct  266   VMSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQQVTERVDVCVEDETVRYLNRRDV  325

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRI  1187
             Q ALHA+  G    W   S     +  L +  +  +  + +L+ S IPVL+YSGDQD  I
Sbjct  326   QSALHAHLDGVT-KWTVCS--SVLEYELLDLEVPTISVVGSLVKSGIPVLVYSGDQDSVI  382

Query  1188  PVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGG  1367
             P++ +R +   LA  L L T      W++G+++GGW+Q +G+         L+FATVRG 
Sbjct  383   PLTGSRTLVQRLANELGLKTTVPYRVWFEGEQVGGWTQVYGDV--------LSFATVRGA  434

Query  1368  SHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             SH  P S P ++L LF+AFL+G P P T
Sbjct  435   SHEAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_006430527.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
 gb|ESR43767.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
Length=455

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 260/468 (56%), Gaps = 29/468 (6%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEI-----IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             W ++V+ L+  +I     +     I SLPGQP    F QY+GYI   + + RALFYYF E
Sbjct  6     WIIIVSALFCTTILTAKSVPQADKIISLPGQP-QASFQQYAGYITIDEKQQRALFYYFVE  64

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A +E   S PL LWL GG  CSS   G F E+GPF+P+ D  L++N++SWN  +NMLY++
Sbjct  65    AATEAA-SKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-TLLRNEYSWNKEANMLYLE  122

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS   S Y   +D + AR+NL FL  W+ +F+EY++ +F+I G+SY GH  P
Sbjct  123   SPAGVGFSYSANKSFYGSINDAIAARDNLAFLEGWYEKFTEYKNREFFITGESYAGHYVP  182

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA LI++ N          LKGIA+GNP+LE  +   S  E LW HG+IS+  Y +  +
Sbjct  183   QLAQLIIQSNMK------FNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDSTYDIFTR  236

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYL  941
             VCN + +  ++ SG L+  CS +   +S EI   +D  ++    C       S       
Sbjct  237   VCNYSQIRRQYASGSLTAVCSQVISQVSREISRFVDTYDVTLDVCLPSVLLQSKMLSQLQ  296

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  1121
               E  D C+ D   +Y+NR DVQKALHA   G    W   S     D  + N  I  +  
Sbjct  297   DKEEIDVCVEDETTKYLNRKDVQKALHAQLIGVT-SWTVCSEVLKYD--MQNLEIPTIHV  353

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             L  L  S I VL+YSGDQD  +P++ TR +   LA  + L T      W +G++  GW+Q
Sbjct  354   LGKLAKSGIRVLVYSGDQDSVLPLTGTRTLVNGLAKEIGLNTTVPYRTWVEGRQAAGWTQ  413

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              +G+         L+FAT+RG SH  P S P ++L LF AFL G P P
Sbjct  414   VYGDI--------LSFATIRGASHEAPLSQPRRSLALFNAFLGGKPLP  453



>gb|EYU28449.1| hypothetical protein MIMGU_mgv1a004999mg [Erythranthe guttata]
Length=501

 Score =   330 bits (845),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 185/445 (42%), Positives = 257/445 (58%), Gaps = 20/445 (4%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+       RALFYYF EA++ D  S PL LWL GG  CSS 
Sbjct  71    ITELPGQPR-VSFQQFSGYVFVDHNNERALFYYFVEAET-DPASKPLVLWLNGGPGCSSL  128

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+ +  LV N+FSWN  +N+LY+++PIGV FSYS  SS Y   +D +T
Sbjct  129   GVGAFSENGPFRPSGNA-LVTNEFSWNKEANVLYLESPIGVGFSYSANSSSYDGVNDKIT  187

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A +NL FL+ WF++F +Y+D   +I G+SY GH  PQL  LIL+ N+     +   LKGI
Sbjct  188   AEDNLVFLQNWFLKFPQYKDRSLFITGESYAGHYIPQLTELILQFNKKE---KIFNLKGI  244

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E LW HG+IS+  + +    CN +  + E+    LS  CS + 
Sbjct  245   ALGNPVLEFATDFNSRAEFLWSHGLISDTTFKVFTSACNYSRYVSEYYRASLSPICSKVM  304

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
              +++ E    +DK ++          S S +      T+  D C+ D    Y+NR DVQ+
Sbjct  305   SLVTIETSKFVDKYDVTLDVCISSVLSQSKALVPQQMTDKVDVCVEDETVNYLNRRDVQR  364

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G    W   S     D  L +  I  +  +  ++ + IPVL+YSGDQD  IP+
Sbjct  365   ALHARLLGVNR-WLVCS--NILDYELLDLEIPTINIVGRIVEAGIPVLVYSGDQDSVIPL  421

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R++   LA  L+L T      W+ G ++GGW+Q +GN+        L+FAT+RG SH
Sbjct  422   TGSRKLVHRLARELRLRTSTPYRVWFAGMQVGGWTQVYGNN-------KLSFATIRGASH  474

Query  1374  FVPNSSPSKALTLFKAFLKGSPPPN  1448
               P S P ++L LF+AFL+G P P 
Sbjct  475   EAPFSQPERSLVLFRAFLQGKPLPQ  499



>ref|XP_008239549.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=467

 Score =   328 bits (842),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 199/470 (42%), Positives = 271/470 (58%), Gaps = 25/470 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++V  LWF +   + S S       I  LPGQP  V F  +SGYI     + +ALFYYF 
Sbjct  15    VVVLQLWFSM--EVKSSSSHHPDHNITRLPGQP-HVGFQHFSGYITVDDQKHKALFYYFV  71

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             EA+  +  S PL LWL GG  CSS  +G F ENGPFRP  DGE LV+N++SWN  +NMLY
Sbjct  72    EAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLY  128

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TP+GV FSYS +SS Y    D  TAR+NL FL++WF +F +Y+  D ++ G+SY GH 
Sbjct  129   LETPVGVGFSYSKSSSSYVAVDDETTARDNLVFLQRWFNKFPQYKHRDLFLTGESYAGHY  188

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQ  761
              PQLA L++E NR     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y M 
Sbjct  189   IPQLANLMVEINRKE---KLFSLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNMF  245

Query  762   KKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqH  935
               VCN +  + E+    +S  CS +   +S+E    +DK ++          S S     
Sbjct  246   TSVCNYSRYVSEYYRDSVSPSCSKVMSQVSKETSKFVDKYDVTLDVCISSVLSQSKVISP  305

Query  936   YLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDIL  1115
                TE  D C+ D +  Y+NR DVQKALHA   G +  W+  S     D  + N  I  +
Sbjct  306   NQMTERIDVCVEDKIVNYLNRKDVQKALHARLVGVRR-WDVCS--NILDYQVLNMEIPTI  362

Query  1116  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  1295
               + +L+ + IPVL+YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW
Sbjct  363   SLVGSLVKAGIPVLVYSGDQDSVIPLTGSRTLVYRLARELGLNTTVPYRVWFEGKQVGGW  422

Query  1296  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +Q +GN         L+FAT+RG SH  P S P ++L LFK+FL+G P P
Sbjct  423   TQVYGNI--------LSFATIRGASHEAPFSQPERSLRLFKSFLEGRPLP  464



>ref|XP_007162065.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
 gb|ESW34059.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
Length=459

 Score =   328 bits (840),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 186/474 (39%), Positives = 269/474 (57%), Gaps = 31/474 (7%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  +  +L  TL  +S     + I +LPGQP  V F QYSG+I       RALFYYF E
Sbjct  8     MIATIIIVLAQTLVGVSSLPESDQISNLPGQP-QVKFQQYSGHITVDDQHQRALFYYFVE  66

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+ ED  S PL LWL GG  CSS  +G F E+GPFRP+++  L KN +SWN  +N+LY++
Sbjct  67    AE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEKNDYSWNKEANVLYLE  125

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+  S Y + +D +TAR+NL FL++WF +F EY + DF+I G+SYGGH  P
Sbjct  126   SPAGVGFSYSSNKSFYILVTDEITARDNLVFLQRWFTKFPEYSNNDFFITGESYGGHYVP  185

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKK  767
             QLA LI++   +        LKGIA+GNP+LE  +  N   E+ W HG+IS+  + +  +
Sbjct  186   QLAQLIVQTKTH------FNLKGIAIGNPLLEFNTDFNARSEYFWSHGLISDSTFEILTR  239

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF-qscesssisssqqHYLA  944
             VCN +++  +  +G L   C      L  E+   +D+ ++       S +  +   H L 
Sbjct  240   VCNYSSIRRQRQNGNLGGVCEKASKQLYAEVSDYVDEYDVTLDVCLSSVNQQAYVLHQLQ  299

Query  945   -TETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAID  1109
              T+  D C+ D    Y+NR +VQ+ALHA   G        +   T   +LH    N  I 
Sbjct  300   ETQKIDVCVGDKTITYLNRKEVQEALHAKLVG-------VTKWSTCSSVLHYDYSNLEIP  352

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              +P L +L+ S I VL+YSGDQD  IP+  +R +   LA  + L T      W++ K++ 
Sbjct  353   TIPILGSLVKSGIRVLVYSGDQDSVIPLISSRYLVNGLAKEIGLETTVAYRAWFEEKQVA  412

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             GW+QT+G+         L++AT+RG SH  P + P ++L L KAFL G   P+ 
Sbjct  413   GWTQTYGDM--------LSYATIRGASHEAPFTQPQRSLVLLKAFLDGKQLPSV  458



>ref|XP_004513403.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   327 bits (839),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 182/447 (41%), Positives = 256/447 (57%), Gaps = 31/447 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLP QP +V+F QY+GYI   + + RAL+YYF EA+  D  S P+ LWL GG  CSS 
Sbjct  35    IKSLPEQP-EVEFKQYAGYITVDEVQQRALYYYFVEAEV-DPASKPVVLWLNGGPGCSSI  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F E+GPF+P + G L+KN +SWN  +NMLY+++P GV FSYS   S Y + +D MT
Sbjct  93    GVGAFVEHGPFKPAKKG-LMKNDYSWNKEANMLYLESPAGVGFSYSVNESFYDLVNDEMT  151

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WF +FSEY++ DF++ G+SY GH  PQLA LI++            LKGI
Sbjct  152   ARDNLIFLQHWFTKFSEYKNNDFFLTGESYAGHYVPQLAQLIIQTKTK------FNLKGI  205

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP++E  +   S  E+ W HG+IS+  Y +  K CN + +  ++ SG LS  C+ + 
Sbjct  206   AIGNPLMEFNTDFNSRAEYFWSHGLISDSTYEIFTKSCNYSQIRRQYQSGTLSSICARVN  265

Query  840   IMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
              ++S EI   +D  ++    C       +         E  D C+ D    Y+NR +VQK
Sbjct  266   RLVSMEISRYIDLYDVTLDVCLPSEKQQAYVLTQLQEGEKIDVCVEDETYIYLNRKEVQK  325

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDIPVLIYSGDQDLR  1184
             ALHA   G       T+    S V+   + N  I  +  L +L+ S + VL+YSGDQD  
Sbjct  326   ALHAKLVG------ITTWLTCSGVLKYNMKNLEIPTISVLGSLVKSGVRVLVYSGDQDSV  379

Query  1185  IPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRG  1364
             IP+  TR +   LA    L T E    W+ G+++ GW+Q +G         +L+FAT+RG
Sbjct  380   IPLLGTRSLVNKLAKEFGLNTTESYRAWFKGRQVAGWTQVYG---------DLSFATIRG  430

Query  1365  GSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              SH  P S P ++L L K FLKG   P
Sbjct  431   ASHEAPFSQPERSLVLLKTFLKGKSLP  457



>ref|XP_007209121.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
 gb|EMJ10320.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
Length=460

 Score =   327 bits (839),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 198/470 (42%), Positives = 269/470 (57%), Gaps = 23/470 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             ++V  LWF +     S S       I  LPGQP  V F  +SGYI     + +ALFYYF 
Sbjct  6     VVVLQLWFSMEVESSSSSSHHPDHNITRLPGQP-HVGFQHFSGYITVDDQKHKALFYYFV  64

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             EA+  +  S PL LWL GG  CSS  +G F ENGPFRP  DGE LV+N++SWN  +NMLY
Sbjct  65    EAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLY  121

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TP+GV FSYS +SS Y    D  TAR+NL FL++WF +F +Y+  D ++ G+SY GH 
Sbjct  122   LETPVGVGFSYSKSSSSYVSVDDEATARDNLVFLQRWFNKFPQYKHRDLFLTGESYAGHY  181

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQ  761
              PQLA L++E NR     +   +KGIALGNP+LE  +   S  E  W HG+IS+  Y M 
Sbjct  182   IPQLANLMVEINRKE---KLFSIKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNMF  238

Query  762   KKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqH  935
               VCN +  + E+    +S  CS +   +S E    +DK ++          S S     
Sbjct  239   TSVCNYSRYVSEYYRDSVSPSCSKVMSQVSRETSKFVDKYDVTLDVCISSVLSQSKVISP  298

Query  936   YLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDIL  1115
                TE  D C+ D +  Y+NR DVQKALHA   G +  W+  S     D  + N  I  +
Sbjct  299   NQMTERIDVCVEDKIVNYLNRKDVQKALHARLVGVRR-WDVCS--NILDYQVLNLEIPTI  355

Query  1116  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  1295
               + +L+ + IPVL+YSGDQD  IP++ +R +   LA  L L T      W++GK++GGW
Sbjct  356   SLVGSLVKAGIPVLVYSGDQDSVIPLTGSRTLVYRLARELGLNTTVPYRVWFEGKQVGGW  415

Query  1296  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +Q +GN         L+FAT+RG SH  P S P ++L LFK+FL+G P P
Sbjct  416   TQVYGNI--------LSFATIRGASHEAPFSQPERSLRLFKSFLEGRPLP  457



>ref|XP_006482059.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=455

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 259/468 (55%), Gaps = 29/468 (6%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEI-----IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             W  +V+ L+  +I     +     I SLPGQP    F QY+GYI   + + RALFYYF E
Sbjct  6     WITIVSALFCTTILTAKSVPQADKIISLPGQP-QASFQQYAGYITIDEKQQRALFYYFVE  64

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A +E   S PL LWL GG  CSS   G F E+GPF+P+ D  L++N++SWN  +NMLY++
Sbjct  65    AATEAA-SKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-TLLRNEYSWNKEANMLYLE  122

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS   S Y   +D + AR+NL FL  W+ +F EY++ +F+I G+SY GH  P
Sbjct  123   SPAGVGFSYSANKSFYGSVNDAIAARDNLAFLEGWYEKFPEYKNREFFITGESYAGHYVP  182

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKK  767
             QLA LI++ N        + LKGIA+GNP+LE  +   S  E LW HG+IS+  Y +  +
Sbjct  183   QLAQLIIQSNMK------LNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDSTYDIFTR  236

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYL  941
             VCN + +  ++ SG L+  CS +   +S EI   +D  ++    C       S       
Sbjct  237   VCNYSQIRRQYASGSLTAVCSQVISQVSREISRFVDTYDVTLDVCLPSVLLQSKMLSQLQ  296

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  1121
               E  D C+ D   +Y+NR DVQKALHA   G    W   S     D  + N  I  +  
Sbjct  297   DKEEIDVCVEDETTKYLNRKDVQKALHAQLIGVT-SWTVCSEVLKYD--MQNLEIPTIHV  353

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             L  L  S I VL+YSGDQD  +P++ TR +   LA  + L T      W +G++  GW+Q
Sbjct  354   LGKLAKSGIRVLVYSGDQDSVLPLTGTRTLVNGLAKEIGLNTTVPYRTWVEGRQAAGWTQ  413

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              +G+         L+FAT+RG SH  P S P ++L LF AFL G P P
Sbjct  414   VYGDI--------LSFATIRGASHEAPLSQPRRSLALFNAFLGGKPLP  453



>ref|XP_008443350.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=479

 Score =   327 bits (839),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 191/462 (41%), Positives = 266/462 (58%), Gaps = 45/462 (10%)
 Frame = +3

Query  126   IDSLPGQPSD--VDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I SLP QPSD   +F Q+ GY+   + +GRALFYYF EAQ+    S PL LWL GG  CS
Sbjct  32    IRSLPSQPSDSKANFKQFGGYVTVDEKQGRALFYYFVEAQTPQPTSKPLVLWLNGGPGCS  91

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S  +G F E+GPF+   +GE LVKN++SWN  +NMLYV++P GV FSYS+  S Y    D
Sbjct  92    SVGVGAFIEHGPFKI--NGEVLVKNEYSWNTEANMLYVESPAGVGFSYSSNKSFYFKIDD  149

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
              +TAR+N+ FL+ WF +F EY++ DFYI G+SYGGH  PQLA LIL+   N      IKL
Sbjct  150   KITARDNMLFLQNWFDKFPEYKNADFYITGESYGGHYVPQLAQLILKSRTN------IKL  203

Query  657   KGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             KGIA+GNP+L+ ++  N   +++W HG++S+ +Y +   VCN +    E   G +S  C+
Sbjct  204   KGIAIGNPLLDIVNDFNARDKYMWSHGVVSDSIYKLLSSVCNTSRFYQEIFQGSISSECT  263

Query  831   DIEIMLSEEIGHDMDKENLV--FqscesssisssqqHYLA---TETA-------------  956
              +  +LS+++   +D  N++    S  + S  S   H L+   T++A             
Sbjct  264   VVISLLSQQLSPFIDDYNVIGDVCSLAAKSQPSILLHPLSSFITKSASQRHLLSHPQENV  323

Query  957   ----DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI-LHNFAIDILPT  1121
                 D C ++ V +Y+NR DVQKALHA   G  + W+  +   T  +  L N+ I  +  
Sbjct  324   GVDRDICSQENVAKYLNRKDVQKALHAKLVG-VHQWSVCNTNNTDWLYDLKNWLIPTIDV  382

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             + +L+ S I VL+YSGDQD  IP + TR +   LA  L L        W    + GGWS+
Sbjct  383   VGSLVKSQIRVLVYSGDQDTVIPFTGTRTLVNSLAKSLGLNITMSYKVWIVDNQAGGWSE  442

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFL  1427
              +G          LTFA+VRG SH  P + P + L LFKAFL
Sbjct  443   AYGKF--------LTFASVRGASHLAPETQPKRTLALFKAFL  476



>ref|XP_004235841.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=455

 Score =   327 bits (837),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 188/471 (40%), Positives = 268/471 (57%), Gaps = 23/471 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             + VFL  FLL   +  +S   + + I  LPGQP  V F Q+SGY+     + R+LFYYF 
Sbjct  3     MAVFL--FLLYAYVGIVSALPHPDKITKLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFV  59

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA++ D  S PL LWL GG  CSS  +G F ENGPFRP  +G LV N+ SWN  +NMLY+
Sbjct  60    EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVINEHSWNKEANMLYL  117

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYS+ +S Y+  +D +TAR+N+ FL +WF +F +YR  + ++ G+SY GH  
Sbjct  118   ESPIGVGFSYSSDTSSYETVNDEITARDNVVFLLRWFHKFPQYRKSNLFLTGESYAGHYV  177

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQK  764
             PQLA L++  N+     +   LKGIALGNP+LE  +   S  E+ W HG+IS+  Y M  
Sbjct  178   PQLAKLMMAFNKKQ---QLFNLKGIALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFS  234

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHY  938
               CN +  + E+    +S  CS +  ++S E    +DK ++          S S      
Sbjct  235   SACNYSRYVSEYYRDTVSPICSRVMSLVSRETSKFVDKYDVTLDVCISSVLSQSKIISPQ  294

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILP  1118
               +E  D C+ D V  Y+NR DV++ALHA   G  + W+  S     D  L +  I  + 
Sbjct  295   ENSEKLDVCVEDEVVNYLNRKDVKRALHAELVG-VHRWSVCS--SILDYQLLDIEIPTIS  351

Query  1119  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  1298
              +  L+   IPVLIYSGDQD  +P+  +R     LA +++L T      W+ G+++GGW+
Sbjct  352   IIGTLIKERIPVLIYSGDQDSVVPLIGSRATVQQLARQMQLNTTVPYRVWFAGQQVGGWT  411

Query  1299  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
               + N         L+FAT+RG SH  P S P ++L LFK+FL+G P P  
Sbjct  412   HVYDNI--------LSFATIRGASHEAPFSQPERSLVLFKSFLEGKPLPEV  454



>ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF51706.1| serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 188/464 (41%), Positives = 261/464 (56%), Gaps = 27/464 (6%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKF  254
             ++  +  S+S   + + I  LPGQP  V F Q+SGY+     + RALFYYF EA+  D  
Sbjct  14    MMFQSCISLSSSFHSDKIVRLPGQP-HVGFQQFSGYVSVDDKKHRALFYYFVEAEI-DPA  71

Query  255   SMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAF  434
             S PL LWL GG  CSS  +G F ENGPFRP +   LV+N++SWN  +NMLY++TP+GV F
Sbjct  72    SKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGKVLVRNEYSWNKEANMLYLETPVGVGF  130

Query  435   SYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALIL  614
             SY+  SS Y    D  TAR+NL FL+ W+  F +YR  D +I G+SY GH  PQLA L++
Sbjct  131   SYATDSSSYLAVDDEATARDNLVFLKHWYNRFPQYRHRDLFITGESYAGHYIPQLAKLMV  190

Query  615   EDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTM  788
             E N+     +   LKGIALGNP+LE  +   S  E+LW HG+IS+  + M    CN +  
Sbjct  191   EINKKE---KLFHLKGIALGNPVLEFATDFNSRAEYLWSHGLISDSTFKMFTAACNYSRY  247

Query  789   IDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADP  962
             + E+    LS  CS +   ++ E    +DK ++          S S   +    +E  D 
Sbjct  248   VSEYYRDSLSTICSRVMSRVNTETSRFVDKYDVTLDVCISSILSQSKVLRPQQVSERIDV  307

Query  963   CLRDWVGEYINRPDVQKALHANTTG---WQYPWNFTSPGKTSDVILHNFAIDILPTLSAL  1133
             C+ D    Y+NR DVQKALHA   G   W+   N        D  L N  I  +  + +L
Sbjct  308   CVDDETMNYLNRKDVQKALHARLVGVGRWEVCSNIL------DYELLNLEIPTISVVGSL  361

Query  1134  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  1313
             + + IPVL+YSGDQD  IP++ +R +   LA  L L T      W+  K++GGW+Q + +
Sbjct  362   VKAGIPVLVYSGDQDSVIPLTGSRTLVHGLAKELGLNTTVPYRVWFAEKQVGGWTQVYSD  421

Query  1314  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                      L+FAT+RG +H VP S P ++L LFK+FL+G   P
Sbjct  422   I--------LSFATIRGAAHEVPYSQPERSLVLFKSFLEGKHLP  457



>ref|XP_009759845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=463

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 183/465 (39%), Positives = 263/465 (57%), Gaps = 21/465 (5%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +  FL   +L  ++   + + I  LPGQP  V F Q+SGY+     + ++LFYYF EA++
Sbjct  13    IFLFLFCVSLGIVAALPHPDKIIQLPGQP-QVGFQQFSGYVTVDDKKQKSLFYYFVEAET  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              +  S PL LWL GG  CSS  +G F ENGPFRP     LV+N++SWN  +NMLY+++PI
Sbjct  72    -NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEYSWNKEANMLYLESPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYSN +S Y+  +D +TAR+NL FL +WF +F +YR  + ++ G+SY GH  PQLA
Sbjct  130   GVGFSYSNNTSSYETVNDEVTARDNLVFLLRWFQKFPQYRKSNLFLTGESYAGHYVPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              L++  N+     +   LKG+ALGNP+LE  +   S  E+ W HG+IS+  Y M    CN
Sbjct  190   KLMMVFNKKQ---QIFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFSSACN  246

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATE  950
              +  + E+  G +S  CS +  ++S E    +DK  +          S S         E
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISSVLSQSKIISPQENVE  306

Query  951   TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSA  1130
               D C+ D +  Y+NR DV++ALHA   G +  W   S     D  L +  I  +  +  
Sbjct  307   KLDVCVEDEIINYLNRKDVRRALHAELVGVRR-WAVCS--NILDYQLLDIEIPTISIIGM  363

Query  1131  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  1310
             L+   IPVLIYSGDQD  IP+  +R     LA R++L T      W+ G+++GGW+  + 
Sbjct  364   LVKERIPVLIYSGDQDSVIPLIGSRATVHQLARRMQLNTTVPYRVWFAGQQVGGWTHVYD  423

Query  1311  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             N         L+FAT+RG SH  P S P ++L LF++FL+G P P
Sbjct  424   NI--------LSFATIRGASHEAPFSQPERSLVLFRSFLEGRPLP  460



>gb|EEC68261.1| hypothetical protein OsI_36290 [Oryza sativa Indica Group]
Length=472

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 184/468 (39%), Positives = 269/468 (57%), Gaps = 22/468 (5%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +L  LL+  L  +     G+ I+ LPGQP +V F QY+GY+       RALFYYF EA+ 
Sbjct  20    VLQMLLIAALLHLGSCNGGDRIERLPGQP-EVSFGQYAGYVGVDDKGQRALFYYFVEAEL  78

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              D  + PL LWL GG  CSS  +G F ENGPFRP+    LVKN++SWN  +N++Y++TP 
Sbjct  79    -DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPA  136

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV +SYS  ++ Y+   D MTA +N+ FL++W  +F +Y+  + YI+G+SY GH  PQLA
Sbjct  137   GVGYSYSADAAYYQGVDDKMTAMDNMVFLQRWLEKFPQYKGRELYISGESYAGHYIPQLA  196

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              +++E N+     +   LKGIALGNP+LE  +   S  E+ W HG+IS+  Y +   VCN
Sbjct  197   DVMVEFNKKN---KIFNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDSTYRIFTSVCN  253

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLAT  947
              +  + E+  G L+  C+ +   ++ E    +DK ++   V  S   S       H    
Sbjct  254   YSRYVTEYYGGSLTPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILTPHQQVG  313

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  1127
             +  D C+ D    Y+NR DVQ+ALHA   G +   N+       +  L N  I  +  + 
Sbjct  314   QRIDVCVEDETVNYLNRKDVQEALHAKLIGVK---NWAVCSSVLEYELLNLQIPTINIVG  370

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
             +L+ S I VL+YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +
Sbjct  371   SLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLARDLGLKTSVPYRVWFEGQQVGGWTQVY  430

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             G+         L+FAT+RG SH  P S P ++L LF+AFL+G P P T
Sbjct  431   GDM--------LSFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  470



>gb|KEH33274.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=457

 Score =   327 bits (837),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 182/468 (39%), Positives = 270/468 (58%), Gaps = 34/468 (7%)
 Frame = +3

Query  75    LLVNTLYSISIRING----EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             ++   ++ +++ +N     + I SLP QP  V F QY+GYI   + + RALFYYF EA+ 
Sbjct  10    VIATIIFFVTVGVNSISEVDKISSLPQQP-KVGFQQYAGYITVDEVQKRALFYYFVEAEV  68

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
             E   S P+ LWL GG  CSS   G F E+GPF+PT++G L+KN +SWN  +NMLY+++P 
Sbjct  69    EPA-SKPVVLWLNGGPGCSSVGAGAFVEHGPFKPTKNG-LIKNDYSWNKEANMLYLESPA  126

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYS   S Y   +D +TAR+NL FL+ WF +FSEY++ +F+I G+SY GH  PQLA
Sbjct  127   GVGFSYSTNESFYDSVNDYLTARDNLIFLQHWFTKFSEYKNNEFFITGESYAGHYVPQLA  186

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              LI++            LKGIA+GNP+LE  +   S  E+LW HG+IS+  Y    K+CN
Sbjct  187   QLIVQTKSK------FNLKGIAIGNPLLEFNTDFNSRAEYLWSHGLISDSTYDSFTKICN  240

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLAT---  947
              + +  ++ +G L+  C+ +  ++S E+   +D  ++    C S+    +   Y+ T   
Sbjct  241   FSQIRRQYANGALTTVCARVNRLVSMEVSRYIDSYDVTLDVCLSTVEQQT---YVLTQLQ  297

Query  948   --ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  1121
               E  D C+ D    Y+NR +VQ+ALHA   G      +T+        + N  I  +  
Sbjct  298   EGEKIDVCVEDETFTYLNRKEVQEALHAKLVGIT---TWTTCSGVLKYNMQNLEIPTINI  354

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             L  L+ S + VL+YSGDQD  +P+  TR +   LA  + L T E    W++G+++ GW+Q
Sbjct  355   LGTLVKSGVRVLVYSGDQDSVLPLIGTRSLVNGLAKDIGLNTTESYRTWFNGRQVAGWTQ  414

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              +G+         L+FAT+RG SH  P S P ++L L KAFL+G   P
Sbjct  415   VYGDM--------LSFATIRGASHEAPFSQPGRSLVLLKAFLEGKSLP  454



>ref|XP_011040748.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=459

 Score =   327 bits (837),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 193/460 (42%), Positives = 261/460 (57%), Gaps = 33/460 (7%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             SI   G+I+ +LPGQP  V F QY+GYI   + + RALFYYFAEA+  D  + PL LWL 
Sbjct  24    SISEAGKIV-ALPGQPR-VSFQQYAGYITIDEQQKRALFYYFAEAEI-DPATKPLVLWLN  80

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDY  461
             GG  CSS   G F E+GPF+P+ +  L+KN +SWN  +NMLY+++P GV FSYS   S Y
Sbjct  81    GGPGCSSIGAGAFCEHGPFKPSAE-ILLKNDYSWNKEANMLYLESPAGVGFSYSANDSFY  139

Query  462   KIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHL  641
                +D +TA++NL FL +WF EF EY+  DF+I G+SY GH  PQLA LI++        
Sbjct  140   TYVTDEITAQDNLVFLERWFDEFPEYKGRDFFITGESYAGHYVPQLATLIVQSQTK----  195

Query  642   RPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGEL  815
                 LKGIA+GNP+LE  +   S  E  W HG+IS++ Y +   VCN + +  ++ SG L
Sbjct  196   --FNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDDTYEIFTTVCNYSQIRRQYQSGSL  253

Query  816   SEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEY  989
             S  CS +   +S E+   +D  ++          S S   +    T T D C+ D   +Y
Sbjct  254   SLPCSAVNSRVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQMEYTGTIDVCVEDETIKY  313

Query  990   INRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDIPVLI  1160
             +NR DV +ALHA   G    W        SDVI   + N  I  +P L+ LL S I V +
Sbjct  314   LNRKDVLEALHAQLVGVD-QWTV-----CSDVIKYEMENLEISTVPLLAKLLKSGIRVHV  367

Query  1161  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVAN  1340
             YSGDQD  IP++ TR +   LA  L L T      W+ GK++ GW+Q +GN         
Sbjct  368   YSGDQDSVIPLTGTRTIVNGLAKELGLNTTVPYRTWFQGKQVAGWTQVYGNI--------  419

Query  1341  LTFATVRGGSHFVPNSSPSKALTLFKAFLKGS--PPPNTH  1454
             L+FAT+R  SH  P S P ++  LF AFL+G   PPP  +
Sbjct  420   LSFATIRAASHEAPFSQPERSFVLFNAFLEGKQLPPPTVY  459



>ref|NP_001176565.1| Os11g0522900 [Oryza sativa Japonica Group]
 gb|ABA93967.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG86949.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52189.1| hypothetical protein OsJ_34064 [Oryza sativa Japonica Group]
 dbj|BAH95293.1| Os11g0522900 [Oryza sativa Japonica Group]
Length=472

 Score =   327 bits (837),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 184/468 (39%), Positives = 269/468 (57%), Gaps = 22/468 (5%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +L  LL+  L  +     G+ I+ LPGQP +V F QY+GY+       RALFYYF EA+ 
Sbjct  20    VLQMLLIAALLHLGSCNGGDRIERLPGQP-EVSFGQYAGYVGVDDKGRRALFYYFVEAEL  78

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              D  + PL LWL GG  CSS  +G F ENGPFRP+    LVKN++SWN  +N++Y++TP 
Sbjct  79    -DPATKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPA  136

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV +SYS  ++ Y+   D MTA +N+ FL++W  +F +Y+  + YI+G+SY GH  PQLA
Sbjct  137   GVGYSYSADAAYYQGVDDKMTAMDNMVFLQRWLEKFPQYKGRELYISGESYAGHYIPQLA  196

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              +++E N+     +   LKGIALGNP+LE  +   S  E+ W HG+IS+  Y +   VCN
Sbjct  197   DVMVEFNKKN---KIFNLKGIALGNPVLEFTTDFNSRAEYFWSHGLISDSTYRIFTSVCN  253

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLAT  947
              +  + E+  G L+  C+ +   ++ E    +DK ++   V  S   S       H    
Sbjct  254   YSRYVTEYYGGSLTPLCARVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILTPHQQVG  313

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  1127
             +  D C+ D    Y+NR DVQ+ALHA   G +   N+       +  L N  I  +  + 
Sbjct  314   QRIDVCVEDETVNYLNRKDVQEALHAKLIGVK---NWAVCSSVLEYELLNLQIPTINIVG  370

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
             +L+ S I VL+YSGDQD  IP++ +R +   LA  L L T      W++G+++GGW+Q +
Sbjct  371   SLVKSGIRVLVYSGDQDSVIPLTGSRTLVQNLARDLGLKTSVPYRVWFEGQQVGGWTQVY  430

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             G+         L+FAT+RG SH  P S P ++L LF+AFL+G P P T
Sbjct  431   GDM--------LSFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  470



>ref|XP_002517286.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45079.1| serine carboxypeptidase, putative [Ricinus communis]
Length=434

 Score =   325 bits (834),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 186/436 (43%), Positives = 256/436 (59%), Gaps = 23/436 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GYI   + + RALF+YF EA++ D  S PL LWL GG  CSS 
Sbjct  11    IVSLPGQPR-VSFQQYAGYITIDENQQRALFFYFVEAEA-DPASKPLVLWLNGGPGCSSV  68

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV N++SWN  +NMLY++ P GV FSYS  +S Y   +DT+T
Sbjct  69    GAGAFSEHGPFRPSGGDNLVVNEYSWNKEANMLYLEAPAGVGFSYSGNTSFYHSVNDTIT  128

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A++NL FL++WF +F EY + DFYI G+SY GH  PQLA LI++            LKGI
Sbjct  129   AQDNLVFLQQWFAKFPEYMNRDFYITGESYAGHYVPQLANLIVQSGLK------FNLKGI  182

Query  666   ALGNPILEKMSLSNVE--HLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +  N +  + W HG+IS+  Y +   VCN + ++ +++ G LS  C  ++
Sbjct  183   AIGNPLLEFNTDFNSQGDYYWSHGLISDATYQLVTSVCNTSQLMRDYIRGSLSSTCQAVD  242

Query  840   IMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
               LS EI   +D  ++    C S+  + S+     +E  D CL +   EY+N  +VQ AL
Sbjct  243   DQLSIEIPAAIDGYDVTSDVCASNLQAVSKSR--TSEEIDLCLEEKTSEYLNLKEVQDAL  300

Query  1020  HANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSH  1199
             HA   G     N+T   +       N  I  +  + +L+ S I VL+YSGDQD  IP   
Sbjct  301   HAKLVGIS---NWTICSRVLSYDYGNLEIPTIDVVGSLVSSGIQVLVYSGDQDSVIPFIG  357

Query  1200  TREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1379
             +R +   LA +LKL +    G   D K++GGW Q +G+         LT+AT+RGGSH  
Sbjct  358   SRTLVNGLAKKLKLNSTTYRGWLEDNKQVGGWRQVYGDV--------LTYATIRGGSHLA  409

Query  1380  PNSSPSKALTLFKAFL  1427
             P SSP ++L LFKAFL
Sbjct  410   PWSSPRRSLALFKAFL  425



>ref|XP_007159977.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31971.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=466

 Score =   327 bits (837),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 184/447 (41%), Positives = 265/447 (59%), Gaps = 25/447 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +  F Q+SGY+     + +ALFYYF E+++    S PL LWL GG  CSS 
Sbjct  35    IVRLPGQP-NTGFQQFSGYVTVDDLKHKALFYYFVESETHPA-SKPLVLWLNGGPGCSSL  92

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +GE L+KN++SWN  +NMLY++TP+GV FSY+   S Y+  +D  
Sbjct  93    GVGAFSENGPFRP--NGEVLIKNEYSWNRETNMLYLETPVGVGFSYAKGGSSYETVNDET  150

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL++WF +F ++R+ D ++AG+SY GH  PQLA L++E N+     +   LKG
Sbjct  151   TARDNLVFLQRWFNKFPQFRNRDLFLAGESYAGHYVPQLAKLMIEINKKE---KLFNLKG  207

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E  W HG+IS+  Y +    CN +  + E+    +S  CS +
Sbjct  208   IALGNPVLEYATDLNSRAEFFWSHGLISDSTYKLFTTGCNYSRYVSEYYRDSISPVCSKV  267

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqq----HYLATETADPCLRDWVGEYINRPD  1004
                ++ E    +DK ++    C SS +S S+          E+ D C+ D V  Y+NR D
Sbjct  268   LRHVARETSRFVDKYDVTLDVCISSVLSQSKAICPQGQKINESIDVCVDDKVTNYLNRKD  327

Query  1005  VQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLR  1184
             VQ+ALHA   G +  W+  S     D  + N     LP + +L+ + + VLIYSGDQD  
Sbjct  328   VQEALHAKLVGVR-KWDVCS--NILDYDMLNLEKPTLPVVGSLIKAGVRVLIYSGDQDSV  384

Query  1185  IPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRG  1364
             IP++ +R +   LA +L L T      W++G+++GGW+Q +G+         L+FATVRG
Sbjct  385   IPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGSI--------LSFATVRG  436

Query  1365  GSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              SH  P S P ++  LFK+FL+  P P
Sbjct  437   ASHEAPFSQPERSFVLFKSFLEDRPLP  463



>ref|XP_006380972.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58769.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=467

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 181/464 (39%), Positives = 262/464 (56%), Gaps = 41/464 (9%)
 Frame = +3

Query  111   INGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGH  290
             +  + I  LPGQP  V F Q+SGYI   + + R+LFYYF EA++    S PL LWL GG 
Sbjct  24    LEADRIVRLPGQPP-VSFQQFSGYITVDEKQHRSLFYYFVEAETSPA-SKPLVLWLNGGP  81

Query  291   DCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
              CSS  +G F E+GPFRPT    LV+N++SWN  +NMLY+++P GV FSYS   + Y   
Sbjct  82    GCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKEANMLYLESPAGVGFSYSANQTFYSYV  141

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPI  650
             +D MTAR+NL FLR+WF++F +Y+  DF+IAG+SY GH  PQLA LI+    N       
Sbjct  142   NDEMTARDNLVFLRRWFVKFPQYKQRDFFIAGESYAGHYVPQLAQLIIRSKVN------F  195

Query  651   KLKGIALGNPILE-KMSLSNVEHL-WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEY  824
              LKGIA+GNP+LE    L+  +H  W HG+IS+  Y +   VCN++ ++ E L+G +S  
Sbjct  196   NLKGIAIGNPLLEFNTDLNAQDHFYWSHGLISDSTYQLLTSVCNSSKLMREALTGTVSSA  255

Query  825   CSDIEIMLSEEIGHDMDKENL--------------VFqscesssisssqqHYLATETADP  962
             C  +  ++ +E+   +D  ++              +F      S              D 
Sbjct  256   CLGVYTLVQKELSESIDPYDVTGDICLSSNQSQLKIFHQQLLRSRLPYLSPQQVMGKVDV  315

Query  963   CLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTL---SAL  1133
             CL +    Y+NR DVQ ALHA   G       T+    S V+ ++ + +  PT+    +L
Sbjct  316   CLLEETTNYLNRKDVQMALHARLVG------VTNWHVCSVVLEYDRSNEERPTIHVVRSL  369

Query  1134  LMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGN  1313
             + S + VL+YSGDQD  I  + TR + + +A  L+L T      W  G ++GGW+Q +G+
Sbjct  370   VKSGLAVLVYSGDQDSIIAFTGTRSLVSKIAKDLRLKTTVPYRAWLSGNQVGGWTQVYGD  429

Query  1314  SGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                     NL+FAT+RG SH  P++ P ++L LFK+FL+  P P
Sbjct  430   --------NLSFATIRGASHTAPSTQPKRSLLLFKSFLEKKPLP  465



>ref|XP_007046209.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
 gb|EOY02041.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
Length=401

 Score =   324 bits (830),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 244/387 (63%), Gaps = 18/387 (5%)
 Frame = +3

Query  48    KIMVFLLWFLLVNTLYSIS--IRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFY  221
             K M FLL F +++  +        + E+I +LPGQP++V F QYSGYIVT    GRALFY
Sbjct  3     KRMRFLLAFRVISCFFLFFFFCSASAELIKALPGQPANVTFKQYSGYIVTEPKHGRALFY  62

Query  222   YFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNM  401
             YF E  S +    PLTLWL GG  CSS   G F E+GPF+P E+G L+KN++SWNL SNM
Sbjct  63    YFVEVDSANPGLHPLTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNLESNM  122

Query  402   LYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGG  581
             LY+++PIGV FSYSNTSSDY   +DT+TA ENL F+  WF +F +YRD D Y++G+SY G
Sbjct  123   LYLESPIGVGFSYSNTSSDYLGVNDTITAGENLIFILNWFKKFPQYRDSDLYLSGESYAG  182

Query  582   HLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSLSNVEHLWYHGIISEEVYGM  758
             H  PQLAALIL  N+  +  RPIKLK IALGNP+L+ ++S++N E LW HG+IS+E+  +
Sbjct  183   HYIPQLAALILSYNKRFSG-RPIKLKAIALGNPLLDLEISVNNAEFLWSHGVISDEMLML  241

Query  759   QKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHY  938
             +K VC+ +  + E L   LS+ C D+     EEIG   D  +L+   C SS++     + 
Sbjct  242   RKTVCSESRSLKESLHRNLSKQCIDVLNKEQEEIGSYTDPGDLILPICLSSTVLGQTVYQ  301

Query  939   ---------LATETA---DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSD  1082
                      LA  +A   DPCL D + +Y+N P VQ+ALHANTT     W F   G    
Sbjct  302   GALNRLHAKLAMTSAVASDPCLGDRIYQYLNTPKVQEALHANTTHLPSDWEFC--GGHLV  359

Query  1083  VILHNFAIDILPTLSALLMSDIPVLIY  1163
                 +  I+I+P LS LL   IP+L++
Sbjct  360   YQRESLEINIIPLLSKLLRRSIPILLF  386



>ref|XP_006341487.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=463

 Score =   326 bits (835),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 188/471 (40%), Positives = 267/471 (57%), Gaps = 23/471 (5%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             + VFL  FLL   +  +S   + + I  LPGQP  V F Q+SGY+     + R+LFYYF 
Sbjct  11    MAVFL--FLLYVCVGIVSALPHPDKIIKLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFV  67

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYV  410
             EA++ D  S PL LWL GG  CSS  +G F ENGPFRP  +G LVKN+ SWN  +NMLY+
Sbjct  68    EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVKNEHSWNKEANMLYL  125

Query  411   DTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLA  590
             ++PIGV FSYS+ +S Y+  +D +TAR+N+ FL +WF +F +Y   + ++ G+SY GH  
Sbjct  126   ESPIGVGFSYSSDTSSYETVNDEVTARDNVVFLLRWFHKFPQYSKSNLFLTGESYAGHYV  185

Query  591   PQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQK  764
             PQLA L++  N+     +   LKGIALGNP+LE  +   S  E+ W HG+IS+  Y M  
Sbjct  186   PQLAKLMMAFNKKQ---QLFNLKGIALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFS  242

Query  765   KVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHY  938
               CN +  + E+    +S  CS +  ++S E    +DK ++          S S      
Sbjct  243   SACNYSRYVSEYYRDTVSPICSRVMSLVSRETSKFVDKYDVTLDVCISSVLSQSKIISPQ  302

Query  939   LATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILP  1118
                E  D C+ D V  Y+NR DV++ALHA   G +  W+  S     D  L +  I  + 
Sbjct  303   ENAEKLDVCVEDEVVNYLNRKDVRRALHAELVGVRR-WSVCS--SILDYQLLDIEIPTIS  359

Query  1119  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  1298
              +  L+   IPVLIYSGDQD  +P+  +R     LA +++L T      W+ G+++GGW+
Sbjct  360   IIGTLIKERIPVLIYSGDQDSVVPLIGSRATVQQLARQMQLNTTVPYRVWFAGQQVGGWT  419

Query  1299  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
               + N         L+FAT+RG SH  P S P ++L LFK+FL+G P P  
Sbjct  420   HVYDNI--------LSFATIRGASHEAPFSQPERSLVLFKSFLEGKPLPEV  462



>ref|XP_007224935.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
 gb|EMJ26134.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
Length=438

 Score =   325 bits (832),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 174/442 (39%), Positives = 256/442 (58%), Gaps = 39/442 (9%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q++GY+       R+LFYYF EA+S    S PL +W  GG  CSS 
Sbjct  31    IVSLPGQPR-VSFQQFAGYVDVDDHPQRSLFYYFVEAESRPA-SKPLVVWFNGGPGCSSV  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+    L+KN +SWN  +NMLY+++P GV FS++   S Y+  +D +T
Sbjct  89    GEGAFVEHGPFKPSGGATLIKNPYSWNTEANMLYLESPAGVGFSFAADKSFYENVNDNIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR++L FL++WF +F EY   D ++ G+SY GH  PQLA LI++   N        LKGI
Sbjct  149   ARDSLTFLQRWFDKFPEYNHRDLFLVGESYAGHYVPQLAQLIIQSGVN------FNLKGI  202

Query  666   ALGNPILEKMSLSNVEHL--WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +  N E L  W HG+IS+  YG+   VCN++ ++ E ++G  S+ CSD+ 
Sbjct  203   AIGNPLLEFSTDVNAEDLFYWSHGLISDAAYGLLTSVCNSSQLLRETIAGSPSDACSDVI  262

Query  840   IMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
               +S+E+ + +DK                  +Y  T+  D C+ +    Y+NR DVQKAL
Sbjct  263   TQVSQELSNYVDK------------------YYQLTDKIDACVEEETVTYLNRKDVQKAL  304

Query  1020  HANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSH  1199
             HA   G    W+  S     D  + +  I  +P + +L+ S I V++YSGDQD  +P   
Sbjct  305   HAKLVGVSN-WSLCSQVLQYD--MRDMEIPTIPIVGSLVKSGIRVMVYSGDQDSVVPFFG  361

Query  1200  TREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1379
             +R +   LA +L L +      W++GK++GGW+Q + +         L+FA +RG SH  
Sbjct  362   SRSLINGLATQLGLKSTVPYRAWFEGKQVGGWTQVYDDI--------LSFAIIRGASHTA  413

Query  1380  PNSSPSKALTLFKAFLKGSPPP  1445
             P++ P ++L LFK+FL G P P
Sbjct  414   PSTQPKRSLALFKSFLGGKPLP  435



>ref|XP_009355265.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   325 bits (834),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 182/445 (41%), Positives = 259/445 (58%), Gaps = 27/445 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F QY+GY+   + + R+LFYYF EAQ+ D  S PL LWL GG  CSS 
Sbjct  35    IARLPGQPQ-VNFQQYAGYVTVDEKQERSLFYYFVEAQT-DPASKPLVLWLNGGPGCSSI  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPF+P+ED  L+KN FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  93    GVGAFNENGPFQPSEDN-LLKNDFSWNREANMLYLESPAGVGFSYSANKSFYGFVNDDIT  151

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A++NL+FL++WF EF EY++ D +I G+SY GH  PQLA LI++            LK +
Sbjct  152   AQDNLEFLQRWFDEFPEYKNRDLFITGESYAGHYVPQLAQLIIQSKLK------FNLKAV  205

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDE--FLSGELSEYCSD  833
             A+GNP+ E  +   S  E+LW HG+IS+  +     VCN + +  +     G LS  C +
Sbjct  206   AIGNPLFEFSTDINSRAEYLWSHGLISDATFENLTSVCNYSEIFRQEVIRGGPLSPACDE  265

Query  834   IEIMLSEEI-GHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
             +      E+ GH +++ ++       SS+ +       T   D C+ D +  Y+NRPD+Q
Sbjct  266   VANQFEREVPGHLINQYDVTL-DVCLSSVEAQSSQLRKTVKIDVCIGDEIVTYLNRPDLQ  324

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             +ALHA  T     W   S G   +  + N  I +LP L  L+ S I VLIYSGDQD  IP
Sbjct  325   EALHARLTN----WTTCSNGGVLEYDMKNLEIPMLPVLGDLVKSGIRVLIYSGDQDSVIP  380

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ TR + + LA  L L T      W++ K++ GW+Q + ++        L++AT+RG  
Sbjct  381   LTSTRTLVSGLAKDLGLQTNVPYRVWFEEKQVAGWTQVYSDA--------LSYATIRGAG  432

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LF +FL+G P P
Sbjct  433   HEAPISQPERSLLLFTSFLRGKPLP  457



>ref|XP_010678341.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=476

 Score =   325 bits (834),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 188/451 (42%), Positives = 262/451 (58%), Gaps = 31/451 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q++GY+     + ++LFYYF EAQ  D  S PL LWL GG  CSS 
Sbjct  43    ITILPGQPK-VSFKQFAGYVTVDHKKHKSLFYYFVEAQV-DPSSKPLVLWLNGGPGCSSL  100

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP +   LVKN+ SWN  +NMLY++TP+GV FSYS  ++ Y   SD +T
Sbjct  101   GVGAFSENGPFRP-KGNILVKNEHSWNTEANMLYLETPVGVGFSYSIDTTGYDAVSDAVT  159

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FLR+WF +F +Y+  D +I G+SY GH  PQLA L++  N+     +   LKGI
Sbjct  160   ARDNLVFLRRWFNKFPQYKHRDLFITGESYAGHYIPQLADLMVAFNKKE---KLFNLKGI  216

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E+ W HG+IS+  Y +    CN +  + E+  G +S  CS + 
Sbjct  217   ALGNPVLEFANDFNSRAEYFWSHGLISDSTYKIFTSACNYSRYVSEYYRGYVSPICSKVM  276

Query  840   IMLSEEIGHDMDKENLVFqscesssisssq------qHYLATETADPCLRDWVGEYINRP  1001
               +  E    +DK ++    C SS +S S+      Q     E+ D C+ D    Y+NR 
Sbjct  277   RQVGRETSKFVDKYDVTLDVCISSVLSQSKIISPQEQTEAGGESVDVCIEDETVSYLNRQ  336

Query  1002  DVQKALHA---NTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGD  1172
             DVQKALHA   N   W+   N        D  L +  I  +  + +L+ S +PVL+YSGD
Sbjct  337   DVQKALHARLVNVRRWEVCSNIL------DYELLDVEIPTITIVGSLVKSGVPVLVYSGD  390

Query  1173  QDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFA  1352
             QD  IP++ +R +   LA+ L L        W+ G+++GGW++ +GN         L+FA
Sbjct  391   QDSVIPLTGSRTLVHRLAMELGLNATTPYRVWFAGEQVGGWTEVYGNI--------LSFA  442

Query  1353  TVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             TVRG +H VP S P+++L LFK+FL+  P P
Sbjct  443   TVRGAAHEVPYSQPARSLVLFKSFLESRPLP  473



>ref|XP_002282978.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=451

 Score =   325 bits (832),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 182/442 (41%), Positives = 259/442 (59%), Gaps = 29/442 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  35    ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTALKPLVVWFSGGPGCSSV  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
                   ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  94    GA----QHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA LILE +          LKGI
Sbjct  149   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESSVK------FNLKGI  202

Query  666   ALGNPILE-KMSLSNVEHL-WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
              +GNP+++   + ++V H  W HG+IS+  Y +    CN + M  E  SG LS  C  + 
Sbjct  203   LMGNPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  262

Query  840   IMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
                S+E+G  +D+    F    +S + S       TE  D C+ D V +Y NR DVQK+L
Sbjct  263   SQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVNKYFNREDVQKSL  318

Query  1020  HANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSH  1199
             HA   G    W+  S     ++   +  I ++P + +L+ S I   +YSGDQD  IP+  
Sbjct  319   HARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFG  375

Query  1200  TREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1379
             TR +   LA +L+L T      W++G+++GGW+Q +G+         L+FATVRGGSH V
Sbjct  376   TRTLVDGLAKKLRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTV  427

Query  1380  PNSSPSKALTLFKAFLKGSPPP  1445
             P + P++AL LF AFLKG PPP
Sbjct  428   PGTQPARALVLFTAFLKGQPPP  449



>ref|NP_001151474.1| LOC100285107 precursor [Zea mays]
 gb|ACG42988.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=480

 Score =   325 bits (833),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/448 (41%), Positives = 256/448 (57%), Gaps = 21/448 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRG-RALFYYFAEAQSEDKFSMPLTLWLGGGHDCSS  302
             I  LPG+P +V F QYSGY+      G RALFYYF EA   D  S PL LWL GG  CSS
Sbjct  46    IRRLPGEP-EVSFAQYSGYVAVDSGGGKRALFYYFVEADVVDPASKPLVLWLNGGPGCSS  104

Query  303   AAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
               +G F ENGPFRP+    LVKN++SWN  +N++Y++TP GV +SYS  ++ Y+   D M
Sbjct  105   LGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPAGVGYSYSADAAYYQGVDDKM  163

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TA +N+ FL++W  +F +Y+  D YIAG+SY GH  PQLA  ++E N+     R   L+G
Sbjct  164   TAMDNMVFLQRWLQKFPQYKGRDLYIAGESYAGHYIPQLAEAMVEFNKKD---RIFNLRG  220

Query  663   IALGNPILEKMSLSN--VEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             +ALGNP+LE  +  N   E+ W HG+IS+  Y +    CN +  + E+  G LS  C+ +
Sbjct  221   VALGNPVLEFATDFNARAEYFWSHGLISDATYRVFTSACNYSRYVTEYYGGSLSPLCARV  280

Query  837   EIMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRPDV  1007
                ++ E    +DK ++   V  S   S       H    +  D C+ D    Y+NR DV
Sbjct  281   MNQVTRETSRFVDKYDVTLDVCLSSVLSQSKILSPHEQVGQRIDVCVEDETVRYLNRRDV  340

Query  1008  QKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRI  1187
             Q ALHA   G    W   S     +  L N  I  +  + +L+ S I VL+YSGDQD  I
Sbjct  341   QAALHARLVGVD-KWAVCS--SVLEYELLNLQIPTINVVGSLVKSGIRVLVYSGDQDSVI  397

Query  1188  PVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGG  1367
             P++ +R +   LA  + L T      W++G+++GGW+Q +G  GG      L+FAT+RG 
Sbjct  398   PLTGSRTLVQNLARDMGLKTTTPYRVWFEGQQVGGWTQVYG--GGA-----LSFATIRGA  450

Query  1368  SHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             SH  P S P ++L LF+AFL+G P P T
Sbjct  451   SHEAPFSQPGRSLVLFRAFLQGQPLPET  478



>ref|XP_009615672.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nicotiana 
tomentosiformis]
Length=463

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 185/467 (40%), Positives = 260/467 (56%), Gaps = 21/467 (4%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +  FL   +L  +S   + + I  LPGQP  V F Q+SGY+     + R+LFYYF EA++
Sbjct  13    IFLFLFCVSLGIVSALPHPDKIIQLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFVEAET  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              +  S PL LWL GG  CSS  +G F ENGPFRP     LV+N+ SWN  +NMLY+++PI
Sbjct  72    -NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKEANMLYLESPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYSN +S Y+  +D +TAR+NL FL +WF +F  YR  + ++ G+SY GH  PQLA
Sbjct  130   GVGFSYSNDTSSYETVNDEITARDNLVFLLRWFHKFPLYRKSNLFLTGESYAGHYVPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              L++  N+     +   LKG+ALGNP+LE  +   S  E+ W HG+IS+  Y M    CN
Sbjct  190   KLMMAFNKKQ---QIFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFSSACN  246

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATE  950
              +  + E+  G +S  CS +  ++S E    +DK  +          S S         E
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISSVLSQSKIISPQENVE  306

Query  951   TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSA  1130
               D C+ D +  Y+NR DV++ALHA   G +  W   S     D  L +  I  +  +  
Sbjct  307   KLDVCVEDEIVNYLNRKDVRRALHAELVGVRR-WAVCS--SILDYQLLDIEIPTISIIGM  363

Query  1131  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  1310
             L+   IPVLIYSGDQD  IP+  +R     LA R++L T      W+ G+++GGW+  + 
Sbjct  364   LVKERIPVLIYSGDQDSVIPLIGSRATVHQLARRMRLNTTVPYRVWFAGQQVGGWTHVYD  423

Query  1311  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             N         L+FAT+RG SH  P S P ++L LFK+FL+  P P  
Sbjct  424   NI--------LSFATIRGASHEAPFSQPERSLVLFKSFLEDRPLPEV  462



>ref|XP_009599118.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana tomentosiformis]
Length=457

 Score =   324 bits (830),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 194/475 (41%), Positives = 273/475 (57%), Gaps = 32/475 (7%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRING----EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFY  221
             M   ++F L+     I+   NG    + I  LPGQP  V F Q+SGY+     + RALFY
Sbjct  1     MTLSIFFFLLCAFVGIA---NGFPQPDKIILLPGQP-QVGFQQFSGYVTVDDKKQRALFY  56

Query  222   YFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASN  398
             YF EA+     S PL LWL GG  CSS  +G F ENGPFRP  +G+ LVKN++SWN  +N
Sbjct  57    YFVEAEINPA-SKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVKNEYSWNKEAN  113

Query  399   MLYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYG  578
             MLY+++PIGV FSYS  +S Y+  +D  TAR+N+ FL++WF +F +YR+ + ++ G+SY 
Sbjct  114   MLYLESPIGVGFSYSTNTSSYETVNDVTTARDNVVFLQRWFNKFPQYRNSNLFLTGESYA  173

Query  579   GHLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVY  752
             GH  PQLA L++E N+     +   LKG+ALGNP+LE  +   S  E+ W HG+IS+  Y
Sbjct  174   GHYVPQLAKLMIELNQMK---KLFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDSTY  230

Query  753   GMQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssq-  929
              M    CN +  + E+    +S  CS +  ++S E    +DK ++    C SS  S S+ 
Sbjct  231   RMFTSFCNYSRYVSEYYRDNVSPMCSRVMSLVSRETSKFVDKYDVTLDVCLSSVFSQSKI  290

Query  930   ---qHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNF  1100
                Q     E  D C+ D    Y+NR DV++ALHA   G +  W+  S     D  L + 
Sbjct  291   ICPQENADAEKIDVCIDDKTVNYLNREDVRRALHAKLVGVRR-WDVCS--NILDYQLLDI  347

Query  1101  AIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGK  1280
              I  +  +  L+   IPVLIYSGDQD  +P++ +R V   LA R+ L T      W+ G+
Sbjct  348   EIPTISIVGLLVKERIPVLIYSGDQDSVVPLTGSRTVIHQLAKRMGLNTTVPYRVWFAGQ  407

Query  1281  EIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             ++GGW+  + N         L+FATVRG SH VP S P ++L LFK+FL+G   P
Sbjct  408   QVGGWTVVYDNI--------LSFATVRGASHEVPFSQPERSLVLFKSFLEGRALP  454



>ref|XP_011040747.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=467

 Score =   324 bits (830),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 197/468 (42%), Positives = 266/468 (57%), Gaps = 41/468 (9%)
 Frame = +3

Query  102   SIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLG  281
             SI   G+I+ +LPGQP  V F QY+GYI   + + RALFYYFAEA+  D  + PL LWL 
Sbjct  24    SISEAGKIV-ALPGQPR-VSFQQYAGYITIDEQQKRALFYYFAEAEI-DPATKPLVLWLN  80

Query  282   GGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDY  461
             GG  CSS   G F E+GPF+P+ +  L+KN +SWN  +NMLY+++P GV FSYS   S Y
Sbjct  81    GGPGCSSIGAGAFCEHGPFKPSAE-ILLKNDYSWNKEANMLYLESPAGVGFSYSANDSFY  139

Query  462   KIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHL  641
                +D +TA++NL FL +WF EF EY+  DF+I G+SY GH  PQLA LI++        
Sbjct  140   TYVTDEITAQDNLVFLERWFDEFPEYKGRDFFITGESYAGHYVPQLATLIVQSQTK----  195

Query  642   RPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGEL  815
                 LKGIA+GNP+LE  +   S  E  W HG+IS++ Y +   VCN + +  ++ SG L
Sbjct  196   --FNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDDTYEIFTTVCNYSQIRRQYQSGSL  253

Query  816   SEYCSDIEIMLSEEIGHDMDKENL----VFqscesssisssqqHYLA------TETADPC  965
             S  CS +   +S E+   +D  ++       S ES S    Q  +L+      T T D C
Sbjct  254   SLPCSAVNSRVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQMAFLSSPVQEYTGTIDVC  313

Query  966   LRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALL  1136
             + D   +Y+NR DV +ALHA   G    W   S     DVI   + N  I  +P L+ LL
Sbjct  314   VEDETIKYLNRKDVLEALHAQLVGVD-QWTVCS-----DVIKYEMENLEISTVPLLAKLL  367

Query  1137  MSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNS  1316
              S I V +YSGDQD  IP++ TR +   LA  L L T      W+ GK++ GW+Q +GN 
Sbjct  368   KSGIRVHVYSGDQDSVIPLTGTRTIVNGLAKELGLNTTVPYRTWFQGKQVAGWTQVYGNI  427

Query  1317  GGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGS--PPPNTH  1454
                     L+FAT+R  SH  P S P ++  LF AFL+G   PPP  +
Sbjct  428   --------LSFATIRAASHEAPFSQPERSFVLFNAFLEGKQLPPPTVY  467



>ref|XP_004503800.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=466

 Score =   323 bits (829),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 273/472 (58%), Gaps = 26/472 (6%)
 Frame = +3

Query  51    IMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFA  230
             I V LL  L ++++    +  + + I  LPGQP  ++F Q+SGY+   + + R+LFYYF 
Sbjct  11    ITVVLLQ-LSISSMKIFCLSSHADRIHKLPGQP-HINFQQFSGYVTVDEMKQRSLFYYFV  68

Query  231   EAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLY  407
             E+++    S PL LWL GG  CSS  IG F ENGPFRP  +GE L+KN  SWN  +NMLY
Sbjct  69    ESKTNPS-SKPLVLWLNGGPGCSSIGIGAFSENGPFRP--NGEVLIKNDHSWNREANMLY  125

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             ++TP+GV FSY+  +  Y   +D MTAR+NL FL  WF +F +Y+  D ++ G+SY GH 
Sbjct  126   LETPVGVGFSYAKGTFSYMKVNDEMTARDNLVFLLGWFNKFPQYKHRDLFLTGESYAGHY  185

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQ  761
              PQLA L++  N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y M 
Sbjct  186   IPQLAKLMIGINKKK---KIFNLKGIALGNPLLEYATDFNSRAEFFWSHGLISDSTYKMF  242

Query  762   KKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssq----  929
                CN +  + E+    +S  CS +   +S E    +DK ++    C SS +S S+    
Sbjct  243   TAGCNYSRYVSEYYRNSISPLCSKVMRKVSRETSKFVDKYDVTLDVCISSVLSQSKVICP  302

Query  930   qHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAID  1109
             Q + A E+ D C+ D V  Y+NR DVQKALHA   G    W+  +     D  + N  + 
Sbjct  303   QTHQANESIDVCVDDKVTNYLNRRDVQKALHAELVGVP-TWDVCN--NVLDYNMLNLEVP  359

Query  1110  ILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIG  1289
              L  + +L+ + + VLIYSGDQD  IP++ +R +   LA +L L T      W++G ++G
Sbjct  360   TLHVVGSLIKAGVRVLIYSGDQDSVIPLTGSRSLVQKLARQLSLNTTVPYRVWFEGHQVG  419

Query  1290  GWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             GW+Q +GN         L+FAT+RG SH  P S P ++L LF +FL+  P P
Sbjct  420   GWTQVYGNI--------LSFATIRGASHEAPFSQPQRSLVLFNSFLEDRPLP  463



>ref|XP_009778790.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=457

 Score =   323 bits (828),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 185/444 (42%), Positives = 265/444 (60%), Gaps = 25/444 (6%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LPGQP  V F Q+SGY+     + R+LFYYF EA++ +  S PL LWL GG  CSS  +G
Sbjct  29    LPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFVEAET-NPASKPLVLWLNGGPGCSSLGVG  86

Query  315   MFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTAR  491
              F ENGPFRP  +G+ LVKN++SWN  +NMLY+++PIGV FSYS  +S Y+  +D  TAR
Sbjct  87    AFSENGPFRP--NGQVLVKNEYSWNKEANMLYLESPIGVGFSYSTNTSAYETVNDETTAR  144

Query  492   ENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIAL  671
             +N+ FL++WF +F +YR+ + ++ G+SY GH  PQLA L++E N+     +   LKG+AL
Sbjct  145   DNVVFLQRWFNKFPQYRNNNLFLTGESYAGHYVPQLAKLMIELNQKK---KLFNLKGVAL  201

Query  672   GNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIEIM  845
             GNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+    +S  CS +  +
Sbjct  202   GNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSFCNYSRYVSEYYRENVSPMCSRVMSL  261

Query  846   LSEEIGHDMDKENLVFqscesssisssq----qHYLATETADPCLRDWVGEYINRPDVQK  1013
             ++ E    +DK ++    C SS +S S+    Q    TE  D C+ D    Y+NR DV++
Sbjct  262   VTRETSKFVDKYDVTLDVCLSSVLSQSKIISPQENADTEKIDVCIDDKTVNYLNRQDVRR  321

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W+  S     D  L +  I  +  +  L+   IPVLIYSGDQD  +P+
Sbjct  322   ALHAKLVGVR-RWDVCS--NVLDYQLLDIEIPTIYIVGLLVKERIPVLIYSGDQDSVVPL  378

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R V   LA R+ L T      W+ G+++GGW+  + N         L+FATVRG +H
Sbjct  379   TGSRTVVHQLAKRMGLNTTVPYRVWFAGQQVGGWTIVYDNI--------LSFATVRGAAH  430

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
              VP S P ++L LFK+FL+G   P
Sbjct  431   EVPFSQPERSLVLFKSFLEGRALP  454



>ref|XP_006380973.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58770.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=478

 Score =   323 bits (828),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 183/475 (39%), Positives = 266/475 (56%), Gaps = 52/475 (11%)
 Frame = +3

Query  111   INGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGH  290
             +  + I  LPGQP  V F Q+SGYI   + + R+LFYYF EA++    S PL LWL GG 
Sbjct  24    LEADRIVRLPGQPP-VSFQQFSGYITVDEKQHRSLFYYFVEAETSPA-SKPLVLWLNGGP  81

Query  291   DCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
              CSS  +G F E+GPFRPT    LV+N++SWN  +NMLY+++P GV FSYS   + Y   
Sbjct  82    GCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKEANMLYLESPAGVGFSYSANQTFYSYV  141

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPI  650
             +D MTAR+NL FLR+WF++F +Y+  DF+IAG+SY GH  PQLA LI+    N       
Sbjct  142   NDEMTARDNLVFLRRWFVKFPQYKQRDFFIAGESYAGHYVPQLAQLIIRSKVN------F  195

Query  651   KLKGIALGNPILE-KMSLSNVEHL-WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEY  824
              LKGIA+GNP+LE    L+  +H  W HG+IS+  Y +   VCN++ ++ E L+G +S  
Sbjct  196   NLKGIAIGNPLLEFNTDLNAQDHFYWSHGLISDSTYQLLTSVCNSSKLMREALTGTVSSA  255

Query  825   CSDIEIMLSEEIGHDMD-------------------------KENLVFqscesssisssq  929
             C  +  ++ +E+   +D                         +  L + S +   + S +
Sbjct  256   CLGVYTLVQKELSESIDPYDVTGDICLSSNQSQLKIFHQQLLRSRLPYLSPQVLELDSVK  315

Query  930   qHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAID  1109
             Q        D CL +    Y+NR DVQ ALHA   G       T+    S V+ ++ + +
Sbjct  316   QQQQVMGKVDVCLLEETTNYLNRKDVQMALHARLVG------VTNWHVCSVVLEYDRSNE  369

Query  1110  ILPTL---SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGK  1280
               PT+    +L+ S + VL+YSGDQD  I  + TR + + +A  L+L T      W  G 
Sbjct  370   ERPTIHVVRSLVKSGLAVLVYSGDQDSIIAFTGTRSLVSKIAKDLRLKTTVPYRAWLSGN  429

Query  1281  EIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             ++GGW+Q +G+        NL+FAT+RG SH  P++ P ++L LFK+FL+  P P
Sbjct  430   QVGGWTQVYGD--------NLSFATIRGASHTAPSTQPKRSLLLFKSFLEKKPLP  476



>emb|CAN72076.1| hypothetical protein VITISV_041583 [Vitis vinifera]
Length=451

 Score =   322 bits (826),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 181/442 (41%), Positives = 257/442 (58%), Gaps = 29/442 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  35    ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTALKPLVVWFSGGPGCSSV  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
                   ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  94    GA----QHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA LILE            LKGI
Sbjct  149   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESRVK------FNLKGI  202

Query  666   ALGNPILE-KMSLSNVEHL-WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
              +G+P+++   + ++V H  W HG+IS+  Y +    CN + M  E  SG LS  C  + 
Sbjct  203   LMGBPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  262

Query  840   IMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
                S+E+G  +D+    F    +S + S       TE  D C+ D V +Y NR DVQK+L
Sbjct  263   SQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVNKYXNREDVQKSL  318

Query  1020  HANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSH  1199
             HA   G    W+  S     ++   +  I ++P + +L+ S I   +YSGDQD  IP+  
Sbjct  319   HARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFG  375

Query  1200  TREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1379
             TR +   LA  L+L T      W++G+++GGW+Q +G+         L+FATVRGGSH V
Sbjct  376   TRTLVDGLAKXLRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTV  427

Query  1380  PNSSPSKALTLFKAFLKGSPPP  1445
             P + P++AL LF AFLKG PPP
Sbjct  428   PGTQPARALVLFTAFLKGQPPP  449



>ref|XP_004979352.1| PREDICTED: serine carboxypeptidase-like 45-like [Setaria italica]
Length=472

 Score =   323 bits (828),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 184/447 (41%), Positives = 257/447 (57%), Gaps = 21/447 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V F QYSGY+       RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  40    IRRLPGQP-EVSFGQYSGYVGVDDVGKRALFYYFVEAEV-DPASKPLVLWLNGGPGCSSL  97

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP+    LVKN++SWN  +N++Y++TP GV +SYS  ++ Y+   D MT
Sbjct  98    GVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPAGVGYSYSADAAYYQGVDDKMT  156

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A +N+ FL++W  +F +Y+  D YIAG+SY GH  PQLA +++E N+     +   LKGI
Sbjct  157   ATDNMVFLQRWLQKFPQYKGRDLYIAGESYAGHYIPQLAEVMVEFNKKD---KIFNLKGI  213

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +   S  E+ W HG+IS+  Y +   VCN +  + E+  G LS  C+ + 
Sbjct  214   ALGNPVLEFTTDFNSRAEYFWSHGLISDGTYRVFTSVCNYSRYVAEYYGGALSPLCARVM  273

Query  840   IMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
               ++ E    +DK ++   V  S   S       H  A    D C+ D    Y+NR DVQ
Sbjct  274   NQVTRETSRFVDKYDVTLDVCLSSVLSQSKVLTPHQQAGNRIDVCVEDETVRYLNRRDVQ  333

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
              A+HA   G    W   S     +  L N  I  +  + +L+ S I VL+YSGDQD  IP
Sbjct  334   AAMHARLVGVD-KWAVCS--SVLEYELLNLQIPTINIVGSLVKSGIRVLVYSGDQDSVIP  390

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  + L T      W++G+++GGW+Q +G  GG      L+FAT+RG S
Sbjct  391   LTGSRTLVQNLAHDMGLKTTTPYRVWFEGQQVGGWTQVYG--GG-----TLSFATIRGAS  443

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             H  P S P ++L L ++FL+G P P T
Sbjct  444   HEAPFSQPERSLVLVRSFLQGQPLPET  470



>ref|XP_004241645.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=457

 Score =   322 bits (826),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 182/441 (41%), Positives = 258/441 (59%), Gaps = 21/441 (5%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LPGQP  V F Q+SGY+     + RALFYYF EA++ D  S PL LWL GG  CSS  +G
Sbjct  31    LPGQP-QVGFQQFSGYVTVDDKKQRALFYYFVEAET-DPASKPLVLWLNGGPGCSSVGVG  88

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPFRP     LVKN+ SWN  +NMLY+++P+GV FSYS  +S Y+  +D +TAR+
Sbjct  89    AFSENGPFRP-RGQVLVKNEHSWNKEANMLYLESPVGVGFSYSTNTSSYETVNDEITARD  147

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALG  674
             N+ FL++WF +F +YR+ + ++ G+SY GH  PQLA L++E N      +   LKG+ALG
Sbjct  148   NVVFLQRWFNKFPQYRENNLFLTGESYAGHYVPQLAKLMIELNNKK---KLFNLKGVALG  204

Query  675   NPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIEIML  848
             NP+LE  +   S  E+ W HG+IS+  Y M   VCN +  + E+    +S  CS +  ++
Sbjct  205   NPVLEFATDFNSRAEYFWSHGLISDSTYRMFTSVCNYSRYVSEYYRDGVSPMCSRVMSLV  264

Query  849   SEEIGHDMDKENLVFqscesssisssqqHYLAT--ETADPCLRDWVGEYINRPDVQKALH  1022
             S E    +DK ++    C SS +S S         E  D C+ D    Y+NR DV+ ALH
Sbjct  265   SRETSKFVDKYDVTLDVCMSSVLSQSNIISPQENGEKIDVCIDDETVNYLNRQDVRTALH  324

Query  1023  ANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHT  1202
             A   G  + W+  S     D  L +  I  +  +  L+   IPVLIYSGDQD  +P++ +
Sbjct  325   ARLVG-VHSWDVCS--TILDYQLLDIEIPTISIVGLLVKERIPVLIYSGDQDSVVPLTGS  381

Query  1203  REVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1382
             R V   LA ++ L T      W+ G+++GGW+Q + N         L+FAT+RG +H  P
Sbjct  382   RSVVHQLANQMGLNTTVPYRVWFSGQQVGGWTQVYDNI--------LSFATIRGAAHEAP  433

Query  1383  NSSPSKALTLFKAFLKGSPPP  1445
              S P ++L LF++FL+G   P
Sbjct  434   FSQPERSLVLFRSFLQGKALP  454



>ref|XP_011041403.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=476

 Score =   323 bits (827),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 187/483 (39%), Positives = 261/483 (54%), Gaps = 47/483 (10%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIID---SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +L  T + I   ++    D   SLPGQP  V F QY+GY+   + + +ALFYYF EA++ 
Sbjct  11    VLCATFFQICRAVDSPADDKLLSLPGQPR-VSFQQYAGYVTVDENQDKALFYYFVEAET-  68

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS   G F E+GPFRP+  G LV+N +SWN  +NMLY+++P G
Sbjct  69    DPASKPLVLWLNGGPGCSSVGAGAFSEHGPFRPSGGGSLVRNDYSWNKEANMLYLESPAG  128

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAA  605
             V FSYS   S Y + +DT+T ++N  FL+ WF +F EY++ D +I G+SY GH  PQLA 
Sbjct  129   VGFSYSANQSFYDLVNDTITVQDNFVFLQNWFQKFPEYKNRDLFITGESYAGHYVPQLAD  188

Query  606   LILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNVE--HLWYHGIISEEVYGMQKKVCNA  779
             LI++            LKGIALGNP+LE  +  N E    W HG+IS   Y +   VCN 
Sbjct  189   LIVKSGLK------FNLKGIALGNPLLEFGTDFNSEGDFYWSHGLISNPTYELLSAVCNT  242

Query  780   TTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqs--------------------  899
             + +  E +   LS  CS +   L  EI + +DK ++                        
Sbjct  243   SQLWRERIGNSLSASCSKVNDQLHAEISYAIDKYDVTANVCLSFGASLLGVQNNPLTPRF  302

Query  900   ---cesssisssqqHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPG  1070
                  + S+  +     A E  DPC+++    Y+NR DVQ++ HA   G    W F S  
Sbjct  303   RLFSSAESLQEALSQQKAQENIDPCVQEETFVYLNRKDVQESFHAKLVG-TPKWTFCSGV  361

Query  1071  KTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTL  1250
                D  L N  I  +  + +L+ S + VL+YSGDQD  IP + +R +   LA +L L   
Sbjct  362   VNYD--LRNLEIPTIDVVGSLVTSGVRVLVYSGDQDSVIPFTGSRTLVEGLAKKLGLNAT  419

Query  1251  EMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLK  1430
                  W++ K++GGW+Q +G+         LTF+T+RGGSH  P SSP ++L LF AFL 
Sbjct  420   VPYTAWFEDKQVGGWTQVYGDI--------LTFSTIRGGSHMAPFSSPGRSLALFAAFLS  471

Query  1431  GSP  1439
             G P
Sbjct  472   GKP  474



>ref|XP_011040750.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=499

 Score =   323 bits (829),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 184/475 (39%), Positives = 266/475 (56%), Gaps = 52/475 (11%)
 Frame = +3

Query  111   INGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGH  290
             +  + I  LPGQP  V F Q+SGYI   + + R+LFYYF EA+S    S PL LWL GG 
Sbjct  45    LEADRIVRLPGQPP-VSFQQFSGYITVDEKQHRSLFYYFVEAESSPA-SKPLVLWLNGGP  102

Query  291   DCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIW  470
              CSS   G F E+GPFRPT    LV+N++SWN  +N+LY+++P GV FSYS   + Y   
Sbjct  103   GCSSVGAGAFVEHGPFRPTTGNNLVRNEYSWNKEANLLYLESPAGVGFSYSANQTFYSYV  162

Query  471   SDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPI  650
             +D MTAR+NL FLR+WF++F +Y+  DF+IAG+SY GH  PQLA LI+    N       
Sbjct  163   NDEMTARDNLVFLRRWFVKFPQYKQRDFFIAGESYAGHYVPQLARLIIRSKVN------F  216

Query  651   KLKGIALGNPILE-KMSLSNVEHL-WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEY  824
              LKGIA+GNP+L+    L+  +H  W HG+IS+  Y +   VCN + ++ E ++  +S  
Sbjct  217   NLKGIAIGNPLLDFDTDLNAQDHFYWSHGLISDSTYQLLTSVCNNSKLMREAITSTVSSA  276

Query  825   CSDIEIMLSEEIGHDMD-------------------------KENLVFqscesssisssq  929
             C  +  ++ +E+   +D                         +  L + S +   + S +
Sbjct  277   CLGVYTLVQKELSESVDPYDVTGDICLSSNQSQLKIFNQQLLRSRLPYLSPQVLEMDSVK  336

Query  930   qHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAID  1109
             Q      T D CL +   +Y+NR DVQ ALHA   G       T+    S V+ ++ + +
Sbjct  337   QQQQVMGTVDVCLLEETTKYLNRKDVQMALHARLVG------VTNWHVCSVVLEYDRSNE  390

Query  1110  ILPTL---SALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGK  1280
               PT+    +L+ S + VL+YSGDQD  IP + TR + + LA  L+L T      W  G 
Sbjct  391   ERPTIHVVRSLVKSGLKVLVYSGDQDSVIPFTGTRSLVSKLAKDLRLKTTVPYRAWLSGN  450

Query  1281  EIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             ++GGW+Q +G+        NL+FAT+RG SH  P++ P ++L LFKAFL+  P P
Sbjct  451   QVGGWTQVYGD--------NLSFATIRGASHTAPSTQPKRSLLLFKAFLEKKPLP  497



>ref|XP_004136792.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 ref|XP_004159658.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
Length=436

 Score =   321 bits (823),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 181/447 (40%), Positives = 266/447 (60%), Gaps = 25/447 (6%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
             G +I SLPGQP  V+F Q+ GYI   + + R+LFYYF EAQS D  S PL LWL GG  C
Sbjct  10    GHLIKSLPGQPI-VNFKQFGGYITIDELQSRSLFYYFVEAQS-DPTSKPLVLWLNGGPGC  67

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS   G F ENGPFRP  D  L+ N+FSWN  +N+LY+++P GV FS+S  ++ Y   +D
Sbjct  68    SSLGAGAFIENGPFRPKGD-VLILNEFSWNNVANVLYLESPAGVGFSFSKNTTFYDTVND  126

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
              +TA++N+ FL +W  +F EY++ +FYI G+SY GH  PQLA LI++   +      IKL
Sbjct  127   KITAQDNIVFLERWLEKFPEYKNREFYITGESYAGHYVPQLARLIVQSKLS------IKL  180

Query  657   KGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             K IA+GNP+LE  +  N   ++LW HG+ISE  + +   VC+ + ++ E ++GE+S+ C 
Sbjct  181   KAIAIGNPLLEFNTDFNSRGKYLWSHGVISESTFELLNTVCSISQIVREGINGEISDACL  240

Query  831   DIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRP  1001
              I  +++ E+   +++ ++   V  S + +  + S  HY      D C+ + +  Y+NR 
Sbjct  241   SINDLIAREMSPFINEYSINLDVCLSGDQTQTALSALHYAG--KVDVCIGNEIDAYLNRV  298

Query  1002  DVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDL  1181
             DVQ+ALHA   G    W+  S     D    N  +  +  + +L+ S I VLI+SGDQD 
Sbjct  299   DVQQALHAQLIGVS-TWSLCS--DILDYDRTNLFVPTINIVGSLVRSGIRVLIFSGDQDA  355

Query  1182  RIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVR  1361
              IP+  +R +   LA  L+L T      W+   ++GGW +TFG         NL+FAT+R
Sbjct  356   VIPLLGSRTLVNKLAKALRLNTTLPYSAWFHNHQVGGWVETFGEKN------NLSFATIR  409

Query  1362  GGSHFVPNSSPSKALTLFKAFLKGSPP  1442
             G +H  P +SP+ +LTLF AFL+   P
Sbjct  410   GAAHQAPYTSPATSLTLFTAFLQAKNP  436



>ref|XP_011040753.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=482

 Score =   323 bits (827),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 189/496 (38%), Positives = 269/496 (54%), Gaps = 48/496 (10%)
 Frame = +3

Query  60    FLLWFLLVNTLYSISIRINGEIID----SLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             +++  ++  T   IS  ++   +D    SLPGQP  V F QY+GY+   + + RALFYYF
Sbjct  6     WIIMVVICATFMQISRAVDSSSVDDKILSLPGQPP-VSFQQYAGYVTVDENQDRALFYYF  64

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA+S D  S PL LWL GG  CSS  IG F ENGPFRP   G LV+N +SWN  +NMLY
Sbjct  65    VEAES-DPASKPLVLWLNGGPGCSSFGIGAFSENGPFRPRGGGLLVRNDYSWNKEANMLY  123

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             +++P GV FSYS   S Y + +DT+TA+++  FL++WF++F EY+D DFYI G+SY GH 
Sbjct  124   LESPAGVGFSYSANQSFYDLVNDTITAQDSYIFLQQWFVKFPEYKDRDFYITGESYAGHY  183

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNVE--HLWYHGIISEEVYGMQ  761
              PQLA LI +            LKGIA+GN +LE  +  N E  + W HG+IS+  Y + 
Sbjct  184   VPQLAHLIAQSGLK------FNLKGIAVGNALLEFNTDLNSEGDYYWAHGLISDATYELM  237

Query  762   KKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLV-----------------  890
               VCN++ +  E ++G     C  +   LS E  +  D  N++                 
Sbjct  238   NSVCNSSQLWRESITGSSFAACVVVNKRLSVEFPNAFDDYNVIGDICISSGESQLDVPSY  297

Query  891   -FqscesssisssqqHYLATETADP-----CLRDWVGEYINRPDVQKALHANTTGWQYPW  1052
              F+     S S+        +T D      C+++   +Y+N+ DVQ+ALHA   G     
Sbjct  298   PFRPKFKVSSSTQSVQAALDQTKDAGNIDVCVQEKSSQYLNKKDVQEALHAQLVGVT---  354

Query  1053  NFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVR  1232
              +T      +    NF I  +  + +L+ S I VL+YSGDQD  IP   +R +   LA  
Sbjct  355   RWTGCSSVVNYDRRNFEIPTINIVGSLVSSGIRVLVYSGDQDSVIPFMGSRILVDGLAKE  414

Query  1233  LKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTL  1412
             L L       PW++ K++GGW+Q +G+         LTFAT+RG  H  P +SP ++L L
Sbjct  415   LGLNATVPYRPWFEDKQVGGWTQVYGDI--------LTFATIRGAGHLAPLTSPKRSLAL  466

Query  1413  FKAFLKGSPPPNTHPD  1460
             F AF+ G P P   P+
Sbjct  467   FSAFMSGKPLPEALPN  482



>ref|XP_002307961.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
 gb|EEE91484.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
Length=482

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 191/498 (38%), Positives = 267/498 (54%), Gaps = 48/498 (10%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIID----SLPGQPSDVDFNQYSGYIVTHKFRGRALFY  221
               +++  ++  T   IS  ++   +D    SLPGQP  V F QYSGY+   + + RALFY
Sbjct  4     QAWIIMVVICATFMQISRAVDSSSVDDKILSLPGQPP-VSFQQYSGYVTVDENQDRALFY  62

Query  222   YFAEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNM  401
             YF EA+S D  S PL LWL GG  CSS  IG F ENGPFRP   G LV+N + WN  +NM
Sbjct  63    YFVEAES-DPASKPLVLWLNGGPGCSSFGIGAFSENGPFRPRGGGLLVRNDYRWNKEANM  121

Query  402   LYVDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGG  581
             LY+++P GV FSYS   S Y + +DT+TA+++  FL+ WF++F EY+D DFYI G+SY G
Sbjct  122   LYLESPAGVGFSYSANQSFYDLVNDTITAQDSYIFLQLWFVKFPEYKDRDFYITGESYAG  181

Query  582   HLAPQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNVE--HLWYHGIISEEVYG  755
             H  PQLA LI +            LKGIA+GN +LE  +  N E  + W HG+IS+  Y 
Sbjct  182   HYVPQLAHLIAQSGLK------FNLKGIAVGNALLEFNTDFNSEGDYYWAHGLISDATYE  235

Query  756   MQKKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLV---------------  890
             +   VCN++ +  E ++G     C  +   LS E  +  D  N++               
Sbjct  236   LMNSVCNSSQLWRESITGSRFAACVVVNKRLSIEFPNSFDDYNVIGDICISSGESQLDVP  295

Query  891   ---FqscesssisssqqHYLATETADP-----CLRDWVGEYINRPDVQKALHANTTGWQY  1046
                F+     S S+        +T D      C+++   +Y+NR DVQ+ALHA   G   
Sbjct  296   SYPFRPKFQVSSSTQSVQAALDQTKDAENIDVCVQEKSSQYLNRKDVQEALHAQLVGVT-  354

Query  1047  PWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLA  1226
                +T      +    NF I  +  + +L+ S I VL+YSGDQD  IP   +R +   LA
Sbjct  355   --RWTGCSSVVNYDRRNFEIPTINIVGSLVSSGIRVLVYSGDQDSVIPFIGSRILVDGLA  412

Query  1227  VRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKAL  1406
               L L       PW++ K++GGW+Q +G+         LTFAT+RG  H  P +SP ++L
Sbjct  413   KELGLNATVPYRPWFEDKQVGGWTQVYGDI--------LTFATIRGAGHLAPLTSPKRSL  464

Query  1407  TLFKAFLKGSPPPNTHPD  1460
              LF AFL G P P   P+
Sbjct  465   ALFSAFLSGKPLPEALPN  482



>gb|EMS60816.1| Serine carboxypeptidase-like 45 [Triticum urartu]
Length=506

 Score =   323 bits (828),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 193/496 (39%), Positives = 269/496 (54%), Gaps = 60/496 (12%)
 Frame = +3

Query  99    ISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWL  278
             +S+ +  + I +LPGQP  V F QYSGY+     R R+LFYYFAEA+  D  + PL LWL
Sbjct  24    LSMAMVEDKITALPGQPP-VSFAQYSGYVEVDAMRKRSLFYYFAEAEL-DPATKPLVLWL  81

Query  279   GGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSD  458
              GG  CSS  +G F ENGPFRP+ +  LV N++SWN  +NMLY+++P GV FSYS   S 
Sbjct  82    NGGPGCSSVGVGAFSENGPFRPSGNA-LVGNEYSWNKEANMLYLESPAGVGFSYSTDPSF  140

Query  459   YKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILE-DNRNPA  635
             Y    D+MTAR+NL+FL  WF +F +Y+  D YIAG+SY GH  PQLA  ++E D++   
Sbjct  141   YGGVGDSMTARDNLRFLEGWFAKFPQYKGRDLYIAGESYAGHYVPQLAQRMVEFDDKE--  198

Query  636   HLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSG  809
               +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y +   VCN +  + E+  G
Sbjct  199   --KLFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFTTVCNYSRYVSEYYHG  256

Query  810   ELSEYCSDIEIMLSEEIGHDMDKEN---------------------------LVFqsces  908
              +S  C  +   ++ E    +DK +                           + F     
Sbjct  257   SISTVCDRVMSQVTRETSRFVDKYDVTLDVCISSVLMQSQVLTPSPNVSFFSITFAKEMY  316

Query  909   ssisssqqHYLATE----TADPCLRDWVGEYINRPDVQKALHANTTG---W-----QYPW  1052
              ++S +     +TE      D C+ D    Y+NR DVQKA+HA   G   W     Q   
Sbjct  317   VTLSLTDNFLQSTEQLNRALDVCVEDETMNYLNRKDVQKAMHAQLNGVPKWTLHFLQQGC  376

Query  1053  NFTSPGKTSDVILH---NFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVL  1223
             +FT     S V+ +   +  I  +  + AL+ S IPVL+YSGDQD  IP++ +R +   L
Sbjct  377   DFTECFALSSVLEYKQLDLQIPTINIVGALVKSGIPVLVYSGDQDSVIPLTGSRTLVHRL  436

Query  1224  AVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKA  1403
             A RL+L        W+ GK++GGW+Q F +         L+FAT+RG SH  P S P ++
Sbjct  437   AKRLRLNATVPYRVWFQGKQVGGWTQVFSDV--------LSFATIRGASHEAPFSQPERS  488

Query  1404  LTLFKAFLKGSPPPNT  1451
             L LF+AFL   P P +
Sbjct  489   LVLFRAFLASRPLPES  504



>ref|XP_008670742.1| PREDICTED: serine carboxypeptidase-like 45 [Zea mays]
 tpg|DAA42025.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=479

 Score =   321 bits (823),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 187/449 (42%), Positives = 258/449 (57%), Gaps = 21/449 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRG--RALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I  LPGQP +V F QYSGY+      G  RALFYYF EA + D  S PL LWL GG  CS
Sbjct  43    ITRLPGQP-EVSFGQYSGYVGVDGDGGGKRALFYYFVEADAPDPASKPLVLWLNGGPGCS  101

Query  300   SAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDT  479
             S  +G F ENGPFRP+    LVKN++SWN  +N++Y++TP GV +SYS  ++ Y+   D 
Sbjct  102   SLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLETPAGVGYSYSADAAYYQGVDDK  160

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLK  659
             MTA +N+ FL++W  +F +YR  D YIAG+SY GH  PQLA  ++E N      R   LK
Sbjct  161   MTAMDNMVFLQRWLQKFPQYRGRDLYIAGESYAGHYIPQLAEAMVEFNNK--EERIFNLK  218

Query  660   GIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             G+ALGNP+LE  +   S  E+ W HG+IS+  +      CN +  + E+  G LS  C+ 
Sbjct  219   GVALGNPVLEFATDFNSRAEYFWSHGLISDATFRAFTSACNYSRYVAEYYGGALSPLCAR  278

Query  834   IEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRPD  1004
             +   ++ E    +DK ++   VF S   S   +   H    +  D C+ D    Y+NR D
Sbjct  279   VMNRVTRETSRFVDKYDVTLDVFLSSVLSQSKTLSPHEQVGQRVDVCVEDETVRYLNRRD  338

Query  1005  VQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLR  1184
             VQ ALHA   G    W   S     +++  N  I  +  + +L+ S I VL+YSGDQD  
Sbjct  339   VQAALHARLVGVD-KWAVCSSVLQYELL--NLQIPTINVVGSLVRSGIRVLVYSGDQDSV  395

Query  1185  IPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRG  1364
             IP++ +R +   LA  + L T      W++G+++GGW+Q +G  GG      L+FATVRG
Sbjct  396   IPLTGSRTLVQSLARGMGLKTTTPYRVWFEGQQVGGWTQVYG--GGA-----LSFATVRG  448

Query  1365  GSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
              SH  P S P ++L LF+AFL+G P P T
Sbjct  449   ASHEAPFSQPGRSLVLFRAFLQGQPLPET  477



>ref|XP_002517289.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45082.1| serine carboxypeptidase, putative [Ricinus communis]
Length=464

 Score =   321 bits (822),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 193/453 (43%), Positives = 257/453 (57%), Gaps = 41/453 (9%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP +V F QY+GYI   + + RALFYYF EA++ D  S PL LWL GG  CSS 
Sbjct  30    IGTLPGQP-EVSFKQYAGYITIDEKQQRALFYYFVEAET-DPSSKPLVLWLNGGPGCSSI  87

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+    L+KN +SWN  +NMLY+++P GV FSY    S Y   +D MT
Sbjct  88    GAGAFCEHGPFKPS-GKILLKNDYSWNREANMLYLESPAGVGFSYCANKSFYNSVNDEMT  146

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A +NL FL +WF +F EYR+ DF+I G+SY GH  PQLA LI+E          + LKGI
Sbjct  147   AIDNLAFLERWFSKFPEYRNRDFFITGESYAGHYVPQLAQLIVESKSK------LNLKGI  200

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEF-LSGELSEYCSDI  836
             A+GNP+LE  +   S  E  W HG+IS+  Y +  ++CN + +  ++  SG LS  CS +
Sbjct  201   AIGNPLLEFDTDFNSRAEFFWSHGLISDATYEIFTRICNYSQIRRQYQTSGSLSPDCSRV  260

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHYL-ATETA---DPCLRDWVGEYINRPD  1004
                +S E+   +D  ++        S   SQ H L   E A   D C+ D   +Y+NR D
Sbjct  261   SREVSREVSKFVDTYDITL--DVCLSSIQSQSHVLNQMEYAGKIDVCVEDETVKYLNRKD  318

Query  1005  VQKALHAN---TTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDIPVLIYS  1166
             VQ+ALHA      GW            SDV+   + N  I   P L  L+ S I VLIYS
Sbjct  319   VQEALHAQLFGVNGWTV---------CSDVLKYNMQNLEISTTPLLGKLIKSGIRVLIYS  369

Query  1167  GDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLT  1346
             GDQD  IP++ TR +   LA  L L T      W+ GK++ GW+Q FG+         L+
Sbjct  370   GDQDSVIPLTGTRALVNGLAKELTLNTTVPYRAWFGGKQVAGWTQVFGDI--------LS  421

Query  1347  FATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +AT+RG SH  P S P +++ LF AFL G P P
Sbjct  422   YATIRGASHEAPFSQPERSIVLFSAFLGGVPLP  454



>gb|KDP37690.1| hypothetical protein JCGZ_06347 [Jatropha curcas]
Length=467

 Score =   321 bits (822),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 192/450 (43%), Positives = 258/450 (57%), Gaps = 35/450 (8%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V F QY+GYI   +   RALFYYF EA+     S PL LWL GG  CSS 
Sbjct  32    IVKLPGQP-EVSFKQYAGYITIDENHKRALFYYFVEAEINSA-SKPLVLWLNGGPGCSSI  89

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+ D  L+KN FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  90    GAGAFCEHGPFKPSGD-ILLKNDFSWNKEANMLYLESPAGVGFSYSANDSFYASVNDEIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A++NL FL  WF +F EY+D DF+I G+SY GH APQLA LI++ N        I LKGI
Sbjct  149   AQDNLAFLEHWFSKFPEYKDRDFFITGESYAGHYAPQLAQLIVQSNAK------INLKGI  202

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEF-LSGELSEYCSDI  836
             A+GNP+LE  +   S  E+ W HG+IS+  Y +   +CN + +  E+  SG LS  CS +
Sbjct  203   AIGNPLLEFDTDFNSRAEYFWSHGLISDATYQIFTTICNYSQIRREYEASGFLSPACSKV  262

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHYL-ATETA---DPCLRDWVGEYINRPD  1004
                +S E+   +D  ++        S   SQ H L   E A   D C+ D   +Y+NR D
Sbjct  263   NSEVSREVSKFVDTYDITL--DVCLSSVQSQAHLLNQMEYAGQIDVCVEDKTVKYLNRKD  320

Query  1005  VQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDIPVLIYSGDQ  1175
             VQ+ALHA   G    W        +DV+     N  I  +P +  L+ S I V +YSGDQ
Sbjct  321   VQEALHAQLLGVN-AWTV-----CTDVVKYNTQNLEIPTIPIIGKLVKSGIRVFVYSGDQ  374

Query  1176  DLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFAT  1355
             D  IP++ TR +   LA +L L T      W++GK++ GW+Q +G+         L+FAT
Sbjct  375   DSVIPLTGTRSLVNGLAKQLGLNTTVPYRTWFEGKQVAGWTQVYGDI--------LSFAT  426

Query  1356  VRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +RG SH  P S P ++L LF +FL+G   P
Sbjct  427   IRGASHEAPFSQPERSLVLFSSFLEGKQLP  456



>ref|XP_008240683.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=456

 Score =   320 bits (820),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 188/466 (40%), Positives = 268/466 (58%), Gaps = 31/466 (7%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             +LL+    S +     + I SLPGQP  V F QY+GY+   + + RALFYYF EA++ D 
Sbjct  9     YLLIGLSISSNSLPEADKITSLPGQPQ-VSFQQYAGYVTVDEKQQRALFYYFVEAET-DA  66

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS   G F E+GPF+P+ D  L+KN FSWN  +NMLY+++P GV 
Sbjct  67    ASKPLVLWLNGGPGCSSVGAGAFIEHGPFKPSGD-ILLKNDFSWNKEANMLYLESPAGVG  125

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYS+  S Y   +D +TA +NL FL +WF +F E+++ DF+I G+SYGGH  P+LA L+
Sbjct  126   FSYSSNQSFYDFVNDAITANDNLVFLERWFDKFPEFKNRDFFITGESYGGHYVPELARLV  185

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMSLSN--VEHLWYHGIISEEVYGMQKKVCNATT  785
             ++   N        LKGIA+GNP+L+  +  N   E+ W HG+IS+  +     VCN + 
Sbjct  186   VQSKLN------FNLKGIAIGNPLLDFNTDFNAGAEYYWSHGLISDATFESFTSVCNYSQ  239

Query  786   MIDEFL-SGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETA  956
             M+ + + +G+LS  C+ +   +  EI + +D  ++         ++ S        TE  
Sbjct  240   MLRQIINTGKLSPACAAVYNQVQTEISNFIDPHDVTLDVCLSSDAAQSRKLTQLQETEKI  299

Query  957   DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHN---FAIDILPTLS  1127
             D CL D   +Y+NR DVQ+ALHA   G     N+T     SDV+ +N     I +LP L 
Sbjct  300   DVCLEDETIKYLNRQDVQEALHAQLIGVS---NWT---ICSDVVRYNRQSMEILMLPVLG  353

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
              L  S I +L YSGDQD  IP++ TR     LA  L+L T      W++ K++ GW+Q +
Sbjct  354   YLSRSGIRILAYSGDQDSVIPLTGTRTAVDGLAEVLELNTTVPYRVWFEEKQVAGWTQVY  413

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             G+         L+FAT+RG  H VP + P ++L LF +FL G P P
Sbjct  414   GDV--------LSFATIRGAGHTVPYTQPERSLLLFSSFLGGKPLP  451



>ref|XP_007028221.1| Serine carboxypeptidase 45 [Theobroma cacao]
 gb|EOY08723.1| Serine carboxypeptidase 45 [Theobroma cacao]
Length=470

 Score =   320 bits (821),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 181/465 (39%), Positives = 260/465 (56%), Gaps = 50/465 (11%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I +LPGQP   +F Q+SGY+   + + RALFYYF EA++    S PL LWL GG  CSS 
Sbjct  29    IVALPGQPR-ANFQQFSGYLTVDEKQKRALFYYFVEAETMPA-SKPLVLWLNGGPGCSSI  86

Query  306   AIGMFYENGPFRPTEDGELV-KNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
               G   E+GPF+P  +GE + KN++SWN  +NMLY+++P GV FSYS  +S Y   +D +
Sbjct  87    GAGALTEHGPFKP--NGETMEKNKYSWNKEANMLYLESPAGVGFSYSANNSFYANLNDEV  144

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
              AR+NL FL +WF++F EY++ DFYI G+SY GH  PQLA LI+  N        + LKG
Sbjct  145   AARDNLVFLERWFVKFPEYKNRDFYITGESYAGHYVPQLAQLIIHSNLK------LNLKG  198

Query  663   IALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IA+GNP+LE  +  N   ++ W HG+IS+  Y +    CN++ ++ E +   +S  C  +
Sbjct  199   IAIGNPLLEFATDMNSVDQYYWSHGLISDSAYELLTSFCNSSRLMREVIRRSISSDCISV  258

Query  837   EIMLSEEIGHDMDKENLV--FqscesssisssqqHYL-----------------ATETAD  959
                +S E+   +D+ +++         S  +   H L                  +   D
Sbjct  259   YSEVSTELTKSIDQYDVIADVCLSSGQSPMAILSHSLLSGPQHSSQADGLSQQQVSVKED  318

Query  960   PCLRDWVGEYINRPDVQKALHAN---TTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSA  1130
             PC++D   +Y+NR DVQKALHA    TT W     F          + N     +  + +
Sbjct  319   PCIQDKTTKYLNRKDVQKALHAQLVGTTSWNLCNKFVQ-------YMDNLETPTIHIVGS  371

Query  1131  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFG  1310
             ++ S IPV++YSGDQD  IP + TR +   LA  L L T     PW++GK++GGW+Q +G
Sbjct  372   IVKSGIPVMVYSGDQDSVIPFTGTRTLVYKLAKALGLNTTVPYRPWFEGKQVGGWTQVYG  431

Query  1311  NSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +         L+FAT+RG SH  P S P ++L LFKA L G P P
Sbjct  432   DI--------LSFATIRGASHTAPASQPERSLALFKAVLAGKPLP  468



>ref|XP_009615670.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nicotiana 
tomentosiformis]
Length=464

 Score =   320 bits (819),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 185/468 (40%), Positives = 260/468 (56%), Gaps = 22/468 (5%)
 Frame = +3

Query  63    LLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQS  242
             +  FL   +L  +S   + + I  LPGQP  V F Q+SGY+     + R+LFYYF EA++
Sbjct  13    IFLFLFCVSLGIVSALPHPDKIIQLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFVEAET  71

Query  243   EDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPI  422
              +  S PL LWL GG  CSS  +G F ENGPFRP     LV+N+ SWN  +NMLY+++PI
Sbjct  72    -NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKEANMLYLESPI  129

Query  423   GVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLA  602
             GV FSYSN +S Y+  +D +TAR+NL FL +WF +F  YR  + ++ G+SY GH  PQLA
Sbjct  130   GVGFSYSNDTSSYETVNDEITARDNLVFLLRWFHKFPLYRKSNLFLTGESYAGHYVPQLA  189

Query  603   ALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCN  776
              L++  N+     +   LKG+ALGNP+LE  +   S  E+ W HG+IS+  Y M    CN
Sbjct  190   KLMMAFNKKQ---QIFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFSSACN  246

Query  777   ATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATE  950
              +  + E+  G +S  CS +  ++S E    +DK  +          S S         E
Sbjct  247   YSRYVSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISSVLSQSKIISPQENVE  306

Query  951   TADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSA  1130
               D C+ D +  Y+NR DV++ALHA   G +  W   S     D  L +  I  +  +  
Sbjct  307   KLDVCVEDEIVNYLNRKDVRRALHAELVGVRR-WAVCS--SILDYQLLDIEIPTISIIGM  363

Query  1131  LLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKE-IGGWSQTF  1307
             L+   IPVLIYSGDQD  IP+  +R     LA R++L T      W+ G++ +GGW+  +
Sbjct  364   LVKERIPVLIYSGDQDSVIPLIGSRATVHQLARRMRLNTTVPYRVWFAGQQVVGGWTHVY  423

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
              N         L+FAT+RG SH  P S P ++L LFK+FL+  P P  
Sbjct  424   DNI--------LSFATIRGASHEAPFSQPERSLVLFKSFLEDRPLPEV  463



>ref|XP_011002097.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   320 bits (819),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 185/444 (42%), Positives = 253/444 (57%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+       RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  34    IVRLPGQP-HVGFQQFSGYVTVDNNEHRALFYYFVEAEI-DPESRPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F ENGPFRP E   L++N+ SWN  +NMLY++TP+GV FSY+  SS +    D  T
Sbjct  92    GLGAFSENGPFRP-EGRVLIRNEHSWNREANMLYLETPVGVGFSYATNSSSFVAVDDEAT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WF +F +YR  D +IAG+SY GH  PQLA L++  N+     +   LKGI
Sbjct  151   ARDNLLFLQGWFHKFPQYRSTDLFIAGESYAGHYIPQLAKLMIGINKKE---KLFNLKGI  207

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+L+  +   S  E+ W HG+IS+  Y M    CN +  + E+    +S  CS + 
Sbjct  208   ALGNPVLDFATDLNSRAEYFWSHGLISDSTYKMFTSACNYSRYVSEYYRDSVSSICSIVM  267

Query  840   IMLSEEIGHDMDKENLVFqscesssisssq--qHYLATETADPCLRDWVGEYINRPDVQK  1013
               ++ E    +DK ++    C S+  S S+       +E  D C+ D    Y+NR DV++
Sbjct  268   NQVNTETSRFVDKYDVTLDVCVSTVFSQSKFISPKQVSERIDVCIEDETVNYLNRKDVRR  327

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D    N  I     + +L+ + IPVL+YSGDQD  IP+
Sbjct  328   ALHARLIGVRR-WEVCS--NILDYEFLNIEIPTFNIVGSLVKAGIPVLVYSGDQDSVIPL  384

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   +A  L L T      W+ GK++GGW+Q +GN         L+FAT+RG SH
Sbjct  385   TGSRTLVHRVAKELGLNTTVPYRVWFAGKQVGGWTQVYGNI--------LSFATIRGASH  436

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
               P S P ++L LFK+FL+G   P
Sbjct  437   EAPFSQPERSLMLFKSFLEGKHLP  460



>ref|XP_009355272.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Pyrus 
x bretschneideri]
Length=461

 Score =   319 bits (818),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 182/442 (41%), Positives = 255/442 (58%), Gaps = 29/442 (7%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LP QP  V+F QY+GY+   + + R+LFYYF EAQ+ +  S PL LWL GG  CSS  +G
Sbjct  38    LPSQP-QVNFQQYAGYVTVDEKQERSLFYYFVEAQT-NPASKPLVLWLNGGPGCSSVGVG  95

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPF+P+ D  L+KN FSWN  +N+LY+++P GV FSYS   S Y   +D +TAR+
Sbjct  96    AFNENGPFQPSGD-ILLKNDFSWNREANILYLESPAGVGFSYSANKSFYGFVNDDITARD  154

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALG  674
             N++FL++WF EF  Y++ DF+I G+SY GH  PQLA LI++            LK IA+G
Sbjct  155   NIEFLQRWFDEFPAYKNRDFFITGESYAGHYVPQLAQLIIQSKLK------FNLKAIAIG  208

Query  675   NPILEKMSLSN--VEHLWYHGIISEEVYGMQKKVCNATTMIDE--FLSGELSEYCSDIEI  842
             NP+LE  S +N   E+LW HG+IS+  +     VCN + +I +     G L+  C  +  
Sbjct  209   NPLLEFNSDNNAQAEYLWSHGLISDATFENLTSVCNNSEIIRQVRIRGGPLTPACDAVAT  268

Query  843   MLSEEI-GHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
              +  E+ G+ +D+ + V      SS+ +       T   D C+ D    Y+NRPDVQ+AL
Sbjct  269   QVESEVPGYLIDQYD-VTHDVCLSSVEAQSFQLQKTAKIDVCIADETVSYLNRPDVQEAL  327

Query  1020  HANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSH  1199
             HA  T W      T+        + N  + +LP L  L+ S I VLIYSGDQD  IP++ 
Sbjct  328   HARVTNW------TTCSNVLKYDMKNVEVPMLPVLGDLVKSGIRVLIYSGDQDSVIPLTS  381

Query  1200  TREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1379
             TR +A  LA  L L T      W   K++ GW+Q + ++        L++AT+RG  H  
Sbjct  382   TRTLANGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------LSYATIRGAGHEA  433

Query  1380  PNSSPSKALTLFKAFLKGSPPP  1445
             P S P ++L LF +FLKG P P
Sbjct  434   PISQPERSLLLFTSFLKGKPLP  455



>gb|EMS58238.1| Serine carboxypeptidase-like 45 [Triticum urartu]
Length=455

 Score =   317 bits (812),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 180/450 (40%), Positives = 255/450 (57%), Gaps = 22/450 (5%)
 Frame = +3

Query  117   GEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDC  296
             G  I  LPGQP +V F QYSGYI       RALFYYF EA+  D  + PL LWL GG  C
Sbjct  21    GGRITRLPGQP-EVSFGQYSGYIEVDGKGSRALFYYFVEAEL-DPATKPLVLWLNGGPGC  78

Query  297   SSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             SS  +G F ENGPFRP+    LV+N++SWN  +N++Y++TP GV FSYS  ++ Y+  +D
Sbjct  79    SSLGVGAFSENGPFRPSGQA-LVRNEYSWNKEANVIYLETPAGVGFSYSADAAYYQGVND  137

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
              MTA  N+ F+++W  +F +Y+  + YIAG+SY GH  PQLA +++E N+         L
Sbjct  138   NMTAMGNMVFMQRWLEKFPQYKGRELYIAGESYAGHYIPQLAEVMVEFNKKD---NIFNL  194

Query  657   KGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             KG+ALGNP+L   +   S  E+ W HG+IS+  Y +   VCN +  + E+  G LS  C+
Sbjct  195   KGLALGNPVLHFTTDFNSRAEYFWSHGLISDSTYRIFTSVCNYSRYVSEYYGGSLSPLCA  254

Query  831   DIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADPCLRDWVGEYINRP  1001
              +   ++ E    +DK ++   V  S   S       H       D C+ D    Y+NR 
Sbjct  255   RVMNQVTRETSRFVDKYDVTLDVCLSSVLSQSMILSPHKRVGHRIDVCVEDETVNYLNRK  314

Query  1002  DVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDL  1181
             DVQ+ALHA   G +   N+       +  L N  I  +  + +L+ S I VL+YSGDQD 
Sbjct  315   DVQEALHAKLIGVK---NWAVCSSVLEYELLNLQIPTIDIVGSLVKSGIRVLVYSGDQDS  371

Query  1182  RIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVR  1361
              IP++ +R +   LA  L L T      W++GK++GGW+Q +G+         L+FAT+R
Sbjct  372   VIPLTGSRTLVQNLARDLGLKTSIPYRVWFEGKQVGGWTQVYGD--------KLSFATIR  423

Query  1362  GGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             G SH  P S P ++L L +AFL+  P P T
Sbjct  424   GASHEAPFSQPERSLVLIRAFLQDRPLPET  453



>ref|XP_003630573.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AET05049.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   317 bits (813),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 188/450 (42%), Positives = 265/450 (59%), Gaps = 27/450 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  + F  +SGY+   + + R LFYYF E+++    S PL LWL GG  CSS 
Sbjct  34    IHKLPGQP-HIGFQHFSGYVTVDEKKRRYLFYYFVESETGPS-SKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTS-SDYKIWSDT  479
              +G F ENGPFRP  +GE L+KN+ SWN  +NMLY++TP+GV FSY+  S S+ K+ +D 
Sbjct  92    GVGAFSENGPFRP--NGEVLIKNEHSWNREANMLYLETPVGVGFSYAKGSFSNIKV-NDE  148

Query  480   MTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLK  659
             +TAR+NL FL  WF +F +Y+  D ++ G+SY GH  PQLA L++  N      +   LK
Sbjct  149   VTARDNLVFLLHWFNKFPQYKHTDLFLTGESYAGHYIPQLANLMIGINNKE---KIFNLK  205

Query  660   GIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSD  833
             GIALGNP+LE  +   S  E  W HG+IS+  Y M    CN +  + E+    +S  CS 
Sbjct  206   GIALGNPLLEYATDFNSRAEFFWSHGLISDSTYKMFTAGCNYSQYVSEYYRNSISLLCSK  265

Query  834   IEIMLSEEIGHDMDKENLVFqscesssisssq----qHYLATETADPCLRDWVGEYINRP  1001
             +   +S E    +DK ++    C SS +S S+    Q++ A E+ D C+ D V  Y+NR 
Sbjct  266   VMSQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQNHHANESIDVCVDDEVTNYLNRR  325

Query  1002  DVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDL  1181
             DVQKALHA   G    WN  S     D  + N  +  L  + +++ + + VLIYSGDQD 
Sbjct  326   DVQKALHAELIGVP-KWNVCS--NILDYNMLNLEVPTLHVVGSIIKAGVRVLIYSGDQDS  382

Query  1182  RIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVR  1361
              IP++ +R +   LA +L L T      W++G ++GGW+Q +GN+        LTFAT+R
Sbjct  383   VIPLTGSRTLVHKLARQLALKTTIPYRVWFEGHQVGGWTQVYGNT--------LTFATIR  434

Query  1362  GGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             G SH  P S P ++L LFK+FL+  P P +
Sbjct  435   GASHEAPFSQPERSLVLFKSFLENKPLPKS  464



>gb|KEH40983.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=417

 Score =   316 bits (809),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 190/472 (40%), Positives = 258/472 (55%), Gaps = 67/472 (14%)
 Frame = +3

Query  48    KIMVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYF  227
             ++ VF   F+ +  L  ++  +  + I  LP QP  VDF Q+SG+I   +   RALFYYF
Sbjct  7     ELCVFSTIFMFI--LGGVNSTLESDKITRLPDQPK-VDFQQFSGHITIDETHQRALFYYF  63

Query  228   AEAQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLY  407
              EA+  D  S P+ LWL GG  CSS   G F E+GPF+PT  G LVKN FSWN  +NM+Y
Sbjct  64    VEAEV-DPASKPVVLWLNGGPGCSSVGQGSFSEHGPFKPTRKG-LVKNSFSWNKVANMIY  121

Query  408   VDTPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHL  587
             +D+PIGV FSYS   SDY + +D +TAR+NL FL+ WF  F  +R  DF+I G+SY GH 
Sbjct  122   LDSPIGVGFSYSANKSDYFLVNDQITARDNLLFLQGWFSRFPMHRSSDFFITGESYAGHF  181

Query  588   APQLAALILEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQ  761
             APQLA LI++ N N      I+LKGIA+GNP+LE  +   S  E LW HG I +  Y M 
Sbjct  182   APQLAELIIQTNAN------IRLKGIAIGNPLLEFNTDFSSGAEFLWSHGQIQDSTYQML  235

Query  762   KKVCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYL  941
             K VC+   +  +  +G+LS  C               DK+                    
Sbjct  236   KTVCSVAEIRRQSRTGKLSNAC---------------DKQ--------------------  260

Query  942   ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPT  1121
             A E  D C+      Y+NR +VQKALH    G    W+       + V++++F     PT
Sbjct  261   AVEKIDVCIGHETVAYLNRKEVQKALHTQLVG---NWS-----TCTSVMVYDFQNLENPT  312

Query  1122  LS---ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGG  1292
             +S    L+ S + VL YSGDQD  IP++ TR + T LA  L L T     PW+ G+++ G
Sbjct  313   ISMLGKLVKSGVRVLAYSGDQDSVIPLTGTRSLVTGLAKELGLNTTGAYRPWFMGRQVAG  372

Query  1293  WSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
              +Q +G+         L+FAT+RG  H  P + P ++L LFKAFL+G   P 
Sbjct  373   STQVYGDI--------LSFATIRGAGHAAPFTQPGRSLVLFKAFLEGKQLPK  416



>ref|XP_004238587.1| PREDICTED: putative serine carboxypeptidase-like 23 [Solanum 
lycopersicum]
Length=483

 Score =   318 bits (814),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 180/443 (41%), Positives = 243/443 (55%), Gaps = 31/443 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I+ LPG+P DVDFNQYSGY+      GRALFYYF E+ +    S PL LWL GG  CSS 
Sbjct  67    IEKLPGEPEDVDFNQYSGYVTVDSSAGRALFYYFTESPTHSA-SKPLVLWLNGGPGCSSL  125

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E GPFR  +DG L +NQFSW   +N++++++P GV FSY+NTSSD+    D  T
Sbjct  126   GGGAFGELGPFRVNKDGTLQRNQFSWISEANIIFLESPAGVGFSYTNTSSDFNFSGDRTT  185

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAH-LRPIKLKG  662
             A ++  FL  W   F EY+  DFY+ G+SY GH  PQLA LIL  N N    +  I LKG
Sbjct  186   AHDSYTFLVNWLERFPEYKPNDFYLIGESYAGHYIPQLAQLILLHNSNSDETISTINLKG  245

Query  663   IALGNPIL--EKMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IA+GN  +  E       E+ W H +ISEE+Y      CN +T         +S+ C+  
Sbjct  246   IAIGNAYVDFEANMKGTTEYYWSHALISEELYNKIILTCNFST------PSSVSKKCNAY  299

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKA  1016
                + EEIG      N+   +  +   ++      +T   DPCL  ++  Y N P+VQKA
Sbjct  300   LDQIDEEIG------NIFIYNVYAPLCTNRSPSSTSTSDVDPCLPSYIQSYFNIPEVQKA  353

Query  1017  LHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVS  1196
             +HAN T   YPW   S   T ++   +  + +LP L  L+ S + + +YSGD D+ +PV+
Sbjct  354   MHANVTNLPYPWE--SCNNTLNLNWKDRPLSVLPLLHQLMKSGLRIWLYSGDMDVVVPVT  411

Query  1197  HTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1376
              TR     L + +K +      PWY   E+GG+          E+  NLTF T+RG  HF
Sbjct  412   DTRYAIKKLNLSVKTSWY----PWYLQGEVGGYV---------EEYENLTFVTIRGAGHF  458

Query  1377  VPNSSPSKALTLFKAFLKGSPPP  1445
             VP   P++AL  F  FL G PPP
Sbjct  459   VPTYQPNRALAFFSQFLSGKPPP  481



>ref|XP_011042948.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   315 bits (808),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 188/447 (42%), Positives = 254/447 (57%), Gaps = 23/447 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V F Q+SGY+     + RALFYYF EA+  D  S PL LWL GG  CSS 
Sbjct  34    IAGLPGQP-HVGFQQFSGYVTVDGNKHRALFYYFVEAEI-DPASKPLVLWLNGGPGCSSL  91

Query  306   AIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTM  482
              +G F ENGPFRP  +G  L++N+ SWN  +NMLY++TP+GV FSY+  +S Y    D  
Sbjct  92    GVGAFSENGPFRP--NGRILIRNEHSWNREANMLYLETPVGVGFSYATDNSSYVAVDDEA  149

Query  483   TARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
             TAR+NL FL+ WF +F +YR+ D +I G+SY GH  PQLA L++E N+    +    LKG
Sbjct  150   TARDNLVFLQGWFHKFPQYRNKDLFITGESYAGHYIPQLAKLMVEINKKKKLV---NLKG  206

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IALGNP+LE  +   S  E+ W HG+IS+  Y M    CN +  + E+    +S  CS +
Sbjct  207   IALGNPVLEFATDLNSRAEYFWSHGLISDSTYKMFTSACNYSRYVSEYYRDSVSSVCSLV  266

Query  837   EIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                +S E    +DK ++    C     S S        +E  D C+ D    Y+NR DV+
Sbjct  267   MKQVSTETSRFVDKYDVTLDVCIPSVLSQSKVISPKQVSERIDVCIEDETVNYLNREDVR  326

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             KA HA   G +  W   S     D  + N  I  +  + +L+ + IPVLIYSGDQD  IP
Sbjct  327   KAFHARLIGVRR-WEVCS--NILDYEVLNIEIPTINIVGSLIKAGIPVLIYSGDQDSVIP  383

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ +R +   LA  L L T      W+ GK++GGW+Q +GN         L+FAT+RG S
Sbjct  384   LTGSRTLVHRLAKELGLNTTVPYRAWFAGKQVGGWTQVYGNI--------LSFATIRGAS  435

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             H  P S P ++L LFK+FL+G   P  
Sbjct  436   HEAPFSQPERSLMLFKSFLQGKHLPEV  462



>ref|XP_008443351.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=472

 Score =   316 bits (809),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 188/490 (38%), Positives = 271/490 (55%), Gaps = 49/490 (10%)
 Frame = +3

Query  66    LWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSE  245
             +  L+   ++       G++I SLPGQP  V+F QY GYI   + + R+LFYYF EAQS 
Sbjct  1     MLLLMQKIMFRFGECFEGDLIKSLPGQPI-VNFKQYGGYITIDELQSRSLFYYFVEAQS-  58

Query  246   DKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIG  425
             D  S PL LWL GG  CSS   G F ENGPFRP +   L+ N+FSWN  +N+LY+++P G
Sbjct  59    DPSSKPLVLWLNGGPGCSSLGAGAFVENGPFRP-KGNVLILNEFSWNNVANVLYLESPAG  117

Query  426   VAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAA  605
             V FS+S  ++ Y   +D +TA++N+ FL +W  +F EY++ +FYI G+SY GH  PQLA 
Sbjct  118   VGFSFSKNTTFYDTVNDKITAQDNIVFLERWLEKFPEYKNKEFYITGESYAGHYVPQLAR  177

Query  606   LILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVCNA  779
             LI++   N      IKLK IA+GNP+LE  +  N   ++LW HG+ISE  + +   VC+ 
Sbjct  178   LIVQSKLN------IKLKAIAIGNPLLEFNTDFNSRGKYLWSHGVISESTFELLNSVCSI  231

Query  780   TTMIDEFLSGELSEYCSDIEIMLSEE---------IGHDMDKENLVFqscesssisssqq  932
             + MI E ++GE+S+ C  I  ++S+E         I  D+       Q+  SS  S +  
Sbjct  232   SQMIRESINGEISDACFSINDLVSQEMSPFINGYAINLDVCSSGDPTQTALSSLHSLTFT  291

Query  933   HYLATETADP--------------------CLRDWVGEYINRPDVQKALHANTTGWQYPW  1052
               L  + ++P                    C+ + +  Y+NR DVQ+ALHA   G    W
Sbjct  292   KRLGDDQSNPKPTSSTPLPQFSGDAGKVDVCIVNEIEAYLNRVDVQQALHAQLVGVS-SW  350

Query  1053  NFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVR  1232
             +  S     D    N  I  +  + +L+ S I VL+YSGDQD  IP+  TR +   LA  
Sbjct  351   SLCS--DILDYDRTNLFIPTINIMGSLVHSGIRVLVYSGDQDSVIPLLGTRTLVNKLAKA  408

Query  1233  LKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTL  1412
             ++L T      W+   ++GGW +TFG         NL+FAT+RG +H  P +SP+ +L L
Sbjct  409   MRLNTTLPYSAWFHNHQVGGWVETFGEKN------NLSFATIRGAAHQAPYTSPATSLAL  462

Query  1413  FKAFLKGSPP  1442
             F AFL+   P
Sbjct  463   FTAFLQAKNP  472



>ref|XP_008378883.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score =   315 bits (807),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 177/441 (40%), Positives = 247/441 (56%), Gaps = 25/441 (6%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LPGQP  V+F QY+GY+   + + R+LFYYF EAQ+ +  S PL LWL GG  CSS  +G
Sbjct  37    LPGQPQ-VNFQQYAGYVTVDEKQERSLFYYFVEAQT-NPASKPLVLWLNGGPGCSSVGVG  94

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPF+P+ D  L+KN FSWN  +NMLY+++P GV FSYS   S Y   +D +TAR+
Sbjct  95    AFNENGPFQPSXD-ILLKNDFSWNRZANMLYLESPAGVGFSYSANKSFYGYMNDDITARD  153

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALG  674
             N++FL++WF +F EY++ DF+I G+SY GH  PQLA LI++            LK IA+G
Sbjct  154   NIEFLQRWFDKFPEYKNRDFFITGESYAGHYVPQLAQLIIQSKLK------FNLKAIAIG  207

Query  675   NPILEKMSLSN--VEHLWYHGIISEEVYGMQKKVCNATTMIDE--FLSGELSEYCSDIEI  842
             NP+LE  S  N   E+ W HG+I +  +     VCN + ++ +     G LS  C  +  
Sbjct  208   NPLLEFNSDKNAQAEYWWSHGLIXDATFEXXTSVCNFSEIVRQIDIRGGPLSPACDAVAN  267

Query  843   MLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKALH  1022
                 E+   +  +  V ++   SS+ +       TE  D C+ D    Y+NRPDVQ+ LH
Sbjct  268   QFESEVPDHVINQYDVTRNVCLSSVKAQSFQLRKTEKIDVCIGDETVTYLNRPDVQEVLH  327

Query  1023  ANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHT  1202
             A  T     W   S        + N    +LP L  L+ S I VLIYSGDQD  IP+  T
Sbjct  328   ARVTN----WTTCSNRVVIQYDMKNLETPMLPVLGDLVKSGIRVLIYSGDQDSAIPLXST  383

Query  1203  REVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVP  1382
             R +   LA  L L T      W   K++ GW+Q + ++        L++AT+RG  H  P
Sbjct  384   RTLVNGLAKDLGLQTNVPYSVWVQEKQVAGWTQVYSDA--------LSYATIRGAGHEAP  435

Query  1383  NSSPSKALTLFKAFLKGSPPP  1445
              S P ++L +F +FL+G P P
Sbjct  436   ISQPERSLLMFASFLRGKPLP  456



>ref|XP_009355270.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Pyrus 
x bretschneideri]
Length=480

 Score =   315 bits (808),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 185/455 (41%), Positives = 257/455 (56%), Gaps = 36/455 (8%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LP QP  V+F QY+GY+   + + R+LFYYF EAQ+ +  S PL LWL GG  CSS  +G
Sbjct  38    LPSQP-QVNFQQYAGYVTVDEKQERSLFYYFVEAQT-NPASKPLVLWLNGGPGCSSVGVG  95

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPF+P+ D  L+KN FSWN  +N+LY+++P GV FSYS   S Y   +D +TAR+
Sbjct  96    AFNENGPFQPSGD-ILLKNDFSWNREANILYLESPAGVGFSYSANKSFYGFVNDDITARD  154

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALG  674
             N++FL++WF EF  Y++ DF+I G+SY GH  PQLA LI++            LK IA+G
Sbjct  155   NIEFLQRWFDEFPAYKNRDFFITGESYAGHYVPQLAQLIIQSKLK------FNLKAIAIG  208

Query  675   NPILEKMSLSN--VEHLWYHGIISEEVYGMQKKVCNATTMIDE--FLSGELSEYCSDIEI  842
             NP+LE  S +N   E+LW HG+IS+  +     VCN + +I +     G L+  C  +  
Sbjct  209   NPLLEFNSDNNAQAEYLWSHGLISDATFENLTSVCNNSEIIRQVRIRGGPLTPACDAVAT  268

Query  843   MLSEEI-GHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
              +  E+ G+ +D+ + V      SS+ +       T   D C+ D    Y+NRPDVQ+AL
Sbjct  269   QVESEVPGYLIDQYD-VTHDVCLSSVEAQSFQLQKTAKIDVCIADETVSYLNRPDVQEAL  327

Query  1020  HANTTGWQYPWN----FTS---------PGKTSDVILHNFAIDILPTLSALLMSDIPVLI  1160
             HA  T W    N    FT           G      + N  + +LP L  L+ S I VLI
Sbjct  328   HARVTNWTTCSNKSFLFTVLLNLIILFYIGSVLKYDMKNVEVPMLPVLGDLVKSGIRVLI  387

Query  1161  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVAN  1340
             YSGDQD  IP++ TR +A  LA  L L T      W   K++ GW+Q + ++        
Sbjct  388   YSGDQDSVIPLTSTRTLANGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------  439

Query  1341  LTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             L++AT+RG  H  P S P ++L LF +FLKG P P
Sbjct  440   LSYATIRGAGHEAPISQPERSLLLFTSFLKGKPLP  474



>ref|XP_007203526.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
 gb|EMJ04725.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
Length=461

 Score =   315 bits (806),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 185/466 (40%), Positives = 264/466 (57%), Gaps = 37/466 (8%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             FL+ N+L         + I SLPGQP  V F QY+GY+   + + RALFYYF EA++ D 
Sbjct  20    FLIANSL------PEADKITSLPGQP-QVSFQQYAGYVTVDEKQQRALFYYFVEAET-DA  71

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS   G F E+GPF+P+ D  L+KN FSWN  +NMLY+++P GV 
Sbjct  72    ASKPLVLWLNGGPGCSSVGAGAFIEHGPFKPSGD-ILLKNDFSWNKEANMLYLESPAGVG  130

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
             FSYS+  S Y   +D +TA +N  FL +WF +F E+++ DF+I G+SYGGH  P+LA L+
Sbjct  131   FSYSSNQSFYDFVNDAITANDNFVFLERWFDKFPEFKNRDFFITGESYGGHYVPELARLV  190

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATT  785
             ++   N        LKGIA+GNP+L+  +   S  E+ W HG+IS+  +     VCN + 
Sbjct  191   VQSKLN------FNLKGIAIGNPLLDFNTDFNSGAEYYWSHGLISDATFESFTSVCNYSQ  244

Query  786   MIDEFL-SGELSEYCSDIEIMLSEEIGH--DMDKENLVFqscesssisssqqHYLATETA  956
             M+ + + +G+LS  C+ +   +  EI +  D+    L       ++ S        TE  
Sbjct  245   MLRQIINTGKLSPACAAVYNQVQTEISNFIDLYDVTLNVCLSSDAAQSRKLTQLQETEKI  304

Query  957   DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHN---FAIDILPTLS  1127
             D CL D   +Y+NR DVQ+ALHA   G     N+T     SDV+ +N     I +LP L 
Sbjct  305   DVCLEDETSKYLNRQDVQEALHARLIGVS---NWT---ICSDVVRYNRQSMEILMLPVLG  358

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
              L    I + +YSGDQD  IP++ TR     LA  L+L T      W++ K++ GW+Q +
Sbjct  359   YLSRFGIRIFVYSGDQDSVIPLTGTRTAVDGLAEVLELNTTVPYRVWFEEKQVAGWTQVY  418

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             G+         L+FAT+RG  H  P + P ++L LF +F+ G P P
Sbjct  419   GDV--------LSFATIRGAGHTAPYTQPERSLLLFSSFVGGKPLP  456



>ref|XP_009355271.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Pyrus 
x bretschneideri]
Length=478

 Score =   315 bits (807),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 185/455 (41%), Positives = 257/455 (56%), Gaps = 36/455 (8%)
 Frame = +3

Query  135   LPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSAAIG  314
             LP QP  V+F QY+GY+   + + R+LFYYF EAQ+ +  S PL LWL GG  CSS  +G
Sbjct  36    LPSQP-QVNFQQYAGYVTVDEKQERSLFYYFVEAQT-NPASKPLVLWLNGGPGCSSVGVG  93

Query  315   MFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTARE  494
              F ENGPF+P+ D  L+KN FSWN  +N+LY+++P GV FSYS   S Y   +D +TAR+
Sbjct  94    AFNENGPFQPSGD-ILLKNDFSWNREANILYLESPAGVGFSYSANKSFYGFVNDDITARD  152

Query  495   NLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALG  674
             N++FL++WF EF  Y++ DF+I G+SY GH  PQLA LI++            LK IA+G
Sbjct  153   NIEFLQRWFDEFPAYKNRDFFITGESYAGHYVPQLAQLIIQSKLK------FNLKAIAIG  206

Query  675   NPILEKMSLSN--VEHLWYHGIISEEVYGMQKKVCNATTMIDE--FLSGELSEYCSDIEI  842
             NP+LE  S +N   E+LW HG+IS+  +     VCN + +I +     G L+  C  +  
Sbjct  207   NPLLEFNSDNNAQAEYLWSHGLISDATFENLTSVCNNSEIIRQVRIRGGPLTPACDAVAT  266

Query  843   MLSEEI-GHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
              +  E+ G+ +D+ + V      SS+ +       T   D C+ D    Y+NRPDVQ+AL
Sbjct  267   QVESEVPGYLIDQYD-VTHDVCLSSVEAQSFQLQKTAKIDVCIADETVSYLNRPDVQEAL  325

Query  1020  HANTTGWQYPWN----FTS---------PGKTSDVILHNFAIDILPTLSALLMSDIPVLI  1160
             HA  T W    N    FT           G      + N  + +LP L  L+ S I VLI
Sbjct  326   HARVTNWTTCSNKSFLFTVLLNLIILFYIGSVLKYDMKNVEVPMLPVLGDLVKSGIRVLI  385

Query  1161  YSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVAN  1340
             YSGDQD  IP++ TR +A  LA  L L T      W   K++ GW+Q + ++        
Sbjct  386   YSGDQDSVIPLTSTRTLANGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------  437

Query  1341  LTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             L++AT+RG  H  P S P ++L LF +FLKG P P
Sbjct  438   LSYATIRGAGHEAPISQPERSLLLFTSFLKGKPLP  472



>emb|CBI32802.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   324 bits (830),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 182/442 (41%), Positives = 259/442 (59%), Gaps = 29/442 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q+SGYI   + + R+ FYYF EA+++     PL +W  GG  CSS 
Sbjct  368   ISSLPGQPR-VSFQQFSGYITIDEKQDRSFFYYFVEAENDTTALKPLVVWFSGGPGCSSV  426

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
                   ++GPFRP+ D  L+ N++SWN  +NMLY ++P G  FSYS  +S Y   +D +T
Sbjct  427   GA----QHGPFRPSGD-ILLTNKYSWNREANMLYPESPAGTGFSYSANTSFYTNLNDEIT  481

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FL+ WFI+F +Y++ + +IAG+SY GH  PQLA LILE +          LKGI
Sbjct  482   ARDNLVFLKNWFIKFPQYKNSELFIAGESYAGHFVPQLAQLILESSVK------FNLKGI  535

Query  666   ALGNPILE-KMSLSNVEHL-WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
              +GNP+++   + ++V H  W HG+IS+  Y +    CN + M  E  SG LS  C  + 
Sbjct  536   LMGNPLMDFDTNYNSVPHFYWSHGLISDSTYNLFSSKCNYSRMNREQTSGSLSPACLAVR  595

Query  840   IMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKAL  1019
                S+E+G  +D+    F    +S + S       TE  D C+ D V +Y NR DVQK+L
Sbjct  596   SQYSQEVGDSVDR----FDVTLNSCLPSVDPQPQVTENVDVCIGDEVNKYFNREDVQKSL  651

Query  1020  HANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSH  1199
             HA   G    W+  S     ++   +  I ++P + +L+ S I   +YSGDQD  IP+  
Sbjct  652   HARLVGVA-NWSMCSGALRYNI--KDKEITMIPVMGSLVKSGIRTFVYSGDQDSVIPLFG  708

Query  1200  TREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFV  1379
             TR +   LA +L+L T      W++G+++GGW+Q +G+         L+FATVRGGSH V
Sbjct  709   TRTLVDGLAKKLRLNTTVPYRNWFEGEQVGGWTQVYGDI--------LSFATVRGGSHTV  760

Query  1380  PNSSPSKALTLFKAFLKGSPPP  1445
             P + P++AL LF AFLKG PPP
Sbjct  761   PGTQPARALVLFTAFLKGQPPP  782


 Score =   206 bits (524),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 112/278 (40%), Positives = 160/278 (58%), Gaps = 12/278 (4%)
 Frame = +3

Query  54   MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
            MV L    +    +++      + + SLPGQP  V F Q+ GY+   + +GRALFYYF E
Sbjct  8    MVVLATLCVAPLCFAMEPVSESDKLGSLPGQP-HVSFQQFGGYVTIDEKQGRALFYYFVE  66

Query  234  AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
            A ++   S PL LWL GG  CSS   G F E+GPFRP     L++N+ SWN  +NMLYV+
Sbjct  67   AVTDPTASKPLVLWLTGGPGCSSLGGGAFMEHGPFRP-RGNTLLRNKHSWNREANMLYVE  125

Query  414  TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
            +P GV FSYS   S Y   +D +TAR+NL FL  WF++F +YR+ + +I G+SY GH  P
Sbjct  126  SPAGVGFSYSRNKSFYDDINDEVTARDNLAFLEGWFMKFPKYRNRELFITGESYAGHYVP  185

Query  594  QLAALILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNVE--HLWYHGIISEEVYGMQKK  767
            QLA L++   +N        LKGI +GNP+LE  +  N +    W HG+IS+  + +   
Sbjct  186  QLAQLVINSGKN------FNLKGILIGNPLLEFDTDMNAQGDFFWSHGLISDSTHALLTS  239

Query  768  VCNATTMIDEF--LSGELSEYCSDIEIMLSEEIGHDMD  875
             CN + ++     +S  LS  C ++    + EIG  +D
Sbjct  240  TCNYSQIMRWVYNISESLSPECYEVYNKSAGEIGGSVD  277



>ref|XP_006576775.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=426

 Score =   313 bits (802),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 181/471 (38%), Positives = 252/471 (54%), Gaps = 62/471 (13%)
 Frame = +3

Query  54    MVFLLWFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAE  233
             M+  L  +L  TL  ++     + I +LPGQP  V F QYSGYI       RALFYYF E
Sbjct  10    MIVTLIIVLAQTLVVVNSLPEADKITNLPGQP-HVKFQQYSGYITVDDQNQRALFYYFVE  68

Query  234   AQSEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVD  413
             A+     S P+ LWL GG  CSS  +G   E+GPF+P ++  LVKN +SWN  +N+LY++
Sbjct  69    AEKHPT-SKPVVLWLNGGPGCSSIGVGALVEHGPFKPGDNNVLVKNHYSWNKVANVLYLE  127

Query  414   TPIGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAP  593
             +P GV FSYS+ +S Y + +D +TAR+NL FL++WF EF EY   DF+I G+SY GH AP
Sbjct  128   SPAGVGFSYSSNTSFYTLVTDEITARDNLIFLQRWFTEFPEYSKNDFFITGESYAGHYAP  187

Query  594   QLAALILEDNRNPAHLRPIKLKGIALGNPILE-KMSL-SNVEHLWYHGIISEEVYGMQKK  767
             QLA LI++   N        LKG+A+GNP++E    L S  E  W HG+IS+  Y +  +
Sbjct  188   QLAQLIVQTKTN------FNLKGVAIGNPLMEFDTDLNSKAEFFWSHGLISDSTYDLFTR  241

Query  768   VCNATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscesssisssqqHYLAT  947
             VCN +T+  + +      Y           + + M +                      T
Sbjct  242   VCNYSTIRRQTIQANQQAY-----------VLNQMQE----------------------T  268

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILH----NFAIDIL  1115
             +  D C+ D    Y+NR DVQKALHA            S       +LH    N  I  +
Sbjct  269   QKIDVCVDDKAVTYLNRKDVQKALHAKLVE-------VSKWSACSRVLHYDRRNLEIPTV  321

Query  1116  PTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGW  1295
               L +L+ S+I VL+YSGDQD  IP+  +R +   LA  L L T      W++ K++ GW
Sbjct  322   SILGSLVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLNTTVAYRAWFERKQVAGW  381

Query  1296  SQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPN  1448
             +Q +G          L++AT+RG SH  P + P ++L L KAFL+G P PN
Sbjct  382   TQVYGEL--------LSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLPN  424



>ref|XP_010271869.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=465

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 185/444 (42%), Positives = 257/444 (58%), Gaps = 21/444 (5%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I+ LPGQP DV+F Q+SGYI   + + RALFYYF EA++ D  S PL LWL GG  CSS 
Sbjct  36    INKLPGQP-DVNFQQFSGYITVDESQQRALFYYFVEAET-DPASKPLVLWLNGGPGCSSV  93

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F E+GPF+P+ D  LV+N +SWN  +NMLY++TP GV FSYS  SS Y   +D MT
Sbjct  94    GVGAFSEHGPFKPSGD-ILVRNDYSWNREANMLYLETPAGVGFSYSTNSSYYSNVNDEMT  152

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A +NL FL++WFI+F +YRD D +I G+SY GH  PQLA L+++ N      +   LKGI
Sbjct  153   AMDNLIFLQRWFIKFPQYRDRDLFITGESYAGHYVPQLALLMIQFNEKE---KLFNLKGI  209

Query  666   ALGNPILEKMSLSN--VEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +  N   E +W HG+IS+  YG+    CN +    E   G +S  C  + 
Sbjct  210   ALGNPLLEFATDFNARAEFMWSHGLISDPTYGIFTSSCNYSQYKSESYRGSVSPICLGVI  269

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
               + +EI   +D+ ++            + S       E  D C+ D    Y+NR DVQK
Sbjct  270   SQVEKEISKYVDQYDVTLDICLSSIVQQTKSLTRPQIVENIDVCVGDETFAYLNRADVQK  329

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G +  W   S     D++  N  +  +  + +++ S + VL+YSGDQD  IP+
Sbjct  330   ALHARLLGVK-GWEVCSEVLNYDML--NLEVPTIHVVGSVIRSGVRVLVYSGDQDSVIPL  386

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
             + +R +   LA  L L T      W+  K++GGW+Q + +         L+FAT+RG SH
Sbjct  387   TGSRMLVHRLANELGLNTTIAYRVWFQDKQVGGWTQVYSDI--------LSFATIRGASH  438

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
               P S P ++L LFKAFL+  P P
Sbjct  439   EAPFSQPERSLLLFKAFLEDKPLP  462



>ref|XP_009355269.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 183/445 (41%), Positives = 252/445 (57%), Gaps = 28/445 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F QY+GY+   + +GR+LFYYF EAQ+ D  S PL LWL GG  CSS 
Sbjct  35    ITRLPGQPQ-VNFQQYAGYVTVDEKQGRSLFYYFVEAQT-DPASKPLVLWLNGGPGCSSV  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F  +GPF+P+ D  L+KN FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  93    G-GAFIAHGPFQPSGD-ILLKNDFSWNREANMLYLESPAGVGFSYSANKSFYGFVNDDIT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL+FLR+WF EF EY++ D +I G SY GH  PQLA LI++            LK +
Sbjct  151   ARDNLEFLRRWFHEFPEYKNRDLFITGQSYAGHYVPQLAQLIIQSKLK------FNLKAV  204

Query  666   ALGNPILEKMSLSN--VEHLWYHGIISEEVYGMQKKVCNATTMIDE--FLSGELSEYCSD  833
             A+GNP+LE  + +N   E+ W HG+IS+  +     VCN + +  +     G LS  C  
Sbjct  205   AIGNPLLEFNTDANSPAEYWWSHGLISDATFANLTSVCNYSEIFRQEVIRGGPLSPACDA  264

Query  834   IEIMLSEEI-GHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
             +      E+ GH ++  ++       SS+ +       T   D C+ D +  Y+NRPDVQ
Sbjct  265   VANQFEREVPGHLINPYDVTL-DVCLSSVEAQSFQLRKTVKIDVCIGDEIVTYLNRPDVQ  323

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             +ALHA  T     W   S G   +  + +  I +LP L  L+ S I VLIYSGDQD  IP
Sbjct  324   EALHARVTN----WTICSNGGVLEYDMKDHEILMLPVLGDLVKSGIRVLIYSGDQDSIIP  379

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             +  TR +   LA  L L T      W   K++ GW+Q +G++        L++AT+RG  
Sbjct  380   LVSTRTLVNGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYGDT--------LSYATIRGAG  431

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LF +FL+G P P
Sbjct  432   HEAPISQPERSLLLFTSFLRGKPLP  456



>ref|XP_006354958.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=496

 Score =   315 bits (806),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 177/442 (40%), Positives = 243/442 (55%), Gaps = 31/442 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I+ LPG+P  VDFNQYSGY+      GRALFYYF E+ S D  S PL LWL GG  CSS 
Sbjct  80    IEKLPGEPEGVDFNQYSGYVTVDSSAGRALFYYFVESPS-DSASKPLVLWLNGGPGCSSL  138

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E GPFR  +DG L +NQFSW   +N++++++P GV FSY+NTSSD+    D  T
Sbjct  139   GGGAFGELGPFRVNKDGTLQRNQFSWISEANIIFLESPAGVGFSYTNTSSDFNFSGDRTT  198

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAH-LRPIKLKG  662
             AR++  FL  W   F EY+  DFY+ G+SY GH  PQLA LIL+ N N    +  I LKG
Sbjct  199   ARDSYTFLVNWLERFPEYKANDFYLIGESYAGHYVPQLAQLILQHNNNSNKTISTINLKG  258

Query  663   IALGNPIL--EKMSLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IA+GN  +  E       E+ W H +ISEE+Y      CN ++         +S+ C+  
Sbjct  259   IAIGNAYVDFEANMKGTTEYYWSHALISEELYNKIISTCNFSS------PSSVSKKCNAY  312

Query  837   EIMLSEEIGHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKA  1016
                + EE G      N+   +  +   ++      +    DPCL +++  Y N P+VQKA
Sbjct  313   LDQIDEETG------NIFIYNVYAPLCNNGSPSSTSISDVDPCLPNYIQSYFNIPEVQKA  366

Query  1017  LHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVS  1196
             +HAN T   YPW   S   T ++   +  + +LP L  L+ S++ + +YSGD D+ +PV+
Sbjct  367   MHANVTNLPYPWE--SCNNTLNLNWKDRPLSVLPLLHQLMKSELRIWLYSGDMDVVVPVT  424

Query  1197  HTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHF  1376
              TR     L + +K +      PWY   E+GG+          E+  NLT  T+RG  HF
Sbjct  425   DTRYAIKKLNLSVKTSWY----PWYLQGEVGGYV---------EEYENLTLVTIRGAGHF  471

Query  1377  VPNSSPSKALTLFKAFLKGSPP  1442
             VP   P++AL  F  FL G PP
Sbjct  472   VPTYQPNRALAFFSHFLSGKPP  493



>ref|XP_010673054.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=467

 Score =   313 bits (803),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 184/464 (40%), Positives = 260/464 (56%), Gaps = 25/464 (5%)
 Frame = +3

Query  75    LLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKF  254
             LL N L           I SLPGQP  V+F Q++GYI   + + R LFYYF EA++    
Sbjct  19    LLCNNLAEEFPSSEAHKITSLPGQP-HVNFQQFAGYITVDETQKRYLFYYFVEAETNPS-  76

Query  255   SMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAF  434
             S PL LWL GG  CSS   G F E+GPF P+ +  LVKN +SWN  +NMLY+++P GV F
Sbjct  77    SKPLVLWLNGGPGCSSIGAGAFSEHGPFHPSGN-VLVKNDYSWNKEANMLYLESPAGVGF  135

Query  435   SYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALIL  614
             SYS  +S Y   +D +TA++NL FL+ W   F EY++ DF+I G+SYGGH  PQLA LIL
Sbjct  136   SYSVNTSFYDGVNDEITAKDNLVFLQNWLEIFPEYKNRDFFITGESYGGHYVPQLANLIL  195

Query  615   EDNRNPAHLRPIKLKGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVCNATTM  788
             + +          LKGIALGNP+LE  +  N   E+LW HG+IS+  Y + +KVCN + +
Sbjct  196   KSSLKS------NLKGIALGNPLLEFNTDFNSRPEYLWSHGLISDATYELSQKVCNFSQI  249

Query  789   IDEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETAD  959
               +   G LS  C+ +   +S EIG  +D  ++   V     +        + +  +  D
Sbjct  250   RRQAQKGFLSPSCALVNSHMSSEIGKFIDSYDVTLDVCYHSIAKQAHVLDLNQMDEQQID  309

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
              CL D   +YINR DVQK ++A   G    W+  S     +  + +  +  LP L     
Sbjct  310   VCLDDETTQYINRKDVQKVMNAQLVGVT-QWSMCS--GVVNYHMDDLEVPTLPLLGTFAK  366

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             S + VL+YSGDQD  +P++ +R +   LA  L L T      W   K++GGW+Q +G+  
Sbjct  367   SGVRVLVYSGDQDSVLPLTGSRMLVDSLAKELGLKTTVSYRTWLSDKQVGGWTQVYGDI-  425

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
                    L +AT+RG +H  P S P+++L LF++FL GSP P+ 
Sbjct  426   -------LAYATIRGAAHEAPFSQPARSLVLFRSFLNGSPLPDV  462



>ref|XP_009355267.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Pyrus 
x bretschneideri]
Length=462

 Score =   313 bits (802),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 182/445 (41%), Positives = 250/445 (56%), Gaps = 28/445 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F QY+GY+   + +GR+LFYYF EAQ+ D  S PL LWL GG  CSS 
Sbjct  35    ITRLPGQP-QVNFQQYAGYVTVDEKQGRSLFYYFVEAQT-DPASKPLVLWLNGGPGCSSV  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+ D  L+K  FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  93    G-GAFIEHGPFQPSGD-ILLKKDFSWNREANMLYLESPAGVGFSYSANKSFYGFVNDDIT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL+FL++WF EF EY++ D +I G SY GH  PQLA LI++            LK +
Sbjct  151   ARDNLEFLQRWFDEFPEYKNRDLFITGVSYAGHYVPQLAQLIIQSKLK------FNLKAV  204

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMI--DEFLSGELSEYCSD  833
             A+GNP+LE  +   S  E+ W HG+IS+  +     VCN + +   +    G L+  C  
Sbjct  205   AIGNPLLEFNTDINSRAEYWWSHGLISDATFANLTSVCNYSEIFRQERIRGGPLTPACDA  264

Query  834   IEIMLSEEI-GHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
             +      E+ GH +++ ++       SS+ +       T   D CL D +  Y+NRPDVQ
Sbjct  265   VANQFEREVPGHLINRYDVTL-DVCLSSVEAQSFQLRKTVKIDVCLVDEIVSYLNRPDVQ  323

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             +ALHA  T     W F S        L N    +LP L  L+ S I VLIYSGDQD  IP
Sbjct  324   EALHARITN----WTFCSNRAVIQYDLKNLETPMLPVLGELVKSGIRVLIYSGDQDSIIP  379

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ TR +   LA  L L T      W   K++ GW+Q + ++        L++AT+RG  
Sbjct  380   LTSTRTLVNGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------LSYATIRGAG  431

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LF +FL+G P P
Sbjct  432   HEAPISQPERSLLLFASFLRGKPLP  456



>ref|XP_010055744.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Eucalyptus 
grandis]
Length=477

 Score =   313 bits (802),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 183/458 (40%), Positives = 258/458 (56%), Gaps = 28/458 (6%)
 Frame = +3

Query  84    NTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMP  263
             +TL +IS   + + I SLPGQP  V F+QY+GYI   + + RALFYYF EA+++     P
Sbjct  25    STLSTIS---DADKIASLPGQP-KVSFSQYAGYITVDEKQQRALFYYFTEAEADPALK-P  79

Query  264   LTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYS  443
             L LWL GG  CSS  +G F E+GPF+P+ D  L+KN +SWN  +NMLY+++P GV FSYS
Sbjct  80    LVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-VLLKNDYSWNKEANMLYIESPAGVGFSYS  138

Query  444   NTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDN  623
               +S Y +  D MTAR+NL FL  WF +F +YR+ D +I G+SY GH  PQLA LI++  
Sbjct  139   VNNSFYNLVDDKMTARDNLAFLCNWFEKFPQYRERDLFITGESYAGHYVPQLAKLIVQS-  197

Query  624   RNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDE  797
                   +   LKGIA+GNP+LE  +   S  E LW HG+IS+  Y     +CN + +  +
Sbjct  198   ------KLFNLKGIAIGNPLLEFDTDINSRAEFLWSHGLISDATYESFNTICNFSKIQRQ  251

Query  798   FLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLR  971
               SG L+  CS +      EI   +D  ++          S S+       T+  D C++
Sbjct  252   RRSGALTPVCSHVFTEALREISKFVDGYDVTLDVCLSTVFSQSAVLNKLQETQKIDVCVQ  311

Query  972   DWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIP  1151
             +   +Y+NR +VQ+ALHA   G      +T+        + N  I  +  L  L  S I 
Sbjct  312   EETYKYLNRKEVQEALHARLIGIS---AWTTCSSVLKYEMQNLEIPTVSILGELAKSGIH  368

Query  1152  VLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEK  1331
             VL+YSGDQD  IP+  TR +   LA +L L T      W+  +++ GW+Q +G+      
Sbjct  369   VLVYSGDQDAAIPLLGTRTIVNNLAKQLGLNTTVPYRVWFKERQVAGWTQVYGDI-----  423

Query  1332  VANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                L+FAT+RG SH  P S P ++L LF +FL G P P
Sbjct  424   ---LSFATIRGASHEAPFSQPERSLVLFSSFLGGRPLP  458



>ref|XP_008218862.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=480

 Score =   312 bits (800),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 175/466 (38%), Positives = 259/466 (56%), Gaps = 45/466 (10%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F Q++GYI       R+LFYYF EA+S    S PL +W  GG  CSS 
Sbjct  31    IVSLPGQPR-VSFQQFAGYIDVDDHPQRSLFYYFVEAESRPA-SKPLVVWFNGGPGCSSV  88

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+    L+KN +SWN  +NMLY+++P GV FS++   S Y+  +D +T
Sbjct  89    GEGAFVEHGPFKPSGGATLIKNPYSWNTEANMLYLESPAGVGFSFAADKSFYENVNDNIT  148

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR++L FL++WF +F EY   D ++ G+SY GH  PQLA LI++   N        LKGI
Sbjct  149   ARDSLTFLQRWFDKFPEYNHRDLFLVGESYAGHYVPQLAQLIIQSGVN------FNLKGI  202

Query  666   ALGNPILEKMSLSNVEHL--WYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +  N E L  W HG+IS+  YG+   VCN++ ++ E ++G  S+ CSD+ 
Sbjct  203   AIGNPLLEFSTDVNAEDLFYWSHGLISDAAYGLLTSVCNSSQLLRETIAGSPSDACSDVA  262

Query  840   IMLSEEIGHDMDK------------------------ENLVFqscesssisssqqHYLAT  947
               +S+E+ + +DK                         N    +   SS  +   +   T
Sbjct  263   TQVSQELSNYVDKYYVTGDICLSPPFPTKLELLNPLRSNFRTSAFHRSSAEAGNYNQQLT  322

Query  948   ETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLS  1127
             +  D C+ +    Y+NR DVQKALHA   G    W+  S     D  + +  I  +  + 
Sbjct  323   DKIDACVEEETVTYLNRKDVQKALHAKLVGVS-SWSLCSQVLQYD--MRDIEISTIHIVG  379

Query  1128  ALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTF  1307
             +L+ S + V++YSGDQD  +P   +R +   LA +L L +      W++GK++GGW+Q +
Sbjct  380   SLVKSGVRVMVYSGDQDSVVPFFGSRGLINGLATQLGLKSTVPYRAWFEGKQVGGWTQVY  439

Query  1308  GNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             G+         L+FA +RG SH  P++ P ++L LFK+FL G   P
Sbjct  440   GDI--------LSFAIIRGASHTAPSTQPKRSLALFKSFLGGKTLP  477



>ref|XP_010271865.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=520

 Score =   313 bits (803),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 185/461 (40%), Positives = 262/461 (57%), Gaps = 37/461 (8%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V+F QYSGYI   + + RALFYYF EA++ +  S PL LW+ GG  CSS 
Sbjct  73    IIKLPGQP-EVNFQQYSGYITVDEEQQRALFYYFVEAET-NPASKPLVLWVNGGPGCSSI  130

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV+N++SWN  +NMLY++TP GV FSYS  +S Y   +D MT
Sbjct  131   GTGAFSEHGPFRPS-GKNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVNDEMT  189

Query  486   ---------ARENLK----FLR---KWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILE  617
                      A+++      FLR   +W  +F E+++ D +I G+SY GH  PQLA L+++
Sbjct  190   GPGKNYSIEAQKSYSYTSWFLRTSSRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQ  249

Query  618   DNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMI  791
              N      +   LKGIALGNP+LE  +   S  E LW HG+IS+  YG     CN +  +
Sbjct  250   FNDQ----KLFNLKGIALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFL  305

Query  792   DEFLSGELSEYCSDIEIMLSEEIGHDMDKENL---VFqscesssisssqqHYLATETADP  962
              ++  G +S  C  +  +++ EI   +D+ ++   V  S   S   +        E+ D 
Sbjct  306   SKYYRGSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQQKVVESTDV  365

Query  963   CLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMS  1142
             C+ D    Y+NR DVQK+LHA+  G    W   +  +     + N  +  +P LS+L  S
Sbjct  366   CVEDETYNYLNRDDVQKSLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRS  424

Query  1143  DIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGG  1322
              I +L+YSGDQD  IP++ TR +   LA  L L T      W++GK++GGW+Q +G+   
Sbjct  425   GIKILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI--  482

Query  1323  GEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                   LTFAT+RGGSH  P S P ++L LF +FLKG P P
Sbjct  483   ------LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  517



>ref|XP_004159625.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
45-like [Cucumis sativus]
Length=479

 Score =   312 bits (800),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 186/464 (40%), Positives = 260/464 (56%), Gaps = 46/464 (10%)
 Frame = +3

Query  126   IDSLPGQPSD--VDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I SLP QPSD   +F Q+ GY+   + +GRALFYYF EAQ++   S PL LWL GG  CS
Sbjct  33    IRSLPSQPSDSKANFKQFGGYVTIDEKQGRALFYYFVEAQTQPT-SKPLVLWLNGGPGCS  91

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E+GPF+   +GE LVKN++SWN  +NMLYV++P GV FSYS+  S Y   +D
Sbjct  92    SVGAGAFIEHGPFKI--NGETLVKNEYSWNTEANMLYVESPAGVGFSYSSNKSFYSKIND  149

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
              +TAR+NL FL+ WF++F EY++ DFYI G+SYGGH  PQLA LIL+   N      IKL
Sbjct  150   KITARDNLLFLQNWFVKFPEYKNADFYITGESYGGHYVPQLAQLILKSKAN------IKL  203

Query  657   KGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             KGIA+GNP+L+ ++  N   + +W HG+IS+  Y +   +CN +    E   G +S  C 
Sbjct  204   KGIAIGNPLLDLVNDFNARDKFMWSHGVISDSAYMLLSSICNTSRFYQEIFQGFISSDCI  263

Query  831   DIEIMLSEEIGHDMDKENLV--FqscesssisssqqHYLATETA----------------  956
              +   +S+++   +D  N++    S  + S  S   H L++                   
Sbjct  264   FVXSEVSKQLSPLIDDYNVIGDVCSLTAKSQPSVLLHPLSSFITKSVSQRHLLSHPQEKV  323

Query  957   ----DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTS-DVILHNFAIDILPT  1121
                 D C ++ + +Y+NR DVQKALHA   G    W+  +   +     L N+    +  
Sbjct  324   GIDRDVCSQENIAKYLNRNDVQKALHAKLIGVD-QWSVCNSNNSDWHYDLKNWLTPTIGV  382

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             + +L+ S I VL+YSGDQD  +P + TR +  +LA  L L        W    + GGWS+
Sbjct  383   VGSLVKSHIRVLVYSGDQDSVVPFTGTRTLVNLLANSLGLNITMSYKVWVVDNQAGGWSE  442

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKG  1433
              +G          L+FATVRG SH  P + P  +L LFKAFL G
Sbjct  443   AYGKF--------LSFATVRGASHLAPETQPKTSLALFKAFLDG  478



>gb|ABK26025.1| unknown [Picea sitchensis]
Length=384

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/390 (41%), Positives = 255/390 (65%), Gaps = 21/390 (5%)
 Frame = +3

Query  324   ENGPFRPT-EDGELV-KNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMTAREN  497
             E+GPF+P   +GEL+  N++SWN+ +NMLY+++PIGV FSYSN+SSDY+ ++D MTA++N
Sbjct  2     EHGPFKPRGHNGELLWTNKYSWNMETNMLYLESPIGVGFSYSNSSSDYQYYNDAMTAQDN  61

Query  498   LKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGIALGN  677
             L FL  WF +F EYR +DFYI G+SYGGH  PQLA L+L  N+NP +++P+KL+GIA+GN
Sbjct  62    LAFLLNWFEKFPEYRSVDFYITGESYGGHYVPQLATLVLNHNKNP-NIKPVKLEGIAMGN  120

Query  678   PILE-KMSLSNVEHLWYHGIISEEVYGMQKKVCNATTM-IDEFLSGELSEYCSDIEIMLS  851
             P ++ ++S++N E  W HG+IS+E Y + + VCN +   ++ ++   LS+ C ++   + 
Sbjct  121   PFVDIEISINNDEFFWSHGLISDETYRLAQSVCNNSRRWVESYVLNNLSKTCQNVFSKVQ  180

Query  852   EEIGHDMDKENLVF--------qscesssisssqqHYL--ATETADPCLRDWVGEYINRP  1001
              E G +++ E++               S      QH +       DPC+   + +Y+N+ 
Sbjct  181   SETG-NINLEDVTLGLCLNGGGSQTTGSGKPRKFQHKIEHTFNKIDPCIDFKINQYLNKQ  239

Query  1002  DVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDL  1181
             +V+K+LHANT+ +   W   S     D    N  I+++P LS LL + + + +YSGDQD 
Sbjct  240   EVKKSLHANTSLY---WEACSGKLHYD--QKNRGINVIPVLSDLLKAGLRITLYSGDQDS  294

Query  1182  RIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVR  1361
             ++P + TR +A  LA  L L T+   GPWYD K++ GW+Q++G++  G+  + LT+ATVR
Sbjct  295   KVPFTATRTIANNLAKELNLYTVIPYGPWYDNKQVAGWTQSYGHTVKGKNESILTYATVR  354

Query  1362  GGSHFVPNSSPSKALTLFKAFLKGSPPPNT  1451
             GG H VP ++PS+AL L++AF++  P P++
Sbjct  355   GGGHEVPYTNPSEALNLYRAFIRALPLPSS  384



>ref|XP_010055754.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW90022.1| hypothetical protein EUGRSUZ_A02225 [Eucalyptus grandis]
Length=474

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 182/444 (41%), Positives = 249/444 (56%), Gaps = 25/444 (6%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GY+   + + RALFYYFAEA++ D  S PL LWL GG  CSS 
Sbjct  33    IASLPGQP-KVSFGQYAGYVTVDEKQQRALFYYFAEAEA-DPASKPLVLWLNGGPGCSSI  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+ D  L+KN +SWN  +NMLY+++P GV FSYS  +S Y    D MT
Sbjct  91    GAGAFCEHGPFKPSGD-VLLKNDYSWNKEANMLYLESPAGVGFSYSVNTSYYSSVDDKMT  149

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL FLR WF +F EY++ D +I G+SY GH  PQLA LI++        +   LKGI
Sbjct  150   ARDNLAFLRNWFEKFPEYKERDLFITGESYAGHYVPQLALLIVQS-------KLFNLKGI  202

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             A+GNP+LE  +   S  E  W HG+IS+  Y     +CN + +  +  SG L+  CS + 
Sbjct  203   AIGNPLLEFNTDFNSRAEFFWSHGLISDATYESFNTMCNYSQIRRQAQSGTLTPVCSRVN  262

Query  840   IMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQK  1013
                + +I   +D  ++         SS S+        E  D C+ D   +Y+NR +VQ+
Sbjct  263   SEANRQISKFIDTYDVTLDVCLSTVSSQSAVLNKLQQAEKIDVCVEDKTLKYLNRKEVQE  322

Query  1014  ALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPV  1193
             ALHA   G    W   S     +    N  I  +  L  L+ S I VL+YSGDQD  IP+
Sbjct  323   ALHARLVGIS-SWTVCSYVLKYE--YQNLEIPTISILGELVKSGIQVLVYSGDQDSAIPL  379

Query  1194  SHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSH  1373
               TR +   LA +L L T      W++  ++ GW+Q +G+         L++AT+RG SH
Sbjct  380   LGTRTLVNNLAKQLGLNTTVPYRVWFEESQVAGWTQVYGD--------KLSYATIRGASH  431

Query  1374  FVPNSSPSKALTLFKAFLKGSPPP  1445
               P S P ++L LF +FL G P P
Sbjct  432   EAPFSQPERSLLLFSSFLGGRPLP  455



>ref|XP_010271866.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nelumbo 
nucifera]
Length=519

 Score =   313 bits (801),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 187/460 (41%), Positives = 264/460 (57%), Gaps = 36/460 (8%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP +V+F QYSGYI   + + RALFYYF EA++ +  S PL LW+ GG  CSS 
Sbjct  73    IIKLPGQP-EVNFQQYSGYITVDEEQQRALFYYFVEAET-NPASKPLVLWVNGGPGCSSI  130

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP+    LV+N++SWN  +NMLY++TP GV FSYS  +S Y   +D MT
Sbjct  131   GTGAFSEHGPFRPS-GKNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVNDEMT  189

Query  486   ---------ARENLK----FLR---KWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILE  617
                      A+++      FLR   +W  +F E+++ D +I G+SY GH  PQLA L+++
Sbjct  190   GPGKNYSIEAQKSYSYTSWFLRTSSRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQ  249

Query  618   DNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMI  791
              N      +   LKGIALGNP+LE  +   S  E LW HG+IS+  YG     CN +  +
Sbjct  250   FNDQ----KLFNLKGIALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFL  305

Query  792   DEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVFqscess--sisssqqHYLATETADPC  965
              ++  G +S  C  +  +++ EI   +D+ ++    C SS  S S +       E+ D C
Sbjct  306   SKYYRGSVSSVCLRVVSLVNREISRFIDEYDVTLSVCVSSILSQSKALTPQKVVESTDVC  365

Query  966   LRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSD  1145
             + D    Y+NR DVQK+LHA+  G    W   +  +     + N  +  +P LS+L  S 
Sbjct  366   VEDETYNYLNRDDVQKSLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSG  424

Query  1146  IPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGG  1325
             I +L+YSGDQD  IP++ TR +   LA  L L T      W++GK++GGW+Q +G+    
Sbjct  425   IKILVYSGDQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDI---  481

Query  1326  EKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                  LTFAT+RGGSH  P S P ++L LF +FLKG P P
Sbjct  482   -----LTFATIRGGSHEAPFSQPQRSLVLFNSFLKGKPLP  516



>gb|KCW90016.1| hypothetical protein EUGRSUZ_A02215 [Eucalyptus grandis]
Length=469

 Score =   310 bits (795),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 185/448 (41%), Positives = 254/448 (57%), Gaps = 32/448 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GY+   + + RALF+YFAEA++ D  S PL LWL GG  CSS 
Sbjct  33    IASLPGQP-KVSFGQYAGYVTVDEKQQRALFFYFAEAEA-DPASKPLVLWLNGGPGCSSI  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F E+GPF+P  D  L+KN +SWN  +NMLY+++P GV FSYS  +S Y    D MT
Sbjct  91    GLGSFSEHGPFKPRGD-VLLKNDYSWNKEANMLYLESPAGVGFSYSVHTSYYSSVDDEMT  149

Query  486   -ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKG  662
               R+NL FLR WF +F EY++ DF+I G+SY GH  PQLA LI++        +   LKG
Sbjct  150   EQRDNLAFLRSWFEKFPEYKERDFFITGESYAGHYVPQLAMLIVQS-------KLFNLKG  202

Query  663   IALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDI  836
             IA+GNP+LE  +   S  E  W HG+IS+  Y     +CN + +  +  SG L+  CS +
Sbjct  203   IAIGNPLLEFNTDFNSRAEFFWSHGLISDATYESFNTMCNYSQIRRQAQSGTLTPVCSRV  262

Query  837   EIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
                 + EI   +D  ++         SS S+       TE  D C++D   +Y+NR +VQ
Sbjct  263   NSEANREISKFIDTYDVTLDVCLSTVSSQSAVLNKLQQTEKIDVCVQDETLKYLNRKEVQ  322

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDIPVLIYSGDQDL  1181
             +ALHA   G       +S    SDV+     N  I  +  L  L+ S I VL+YSGDQD 
Sbjct  323   EALHARLVG------ISSWTVCSDVLEYEYQNLEIPTITILGELVKSGIHVLVYSGDQDS  376

Query  1182  RIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVR  1361
              IP+  TR +   LA +L L T      W++  ++ GW+Q +G+         L++AT+R
Sbjct  377   AIPLLGTRTLVNNLAKQLGLNTTVPYRVWFEESQVAGWTQVYGDI--------LSYATIR  428

Query  1362  GGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             G SH  P S P ++L LF +FL G P P
Sbjct  429   GASHVAPFSQPERSLVLFSSFLGGRPLP  456



>gb|KHG30064.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=472

 Score =   310 bits (795),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 184/488 (38%), Positives = 261/488 (53%), Gaps = 52/488 (11%)
 Frame = +3

Query  69    WFLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHK---FRGRALFYYFAEAQ  239
             W   V  L  +      +I+ +LPGQP  V F  +SGY+  H     R RALFYYF EA+
Sbjct  6     WVGFVTLLLHVCFSGADKIV-ALPGQP-KVSFQHFSGYVTVHDEKPHRQRALFYYFVEAE  63

Query  240   SEDKFSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTP  419
             +    S PL LWL GG  CSS   G F E+GPF+P     L KN  SWN  +NMLY+++P
Sbjct  64    TMPA-SKPLVLWLNGGPGCSSVGAGAFIEHGPFKPNGK-TLTKNANSWNKEANMLYLESP  121

Query  420   IGVAFSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQL  599
              GV FSYS  +S Y   +D + AR+N  FL +W + F +Y++ DFYI G+SY GH  PQL
Sbjct  122   AGVGFSYSANNSFYTDLNDEVVARDNFVFLERWLLIFPQYKNRDFYITGESYAGHYVPQL  181

Query  600   AALILEDNRNPAHLRPIKLKGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVC  773
                I+  N        + LKGIA+GNP+LE ++  N   ++ W HG+IS+  Y +    C
Sbjct  182   TLHIIHSNLK------LNLKGIAIGNPLLEFVTDMNSADQYYWSHGLISDSAYELLLSFC  235

Query  774   NATTMIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLV---------------------  890
             N++ ++ E L+   S  C  +   +++E+G  +DK +++                     
Sbjct  236   NSSRLMREALTQSFSSDCLSVYGEVAKELGKSVDKYDVIADVCLSSGQSSMAIFSHPMFL  295

Query  891   ---FqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFT  1061
                F S   S +    Q  +  E ADPC+ D   +Y+NR DVQKALHA   G    WN  
Sbjct  296   GPQFSSSLHSQVDGFSQQQVKVE-ADPCIEDKTTKYLNRKDVQKALHAKLVGIT-SWNLC  353

Query  1062  SPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKL  1241
             +        + +     + T+  ++ S IPV++YSGDQD  IP + TR +   LA  L L
Sbjct  354   NKIVQ---YMDDLETPTIYTVGKIVKSGIPVMVYSGDQDSVIPFTGTRNLVYKLAKALGL  410

Query  1242  TTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKA  1421
              T     PW++GK++GGW+Q +G+         L+FAT+RG SH  P S P +++ LFKA
Sbjct  411   KTTVPYRPWFEGKQVGGWTQVYGDI--------LSFATIRGASHTAPASQPKRSMALFKA  462

Query  1422  FLKGSPPP  1445
              L G P P
Sbjct  463   VLSGKPLP  470



>ref|XP_009355268.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Pyrus 
x bretschneideri]
Length=461

 Score =   310 bits (794),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 180/445 (40%), Positives = 249/445 (56%), Gaps = 29/445 (7%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I  LPGQP  V+F QY+GY+   + +GR+LFYYF EAQ+ D  S PL LWL GG  CSS 
Sbjct  35    ITRLPGQP-QVNFQQYAGYVTVDEKQGRSLFYYFVEAQT-DPASKPLVLWLNGGPGCSSV  92

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPF+P+ D  L+K  FSWN  +NMLY+++P GV FSYS   S Y   +D +T
Sbjct  93    G-GAFIEHGPFQPSGD-ILLKKDFSWNREANMLYLESPAGVGFSYSANKSFYGFVNDDIT  150

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             AR+NL+FL++WF EF EY++ D +I G SY GH  PQLA LI++            LK +
Sbjct  151   ARDNLEFLQRWFDEFPEYKNRDLFITGVSYAGHYVPQLAQLIIQSKLK------FNLKAV  204

Query  666   ALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMI--DEFLSGELSEYCSD  833
             A+GNP+LE  +   S  E+ W HG+IS+  +     VCN + +   +    G L+  C  
Sbjct  205   AIGNPLLEFNTDINSRAEYWWSHGLISDATFANLTSVCNYSEIFRQERIRGGPLTPACDA  264

Query  834   IEIMLSEEI-GHDMDKENLVFqscesssisssqqHYLATETADPCLRDWVGEYINRPDVQ  1010
             +      E+ GH +++ ++       SS+ +       T   D CL D +  Y+NRPDVQ
Sbjct  265   VANQFEREVPGHLINRYDVTL-DVCLSSVEAQSFQLRKTVKIDVCLVDEIVSYLNRPDVQ  323

Query  1011  KALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQDLRIP  1190
             +ALHA  T W +              L N    +LP L  L+ S I VLIYSGDQD  IP
Sbjct  324   EALHARITNWTF-----CSKAVIQYDLKNLETPMLPVLGELVKSGIRVLIYSGDQDSIIP  378

Query  1191  VSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFATVRGGS  1370
             ++ TR +   LA  L L T      W   K++ GW+Q + ++        L++AT+RG  
Sbjct  379   LTSTRTLVNGLAKDLGLQTNVPYRVWVQEKQVAGWTQVYSDA--------LSYATIRGAG  430

Query  1371  HFVPNSSPSKALTLFKAFLKGSPPP  1445
             H  P S P ++L LF +FL+G P P
Sbjct  431   HEAPISQPERSLLLFASFLRGKPLP  455



>gb|KDP37687.1| hypothetical protein JCGZ_06344 [Jatropha curcas]
Length=463

 Score =   309 bits (791),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 180/467 (39%), Positives = 257/467 (55%), Gaps = 48/467 (10%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GYI   + + RALFYYF EA++ +  S PL LWL GG  CSS 
Sbjct  14    IVSLPGQP-QVSFQQYAGYITVDEKQQRALFYYFVEAET-NPASKPLVLWLNGGPGCSSV  71

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
               G F E+GPFRP     L +N++SWN  +N+LY+++P GV FSYS  +S Y   +DT+T
Sbjct  72    GAGAFSEHGPFRPAGGVNLTRNEYSWNKEANILYLESPAGVGFSYSANTSFYDSVNDTIT  131

Query  486   ARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKLKGI  665
             A++NL FL++WF +F +Y++ DF+I G+SY GH  PQLA LI++            LKGI
Sbjct  132   AQDNLVFLQQWFEKFPDYKNRDFFITGESYAGHYVPQLANLIVQSGLK------FNLKGI  185

Query  666   ALGNPILEKMSLSNVE--HLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCSDIE  839
             ALGNP+LE  +  N E  + W HG+IS+  Y +    CN + +  E + G LS  C  + 
Sbjct  186   ALGNPLLEFSTDMNSEGYYYWSHGLISDSTYQLLTSTCNMSQLWREGIRGSLSPDCEAVN  245

Query  840   IMLSEEIGHDMDKENLV--FqscesssisssqqHYL------------------------  941
               +S EI +++D+ ++          +      H L                        
Sbjct  246   DRISAEIPYEIDEYDVTSDVCVSYGQAQLKVNDHPLRARFRFSKSLQENSSKPVSSPYTQ  305

Query  942   -ATETADPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILP  1118
              A+E  D C+++   EY+N  +VQ+ALHA   G      ++S  +  +    N  I  + 
Sbjct  306   KASENIDLCVQEKTYEYLNFKNVQEALHAQLVGIA---KWSSCSQVVNYDRENLEIPTIG  362

Query  1119  TLSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWS  1298
              + +L+ S I VLIYSGDQD  IP   +R +   LA +L L        W + K++GGW+
Sbjct  363   VVGSLVSSGIRVLIYSGDQDSVIPFIGSRTLVNNLAKQLGLNATVAYRGWIEDKQVGGWT  422

Query  1299  QTFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSP  1439
             + +G+         L+F T+RGGSH  P SSP ++L LFKAFL G P
Sbjct  423   EVYGDI--------LSFTTIRGGSHLAPFSSPKRSLALFKAFLAGKP  461



>gb|EYU18606.1| hypothetical protein MIMGU_mgv1a004861mg [Erythranthe guttata]
Length=507

 Score =   310 bits (794),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 182/463 (39%), Positives = 261/463 (56%), Gaps = 24/463 (5%)
 Frame = +3

Query  78    LVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFS  257
             +V T+ +       + I SLPGQP + DFNQYSGYI   + + R+ FYYF EA++ D  S
Sbjct  52    IVITISAAKPHFESDKISSLPGQP-NADFNQYSGYIAIDEHQQRSYFYYFVEAET-DPAS  109

Query  258   MPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFS  437
              PL LWL GG  CSS   G F E+GPF+P+ +  LVKN +SWN  +NMLY+++P GV FS
Sbjct  110   KPLVLWLNGGPGCSSIGAGAFGEHGPFQPSGN-VLVKNNYSWNKVANMLYLESPAGVGFS  168

Query  438   YSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILE  617
             YS   S Y+   D +TAR+NL FL  W  +F +++  +FYI G+SYGGH  PQLA LI++
Sbjct  169   YSANKSFYQSVDDVITARDNLIFLENWLKKFPQFKGREFYITGESYGGHYVPQLANLIIK  228

Query  618   DNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMI  791
                       + LKGIA+GNP+LE  +   S  E LW HG+IS+  Y      CN + + 
Sbjct  229   SKSK------LNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDSTYNQFTFACNYSQIR  282

Query  792   DEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF-qscesssisssqqHYLATETA-DPC  965
              +  +G L+  CS +   +S E+   +D  ++       S  + S   + L  E   + C
Sbjct  283   RQAATGFLTPVCSGVIRQVSSEMSRFVDSYDVTLDVCLSSVELQSEVLNQLQEERKINVC  342

Query  966   LRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLMSD  1145
             + D    Y+NR DV+KALHA   G +  W+  S     D  + N  I  +  L +L+ S 
Sbjct  343   VEDETIVYLNREDVRKALHARLIGVK-SWSICSEILRYD--MQNLEIPTIGILGSLVKSG  399

Query  1146  IPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGG  1325
             I VL+YSGDQD  +P++ TR +   LA  + L T      W++GK++ GW+Q +      
Sbjct  400   IRVLVYSGDQDSVLPLTGTRTLVNGLAKDVGLNTTVGYHAWFEGKQVAGWTQVYNEY---  456

Query  1326  EKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPPNTH  1454
                  L+FAT+RG SH  P S P ++L LF +F++G P P  +
Sbjct  457   -----LSFATIRGASHEAPFSQPERSLVLFSSFVEGKPLPRAN  494



>ref|XP_002964377.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ34710.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 173/450 (38%), Positives = 258/450 (57%), Gaps = 23/450 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             E++  LPGQP  V F QY+GY+   K  GRALFYYFAEA++    S PLTLWL GG  CS
Sbjct  26    ELVSRLPGQP-HVSFKQYAGYVTVDKNAGRALFYYFAEAETRAS-SQPLTLWLNGGPGCS  83

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E GPF P   G+ L+ N+ +WN  SNML+++ P GV +SYSN SSDY+  +D
Sbjct  84    SIGGGAFTELGPFYPNASGQGLLVNRQAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQVTD  143

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
              +TA + L FL  W  +F EY+  DFYI G+SY GH  PQLA LI++ ++ P +    +L
Sbjct  144   RITAVDTLNFLLGWMDKFPEYQTRDFYITGESYAGHYVPQLAELIIKHSQVPGNY-AFRL  202

Query  657   KGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             KG+A+GNP+L     ++   E+ W HG+IS+E +      C             +S  C+
Sbjct  203   KGVAIGNPLLNLAVDTSAMYEYFWSHGLISDETFQALSNSCKFEDYELGLADHNVSNACN  262

Query  831   DIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATET--ADPCLRDWVGEYINR  998
             D  +  + E+G  ++  +++   C           +  +A ++   D C+      Y N 
Sbjct  263   DGILQSNTEVGRFINNYDVILDVCLPSIFLQEVRLKQQMAQKSYGVDICIDKERDVYFNL  322

Query  999   PDVQKALHANTTGWQYPWNF-TSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQ  1175
             P+VQ+ LHANTTG  Y W+  T P    D  + + + +++P L  +L + + V I+SGDQ
Sbjct  323   PEVQRELHANTTGLSYSWSMCTGP---VDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQ  379

Query  1176  DLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFAT  1355
             D  +P++ TR +   LA  L + T +    WY G ++ GW+Q++G         NLT+AT
Sbjct  380   DSVVPLTGTRSLIGGLAKSLGMQTTQPYTAWYQGGQVAGWTQSYG---------NLTYAT  430

Query  1356  VRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +RG +H VP + P +AL LF++F++G+  P
Sbjct  431   IRGAAHMVPYAQPERALLLFRSFIRGNALP  460



>gb|AIC80774.1| serine carboxypeptidase [Cicer arietinum]
Length=430

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 182/462 (39%), Positives = 248/462 (54%), Gaps = 54/462 (12%)
 Frame = +3

Query  72    FLLVNTLYSISIRINGEIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDK  251
             FLL    + +S+     II  LPGQP +V+FN +SGY+       +ALF+YF EAQ +D 
Sbjct  16    FLLQLRSFGVSLSHPYRIIH-LPGQP-NVEFNHFSGYVNVDDKNNKALFFYFVEAQ-QDS  72

Query  252   FSMPLTLWLGGGHDCSSAAIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVA  431
              S PL LWL GG  CSS  +G F ENGPFRP  +G LV+NQFSWN               
Sbjct  73    VSKPLVLWLNGGPGCSSIGVGAFSENGPFRPKGEG-LVRNQFSWN---------------  116

Query  432   FSYSNTSSDYKIWSDTMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALI  611
                              TAR+NL FL+ WF++F +YR+   +I G+SY GH  PQLA L+
Sbjct  117   -----------------TARDNLIFLQNWFVQFPQYRNRSLFIVGESYAGHYVPQLAELM  159

Query  612   LEDNRNPAHLRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATT  785
             L+ N+     +   LKGIALGNP+LE  +   S  E  W HG+IS+  Y M   VCN + 
Sbjct  160   LQFNKKE---KLFNLKGIALGNPVLEFSADFNSRAEFFWSHGLISDLTYKMFTSVCNYSR  216

Query  786   MIDEFLSGELSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETAD  959
              + E+ +G +S  CS +   +S E    +DK ++          S +        TET D
Sbjct  217   YVREYYNGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQTKILNPKQVTETID  276

Query  960   PCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTSDVILHNFAIDILPTLSALLM  1139
              C+ D    Y+NR DVQ ALHA   G Q    +T      D  LH+  I  +  +  L+ 
Sbjct  277   VCVEDETVNYLNRKDVQSALHARLVGVQ---RWTPCSNVLDYDLHDLEIPTITVVGKLVK  333

Query  1140  SDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSG  1319
             + IPVL+YSGDQD  IP++ +R +   LA  L++ T      W+  +++GGW+Q +GN  
Sbjct  334   AGIPVLVYSGDQDSVIPLTGSRTLVHQLAKELRMNTTVPYRVWFQKQQVGGWTQVYGNI-  392

Query  1320  GGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
                    L+FATVRG SH  P S P ++L LFK+FL+G P P
Sbjct  393   -------LSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  427



>ref|XP_002972549.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26635.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 178/450 (40%), Positives = 251/450 (56%), Gaps = 22/450 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             +++  LPGQP DV F QY+GY+   +  G+ALFYYF EA+ ED  S PL+LWL GG  CS
Sbjct  28    DLVKDLPGQP-DVSFKQYAGYVTIDQRSGKALFYYFVEAE-EDPTSKPLSLWLNGGPGCS  85

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E GPF P    + LV+N  +WN ASN+L+VD+PIGV +SYSNTSSDY+ ++D
Sbjct  86    SLGGGAFTELGPFYPDSKSDGLVRNSKAWNKASNVLFVDSPIGVGWSYSNTSSDYQTYND  145

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
               T+R+ +KFL  WFI+F EYR  +FYI G+SY GH  PQLA  +L  N+         L
Sbjct  146   EKTSRDLVKFLHGWFIKFPEYRHREFYITGESYAGHYVPQLAVRLLNHNKLAKKSHQFNL  205

Query  657   KGIALGNPILEKM--SLSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             KG+A+GNP L       +  ++ W HG+IS++ Y      CN        L+  +S  C 
Sbjct  206   KGLAIGNPALNSAIDDEATYDYYWSHGLISDKTYQGIVHNCNWHDYDYSGLNHNVSVECV  265

Query  831   DIEIMLSEEIGHDMDKENLVFqsce-sssisssqqHYLATETA---DPCLRDWVGEYINR  998
                   + E+G ++D  +++  +C   +     +   + ++ +   D C+      Y  R
Sbjct  266   KYISQTNTEVGQNVDPYDVLLDACLPEAVHQEFRLRKMKSQRSIGVDICITRERTRYFRR  325

Query  999   PDVQKALHANTTGWQYPW-NFTSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQ  1175
             P+VQ+ALHANTTG  Y W N   P    +    N  ID++  L  LL+  + + IYSGD 
Sbjct  326   PEVQRALHANTTGLPYEWSNCEGPLFYDN---GNLNIDMVTVLENLLVQGLRIFIYSGDA  382

Query  1176  DLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFAT  1355
             D  +P   TR +   +  RL+L TL     WY   ++ GW+Q  G         NLTFAT
Sbjct  383   DSVVPFLGTRTIIDSIVNRLRLKTLVPYSAWYSQSQVAGWTQVTG---------NLTFAT  433

Query  1356  VRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             V+G  H VP + P +AL +F+AF+     P
Sbjct  434   VKGAGHMVPYAQPMRALVMFQAFVNNKNLP  463



>ref|XP_002967656.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ31003.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/450 (38%), Positives = 258/450 (57%), Gaps = 23/450 (5%)
 Frame = +3

Query  120   EIIDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             E++  LPGQP  V F QY+GY+   K  GRALFYYFAEA++    S PLTLWL GG  CS
Sbjct  26    ELVSRLPGQP-HVSFKQYAGYVTVDKNAGRALFYYFAEAETRAS-SQPLTLWLNGGPGCS  83

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E GPF P   G+ L+ N+ +WN  SNML+++ P GV +SYSN SSDY+  +D
Sbjct  84    SIGGGAFTELGPFYPNASGQGLLVNRRAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQVTD  143

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
              +TA + L FL  W  +F EY+  DFYI G+SY GH  PQLA LI++ ++ P +    +L
Sbjct  144   RITAVDTLNFLLGWMDKFPEYQTRDFYITGESYAGHYVPQLAELIIKHSQVPGNY-AFRL  202

Query  657   KGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             KG+A+GNP+L     ++   E+ W HG+IS+E +      C             +S  C+
Sbjct  203   KGVAIGNPLLNLAVDTSAMYEYFWSHGLISDETFQALSNSCKFEDYELGLADHNVSNACN  262

Query  831   DIEIMLSEEIGHDMDKENLVFqsc--esssisssqqHYLATET--ADPCLRDWVGEYINR  998
             D  +  + E+G  ++  +++   C           +  +A ++   D C+      Y N 
Sbjct  263   DGILQSNTEVGRFINNYDVILDVCLPSIFLQEVRLKQQMAQKSYGVDICIDKERDVYFNL  322

Query  999   PDVQKALHANTTGWQYPWNF-TSPGKTSDVILHNFAIDILPTLSALLMSDIPVLIYSGDQ  1175
             P+VQ+ LHANTTG  Y W+  T P    D  + + + +++P L  +L + + V I+SGDQ
Sbjct  323   PEVQRELHANTTGLPYSWSMCTGP---VDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQ  379

Query  1176  DLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVANLTFAT  1355
             D  +P++ TR +   LA  L + T +    WY G ++ GW+Q++G         NLT+AT
Sbjct  380   DSVVPLTGTRSLIGGLAKSLGMQTTQPYTAWYQGGQVAGWTQSYG---------NLTYAT  430

Query  1356  VRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
             +RG +H VP + P +AL LF++F++G+  P
Sbjct  431   IRGAAHMVPYAQPERALLLFRSFIRGNALP  460



>ref|XP_004136677.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 gb|KGN59516.1| hypothetical protein Csa_3G823640 [Cucumis sativus]
Length=479

 Score =   308 bits (790),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 185/464 (40%), Positives = 259/464 (56%), Gaps = 46/464 (10%)
 Frame = +3

Query  126   IDSLPGQPSD--VDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCS  299
             I SLP QPSD   +F Q+ GY+   + +GRALFYYF EAQ++   S PL LWL GG  CS
Sbjct  33    IRSLPSQPSDSKANFKQFGGYVTIDEKQGRALFYYFVEAQTQPT-SKPLVLWLNGGPGCS  91

Query  300   SAAIGMFYENGPFRPTEDGE-LVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSD  476
             S   G F E+GPF+   +GE LVKN++SWN  +NMLYV++P GV FSYS+  S Y   +D
Sbjct  92    SVGAGAFIEHGPFKI--NGETLVKNEYSWNTEANMLYVESPAGVGFSYSSNKSFYSKIND  149

Query  477   TMTARENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAHLRPIKL  656
              +TAR+NL FL+ WF++F EY++ DFYI G+SYGGH  PQLA LIL+   N      IKL
Sbjct  150   KITARDNLLFLQNWFVKFPEYKNADFYITGESYGGHYVPQLAQLILKSKAN------IKL  203

Query  657   KGIALGNPILEKMSLSNV--EHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGELSEYCS  830
             KGIA+GNP+L+ ++  N   + +W HG+IS+  Y +   +CN +    E   G +S  C 
Sbjct  204   KGIAIGNPLLDLVNDFNARDKFMWSHGVISDSAYMLLSSICNTSRFYQEIFQGFISSDCI  263

Query  831   DIEIMLSEEIGHDMDKENLV--FqscesssisssqqHYLATETA----------------  956
              +   +S+++   +D  N++    S  + S  S   H L++                   
Sbjct  264   FVFSEVSKQLSPLIDDYNVIGDVCSLTAKSQPSVLLHPLSSFITKSVSQRHLLSHPQEKV  323

Query  957   ----DPCLRDWVGEYINRPDVQKALHANTTGWQYPWNFTSPGKTS-DVILHNFAIDILPT  1121
                 D C ++ + +Y+NR DVQKALHA   G    W+  +   +     L N+    +  
Sbjct  324   GIDRDVCSQENIAKYLNRNDVQKALHAKLIGVD-QWSVCNSNNSDWHYDLKNWLTPTIGV  382

Query  1122  LSALLMSDIPVLIYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQ  1301
             + +L+ S I VL+YSGDQD  +  + TR +  +LA  L L        W    + GGWS+
Sbjct  383   VGSLVKSHIRVLVYSGDQDSVVSFTGTRTLVNLLANSLGLNITMSYKVWVVDNQAGGWSE  442

Query  1302  TFGNSGGGEKVANLTFATVRGGSHFVPNSSPSKALTLFKAFLKG  1433
              +G          L+FATVRG SH  P + P  +L LFKAFL G
Sbjct  443   AYGKF--------LSFATVRGASHLAPETQPKTSLALFKAFLDG  478



>ref|XP_010023719.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=477

 Score =   308 bits (788),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 185/456 (41%), Positives = 254/456 (56%), Gaps = 40/456 (9%)
 Frame = +3

Query  126   IDSLPGQPSDVDFNQYSGYIVTHKFRGRALFYYFAEAQSEDKFSMPLTLWLGGGHDCSSA  305
             I SLPGQP  V F QY+GY+   + + RALF+YFAEA++ D  S PL LWL GG  CSS 
Sbjct  33    IASLPGQP-KVSFGQYAGYVTVDEKQQRALFFYFAEAEA-DPASKPLVLWLNGGPGCSSI  90

Query  306   AIGMFYENGPFRPTEDGELVKNQFSWNLASNMLYVDTPIGVAFSYSNTSSDYKIWSDTMT  485
              +G F E+GPF+P  D  L+KN +SWN  +NMLY+++P GV FSYS  +S Y    D MT
Sbjct  91    GLGSFSEHGPFKPRGD-VLLKNDYSWNKEANMLYLESPAGVGFSYSVHTSYYSSVDDEMT  149

Query  486   A---------RENLKFLRKWFIEFSEYRDLDFYIAGDSYGGHLAPQLAALILEDNRNPAH  638
                       R+NL FLR WF +F EY++ DF+I G+SY GH  PQLA LI++       
Sbjct  150   GSFPCKLRYQRDNLAFLRSWFEKFPEYKERDFFITGESYAGHYVPQLAMLIVQS------  203

Query  639   LRPIKLKGIALGNPILEKMS--LSNVEHLWYHGIISEEVYGMQKKVCNATTMIDEFLSGE  812
              +   LKGIA+GNP+LE  +   S  E  W HG+IS+  Y     +CN + +  +  SG 
Sbjct  204   -KLFNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDATYESFNTMCNYSQIRRQAQSGT  262

Query  813   LSEYCSDIEIMLSEEIGHDMDKENLVF--qscesssisssqqHYLATETADPCLRDWVGE  986
             L+  CS +    + EI   +D  ++         SS S+       TE  D C++D   +
Sbjct  263   LTPVCSRVNSEANREISKFIDTYDVTLDVCLSTVSSQSAVLNKLQQTEKIDVCVQDETLK  322

Query  987   YINRPDVQKALHANTTGWQYPWNFTSPGKTSDVI---LHNFAIDILPTLSALLMSDIPVL  1157
             Y+NR +VQ+ALHA   G       +S    SDV+     N  I  +  L  L+ S I VL
Sbjct  323   YLNRKEVQEALHARLVG------ISSWTVCSDVLEYEYQNLEIPTITILGELVKSGIHVL  376

Query  1158  IYSGDQDLRIPVSHTREVATVLAVRLKLTTLEMNGPWYDGKEIGGWSQTFGNSGGGEKVA  1337
             +YSGDQD  IP+  TR +   LA +L L T      W++  ++ GW+Q +G+        
Sbjct  377   VYSGDQDSAIPLLGTRTLVNNLAKQLGLNTTVPYRVWFEESQVAGWTQVYGDI-------  429

Query  1338  NLTFATVRGGSHFVPNSSPSKALTLFKAFLKGSPPP  1445
              L++AT+RG SH  P S P ++L LF +FL G P P
Sbjct  430   -LSYATIRGASHVAPFSQPERSLVLFSSFLGGRPLP  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4968245977748