BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18686_g2_i1 len=2060 path=[1892:0-661 2554:662-699 5480:700-2059]

Length=2060
                                                                      Score     E

ref|XP_009618179.1|  PREDICTED: cytochrome P450 94C1-like               734   0.0      
ref|XP_009588047.1|  PREDICTED: cytochrome P450 94C1-like               733   0.0      
ref|XP_009789882.1|  PREDICTED: cytochrome P450 94C1-like               730   0.0      
ref|XP_009774133.1|  PREDICTED: cytochrome P450 94C1-like               718   0.0      
emb|CDP15392.1|  unnamed protein product                                714   0.0      
ref|XP_004249445.1|  PREDICTED: cytochrome P450 94C1-like               713   0.0      
ref|XP_011094380.1|  PREDICTED: cytochrome P450 94C1-like               706   0.0      
ref|XP_007027680.1|  Cytochrome P450 94A1                               706   0.0      
ref|XP_002277129.2|  PREDICTED: cytochrome P450 94C1                    704   0.0      Vitis vinifera
ref|XP_002533544.1|  cytochrome P450, putative                          703   0.0      Ricinus communis
emb|CAN67559.1|  hypothetical protein VITISV_002257                     699   0.0      Vitis vinifera
ref|XP_011077931.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    696   0.0      
ref|XP_007203184.1|  hypothetical protein PRUPE_ppa025166mg             692   0.0      
ref|XP_006341239.1|  PREDICTED: cytochrome P450 94A1-like               695   0.0      
ref|XP_006341238.1|  PREDICTED: cytochrome P450 94A1-like               690   0.0      
ref|XP_006430255.1|  hypothetical protein CICLE_v10013425mg             687   0.0      
ref|XP_008241266.1|  PREDICTED: cytochrome P450 94C1-like               687   0.0      
gb|KDP42721.1|  hypothetical protein JCGZ_23661                         687   0.0      
ref|XP_010049665.1|  PREDICTED: cytochrome P450 94C1-like               685   0.0      
ref|XP_006481811.1|  PREDICTED: cytochrome P450 94A1-like isoform X1    685   0.0      
ref|XP_010097640.1|  Cytochrome P450 94A1                               685   0.0      
ref|XP_010271731.1|  PREDICTED: cytochrome P450 94C1-like               683   0.0      
ref|XP_006430254.1|  hypothetical protein CICLE_v10013407mg             681   0.0      
ref|XP_006481880.1|  PREDICTED: cytochrome P450 94A1-like               681   0.0      
ref|XP_006577067.1|  PREDICTED: cytochrome P450 94A1-like               681   0.0      
ref|XP_007162882.1|  hypothetical protein PHAVU_001G188500g             676   0.0      
ref|XP_002319770.2|  hypothetical protein POPTR_0013s07310g             671   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009366644.1|  PREDICTED: cytochrome P450 94C1-like               671   0.0      
ref|XP_009374745.1|  PREDICTED: cytochrome P450 94C1-like               671   0.0      
ref|XP_010244250.1|  PREDICTED: cytochrome P450 94C1                    670   0.0      
ref|XP_008391766.1|  PREDICTED: cytochrome P450 94C1-like               669   0.0      
ref|XP_007145327.1|  hypothetical protein PHAVU_007G229700g             668   0.0      
gb|KEH42061.1|  cytochrome P450 family 94 protein                       668   0.0      
ref|XP_011005435.1|  PREDICTED: cytochrome P450 94C1-like               667   0.0      
ref|XP_004305353.1|  PREDICTED: cytochrome P450 94A1-like               665   0.0      
emb|CBI30267.3|  unnamed protein product                                665   0.0      
ref|XP_008443586.1|  PREDICTED: cytochrome P450 94C1-like               659   0.0      
gb|KHN18751.1|  Cytochrome P450 94A1                                    660   0.0      
gb|KHN48177.1|  Cytochrome P450 94A1                                    655   0.0      
ref|XP_003541451.1|  PREDICTED: cytochrome P450 94A1-like               655   0.0      
ref|XP_004149216.1|  PREDICTED: cytochrome P450 94A1-like               653   0.0      
gb|KGN59117.1|  hypothetical protein Csa_3G775300                       653   0.0      
ref|XP_004516191.1|  PREDICTED: cytochrome P450 94A1-like               652   0.0      
ref|XP_002529058.1|  cytochrome P450, putative                          650   0.0      Ricinus communis
ref|XP_006471356.1|  PREDICTED: cytochrome P450 94A1-like               650   0.0      
ref|XP_006424280.1|  hypothetical protein CICLE_v10028253mg             648   0.0      
gb|KDO51311.1|  hypothetical protein CISIN_1g040199mg                   648   0.0      
ref|XP_006471355.1|  PREDICTED: cytochrome P450 94A1-like               646   0.0      
ref|XP_010089862.1|  Cytochrome P450 94A1                               645   0.0      
emb|CDP06950.1|  unnamed protein product                                645   0.0      
ref|XP_007010240.1|  Cytochrome P450                                    644   0.0      
ref|XP_002264897.1|  PREDICTED: cytochrome P450 94C1                    644   0.0      Vitis vinifera
ref|XP_010034212.1|  PREDICTED: cytochrome P450 94C1-like               644   0.0      
ref|XP_006424281.1|  hypothetical protein CICLE_v10028254mg             643   0.0      
ref|XP_010658738.1|  PREDICTED: cytochrome P450 94C1-like               641   0.0      
gb|AED99869.1|  cytochrome P450                                         639   0.0      
ref|XP_009589328.1|  PREDICTED: cytochrome P450 94C1-like               637   0.0      
gb|AJD25222.1|  cytochrome P450 CYP94C55                                637   0.0      
emb|CAN66874.1|  hypothetical protein VITISV_021428                     644   0.0      Vitis vinifera
ref|XP_011024239.1|  PREDICTED: cytochrome P450 94C1-like               632   0.0      
ref|XP_011088865.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    629   0.0      
ref|XP_002312905.2|  cytochrome P450 family protein                     627   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007015870.1|  Cytochrome P450 94A1                               628   0.0      
ref|XP_008228870.1|  PREDICTED: cytochrome P450 94C1                    627   0.0      
ref|XP_009766870.1|  PREDICTED: cytochrome P450 94C1-like               626   0.0      
ref|XP_007205046.1|  hypothetical protein PRUPE_ppa004592mg             626   0.0      
ref|XP_011044868.1|  PREDICTED: cytochrome P450 94C1-like               625   0.0      
ref|XP_002315447.2|  hypothetical protein POPTR_0010s24310g             625   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006592314.1|  PREDICTED: cytochrome P450 94A1-like               624   0.0      
gb|EYU35153.1|  hypothetical protein MIMGU_mgv1a026773mg                622   0.0      
ref|XP_004291623.1|  PREDICTED: cytochrome P450 94A1-like               622   0.0      
ref|XP_011046266.1|  PREDICTED: cytochrome P450 94C1-like               618   0.0      
ref|XP_010932013.1|  PREDICTED: cytochrome P450 94C1-like               619   0.0      
ref|XP_006384629.1|  cytochrome P450 family protein                     616   0.0      
ref|XP_008376983.1|  PREDICTED: cytochrome P450 94C1-like               616   0.0      
ref|XP_004139575.1|  PREDICTED: cytochrome P450 94A1-like               614   0.0      
gb|KGN64915.1|  hypothetical protein Csa_1G154090                       615   0.0      
gb|KCW87400.1|  hypothetical protein EUGRSUZ_B03878                     613   0.0      
ref|XP_010045242.1|  PREDICTED: cytochrome P450 94C1-like               612   0.0      
ref|XP_010322431.1|  PREDICTED: cytochrome P450 94C1                    611   0.0      
ref|XP_010912256.1|  PREDICTED: cytochrome P450 94C1-like               611   0.0      
gb|AJD25221.1|  cytochrome P450 CYP94C54                                610   0.0      
ref|XP_010907146.1|  PREDICTED: cytochrome P450 94C1-like               611   0.0      
ref|XP_004506151.1|  PREDICTED: cytochrome P450 94A1-like               610   0.0      
ref|XP_006347236.1|  PREDICTED: cytochrome P450 94A1-like               608   0.0      
ref|XP_009403729.1|  PREDICTED: cytochrome P450 94C1-like               608   0.0      
gb|EYU36964.1|  hypothetical protein MIMGU_mgv1a023150mg                607   0.0      
ref|XP_003538134.1|  PREDICTED: cytochrome P450 94A2-like               608   0.0      
ref|XP_008461642.1|  PREDICTED: cytochrome P450 94C1                    608   0.0      
ref|XP_010541286.1|  PREDICTED: cytochrome P450 94C1-like               607   0.0      
ref|XP_008790927.1|  PREDICTED: cytochrome P450 94C1-like               607   0.0      
ref|XP_009348573.1|  PREDICTED: cytochrome P450 94C1-like               608   0.0      
ref|XP_009800093.1|  PREDICTED: cytochrome P450 94C1-like               607   0.0      
ref|XP_009401100.1|  PREDICTED: cytochrome P450 94C1-like               603   0.0      
ref|XP_009338687.1|  PREDICTED: cytochrome P450 94C1-like               606   0.0      
ref|XP_009411963.1|  PREDICTED: cytochrome P450 94C1-like               603   0.0      
ref|XP_003606223.1|  Cytochrome P450 94A1                               603   0.0      
ref|XP_008801229.1|  PREDICTED: cytochrome P450 94C1                    602   0.0      
ref|XP_009414947.1|  PREDICTED: cytochrome P450 94C1-like               600   0.0      
ref|XP_010067149.1|  PREDICTED: cytochrome P450 94C1-like               600   0.0      
ref|XP_008784226.1|  PREDICTED: cytochrome P450 94C1-like               597   0.0      
ref|XP_009338906.1|  PREDICTED: cytochrome P450 94C1-like               597   0.0      
ref|XP_008371286.1|  PREDICTED: cytochrome P450 94C1-like               595   0.0      
ref|XP_009393377.1|  PREDICTED: cytochrome P450 94C1-like               594   0.0      
ref|XP_007132406.1|  hypothetical protein PHAVU_011G092100g             593   0.0      
ref|XP_009364325.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    595   0.0      
ref|XP_006361448.1|  PREDICTED: cytochrome P450 94A1-like               590   0.0      
ref|XP_006481812.1|  PREDICTED: cytochrome P450 94A1-like isoform X2    585   0.0      
ref|XP_006294094.1|  hypothetical protein CARUB_v10023087mg             586   0.0      
ref|XP_008776666.1|  PREDICTED: cytochrome P450 94C1-like               587   0.0      
ref|XP_010683845.1|  PREDICTED: cytochrome P450 94C1-like               585   0.0      
ref|XP_002880978.1|  CYP94C1                                            583   0.0      
ref|XP_006436643.1|  hypothetical protein CICLE_v10033768mg             582   0.0      
ref|XP_009414555.1|  PREDICTED: cytochrome P450 94C1-like               582   0.0      
ref|XP_009421132.1|  PREDICTED: cytochrome P450 94C1-like               578   0.0      
ref|XP_002458797.1|  hypothetical protein SORBIDRAFT_03g040440          580   0.0      Sorghum bicolor [broomcorn]
ref|XP_010521668.1|  PREDICTED: cytochrome P450 94C1-like               578   0.0      
ref|NP_180337.1|  cytochrome P450, family 94, subfamily C, polype...    577   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510742.1|  PREDICTED: cytochrome P450 94C1-like               575   0.0      
ref|XP_009103613.1|  PREDICTED: cytochrome P450 94C1                    575   0.0      
ref|XP_006409751.1|  hypothetical protein EUTSA_v10016556mg             573   0.0      
gb|AFW78139.1|  putative cytochrome P450 superfamily protein            573   0.0      
emb|CDY04506.1|  BnaA07g13320D                                          572   0.0      
emb|CDX71432.1|  BnaC04g16670D                                          572   0.0      
ref|XP_002439880.1|  hypothetical protein SORBIDRAFT_09g021890          573   0.0      Sorghum bicolor [broomcorn]
ref|XP_010557399.1|  PREDICTED: cytochrome P450 94C1-like               571   0.0      
ref|XP_004487513.1|  PREDICTED: cytochrome P450 94A1-like               571   0.0      
ref|XP_009388367.1|  PREDICTED: cytochrome P450 94C1-like               571   0.0      
ref|XP_010473161.1|  PREDICTED: cytochrome P450 94C1                    570   0.0      
gb|EAY76557.1|  hypothetical protein OsI_04502                          569   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAK08034.1|  predicted protein                                      568   0.0      
ref|XP_003596778.1|  Cytochrome P450                                    566   0.0      
ref|NP_001172660.1|  Os01g0858350                                       567   0.0      
ref|XP_006645049.1|  PREDICTED: cytochrome P450 94A1-like               567   0.0      
ref|XP_004970645.1|  PREDICTED: cytochrome P450 94A1-like               566   0.0      
ref|XP_008657035.1|  PREDICTED: cytochrome P450 94C1-like               565   0.0      
ref|XP_010232583.1|  PREDICTED: cytochrome P450 94C1                    563   0.0      
ref|XP_004961922.1|  PREDICTED: cytochrome P450 94A2-like               563   0.0      
emb|CDM80095.1|  unnamed protein product                                562   0.0      
ref|XP_006851517.1|  hypothetical protein AMTR_s00040p00166370          559   0.0      
dbj|BAJ94069.1|  predicted protein                                      554   0.0      
ref|XP_002862559.1|  CYP94C1                                            552   0.0      
ref|XP_006654479.1|  PREDICTED: cytochrome P450 94A2-like               553   0.0      
gb|EAY98229.1|  hypothetical protein OsI_20140                          552   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_003566202.1|  PREDICTED: cytochrome P450 94C1-like               551   0.0      
ref|NP_001055681.1|  Os05g0445100                                       550   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CBI40252.3|  unnamed protein product                                548   0.0      
ref|XP_010686047.1|  PREDICTED: cytochrome P450 94C1                    541   0.0      
ref|NP_001066166.2|  Os12g0150200                                       540   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CBX25407.1|  hypothetical_protein                                   540   0.0      
gb|ABA95812.1|  Cytochrome P450 family protein, expressed               540   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99856.1|  predicted protein                                      540   0.0      
ref|XP_008662461.1|  PREDICTED: cytochrome P450 94C1-like               540   0.0      
ref|XP_008662467.1|  PREDICTED: cytochrome P450 94C1-like               534   1e-179   
dbj|BAJ85532.1|  predicted protein                                      531   9e-179   
ref|XP_003577893.2|  PREDICTED: cytochrome P450 94C1-like               531   1e-178   
ref|XP_004977561.1|  PREDICTED: cytochrome P450 94A1-like               526   6e-177   
emb|CBX25324.1|  hypothetical_protein                                   521   1e-174   
ref|XP_002450277.1|  hypothetical protein SORBIDRAFT_05g003100          520   2e-174   Sorghum bicolor [broomcorn]
ref|NP_001065766.1|  Os11g0151400                                       521   2e-174   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ88829.1|  predicted protein                                      515   2e-172   
ref|XP_006662735.1|  PREDICTED: cytochrome P450 94A1-like               514   7e-172   
ref|XP_003578905.1|  PREDICTED: cytochrome P450 94C1-like               512   4e-171   
ref|NP_001183398.1|  putative cytochrome P450 superfamily protein       507   3e-169   
ref|XP_004978691.1|  PREDICTED: cytochrome P450 94A1-like               506   7e-169   
ref|XP_002442803.1|  hypothetical protein SORBIDRAFT_08g003110          493   1e-163   Sorghum bicolor [broomcorn]
ref|XP_008664407.1|  PREDICTED: cytochrome P450 94C1-like               489   3e-162   
gb|EAZ17458.1|  hypothetical protein OsJ_32985                          486   4e-161   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19658.1|  hypothetical protein OsJ_35235                          484   4e-160   Oryza sativa Japonica Group [Japonica rice]
emb|CBX24475.1|  hypothetical_protein                                   481   2e-159   
ref|XP_009150186.1|  PREDICTED: cytochrome P450 94B3                    440   2e-143   
emb|CDY59153.1|  BnaC08g48490D                                          429   5e-139   
gb|ADE75655.1|  unknown                                                 429   2e-138   
ref|XP_007037964.1|  Cytochrome P450 94A2                               427   2e-138   
ref|XP_009149812.1|  PREDICTED: cytochrome P450 94B3                    426   1e-137   
ref|XP_010045499.1|  PREDICTED: cytochrome P450 94B3-like               425   4e-137   
ref|XP_009415113.1|  PREDICTED: cytochrome P450 94B3-like               424   5e-137   
gb|KFK34160.1|  hypothetical protein AALP_AA5G108200                    422   3e-136   
ref|XP_002322606.2|  hypothetical protein POPTR_0016s03160g             420   2e-135   Populus trichocarpa [western balsam poplar]
ref|XP_002964775.1|  medium chain fatty acid hydroxylase                419   2e-135   
gb|KCW83161.1|  hypothetical protein EUGRSUZ_B00116                     420   2e-135   
ref|XP_002961706.1|  hypothetical protein SELMODRAFT_76541              419   4e-135   
ref|XP_002988642.1|  medium chain fatty acid hydroxylase                418   7e-135   
ref|XP_007050381.1|  Cytochrome P450 94A1                               417   2e-134   
ref|XP_010026558.1|  PREDICTED: cytochrome P450 94B3-like               417   2e-134   
ref|XP_002511196.1|  cytochrome P450, putative                          416   2e-134   Ricinus communis
ref|XP_010250749.1|  PREDICTED: cytochrome P450 94B3-like               416   2e-134   
ref|XP_006351473.1|  PREDICTED: cytochrome P450 94A1-like               416   3e-134   
ref|XP_011041380.1|  PREDICTED: cytochrome P450 94A1-like               416   4e-134   
ref|XP_010247227.1|  PREDICTED: cytochrome P450 94B3                    416   4e-134   
ref|XP_002979339.1|  medium chain fatty acid hydroxylase                414   5e-134   
ref|XP_010045498.1|  PREDICTED: cytochrome P450 94B3-like               416   7e-134   
ref|XP_004236553.1|  PREDICTED: cytochrome P450 94B3-like               415   7e-134   
gb|EYU43048.1|  hypothetical protein MIMGU_mgv1a026913mg                414   7e-134   
gb|KDO52651.1|  hypothetical protein CISIN_1g036030mg                   415   1e-133   
ref|XP_006477025.1|  PREDICTED: cytochrome P450 94A1-like               414   2e-133   
ref|XP_006440103.1|  hypothetical protein CICLE_v10019793mg             414   3e-133   
ref|XP_010045501.1|  PREDICTED: cytochrome P450 94B3-like               414   5e-133   
ref|XP_002278009.1|  PREDICTED: cytochrome P450 94A1                    413   7e-133   Vitis vinifera
gb|KCW83158.1|  hypothetical protein EUGRSUZ_B00113                     413   7e-133   
ref|XP_010938845.1|  PREDICTED: cytochrome P450 94B3-like               414   7e-133   
ref|XP_010026539.1|  PREDICTED: cytochrome P450 94B3-like               413   9e-133   
ref|XP_002979336.1|  hypothetical protein SELMODRAFT_110688             412   1e-132   
ref|XP_010111213.1|  Cytochrome P450 94A1                               413   1e-132   
ref|XP_006373690.1|  cytochrome P450 family protein                     412   1e-132   
gb|KCW83159.1|  hypothetical protein EUGRSUZ_B00114                     412   3e-132   
ref|XP_010247228.1|  PREDICTED: cytochrome P450 94B3-like               412   3e-132   
ref|XP_006351474.1|  PREDICTED: cytochrome P450 94A1-like               410   6e-132   
ref|XP_004236333.1|  PREDICTED: cytochrome P450 94B3-like               410   6e-132   
gb|AJD25220.1|  cytochrome P450 CYP94B50                                410   1e-131   
ref|XP_008239459.1|  PREDICTED: cytochrome P450 94B3                    409   3e-131   
ref|XP_010550730.1|  PREDICTED: cytochrome P450 94B3                    409   4e-131   
gb|KCW83162.1|  hypothetical protein EUGRSUZ_B00117                     409   4e-131   
ref|XP_006447077.1|  hypothetical protein CICLE_v10017920mg             408   5e-131   
ref|XP_006470124.1|  PREDICTED: cytochrome P450 94A2-like               408   7e-131   
gb|EMS54048.1|  Cytochrome P450 94A1                                    404   7e-131   
ref|XP_006338805.1|  PREDICTED: cytochrome P450 94A1-like               408   8e-131   
ref|XP_009394066.1|  PREDICTED: cytochrome P450 94B3-like               408   8e-131   
ref|XP_010247156.1|  PREDICTED: cytochrome P450 94B3-like               408   9e-131   
gb|EPS70135.1|  hypothetical protein M569_04626                         407   1e-130   
ref|XP_011083758.1|  PREDICTED: cytochrome P450 94B3-like               409   1e-130   
ref|XP_010250748.1|  PREDICTED: cytochrome P450 94B3-like               407   2e-130   
ref|XP_010045497.1|  PREDICTED: cytochrome P450 94B3-like               407   2e-130   
ref|XP_006351475.1|  PREDICTED: cytochrome P450 94A1-like               406   2e-130   
ref|XP_002300789.2|  cytochrome P450 CYP94A1 family protein             407   2e-130   Populus trichocarpa [western balsam poplar]
ref|XP_002877615.1|  CYP94B3                                            407   2e-130   
ref|XP_011070085.1|  PREDICTED: cytochrome P450 94A1                    407   2e-130   
ref|XP_008443231.1|  PREDICTED: cytochrome P450 94A1-like               406   4e-130   
gb|ADO24345.1|  cytochrome P450 A                                       406   4e-130   
ref|XP_007210176.1|  hypothetical protein PRUPE_ppa017252mg             406   4e-130   
ref|XP_009620348.1|  PREDICTED: cytochrome P450 94B3                    406   4e-130   
ref|XP_002279981.1|  PREDICTED: cytochrome P450 94B3-like               406   5e-130   Vitis vinifera
ref|XP_004236332.1|  PREDICTED: cytochrome P450 94B3-like               405   5e-130   
ref|XP_006290939.1|  hypothetical protein CARUB_v10017052mg             405   7e-130   
ref|XP_010503490.1|  PREDICTED: cytochrome P450 94B3-like               405   7e-130   
ref|XP_010515172.1|  PREDICTED: cytochrome P450 94B3-like               405   9e-130   
ref|XP_009386731.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    405   1e-129   
ref|XP_008788557.1|  PREDICTED: cytochrome P450 94A1                    405   1e-129   
ref|XP_011084785.1|  PREDICTED: cytochrome P450 94B3-like               403   1e-129   
gb|KGN63489.1|  hypothetical protein Csa_1G002090                       405   2e-129   
ref|XP_009763713.1|  PREDICTED: cytochrome P450 94A1-like isoform X1    404   2e-129   
ref|XP_007162039.1|  hypothetical protein PHAVU_001G118600g             405   3e-129   
ref|XP_008464443.1|  PREDICTED: cytochrome P450 94B3                    404   3e-129   
ref|XP_002282477.2|  PREDICTED: cytochrome P450 94A1-like               405   4e-129   Vitis vinifera
ref|XP_009784521.1|  PREDICTED: cytochrome P450 94B3-like               404   5e-129   
ref|XP_009610819.1|  PREDICTED: cytochrome P450 94A1-like               403   5e-129   
ref|XP_002318721.2|  hypothetical protein POPTR_0012s09880g             407   6e-129   Populus trichocarpa [western balsam poplar]
gb|KFK28056.1|  hypothetical protein AALP_AA8G465900                    402   8e-129   
emb|CAN75729.1|  hypothetical protein VITISV_031409                     402   9e-129   Vitis vinifera
emb|CDP15011.1|  unnamed protein product                                402   1e-128   
ref|NP_190421.1|  cytochrome P450, family 94, subfamily B, polype...    402   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002282468.1|  PREDICTED: cytochrome P450 94A1                    402   1e-128   Vitis vinifera
ref|XP_010906406.1|  PREDICTED: cytochrome P450 94B3-like               402   1e-128   
ref|XP_010246280.1|  PREDICTED: cytochrome P450 94A2-like               402   1e-128   
ref|XP_011044159.1|  PREDICTED: cytochrome P450 94B3-like               402   2e-128   
gb|ABR16897.1|  unknown                                                 400   2e-128   Picea sitchensis
ref|XP_003521105.1|  PREDICTED: cytochrome P450 94A1                    401   2e-128   
ref|XP_006838838.1|  hypothetical protein AMTR_s00002p00263780          401   2e-128   
gb|KHN12182.1|  Cytochrome P450 94A1                                    401   2e-128   
ref|XP_006482029.1|  PREDICTED: cytochrome P450 94A1-like               402   2e-128   
gb|AJD25218.1|  cytochrome P450 CYP94A48                                401   3e-128   
gb|AAL54884.1|AF092913_1  cytochrome P450-dependent fatty acid hy...    401   4e-128   Nicotiana tabacum [American tobacco]
ref|XP_004136768.1|  PREDICTED: cytochrome P450 94A1-like               400   6e-128   
ref|XP_010112360.1|  Cytochrome P450 94A1                               400   9e-128   
gb|KEH22037.1|  cytochrome P450 family protein                          400   1e-127   
ref|XP_010426348.1|  PREDICTED: cytochrome P450 94B3                    400   1e-127   
ref|XP_010906405.1|  PREDICTED: cytochrome P450 94A1                    400   1e-127   
ref|XP_006383696.1|  cytochrome P450 CYP94A1 family protein             400   1e-127   
ref|XP_004289914.1|  PREDICTED: cytochrome P450 94A1-like               399   1e-127   
gb|EPS72518.1|  hypothetical protein M569_02237                         399   2e-127   
ref|XP_010033411.1|  PREDICTED: cytochrome P450 94B3-like               400   2e-127   
ref|XP_002519477.1|  cytochrome P450, putative                          399   3e-127   Ricinus communis
ref|XP_011026019.1|  PREDICTED: cytochrome P450 94A1-like               399   3e-127   
gb|AAZ39645.1|  cytochrome P450 monooxygenase                           399   4e-127   Petunia x hybrida [garden petunia]
ref|XP_009407042.1|  PREDICTED: cytochrome P450 94B3-like               398   4e-127   
ref|XP_007215034.1|  hypothetical protein PRUPE_ppa004311mg             399   5e-127   
ref|XP_006366194.1|  PREDICTED: cytochrome P450 94A1-like               398   5e-127   
ref|XP_009620147.1|  PREDICTED: cytochrome P450 94A2-like               398   5e-127   
ref|XP_002979685.1|  medium chain fatty acid hydroxylase                398   6e-127   
ref|XP_009359442.1|  PREDICTED: cytochrome P450 94B3-like               398   6e-127   
ref|XP_002985393.1|  hypothetical protein SELMODRAFT_122098             397   7e-127   
ref|XP_006430501.1|  hypothetical protein CICLE_v10011533mg             397   8e-127   
ref|XP_007134770.1|  hypothetical protein PHAVU_010G074400g             397   8e-127   
ref|XP_004167155.1|  PREDICTED: cytochrome P450 94A1-like               398   8e-127   
ref|XP_009604998.1|  PREDICTED: cytochrome P450 94B3-like               397   8e-127   
ref|XP_003516338.1|  PREDICTED: cytochrome P450 94A2-like               397   8e-127   
ref|XP_006383694.1|  cytochrome P450 CYP94A1 family protein             397   9e-127   
ref|XP_008231126.1|  PREDICTED: cytochrome P450 94B3                    397   1e-126   
ref|XP_010055610.1|  PREDICTED: cytochrome P450 94A2                    397   1e-126   
ref|XP_006482030.1|  PREDICTED: cytochrome P450 94A1-like               397   1e-126   
ref|XP_009781600.1|  PREDICTED: cytochrome P450 94A2-like               397   1e-126   
ref|XP_009766464.1|  PREDICTED: cytochrome P450 94B3-like               397   1e-126   
ref|XP_009393106.1|  PREDICTED: cytochrome P450 94A1-like               397   2e-126   
ref|XP_009607568.1|  PREDICTED: cytochrome P450 94B3-like               397   2e-126   
dbj|BAO45862.1|  cytochrome P450 94A1                                   397   2e-126   
ref|XP_010679201.1|  PREDICTED: cytochrome P450 94A1-like               397   2e-126   
ref|XP_008788895.1|  PREDICTED: cytochrome P450 94B3-like               397   2e-126   
ref|XP_010055620.1|  PREDICTED: cytochrome P450 94A2-like               397   2e-126   
gb|AAL54886.1|AF092915_1  cytochrome P450-dependent fatty acid hy...    397   2e-126   
ref|XP_008810187.1|  PREDICTED: cytochrome P450 94A1-like               396   4e-126   
gb|EMT07846.1|  Cytochrome P450 94A1                                    392   4e-126   
ref|XP_010929779.1|  PREDICTED: cytochrome P450 94B3-like               396   4e-126   
ref|XP_003522151.1|  PREDICTED: cytochrome P450 94A2-like               395   6e-126   
ref|XP_008788555.1|  PREDICTED: cytochrome P450 94A2-like               395   8e-126   
ref|XP_010111207.1|  Cytochrome P450 94A1                               400   1e-125   
ref|XP_010677888.1|  PREDICTED: cytochrome P450 94B3                    395   1e-125   
emb|CDP03714.1|  unnamed protein product                                394   1e-125   
ref|XP_010039015.1|  PREDICTED: cytochrome P450 94A2-like               394   2e-125   
gb|EPS62279.1|  hypothetical protein M569_12509                         394   2e-125   
ref|XP_010038019.1|  PREDICTED: cytochrome P450 94A1-like               395   2e-125   
ref|XP_006848391.1|  hypothetical protein AMTR_s00013p00215200          394   2e-125   
ref|XP_004249121.2|  PREDICTED: cytochrome P450 94A2 isoform X2         394   2e-125   
dbj|BAC43161.1|  putative cytochrome P450                               394   2e-125   
ref|XP_002273811.3|  PREDICTED: cytochrome P450 94B3                    395   3e-125   
ref|XP_010679200.1|  PREDICTED: cytochrome P450 94A1-like               394   3e-125   
gb|AAM60854.1|  cytochrome P450-like protein                            394   3e-125   
ref|XP_002300103.1|  cytochrome P450 family protein                     394   3e-125   
ref|XP_010247229.1|  PREDICTED: cytochrome P450 94B3-like               393   3e-125   
ref|XP_008450098.1|  PREDICTED: cytochrome P450 94B3 isoform X1         393   3e-125   
ref|NP_201150.1|  cytochrome P450, family 94, subfamily B, polype...    394   3e-125   
ref|XP_010246279.1|  PREDICTED: cytochrome P450 94A2-like               393   5e-125   
ref|XP_011028759.1|  PREDICTED: cytochrome P450 94A1-like               393   8e-125   
ref|XP_006394276.1|  hypothetical protein EUTSA_v10005707mg             392   1e-124   
ref|XP_010484081.1|  PREDICTED: cytochrome P450 94B1-like               392   1e-124   
ref|XP_002509524.1|  cytochrome P450, putative                          392   1e-124   
ref|XP_003553253.2|  PREDICTED: cytochrome P450 94A1-like               392   1e-124   
ref|XP_011003922.1|  PREDICTED: cytochrome P450 94B3                    393   2e-124   
ref|XP_009610631.1|  PREDICTED: cytochrome P450 94A2                    391   2e-124   
ref|XP_006364779.1|  PREDICTED: cytochrome P450 94A2-like               391   2e-124   
gb|EPS65724.1|  hypothetical protein M569_09053                         390   2e-124   
ref|XP_010460278.1|  PREDICTED: cytochrome P450 94B1-like               391   2e-124   
ref|XP_003624855.1|  Cytochrome P450                                    391   2e-124   
gb|AAL54885.1|AF092914_1  cytochrome P450-dependent fatty acid hy...    391   2e-124   
ref|XP_010444242.1|  PREDICTED: cytochrome P450 94B1                    391   3e-124   
gb|KDP46287.1|  hypothetical protein JCGZ_10127                         391   3e-124   
ref|XP_004299232.1|  PREDICTED: cytochrome P450 94A1-like               390   4e-124   
emb|CDY37921.1|  BnaA06g18960D                                          389   5e-124   
ref|XP_009790300.1|  PREDICTED: cytochrome P450 94A2                    390   6e-124   
emb|CDP03713.1|  unnamed protein product                                390   9e-124   
ref|XP_006282257.1|  hypothetical protein CARUB_v10028534mg             389   1e-123   
ref|XP_004249120.1|  PREDICTED: cytochrome P450 94A2 isoform X1         389   1e-123   
ref|XP_008235727.1|  PREDICTED: cytochrome P450 94A1-like               389   1e-123   
ref|XP_003601427.1|  Cytochrome P450 94A1                               390   2e-123   
gb|KCW84705.1|  hypothetical protein EUGRSUZ_B01524                     387   2e-123   
ref|XP_009615866.1|  PREDICTED: cytochrome P450 94A2-like               389   2e-123   
ref|XP_010673087.1|  PREDICTED: cytochrome P450 94A2-like               389   2e-123   
gb|EYU45403.1|  hypothetical protein MIMGU_mgv1a006399mg                387   2e-123   
ref|XP_008364314.1|  PREDICTED: cytochrome P450 94A1-like               389   2e-123   
ref|XP_010679199.1|  PREDICTED: cytochrome P450 94A2-like               389   2e-123   
ref|XP_002866555.1|  hypothetical protein ARALYDRAFT_496532             389   2e-123   
ref|XP_010278943.1|  PREDICTED: cytochrome P450 94A2-like               388   3e-123   
ref|XP_010111205.1|  Cytochrome P450 94A2                               388   4e-123   
ref|XP_009130252.1|  PREDICTED: cytochrome P450 94B1-like               388   5e-123   
ref|XP_009377719.1|  PREDICTED: cytochrome P450 94A1-like isoform X1    387   5e-123   
ref|XP_006351638.1|  PREDICTED: cytochrome P450 94A2-like               387   6e-123   
ref|XP_008244020.1|  PREDICTED: cytochrome P450 94A1-like               387   7e-123   
emb|CDP06233.1|  unnamed protein product                                387   9e-123   
ref|XP_009354911.1|  PREDICTED: cytochrome P450 94A1-like               387   1e-122   
ref|XP_006404244.1|  hypothetical protein EUTSA_v10011125mg             386   1e-122   
dbj|BAJ97414.1|  predicted protein                                      387   1e-122   
ref|XP_003548522.2|  PREDICTED: cytochrome P450 94A1-like               387   2e-122   
ref|XP_009371650.1|  PREDICTED: cytochrome P450 94B3-like               386   2e-122   
ref|XP_002307954.2|  putative cytochrome P450 family protein            386   2e-122   
ref|XP_008341306.1|  PREDICTED: cytochrome P450 94B3-like               386   2e-122   
ref|XP_004242690.1|  PREDICTED: cytochrome P450 94A1-like               386   2e-122   
ref|XP_010545953.1|  PREDICTED: cytochrome P450 94B3-like               386   2e-122   
gb|AJD25219.1|  cytochrome P450 CYP94A49                                386   2e-122   
ref|XP_004247227.1|  PREDICTED: cytochrome P450 94A1-like               386   2e-122   
ref|XP_008368443.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    386   3e-122   
ref|XP_010039240.1|  PREDICTED: cytochrome P450 94A1-like               386   3e-122   
ref|XP_007209920.1|  hypothetical protein PRUPE_ppa004467mg             385   5e-122   
ref|XP_004233587.1|  PREDICTED: cytochrome P450 94B3                    385   9e-122   
ref|XP_002521002.1|  cytochrome P450, putative                          384   1e-121   
ref|XP_011028760.1|  PREDICTED: cytochrome P450 94A2-like               384   1e-121   
ref|XP_008235725.1|  PREDICTED: cytochrome P450 94A1-like               384   1e-121   
ref|XP_009368544.1|  PREDICTED: cytochrome P450 94B3-like               384   1e-121   
gb|KEH23874.1|  cytochrome P450 family 94 protein                       384   1e-121   
ref|XP_003520587.1|  PREDICTED: cytochrome P450 94A1-like               384   2e-121   
ref|XP_010104028.1|  Cytochrome P450 94A1                               383   2e-121   
ref|XP_008341677.1|  PREDICTED: cytochrome P450 94B3-like               384   2e-121   
ref|XP_010525434.1|  PREDICTED: cytochrome P450 94B3                    383   3e-121   
ref|XP_007161734.1|  hypothetical protein PHAVU_001G094200g             382   4e-121   
ref|XP_002521004.1|  cytochrome P450, putative                          383   4e-121   
ref|XP_008447772.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    382   5e-121   
ref|XP_007199792.1|  hypothetical protein PRUPE_ppa004444mg             382   6e-121   
ref|XP_008346695.1|  PREDICTED: cytochrome P450 94B3-like               382   6e-121   
gb|EPS66548.1|  hypothetical protein M569_08223                         380   7e-121   
ref|XP_009377718.1|  PREDICTED: cytochrome P450 94A1-like               382   7e-121   
ref|XP_002893825.1|  CYP94D1                                            381   1e-120   
ref|XP_009412188.1|  PREDICTED: cytochrome P450 94A1-like               382   1e-120   
gb|KDP21345.1|  hypothetical protein JCGZ_21816                         381   1e-120   
ref|XP_004513634.1|  PREDICTED: cytochrome P450 94A1-like               382   1e-120   
ref|NP_191222.1|  cytochrome P450, family 94, subfamily D, polype...    380   2e-120   
ref|XP_009377720.1|  PREDICTED: cytochrome P450 94A1-like isoform X2    380   3e-120   
ref|XP_009367721.1|  PREDICTED: cytochrome P450 94A1-like               380   3e-120   
ref|XP_009112079.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    380   3e-120   
ref|XP_011040725.1|  PREDICTED: cytochrome P450 94A1                    380   4e-120   
ref|XP_007200096.1|  hypothetical protein PRUPE_ppa019319mg             380   6e-120   
ref|XP_007200970.1|  hypothetical protein PRUPE_ppa004449mg             379   1e-119   
ref|XP_010673086.1|  PREDICTED: cytochrome P450 94A1-like               379   1e-119   
emb|CDP03715.1|  unnamed protein product                                379   1e-119   
ref|XP_004977485.1|  PREDICTED: cytochrome P450 94A1-like               379   2e-119   
ref|XP_004493756.1|  PREDICTED: cytochrome P450 94A1-like               379   2e-119   
ref|XP_008393292.1|  PREDICTED: cytochrome P450 94A2-like               378   5e-119   
ref|XP_004170788.1|  PREDICTED: cytochrome P450 94A2-like               377   5e-119   
ref|XP_010910194.1|  PREDICTED: cytochrome P450 94C1-like               371   6e-119   
ref|XP_010029004.1|  PREDICTED: cytochrome P450 94B3-like               377   6e-119   
gb|KDP21346.1|  hypothetical protein JCGZ_21817                         377   8e-119   
ref|XP_010516270.1|  PREDICTED: cytochrome P450 94B3-like               377   9e-119   
ref|XP_010552073.1|  PREDICTED: cytochrome P450 94B1                    376   1e-118   
sp|O81117.2|C94A1_VICSA  RecName: Full=Cytochrome P450 94A1; AltN...    377   1e-118   
ref|XP_004495122.1|  PREDICTED: cytochrome P450 94A2-like               376   2e-118   
gb|EAY80935.1|  hypothetical protein OsI_36114                          377   3e-118   
ref|XP_011080016.1|  PREDICTED: cytochrome P450 94A2-like               375   3e-118   
ref|XP_008790365.1|  PREDICTED: cytochrome P450 94A1-like               375   3e-118   
ref|XP_008393293.1|  PREDICTED: cytochrome P450 94A2-like               376   3e-118   
ref|NP_001067905.2|  Os11g0483000                                       377   3e-118   
ref|XP_009601037.1|  PREDICTED: cytochrome P450 94B3-like               375   4e-118   
ref|XP_001781706.1|  predicted protein                                  375   4e-118   
ref|XP_007162510.1|  hypothetical protein PHAVU_001G157900g             375   4e-118   
ref|XP_008360918.1|  PREDICTED: cytochrome P450 94A2-like               375   6e-118   
ref|XP_002300790.2|  hypothetical protein POPTR_0002s04340g             371   8e-118   
ref|XP_004980146.1|  PREDICTED: cytochrome P450 94A1-like               374   1e-117   
ref|XP_003553484.1|  PREDICTED: cytochrome P450 94A1-like               374   1e-117   
ref|XP_010504571.1|  PREDICTED: cytochrome P450 94B3-like               373   1e-117   
ref|XP_008382925.1|  PREDICTED: cytochrome P450 94A1-like               374   3e-117   
gb|KGN58177.1|  hypothetical protein Csa_3G585890                       373   3e-117   
ref|XP_002876375.1|  CYP94D2                                            372   4e-117   
ref|XP_009402805.1|  PREDICTED: cytochrome P450 94C1-like               369   5e-117   
gb|AHF22085.1|  CYP94A43                                                372   6e-117   
ref|XP_009337343.1|  PREDICTED: cytochrome P450 94A2-like               372   7e-117   
ref|XP_010673085.1|  PREDICTED: cytochrome P450 94A1-like               372   9e-117   
gb|KHN10717.1|  Cytochrome P450 94A1                                    368   1e-116   
ref|XP_008450099.1|  PREDICTED: cytochrome P450 94B3 isoform X2         370   1e-116   
ref|NP_001168221.1|  uncharacterized protein LOC100381980 precursor     371   1e-116   
ref|XP_004502138.1|  PREDICTED: cytochrome P450 94A2-like               371   2e-116   
emb|CBI21357.3|  unnamed protein product                                372   2e-116   
gb|ACG47870.1|  cytochrome P450 CYP94D27                                371   2e-116   
ref|XP_009594945.1|  PREDICTED: cytochrome P450 94A2-like               370   3e-116   
gb|ABC59092.1|  cytochrome P450 monooxygenase CYP94A14                  370   4e-116   
ref|XP_011087220.1|  PREDICTED: cytochrome P450 94A2-like               370   4e-116   
ref|XP_009346889.1|  PREDICTED: cytochrome P450 94A2-like               370   4e-116   
ref|NP_174713.1|  cytochrome P450, family 94, subfamily D, polype...    369   4e-116   
ref|NP_566155.1|  cytochrome P450, family 94, subfamily B, polype...    369   4e-116   
gb|ABK28430.1|  unknown                                                 369   4e-116   
tpg|DAA38877.1|  TPA: putative cytochrome P450 superfamily protein      371   5e-116   
emb|CDJ26544.1|  unnamed protein product                                370   5e-116   
gb|KFK37646.1|  hypothetical protein AALP_AA3G010200                    369   9e-116   
tpg|DAA38876.1|  TPA: putative cytochrome P450 superfamily protein      371   1e-115   
gb|AJD25223.1|  cytochrome P450 CYP94D47                                369   1e-115   
ref|XP_009337118.1|  PREDICTED: cytochrome P450 94A2-like               369   1e-115   
ref|XP_008678135.1|  PREDICTED: cytochrome P450 94B3                    370   1e-115   
ref|XP_007010545.1|  Cytochrome P450, putative                          368   1e-115   
ref|XP_003577084.2|  PREDICTED: cytochrome P450 94B3-like               368   2e-115   
ref|XP_008351912.1|  PREDICTED: cytochrome P450 94A2-like               369   2e-115   
ref|XP_001763206.1|  predicted protein                                  369   3e-115   
gb|KHN38650.1|  Cytochrome P450 94A1                                    361   3e-115   
ref|XP_010100076.1|  Cytochrome P450 94A1                               389   3e-115   
gb|KFK35660.1|  cytochrome p450                                         367   4e-115   
ref|XP_003577576.1|  PREDICTED: cytochrome P450 94B3                    368   4e-115   
ref|XP_008790364.1|  PREDICTED: cytochrome P450 94A1-like               366   7e-115   
ref|XP_006361761.1|  PREDICTED: cytochrome P450 94A2-like               366   8e-115   
ref|NP_001146262.1|  uncharacterized protein LOC100279836               365   9e-115   
tpg|DAA44138.1|  TPA: putative cytochrome P450 superfamily protein      366   1e-114   
gb|AFW85651.1|  putative cytochrome P450 superfamily protein            367   1e-114   
emb|CDY56777.1|  BnaAnng14430D                                          365   2e-114   
ref|XP_004970286.1|  PREDICTED: cytochrome P450 94A1-like               365   2e-114   
ref|XP_010651498.1|  PREDICTED: cytochrome P450 94A1-like               366   2e-114   
ref|XP_006482377.1|  PREDICTED: cytochrome P450 94A1-like               367   3e-114   
emb|CBX25250.1|  hypothetical_protein                                   365   3e-114   
ref|XP_004301073.1|  PREDICTED: cytochrome P450 94A1-like               364   4e-114   
ref|XP_006402968.1|  hypothetical protein EUTSA_v10005910mg             364   4e-114   
ref|XP_003564422.1|  PREDICTED: cytochrome P450 94B3                    365   4e-114   
ref|XP_002882162.1|  CYP94B2                                            364   6e-114   
sp|P98188.1|C94A2_VICSA  RecName: Full=Cytochrome P450 94A2; AltN...    364   7e-114   
ref|XP_008374734.1|  PREDICTED: cytochrome P450 94A2-like               364   8e-114   
ref|XP_002264277.2|  PREDICTED: cytochrome P450 86B1-like isoform X1    364   9e-114   
ref|XP_006577700.1|  PREDICTED: cytochrome P450 94A1-like               365   1e-113   
ref|XP_010935094.1|  PREDICTED: cytochrome P450 94A1-like               363   1e-113   
ref|XP_002439815.1|  hypothetical protein SORBIDRAFT_09g020650          363   1e-113   
emb|CAN63571.1|  hypothetical protein VITISV_008250                     363   2e-113   
gb|AAN05337.1|  Putative cytochrome P450                                363   3e-113   
ref|XP_006446254.1|  hypothetical protein CICLE_v10014886mg             363   3e-113   
dbj|BAJ90714.1|  predicted protein                                      363   3e-113   
ref|XP_009385300.1|  PREDICTED: cytochrome P450 94C1-like               359   3e-113   
ref|NP_001049423.1|  Os03g0223100                                       363   5e-113   
ref|XP_004962539.1|  PREDICTED: cytochrome P450 94A2-like               362   5e-113   
ref|XP_008808400.1|  PREDICTED: cytochrome P450 94A1-like               361   5e-113   
gb|KHN10718.1|  Cytochrome P450 94A1                                    358   9e-113   
ref|XP_010485350.1|  PREDICTED: cytochrome P450 94B3-like               361   1e-112   
gb|KEH23872.1|  cytochrome P450 family 94 protein                       360   1e-112   
ref|XP_004985159.1|  PREDICTED: cytochrome P450 94A1-like               360   3e-112   
ref|XP_006290956.1|  hypothetical protein CARUB_v10017072mg             360   3e-112   
ref|XP_002465625.1|  hypothetical protein SORBIDRAFT_01g042470          360   3e-112   
ref|XP_006644864.1|  PREDICTED: cytochrome P450 94A1-like               359   6e-112   
gb|EAY76187.1|  hypothetical protein OsI_04120                          358   1e-111   
ref|XP_009104013.1|  PREDICTED: cytochrome P450 94B3-like               358   1e-111   
ref|XP_004250943.1|  PREDICTED: cytochrome P450 94A2-like               359   1e-111   
ref|XP_006470738.1|  PREDICTED: cytochrome P450 94A1-like               359   1e-111   
gb|KDO44961.1|  hypothetical protein CISIN_1g047032mg                   358   2e-111   



>ref|XP_009618179.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana tomentosiformis]
Length=498

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/463 (75%), Positives = 416/463 (90%), Gaps = 6/463 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             ++KL +C+C++C AY++TSW +++ NLCDWYTHLL+NSP++TIHIHVL NTITANPENVE
Sbjct  34    KLKL-WCNCEICHAYVTTSWSSQFTNLCDWYTHLLQNSPTRTIHIHVLGNTITANPENVE  92

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+N+PKGK FS ILGDFLG+GIFNVDGD WRFQR+++S+ELG+ S+ SYAFEV+
Sbjct  93    YMLKTRFDNYPKGKTFSTILGDFLGRGIFNVDGDLWRFQRRMSSLELGKVSIRSYAFEVV  152

Query  1513  QTEIDRRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
               EI +RLLP+LA K +G V+D QDVFRRFSFD ICRFSFGLDPKCLES LP+SEFAVSF
Sbjct  153   HNEIQKRLLPLLANK-EGVVLDFQDVFRRFSFDNICRFSFGLDPKCLESSLPISEFAVSF  211

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              LASKLSAERAM+ SP+VWKIKRFLNIGSE++L+K+I+++N+LA EVIRQ+RKLG S  N
Sbjct  212   DLASKLSAERAMTTSPIVWKIKRFLNIGSERKLKKAIKLINILAQEVIRQKRKLGFS--N  269

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             H+DLLSRFMG+I D ETYLRDIVISFLLAGRDT+ASAL SFF++IANHP  A++I  EAD
Sbjct  270   HRDLLSRFMGTISD-ETYLRDIVISFLLAGRDTIASALISFFYVIANHPQVAKSIREEAD  328

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             RV+G N+DL + EQ M EL+YLQA++ ES+RL+PPIQFDSKFC+EDD+LPDGT VK+GTR
Sbjct  329   RVLGPNKDLKSCEQ-MSELHYLQASIYESMRLYPPIQFDSKFCLEDDILPDGTFVKKGTR  387

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGRME +WG D LEFKPERWL+DG+FFQENPFKYPVFQAGLRVCLGKEMAL+E
Sbjct  388   VTYHPYAMGRMEELWGCDSLEFKPERWLKDGIFFQENPFKYPVFQAGLRVCLGKEMALVE  447

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             +KSVALS+LRRF V LAQP+HTPRFSPGLTA+FR GL V V++
Sbjct  448   IKSVALSLLRRFNVELAQPYHTPRFSPGLTASFRGGLMVSVRE  490



>ref|XP_009588047.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana tomentosiformis]
Length=501

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/465 (75%), Positives = 409/465 (88%), Gaps = 9/465 (2%)
 Frame = -2

Query  1864  LFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYML  1685
             LF+C C++C++Y+S SW +K+ NLCDWYTHLL+ SP++TIHIHVL NTITANPEN+EYML
Sbjct  30    LFWCKCEICNSYISASWSSKFTNLCDWYTHLLKESPTRTIHIHVLGNTITANPENIEYML  89

Query  1684  KSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTE  1505
             K+RFENFPKGK FS ILGDFLG+GIFNVDGD W+FQRK+AS+ELGR+S+ SYAFEVI  E
Sbjct  90    KTRFENFPKGKTFSTILGDFLGRGIFNVDGDLWKFQRKMASLELGRNSIRSYAFEVIHNE  149

Query  1504  IDRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
             I +RLLP+LA   +KD   +DLQDVFRRFSFD ICRFSFGLDPKCLE  LP+SEFA+SF 
Sbjct  150   IQQRLLPLLACVAEKDES-LDLQDVFRRFSFDSICRFSFGLDPKCLELSLPISEFAISFD  208

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LAS+LSAERAM+ SP++WKIKRFLNIGSEK+L+K+I+++N+LA EVIRQRRKLG S  NH
Sbjct  209   LASQLSAERAMNVSPIIWKIKRFLNIGSEKKLKKAIKMINILAQEVIRQRRKLGFS--NH  266

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             KDLLSRFMG+I  +ETYLRDIVISFLLAGRDTVASALTSFFWLIA HP   E I  EAD+
Sbjct  267   KDLLSRFMGTIA-NETYLRDIVISFLLAGRDTVASALTSFFWLIARHPQVVEKIRNEADK  325

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
             V+GKN ++   EQ MREL+YLQA + ES+RLFPPIQFDSKFC+EDD LPDGT +K+GTR+
Sbjct  326   VIGKNHEITNCEQ-MRELHYLQATIYESMRLFPPIQFDSKFCLEDDFLPDGTFIKKGTRI  384

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             TYHPYAMGRME +WGSD LEFKPERW+ +DGVFFQENPFKYPVFQAG+RVCLGKEMAL+E
Sbjct  385   TYHPYAMGRMEALWGSDSLEFKPERWINKDGVFFQENPFKYPVFQAGVRVCLGKEMALVE  444

Query  613   LKSVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQR  482
             +KSVALS L+RF V L  P HHTPRFSPGLTA+FR GLPVFV+++
Sbjct  445   IKSVALSFLQRFHVELVHPSHHTPRFSPGLTASFRGGLPVFVREK  489



>ref|XP_009789882.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana sylvestris]
Length=493

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/463 (74%), Positives = 414/463 (89%), Gaps = 6/463 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             ++KL +C+C++C AY++TSW +++ NLCDWYTHLL+NSP++TIHIHVL NTITANPENVE
Sbjct  34    KLKL-WCNCEICHAYVTTSWSSQFTNLCDWYTHLLQNSPTRTIHIHVLGNTITANPENVE  92

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+N+PKGK FS ILGDFLG+GIFNVDGD WRFQR+++S+ELG+ S+ SYAFEV+
Sbjct  93    YMLKARFDNYPKGKTFSTILGDFLGRGIFNVDGDLWRFQRRMSSLELGKVSIRSYAFEVV  152

Query  1513  QTEIDRRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
              TEI +RLLP+LA K +G V+D QDVFRRFSFD ICRFSFGLDPKCLES LP+SEFA+SF
Sbjct  153   HTEIQKRLLPLLANK-EGAVLDFQDVFRRFSFDNICRFSFGLDPKCLESSLPISEFAISF  211

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              LASKLSAERAM+ SP+ WKIKRFLNIGSE++L+K+I+++N+LA EVIRQ+RKLG S  N
Sbjct  212   DLASKLSAERAMTTSPIAWKIKRFLNIGSERKLKKAIKLINILAQEVIRQKRKLGFS--N  269

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             H+DLLSRFMG+I D ETYLRDIVISFLLAGRDT+ASALTSFF++IAN+P  A++I  E D
Sbjct  270   HRDLLSRFMGTISD-ETYLRDIVISFLLAGRDTIASALTSFFYVIANNPKVAKSIRDEVD  328

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             RV+G N+DL   EQ M EL+YLQA++ ES+RL+PPIQFDSKFC+EDD+LPDGT VK+GTR
Sbjct  329   RVLGPNKDLTCCEQ-MNELHYLQASIYESMRLYPPIQFDSKFCLEDDILPDGTFVKKGTR  387

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGRME +WG D LEFKPERWL+DG+FFQENPFKYPVFQAGLRVCLGKEMAL+E
Sbjct  388   VTYHPYAMGRMEELWGCDSLEFKPERWLKDGIFFQENPFKYPVFQAGLRVCLGKEMALVE  447

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             +KSVALS+LRRF V LAQP+H PRFSPGLTA+FR GL V V++
Sbjct  448   IKSVALSLLRRFNVELAQPYHMPRFSPGLTASFRGGLMVSVRE  490



>ref|XP_009774133.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana sylvestris]
Length=501

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/463 (75%), Positives = 401/463 (87%), Gaps = 9/463 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             F+C C++C++Y+S SW +K+ NLCDWYT LL+ SP++TIHIHVL NTITANPENVEYMLK
Sbjct  31    FWCKCEICNSYISASWSSKFTNLCDWYTLLLKESPTRTIHIHVLGNTITANPENVEYMLK  90

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RFENFPKGK FS ILGDFLG+GIFNVDGD W+FQRK+AS+ELGRSS+ SYAFEVI  EI
Sbjct  91    TRFENFPKGKTFSTILGDFLGRGIFNVDGDLWKFQRKMASLELGRSSIRSYAFEVIHNEI  150

Query  1501  DRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
              +RLLP+LA    KD  ++DLQDVFRRFSFD ICRFSFGLDPK LE  LP+SEFA+SF L
Sbjct  151   QQRLLPLLACVANKD-EILDLQDVFRRFSFDSICRFSFGLDPKSLELSLPISEFALSFDL  209

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             AS+LSAERAM  SP++WKIKR LNIGSEK+L+K+I+ +N+LA EVIRQRRKLG S  NHK
Sbjct  210   ASQLSAERAMHMSPIIWKIKRLLNIGSEKKLKKAIKTINILAQEVIRQRRKLGFS--NHK  267

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFMG+I  +ETYLRDIVISFLLAGRDTVASALTSFFWL+A HP   E I  EAD+V
Sbjct  268   DLLSRFMGTIA-NETYLRDIVISFLLAGRDTVASALTSFFWLVARHPQVVEKIRDEADKV  326

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +GKN ++   EQ MREL+YLQA V ES+RLFPPIQFDSKFC+EDD LPDGT +K+GTRVT
Sbjct  327   IGKNHEITDCEQ-MRELHYLQATVYESMRLFPPIQFDSKFCLEDDFLPDGTFIKKGTRVT  385

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             Y+PYAMGRME +WGSD LEFKPERW+ +DGVFFQENPFKYPVFQAGLRVCLGKEMAL+E+
Sbjct  386   YYPYAMGRMEELWGSDSLEFKPERWINKDGVFFQENPFKYPVFQAGLRVCLGKEMALVEI  445

Query  610   KSVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQ  485
             KSV LS LRRF V L  P HHTPRFSPGLTA+FR GLPVFV++
Sbjct  446   KSVVLSFLRRFHVELVHPSHHTPRFSPGLTASFRGGLPVFVRE  488



>emb|CDP15392.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/463 (73%), Positives = 400/463 (86%), Gaps = 9/463 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C C +C AY+S+SW  K+ NLCDWYT+LL++SPS+TIH+HVL N ITANPENVEY+LK+
Sbjct  6     WCKCVICQAYVSSSWSVKFKNLCDWYTYLLQDSPSQTIHVHVLGNIITANPENVEYILKT  65

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RFEN+PKGK FS ILGDFLG+GIFNVDGD W+FQRK+AS+EL R S+ SYAF+V+Q EI+
Sbjct  66    RFENYPKGKPFSTILGDFLGRGIFNVDGDLWKFQRKMASLELCRISMRSYAFDVVQHEIE  125

Query  1498  RRLLPIL----AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              RL+P+L    AGK+D  V+D QDVFRRFSFDCICR SFGLDP+CLE  LP+SEFAV F 
Sbjct  126   NRLIPLLSSFAAGKEDR-VLDFQDVFRRFSFDCICRVSFGLDPRCLEISLPLSEFAVCFD  184

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LAS+LSAERAM+A+PV WK+KR LNIGSEKELRK+I+++N+LA EVIRQRRKLG S+  H
Sbjct  185   LASRLSAERAMTAAPVTWKVKRMLNIGSEKELRKAIQMINLLAKEVIRQRRKLGFSE--H  242

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             KDLLSRFMGS+  DETYLRDI+ISFLLAGRDTVAS LTSFFWL+ANHP+   AI  EADR
Sbjct  243   KDLLSRFMGSV-TDETYLRDIIISFLLAGRDTVASTLTSFFWLVANHPEVEAAIQREADR  301

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
             VVG  + L + EQ +REL YL AA+ ES+RL+PP+QFDSKFC+EDD+ PDGTAVK+GTRV
Sbjct  302   VVGPKEKLTSLEQ-LRELQYLHAAIFESMRLYPPVQFDSKFCLEDDIFPDGTAVKKGTRV  360

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             TYHPYAMGRME IWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAG RVCLGK+MAL+EL
Sbjct  361   TYHPYAMGRMENIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGQRVCLGKDMALVEL  420

Query  610   KSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             KSVA+S+LR F + LA+ H +PRFSPGLTATF  GLPV V+ +
Sbjct  421   KSVAISLLRNFHIVLAEAHQSPRFSPGLTATFHGGLPVLVRGK  463



>ref|XP_004249445.1| PREDICTED: cytochrome P450 94C1-like [Solanum lycopersicum]
Length=497

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/465 (73%), Positives = 409/465 (88%), Gaps = 7/465 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R+KL +C+C++C AY++TSW +++ NLCDWYTHLL+ SP++TIHIHVL N IT+N +NVE
Sbjct  35    RVKL-WCNCEICHAYITTSWSSQFINLCDWYTHLLKESPTRTIHIHVLGNIITSNTQNVE  93

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+N+PKGK FS ILGDFLG+GIFNVDGD WRFQ++++S+ELG+ S+ SYAFEV+
Sbjct  94    YMLKTRFDNYPKGKTFSTILGDFLGRGIFNVDGDLWRFQKRMSSLELGKVSIRSYAFEVV  153

Query  1513  QTEIDRRLLPILAG-KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
             + EID+RL+P+L   K+ GGV+D QDVFRRFSFDCICRFSFGLDPKCLES LPMS+FA+S
Sbjct  154   KNEIDKRLVPLLHEYKQGGGVLDFQDVFRRFSFDCICRFSFGLDPKCLESSLPMSQFALS  213

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F LASKLSA+RAM+ SP+VWKIKRF NIGSEKELR++I+V+N+LA EVIRQ+RKL  S  
Sbjct  214   FDLASKLSAKRAMTTSPIVWKIKRFFNIGSEKELREAIKVINILAQEVIRQKRKLAFS--  271

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             NH+DLLSRFMGSI D ETYLRDIVISFLLAGRDT+ASALTSFF++I N+P  A+AI  EA
Sbjct  272   NHRDLLSRFMGSISD-ETYLRDIVISFLLAGRDTIASALTSFFYVIGNNPQVAKAIREEA  330

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             +RV+G N+DL + EQ M EL+YLQA V ES+RL+PPIQFDSKFC+EDD L DGT VK+GT
Sbjct  331   NRVLGPNEDLTSYEQ-MSELHYLQACVYESMRLYPPIQFDSKFCLEDDFLLDGTFVKKGT  389

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYHPYAMGRME +WG D LEFKP+RWL+DGVF QENPFKYPVFQAGLRVCLGKEMAL+
Sbjct  390   RVTYHPYAMGRMEELWGCDALEFKPQRWLKDGVFVQENPFKYPVFQAGLRVCLGKEMALV  449

Query  616   ELKSVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQ  485
             E+KSVALS+LRRF V LAQP HH PRFSPGLTA+F+ GL V V+Q
Sbjct  450   EVKSVALSLLRRFHVELAQPYHHNPRFSPGLTASFKGGLLVSVRQ  494



>ref|XP_011094380.1| PREDICTED: cytochrome P450 94C1-like [Sesamum indicum]
Length=507

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/461 (73%), Positives = 399/461 (87%), Gaps = 6/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C++C  Y+ + W  ++ NLCDWY HLL+NSP++TIHIHVL NTITANP+NVEYMLK+
Sbjct  44    WCNCEICQTYIESRWTTQFGNLCDWYAHLLKNSPTRTIHIHVLNNTITANPDNVEYMLKT  103

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK FSAILGDFLG+GIFNVDGD WRFQRK+AS+ELGR+S+ +Y+F V+  EID
Sbjct  104   RFDNFPKGKPFSAILGDFLGRGIFNVDGDLWRFQRKMASLELGRTSIRAYSFRVVNQEID  163

Query  1498  RRLLPILAGKKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
             +RLLP+L     G  V+DLQDVFRRFSFD ICRFSFGLDPKCLE  LP+S+FAVSF LAS
Sbjct  164   QRLLPLLESVSAGNQVLDLQDVFRRFSFDSICRFSFGLDPKCLELSLPLSKFAVSFDLAS  223

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             KLSAERAM ASP+VWKIKR LNIGSEK+LR++I+++++LA EVIRQRRK   SD+N  DL
Sbjct  224   KLSAERAMIASPIVWKIKRLLNIGSEKQLRQAIKIVHLLAREVIRQRRKFSFSDQN--DL  281

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFM SI  DETYLRDI+ISFLLAGRD++ASALTSF WL+A H D   AIL EA++++G
Sbjct  282   LSRFMSSIS-DETYLRDIIISFLLAGRDSMASALTSFIWLVACHQDIEAAILIEAEKIIG  340

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
              NQDL + EQ +REL+YL AA+ ES+RL+PPIQFDSKFC+EDD+LPDG+ VKRGTRVTYH
Sbjct  341   PNQDLTSYEQ-LRELHYLHAAIYESMRLYPPIQFDSKFCLEDDLLPDGSFVKRGTRVTYH  399

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFF-QENPFKYPVFQAGLRVCLGKEMALLELKS  605
             PYAMGRME IWGSDCLEFKPERWLR+GVFF  ENPFKYPVFQAG+RVCLGKEMAL+ELK+
Sbjct  400   PYAMGRMEEIWGSDCLEFKPERWLRNGVFFPHENPFKYPVFQAGIRVCLGKEMALVELKT  459

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             VA+S+LR+F V LAQP  TPRFSPGLTATF DGL V V+ R
Sbjct  460   VAISLLRQFHVELAQPECTPRFSPGLTATFADGLRVLVRPR  500



>ref|XP_007027680.1| Cytochrome P450 94A1 [Theobroma cacao]
 gb|EOY08182.1| Cytochrome P450 94A1 [Theobroma cacao]
Length=538

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/460 (73%), Positives = 394/460 (86%), Gaps = 7/460 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
              +C+C++CSAY+++SW  ++ NLCDWYTHLL+NSP KTIHIHVL NTITANP+NVEYMLK
Sbjct  40    LWCNCEICSAYLASSWSRQFENLCDWYTHLLKNSPGKTIHIHVLGNTITANPDNVEYMLK  99

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             S F+NFPKGK FS ILGDFLG+GIFNVDGDSWRFQ+K+AS+ELG+ S+ SYAFE+I  EI
Sbjct  100   SNFDNFPKGKPFSMILGDFLGRGIFNVDGDSWRFQKKMASLELGKQSIRSYAFEIINCEI  159

Query  1501  DRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RL+P+L   A  K+  V+DLQDVFRRFSFD ICRFSFGLDP+CLE  LPMS+FA +F 
Sbjct  160   IDRLIPLLSSVATGKEQRVLDLQDVFRRFSFDSICRFSFGLDPRCLELSLPMSKFATAFD  219

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERAM+ASP+VWKIKR LNIGSEK+L+K+++++N+LA EVIRQRRK+G     H
Sbjct  220   LASKLSAERAMTASPLVWKIKRMLNIGSEKQLKKAVKIINILAKEVIRQRRKMGFL--TH  277

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFM ++ +DETYLRDIVISFLLAGRDTVAS LTS FWL+A HP    AI  EADR
Sbjct  278   NDLLSRFMCTV-NDETYLRDIVISFLLAGRDTVASGLTSLFWLLAKHPKVGSAIRQEADR  336

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
             V+G+NQ++ + EQ M+EL+YLQAAV ES+RL+PPIQFDSKFC EDD LPDG+ +KRGTRV
Sbjct  337   VIGQNQEMTSFEQ-MKELHYLQAAVYESMRLYPPIQFDSKFCQEDDTLPDGSFLKRGTRV  395

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             TYHPYAMGR+E IWG DCLEFKPERWLR+GVF  ENPFKYPVFQAG RVCLGKEMAL+EL
Sbjct  396   TYHPYAMGRIEEIWGPDCLEFKPERWLRNGVFSPENPFKYPVFQAGFRVCLGKEMALVEL  455

Query  610   KSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFV  491
             KSVALS++RRF++ L  PH TPRFSPGLTATF  GLPV  
Sbjct  456   KSVALSLVRRFQIELVAPHRTPRFSPGLTATFSGGLPVLT  495



>ref|XP_002277129.2| PREDICTED: cytochrome P450 94C1 [Vitis vinifera]
Length=509

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/467 (72%), Positives = 408/467 (87%), Gaps = 9/467 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R+KL +C+C++C +Y++ SW  +++NLCDWYTHLLRNSP++TIH+HVL NTITAN +NVE
Sbjct  46    RLKL-WCNCEICHSYVTLSWSKQFHNLCDWYTHLLRNSPTQTIHVHVLGNTITANQDNVE  104

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RFEN+PKGK FSAILGDFLG+GIFNVDG+ WRFQRK+AS+ELGR+S+ SYAFE++
Sbjct  105   YMLKTRFENYPKGKPFSAILGDFLGRGIFNVDGELWRFQRKMASLELGRTSIRSYAFEIV  164

Query  1513  QTEIDRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
               EI+RRLLP+L   AG +DG V+DLQDVFRRFSFD ICRFSFGLDP CLE  LP+SEFA
Sbjct  165   NYEIERRLLPLLWSVAGNEDG-VLDLQDVFRRFSFDSICRFSFGLDPGCLELSLPISEFA  223

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
              +F LASKLSA RAM+ASP+VW+IKR LN+G+EK+LRK+I+++N+LA EVI+Q+RK+G S
Sbjct  224   DAFDLASKLSAARAMAASPLVWRIKRVLNLGTEKKLRKAIKLINILAQEVIKQKRKMGFS  283

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                HKDLLS FM ++ DD TYLRDIVISFLLAGRDTVASALTSFFWL++NHP    AI +
Sbjct  284   --AHKDLLSLFMRNLNDD-TYLRDIVISFLLAGRDTVASALTSFFWLLSNHPKVGAAIRS  340

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             EAD+++G +Q++ + EQ M+EL+YLQAAV ES+RL+PPIQFDSKFC EDDVLPDGT V+R
Sbjct  341   EADKIIGPDQEVTSFEQ-MQELHYLQAAVHESMRLYPPIQFDSKFCQEDDVLPDGTFVQR  399

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGR+EGIWG DCLEFKPERWL+DGVFF ENPFKYPVFQAG+RVCLGKEMA
Sbjct  400   GTRVTYHPYAMGRIEGIWGPDCLEFKPERWLKDGVFFPENPFKYPVFQAGIRVCLGKEMA  459

Query  622   LLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L+E KSVALS++RRF + LA P   PRFSPGLTATF  GLPV V+ R
Sbjct  460   LMEFKSVALSLVRRFHIELATPCPIPRFSPGLTATFGSGLPVLVRGR  506



>ref|XP_002533544.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF28834.1| cytochrome P450, putative [Ricinus communis]
Length=501

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/470 (71%), Positives = 400/470 (85%), Gaps = 7/470 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R+KL  C+C++C AY++ SW  ++NNLCDWY HLL++SP+KTIHIHVL NTITANPENVE
Sbjct  37    RLKL-RCNCEICEAYLTLSWTKQFNNLCDWYAHLLKSSPTKTIHIHVLGNTITANPENVE  95

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+N+PKGK FS ILG+FLG+GIFNVDGDSWRFQ+K+AS+EL R S+  YAFE++
Sbjct  96    YMLKTRFDNYPKGKPFSTILGNFLGRGIFNVDGDSWRFQKKMASLELDRFSIRMYAFEIV  155

Query  1513  QTEIDRRLLPILAG--KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAV  1340
               EI+ RL+P+L+     +GGV+DLQDVFRRFSFD ICRFSFGLDP+CLE  LP+SEFAV
Sbjct  156   LYEIEHRLVPLLSSVSGNEGGVLDLQDVFRRFSFDSICRFSFGLDPRCLEPTLPISEFAV  215

Query  1339  SFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD  1160
             +F LASKLSAERAM  SP+VWKIKR LN+GSEK++++++ V+N+LA EVIRQ+R +G   
Sbjct  216   AFDLASKLSAERAMVVSPLVWKIKRKLNLGSEKKMKEAMTVINILAQEVIRQKRIMGFL-  274

Query  1159  ENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
              +HKDLLSRFM ++ +DETYLRDIVISFLLAGRDTVASALTS FWL+ANHP+ + AIL E
Sbjct  275   -SHKDLLSRFMQTV-NDETYLRDIVISFLLAGRDTVASALTSLFWLLANHPEVSSAILLE  332

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             ADRV+G NQ+L + EQ M++L+YLQA V ES+RL+PPIQFDSKFC EDD LPDGT V RG
Sbjct  333   ADRVLGPNQELTSYEQ-MKDLHYLQATVYESMRLYPPIQFDSKFCQEDDTLPDGTFVNRG  391

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
             TRVTYHPYAMGRME +WG DCLEFKPERWLR+G FF ENPFKYPVFQAGLRVCLGKEMAL
Sbjct  392   TRVTYHPYAMGRMEDLWGQDCLEFKPERWLRNGTFFNENPFKYPVFQAGLRVCLGKEMAL  451

Query  619   LELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR*CPP  470
             LELKSVA+S+LR+F + L   + TPRFSPGLTATF  GLPV V+     P
Sbjct  452   LELKSVAISLLRKFHIELETSYRTPRFSPGLTATFSGGLPVVVRSSKVNP  501



>emb|CAN67559.1| hypothetical protein VITISV_002257 [Vitis vinifera]
Length=527

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/463 (73%), Positives = 405/463 (87%), Gaps = 9/463 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R+KL +C+C++C +Y++ SW  +++NLCDWYTHLLRNSP++TIH+HVL NTITAN +NVE
Sbjct  40    RLKL-WCNCEICHSYVTLSWSKQFHNLCDWYTHLLRNSPTQTIHVHVLGNTITANQDNVE  98

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RFEN+PKGK FSAILGDFLG+GIFNVDG+ WRFQRK+AS+ELGR+S+ SYAFE++
Sbjct  99    YMLKTRFENYPKGKPFSAILGDFLGRGIFNVDGELWRFQRKMASLELGRTSIRSYAFEIV  158

Query  1513  QTEIDRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
               EI+RRLLP+L   AG +DG V+DLQDVFRRFSFD ICRFSFGLDP CLE  LP+SEFA
Sbjct  159   NYEIERRLLPLLWSVAGNEDG-VLDLQDVFRRFSFDSICRFSFGLDPGCLELSLPISEFA  217

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
              +F LASKLSA RAM+ASP+VW+IKR LN+G+EK+LRK+I+++N+LA EVI+Q+RK+G S
Sbjct  218   DAFDLASKLSAARAMAASPLVWRIKRVLNLGTEKKLRKAIKLINILAQEVIKQKRKMGFS  277

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                HKDLLS FM ++ DD TYLRDIVISFLLAGRDTVASALTSFFWL++NHP    AI +
Sbjct  278   --AHKDLLSLFMRNLNDD-TYLRDIVISFLLAGRDTVASALTSFFWLLSNHPKVGAAIRS  334

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             EAD+++G +Q++ + EQ M+EL+YLQAAV ES+RL+PPIQFDSKFC EDDVLPDGT V+R
Sbjct  335   EADKIIGPDQEVTSFEQ-MQELHYLQAAVHESMRLYPPIQFDSKFCQEDDVLPDGTFVQR  393

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGR+EGIWG DCLEFKPERWL+DGVFF ENPFKYPVFQAG+RVCLGKEMA
Sbjct  394   GTRVTYHPYAMGRIEGIWGPDCLEFKPERWLKDGVFFPENPFKYPVFQAGIRVCLGKEMA  453

Query  622   LLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVF  494
             L+E KSVALS++RRF + LA P   PRFSPGLTATF  GLPV 
Sbjct  454   LMEFKSVALSLVRRFHIELATPCPIPRFSPGLTATFGSGLPVL  496



>ref|XP_011077931.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94C1-like [Sesamum 
indicum]
Length=501

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/460 (72%), Positives = 393/460 (85%), Gaps = 14/460 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CD+C +Y+ + W  ++ NLCDWY HLLRNSP++TIHIHVL NTITANP+NVEYMLK+
Sbjct  41    WCTCDICQSYIESRWAVQFPNLCDWYAHLLRNSPTRTIHIHVLNNTITANPDNVEYMLKT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK FSAILGDFLG+GIFNVDGDSWRFQRK+AS+ELGR S+ ++AFEV+  EID
Sbjct  101   RFDNFPKGKPFSAILGDFLGRGIFNVDGDSWRFQRKMASLELGRVSIGAFAFEVVHQEID  160

Query  1498  RRLLPILAGKKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
             RRL+P++     G  V+DLQDVFRRFSFDCICRFSFGLDPKCLE  LP+SEFAVSF LAS
Sbjct  161   RRLIPLMESVSGGEEVLDLQDVFRRFSFDCICRFSFGLDPKCLELSLPLSEFAVSFDLAS  220

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             KLSAERAM+ASP+VWKIKR LNIGSE+++R++I+++N+LA EVIRQRRK G SD+  KDL
Sbjct  221   KLSAERAMTASPLVWKIKRLLNIGSERKIRRAIKIINVLAHEVIRQRRKFGFSDQ--KDL  278

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFM SI DD+ YLRDIVISFLLAGRDTVASALT+FFWL++ HP+   AIL        
Sbjct  279   LSRFMSSISDDK-YLRDIVISFLLAGRDTVASALTTFFWLVSRHPEVEAAIL--------  329

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
              +Q L + EQ MREL+YL A+V ES+RL+PPIQFDSKFC EDDVLPDG+ VKRGTRVTYH
Sbjct  330   -HQXLTSHEQ-MRELHYLHASVYESMRLYPPIQFDSKFCSEDDVLPDGSFVKRGTRVTYH  387

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             PYAMGRME IWG DC EF+PERWLRDGVF+ ENPFKYPVFQAG+RVCLGKEMAL+ELKSV
Sbjct  388   PYAMGRMEEIWGPDCSEFRPERWLRDGVFWPENPFKYPVFQAGIRVCLGKEMALVELKSV  447

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             A+++LRR+R+ LA P  TPRFSPGLTAT+ DGL   +  R
Sbjct  448   AITLLRRYRLELAHPQPTPRFSPGLTATYGDGLRARIHPR  487



>ref|XP_007203184.1| hypothetical protein PRUPE_ppa025166mg, partial [Prunus persica]
 gb|EMJ04383.1| hypothetical protein PRUPE_ppa025166mg, partial [Prunus persica]
Length=478

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/475 (70%), Positives = 403/475 (85%), Gaps = 11/475 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R KL+YC+C++C AY+++ W  K++NLCDWY HLLR+SP+KTIHIHVLRNTITANPENVE
Sbjct  5     RSKLWYCNCEICHAYVTSCWSLKFDNLCDWYAHLLRDSPTKTIHIHVLRNTITANPENVE  64

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RFEN+PKGK FSAILGDFLGQGIFNVDG SWRFQRK+AS+EL R SV S+AFE++
Sbjct  65    YMLKTRFENYPKGKPFSAILGDFLGQGIFNVDGHSWRFQRKMASLELDRHSVRSFAFEIV  124

Query  1513  QTEIDRRLLPIL---AGKKDGG--VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSE  1349
               EI+ RL+P+L   +   DGG  V+DLQDVF+RFSFD IC+FSFGLDP CLE  LP+S+
Sbjct  125   SHEIEHRLIPLLSSFSSSHDGGGSVLDLQDVFKRFSFDSICKFSFGLDPMCLELSLPLSK  184

Query  1348  FAVSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLG  1169
             FAV+F +AS+LSA+RAM+ASP++WKIKR  N+GSEK+L++SI ++++LA EVI ++R+ G
Sbjct  185   FAVAFDMASQLSAKRAMTASPLIWKIKRIFNLGSEKQLKESINMIDLLAKEVIARKRETG  244

Query  1168  TSDENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAI  989
              S +  KDLLSRFM S+ +DETYLRDIVISFLLAGRDTVASALTSFFWL+  HP AA A+
Sbjct  245   FSTQ--KDLLSRFMRSV-EDETYLRDIVISFLLAGRDTVASALTSFFWLMGTHPAAASAV  301

Query  988   LAEADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
               EADRV+G NQ L   EQ M EL+YLQAA+ ES+RLFPPIQFDSKFC +DDVLPDGT+V
Sbjct  302   RVEADRVLGPNQGLKNFEQ-MHELHYLQAAIYESMRLFPPIQFDSKFCAQDDVLPDGTSV  360

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKE  629
             ++GTRVTYHPYAMGR++ IWGSDC+EFKPERWL+D VFF E+PFKYPVFQ GLRVCLGKE
Sbjct  361   RKGTRVTYHPYAMGRIQDIWGSDCMEFKPERWLKDSVFFTEDPFKYPVFQPGLRVCLGKE  420

Query  628   MALLELKSVALSVLRRFRVH--LAQPHHTPRFSPGLTATFRDGLPVFVQQR*CPP  470
             MAL+E+K+VALS+LRRF +H    +    PRFSPGLTATF DGLPV V++R   P
Sbjct  421   MALMEMKTVALSLLRRFSIHPVTHELSRVPRFSPGLTATFSDGLPVLVRERKTQP  475



>ref|XP_006341239.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=615

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/463 (72%), Positives = 393/463 (85%), Gaps = 7/463 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             F C C++C  Y+++SWY ++ NLCDWYTHLL+ SP++TIHIHVL NTITANP NVEYMLK
Sbjct  151   FLCKCEICQCYITSSWYPQFTNLCDWYTHLLQKSPTRTIHIHVLGNTITANPRNVEYMLK  210

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RFENFPKGK FS ILGDFLG+GIFNVDGD WRFQRK+AS+EL R+S+ S+AF+V+ TEI
Sbjct  211   TRFENFPKGKNFSTILGDFLGRGIFNVDGDLWRFQRKMASLELRRNSIRSFAFDVMNTEI  270

Query  1501  DRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
               RL+P+LA        ++DLQDVFRRFSFDCICRFSFGLDPKCLE  LP+S+FA+SF L
Sbjct  271   QNRLIPLLACVANNKDEILDLQDVFRRFSFDCICRFSFGLDPKCLELSLPISQFAISFDL  330

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             AS+LSA+RAM  S +VWKIKRF NIGSE++L+K+I+++N+LA EVIRQRRKLG S  NHK
Sbjct  331   ASQLSAKRAMHVSSIVWKIKRFFNIGSERKLKKAIKLINILAQEVIRQRRKLGFS--NHK  388

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM     +ETYLRDIVISFLLAGRDTVASA TS FWL+A +P  AE I  EA+ V
Sbjct  389   DLLSRFMQGDIVNETYLRDIVISFLLAGRDTVASASTSLFWLLAENPRVAERIRDEANEV  448

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +G NQ+L + EQ +R+L+YLQA V ES+RL+PPIQFDSKFC+EDD LPDGT VK+GTRVT
Sbjct  449   LGLNQELTSCEQ-LRDLHYLQACVYESMRLYPPIQFDSKFCLEDDFLPDGTFVKKGTRVT  507

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             YHPYAMGRME +WG DCLEFKPERW+ +DGVFFQENP+KYPVFQAG+RVCLGKEMAL+EL
Sbjct  508   YHPYAMGRMEELWGVDCLEFKPERWINKDGVFFQENPYKYPVFQAGVRVCLGKEMALVEL  567

Query  610   KSVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQ  485
             KS+ALS LRRF V LA P H  PRFSPGLTA+ R GLPVFV++
Sbjct  568   KSMALSFLRRFNVELAHPSHQIPRFSPGLTASLRGGLPVFVRE  610



>ref|XP_006341238.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=496

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/463 (71%), Positives = 392/463 (85%), Gaps = 7/463 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             F C C++C  YM++SWY ++ NLCDWYTHLL+ SP++TIHIHVL NTITANP+NVEYMLK
Sbjct  32    FLCKCEICQCYMTSSWYPQFTNLCDWYTHLLQKSPTRTIHIHVLGNTITANPKNVEYMLK  91

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+NFPKGK FS ILGDFLG+GIFNVDGD W+FQRK+AS+EL R+S+ S+AF+V+  EI
Sbjct  92    TRFDNFPKGKNFSTILGDFLGRGIFNVDGDLWQFQRKMASLELRRNSIRSFAFDVMNNEI  151

Query  1501  DRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
               RL+P+LA        ++DLQDVFRRFSFDCICRFSFGLDPKCLE  LP+S+FA+SF L
Sbjct  152   QNRLIPLLACVANNKDKILDLQDVFRRFSFDCICRFSFGLDPKCLELSLPISQFAISFDL  211

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             AS+LSA+RAM  S +VWKIKRF NIGSE++L+K+I+++N+LA EVIRQRRKLG S  NHK
Sbjct  212   ASQLSAKRAMHVSSIVWKIKRFFNIGSERKLKKAIKLINILAQEVIRQRRKLGFS--NHK  269

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM     +ETYLRDIVISFLLAGRDTVAS  TS FWL+A +P  AE I  EA+ V
Sbjct  270   DLLSRFMQGDIVNETYLRDIVISFLLAGRDTVASTSTSLFWLLAENPRVAERIREEANEV  329

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +G NQ+L + EQ +R+L+YLQA V ES+RL+PPIQFDSKFC+EDD LPDGT VK+GTRVT
Sbjct  330   LGLNQELTSCEQ-LRDLHYLQACVYESMRLYPPIQFDSKFCLEDDFLPDGTFVKKGTRVT  388

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             YHPYAMGRME +WG DCLEFKPERW+ +DGVFFQENP+KYPVFQAG+RVCLGKEMAL+EL
Sbjct  389   YHPYAMGRMEELWGVDCLEFKPERWINKDGVFFQENPYKYPVFQAGVRVCLGKEMALVEL  448

Query  610   KSVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQ  485
             KS+ LS LRRF V LA P HH PRFSPGLTA+F  GLPVFV++
Sbjct  449   KSMTLSFLRRFHVELAHPSHHIPRFSPGLTASFCGGLPVFVRE  491



>ref|XP_006430255.1| hypothetical protein CICLE_v10013425mg [Citrus clementina]
 gb|ESR43495.1| hypothetical protein CICLE_v10013425mg [Citrus clementina]
Length=463

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/468 (70%), Positives = 401/468 (86%), Gaps = 10/468 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             ++KL +C+C++C  Y++ SW  +++NLCDWY HLL  SP+KTIHIHVL NTITANP+NVE
Sbjct  2     KLKL-WCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVE  60

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+NFPKGK FS ILGDFLG+GIFNVDGDSWRFQ+++AS+EL R S+ SYA E++
Sbjct  61    YMLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIV  120

Query  1513  QTEIDRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
               EI  RL+P+L   AGK+DG V+DLQDVF+RFSFD +C+FSFGLDP+CLE  LPMS+FA
Sbjct  121   NQEIKTRLIPLLSSVAGKEDG-VLDLQDVFKRFSFDSMCKFSFGLDPRCLELSLPMSDFA  179

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
             V+F LASKLSAERAM+ SP+VWKIKR LN+GSEK+L+++I+++++LA+EVI+QRRK+G S
Sbjct  180   VAFDLASKLSAERAMTVSPLVWKIKRMLNLGSEKQLKEAIKMIDLLALEVIKQRRKMGFS  239

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                HKDLLSRFM S+ DD TYLRDIVISFLLAGRDTVASALTSF WL+  +P     I A
Sbjct  240   --THKDLLSRFMSSVNDD-TYLRDIVISFLLAGRDTVASALTSFVWLLGKNPRVCSEIRA  296

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             EADR++G+NQ+L + +Q +REL+YLQAAV ES RL+PPIQFDSKFC EDDVLPDGT VK+
Sbjct  297   EADRILGQNQELTSFDQ-LRELHYLQAAVYESTRLYPPIQFDSKFCEEDDVLPDGTYVKK  355

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGRM  IWG +CLEFKPERWL++G+F  ENP+KYPVFQAG RVCLGKEMA
Sbjct  356   GTRVTYHPYAMGRMREIWGQNCLEFKPERWLKNGLFLPENPYKYPVFQAGFRVCLGKEMA  415

Query  622   LLELKSVALSVLRRFRVHLAQPHH-TPRFSPGLTATFRDGLPVFVQQR  482
             L+E+K VALS++R+F++HL  P+  TPRFSPGLTATF  GLPV +QQR
Sbjct  416   LVEIKIVALSLVRQFQIHLVSPYRATPRFSPGLTATFSGGLPVLLQQR  463



>ref|XP_008241266.1| PREDICTED: cytochrome P450 94C1-like [Prunus mume]
Length=497

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/470 (70%), Positives = 399/470 (85%), Gaps = 11/470 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R KL+YC+C++C AY+++ W  K++NLCDWY HLLR+SP+KTIHIHVLRNTITANPENVE
Sbjct  24    RSKLWYCNCEICHAYVTSCWSLKFDNLCDWYAHLLRDSPTKTIHIHVLRNTITANPENVE  83

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RFEN+PKGK FSAILGDFLGQGIFNVDG SWRFQRK+AS+ELGR SV S+AFE++
Sbjct  84    YMLKTRFENYPKGKPFSAILGDFLGQGIFNVDGHSWRFQRKMASLELGRHSVRSFAFEIV  143

Query  1513  QTEIDRRLLPIL-----AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSE  1349
               EI+RRL+P+L     +    G V+DLQDVF+RFSFD IC+FSFGLDP CLE  LP+S+
Sbjct  144   SHEIERRLIPLLSSFSSSDDGGGSVLDLQDVFKRFSFDSICKFSFGLDPMCLELSLPLSK  203

Query  1348  FAVSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLG  1169
             FAV+F +AS+LSA+RAM+ASP++WKIKR  N+GSEK+L++SI ++++LA EVI ++R+ G
Sbjct  204   FAVAFDMASQLSAKRAMTASPLIWKIKRIFNLGSEKQLKESINMIDLLAKEVIARKRETG  263

Query  1168  TSDENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAI  989
              S +  KDLLSRFM S+ +DETYLRDIVISFLLAGRDTVASALTSFFWL+  HP  A A+
Sbjct  264   FSTQ--KDLLSRFMRSV-EDETYLRDIVISFLLAGRDTVASALTSFFWLMGTHPTVASAV  320

Query  988   LAEADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
               EADRV+G NQ L   EQ M EL+YLQAA+ ES+RLFPPIQFDSKFC +DDVLPDGT V
Sbjct  321   RVEADRVLGPNQGLKNFEQ-MHELHYLQAAIYESMRLFPPIQFDSKFCAQDDVLPDGTFV  379

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKE  629
             ++GTRVTYHPYAMGR++ IWGSDC+EFKPERWL+D VFF E+PFKYPVFQ GLRVCLGKE
Sbjct  380   RKGTRVTYHPYAMGRIQDIWGSDCMEFKPERWLKDSVFFTEDPFKYPVFQPGLRVCLGKE  439

Query  628   MALLELKSVALSVLRRFRVH--LAQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             MAL+E+K+VALS+LRRF +H    +    PRFSPGLTATF DGLPV V++
Sbjct  440   MALMEMKTVALSLLRRFNIHPVTHELGRVPRFSPGLTATFSDGLPVLVRE  489



>gb|KDP42721.1| hypothetical protein JCGZ_23661 [Jatropha curcas]
Length=515

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/467 (72%), Positives = 399/467 (85%), Gaps = 9/467 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R+KL +C+C+VC AY++ SW  ++ NLCDWY HLL+NSPSKTIHIHVL N ITANPENVE
Sbjct  38    RLKL-WCNCEVCDAYLTLSWTKQFVNLCDWYAHLLKNSPSKTIHIHVLGNIITANPENVE  96

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             Y+LK+RFEN+PKGK FS ILGDFLGQGIFNVDGD WRFQRK+AS+EL R S+ SYAF++I
Sbjct  97    YILKTRFENYPKGKPFSTILGDFLGQGIFNVDGDLWRFQRKMASLELDRFSIRSYAFDII  156

Query  1513  QTEIDRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAV  1340
             + EI+ RL+P+L     K+  V+DLQDVFRRFSFD ICRFSFG+DP+CLE  LP+S+FAV
Sbjct  157   RFEIEDRLIPLLKSISIKEDRVIDLQDVFRRFSFDSICRFSFGIDPRCLEITLPISDFAV  216

Query  1339  SFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD  1160
             +F LASKLSAERAM+ SP++WKIKR  N+G+EK+++++I+++N+LA EVIRQRRK+G   
Sbjct  217   AFDLASKLSAERAMTVSPLIWKIKRMFNLGTEKKMKEAIKLINILAQEVIRQRRKMGFL-  275

Query  1159  ENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
              + KDLLSRFM ++ DD TYLRDIVISFLLAGRDTVASALTSFFWL+AN+P    AIL E
Sbjct  276   -SQKDLLSRFMHTVNDD-TYLRDIVISFLLAGRDTVASALTSFFWLLANYPQVRLAILDE  333

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             AD+V+G NQ+L  S Q++R+L+YLQAAV ES+RL+PPIQFDSKFC EDD LPDGT VK+G
Sbjct  334   ADKVLGLNQEL-KSFQQLRDLHYLQAAVYESMRLYPPIQFDSKFCEEDDFLPDGTFVKKG  392

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLR-DGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYHPYAMGR+E IWG DCLEFKPERWLR DG+FF ENPFKYPVFQAGLRVCLGKEMA
Sbjct  393   TRVTYHPYAMGRIEEIWGQDCLEFKPERWLRDDGIFFPENPFKYPVFQAGLRVCLGKEMA  452

Query  622   LLELKSVALSVLRRFRVHL-AQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             LLELK VA+S+LRRF   L    +HTPRFSPGLTATF  GLPV V++
Sbjct  453   LLELKCVAISLLRRFHFDLITTTYHTPRFSPGLTATFSGGLPVLVRE  499



>ref|XP_010049665.1| PREDICTED: cytochrome P450 94C1-like [Eucalyptus grandis]
 gb|KCW89218.1| hypothetical protein EUGRSUZ_A01523 [Eucalyptus grandis]
Length=496

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/460 (70%), Positives = 393/460 (85%), Gaps = 7/460 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
              +C+C++C  Y+S  W   Y NLCDWY HLLR+SP+KT+HIHVL NTIT NP+NVEYMLK
Sbjct  40    LWCNCEICQTYLSLGWSKSYVNLCDWYAHLLRSSPTKTVHIHVLGNTITGNPDNVEYMLK  99

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RFENFPKGK FS ILGDFLGQGIFNVDGDSW+FQ+K+A++EL R ++ SYAFE+++ EI
Sbjct  100   TRFENFPKGKPFSTILGDFLGQGIFNVDGDSWKFQKKMANLELDRFAIRSYAFEIVKCEI  159

Query  1501  DRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
             + RL+ + +    ++GGV+DLQDVF+RFSFDCICRFSFGLDP+CLE  LPMSEFA+SF L
Sbjct  160   ENRLVALFSSVAGQEGGVLDLQDVFKRFSFDCICRFSFGLDPRCLELSLPMSEFALSFDL  219

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             ASKLSAERAM ASP+VWKIKR  NIGSEK L+++I ++N+LA+EVI+Q+RK+G S  NH+
Sbjct  220   ASKLSAERAMEASPLVWKIKRAFNIGSEKRLKEAINMINILALEVIKQKRKIGFS--NHR  277

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM ++ D ETYLRDI++SFLLAGRDTVASALTSFFWLIA +P     I AE DRV
Sbjct  278   DLLSRFMCTVSD-ETYLRDIIVSFLLAGRDTVASALTSFFWLIAKNPQVLSKIHAELDRV  336

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +G +Q+L++ +Q +REL YLQAA+ ES+RL+PPIQFDSKFC ++D+LPDGT VKRGTRVT
Sbjct  337   MG-DQELVSYDQ-IRELPYLQAAIYESMRLYPPIQFDSKFCEDNDILPDGTFVKRGTRVT  394

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YHPYAMGR+E IWG DCLE+KPERWL++G+FF ENP+KYPVFQAGLRVCLGKEMALLELK
Sbjct  395   YHPYAMGRIEDIWGPDCLEYKPERWLKNGIFFAENPYKYPVFQAGLRVCLGKEMALLELK  454

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQ  488
             SVA+S+LRRF++ L  P    RFSPGLTAT R GLPV V+
Sbjct  455   SVAVSLLRRFQIELVTPDQVIRFSPGLTATIRGGLPVVVR  494



>ref|XP_006481811.1| PREDICTED: cytochrome P450 94A1-like isoform X1 [Citrus sinensis]
Length=504

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/468 (69%), Positives = 400/468 (85%), Gaps = 10/468 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             ++KL +C+C++C  Y++ SW  +++NLCDWY HLL  SP+KTIHIHVL NTITANP+NVE
Sbjct  43    KLKL-WCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVE  101

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+NFPKGK FS ILGDFLG+GIFNVDGDSWRFQ+++AS+EL R S+ SYA E++
Sbjct  102   YMLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIV  161

Query  1513  QTEIDRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
               EI  RL+P+L   AGK+DG V+DLQDVF+RFSFD +C+FSFGLDP+CLE  LPMS+FA
Sbjct  162   NQEIKTRLIPLLSSVAGKEDG-VLDLQDVFKRFSFDSMCKFSFGLDPRCLELSLPMSDFA  220

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
             V+F LASKLSAERAM+ SP+VWKIKR LN+GSEK+L+++I+++++LA+EVI+QRRK+G S
Sbjct  221   VAFDLASKLSAERAMTVSPLVWKIKRMLNLGSEKQLKEAIKMIDLLALEVIKQRRKMGFS  280

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                HKDLLSRFM S+ DD TYLRDIVISFLLAGRDTVASALTSF WL+  +P     I A
Sbjct  281   --THKDLLSRFMSSVNDD-TYLRDIVISFLLAGRDTVASALTSFVWLLGKNPRVCSEIRA  337

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             EADR++G+NQ+L + +Q +REL+YLQAAV ES RL+PPIQFDSKFC EDDVLPDGT VK+
Sbjct  338   EADRILGQNQELTSFDQ-LRELHYLQAAVSESTRLYPPIQFDSKFCEEDDVLPDGTYVKK  396

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGRM  IWG +CLEF PERWL++GVF  ENP+KYPVFQAG RVCLGKEMA
Sbjct  397   GTRVTYHPYAMGRMREIWGQNCLEFNPERWLKNGVFLPENPYKYPVFQAGFRVCLGKEMA  456

Query  622   LLELKSVALSVLRRFRVHLAQPH-HTPRFSPGLTATFRDGLPVFVQQR  482
             L+E+KSVALS++R+F++ L  P+ + PRFSPGLTATF  GLPV +QQR
Sbjct  457   LVEIKSVALSLVRQFQIQLMSPYRNIPRFSPGLTATFNGGLPVLLQQR  504



>ref|XP_010097640.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXC43583.1| Cytochrome P450 94A1 [Morus notabilis]
Length=508

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/473 (70%), Positives = 396/473 (84%), Gaps = 19/473 (4%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R +  +C+C++C  Y+++SW  ++ NLCDWY+HLL  SP+KTIHIHVL N +TANP NVE
Sbjct  30    RQRYLWCNCEICHVYLTSSWTKQFANLCDWYSHLLSKSPTKTIHIHVLGNIVTANPNNVE  89

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+NFPKGK FSAILGDFLG GIFNVDGDSWRFQRK+A +EL R S+ S+AFE++
Sbjct  90    YMLKTRFDNFPKGKPFSAILGDFLGHGIFNVDGDSWRFQRKMARLELDRYSIRSFAFEIV  149

Query  1513  QTEIDRRLLPIL----AGKK------DGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESL  1364
               EI+ RL+P+L    AGK       +GGV+DLQDVFRRFSFD ICRFSFGLDP CLE  
Sbjct  150   NNEIESRLIPLLSSFSAGKSVSGFDGNGGVLDLQDVFRRFSFDSICRFSFGLDPMCLEMS  209

Query  1363  LPMSEFAVSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQ  1184
             +P+SEFAVSF LAS+LSAERAM+ASP+VWK+KR LN+GSEK+L+ +I V+NMLA EVIRQ
Sbjct  210   VPLSEFAVSFDLASRLSAERAMTASPLVWKVKRLLNLGSEKQLKVAINVVNMLAKEVIRQ  269

Query  1183  RRKLGTSDENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPD  1004
             +RK+G S  NH DLLSRFM ++ +DE+YLRDIV+SFLLAGRDT+ASALTSFFWL+ NHPD
Sbjct  270   KRKMGFS--NHMDLLSRFMRTV-NDESYLRDIVVSFLLAGRDTIASALTSFFWLVVNHPD  326

Query  1003  AAEAILAEADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLP  824
                AI AEADRV+G N++L   EQ +++L+YL+AA+ ES+RL+PPIQFDSKFC+ DDVLP
Sbjct  327   VEAAICAEADRVIGPNRNLKNFEQ-VQKLHYLKAAIYESMRLYPPIQFDSKFCLYDDVLP  385

Query  823   DGTAVKRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLR-DGVFFQENPFKYPVFQAGLR  647
             DGT VKRGTRVTYHPYAMGR+E IWGSD +EFKPERWLR DGVF QENPFKYPVFQAGLR
Sbjct  386   DGTVVKRGTRVTYHPYAMGRLEEIWGSDFMEFKPERWLRNDGVFRQENPFKYPVFQAGLR  445

Query  646   VCLGKEMALLELKSVALSVLRRFRVHLAQP----HHTPRFSPGLTATFRDGLP  500
             VCLGKEMA++ELKSVAL++LRRF + LA P    H  PRFSPGLTATF  G P
Sbjct  446   VCLGKEMAMVELKSVALALLRRFEIKLATPPSQRHTQPRFSPGLTATFSGGGP  498



>ref|XP_010271731.1| PREDICTED: cytochrome P450 94C1-like [Nelumbo nucifera]
Length=503

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/457 (70%), Positives = 393/457 (86%), Gaps = 5/457 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CDVC +Y++ SW  +++NLCDWYTHLL+ SPSKTIH+HVLRNTITANP+NVEYMLK+
Sbjct  42    WCNCDVCRSYLTASWSIEFDNLCDWYTHLLKKSPSKTIHVHVLRNTITANPDNVEYMLKT  101

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RFEN+PKGK FS ILGD LG+GIFNVDGD+W+FQRK+AS+ELG  S+ S+AFE++ TEI 
Sbjct  102   RFENYPKGKPFSVILGDLLGRGIFNVDGDTWKFQRKLASLELGSVSIRSFAFEIVTTEIK  161

Query  1498  RRLLPILAGKK-DGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
             RRL+P+L+    +G V+DLQDVFRRF+FD ICRFSFGLDP CLE  LP+SEFA++F LAS
Sbjct  162   RRLVPLLSSAAGEGRVLDLQDVFRRFTFDNICRFSFGLDPGCLELSLPISEFAMAFDLAS  221

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA+RA+S SP++WKIKR LN+GSEK+L+K+I ++N+LA EVIRQRRK+G S    +DL
Sbjct  222   RLSAQRALSLSPLIWKIKRLLNLGSEKKLKKAIRLINVLAKEVIRQRRKMGFS--ASQDL  279

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFMG+I DD+ YLRDIVISFLLAGRDTVASALTSFFWL+A HP+ A  IL E+DRV+G
Sbjct  280   LSRFMGTINDDK-YLRDIVISFLLAGRDTVASALTSFFWLLAKHPEVAATILNESDRVMG  338

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
               Q+L + EQ +RE++YL +AV ESLRL+PP+QFDSKF  EDDVLPDGTAVKRGTRVTYH
Sbjct  339   PTQELASFEQ-IREMHYLHSAVYESLRLYPPVQFDSKFSQEDDVLPDGTAVKRGTRVTYH  397

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             PYAMGRME +WG DCLEFKPERWL++G+F  ENPFKYPVFQAGLRVCLGKEM+L+E+KSV
Sbjct  398   PYAMGRMEELWGPDCLEFKPERWLKNGIFSPENPFKYPVFQAGLRVCLGKEMSLVEIKSV  457

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFV  491
              L+V+R F + + + + +PRF+PGLTAT   GLP  V
Sbjct  458   VLAVVRSFEIQVVEDNDSPRFAPGLTATVSGGLPALV  494



>ref|XP_006430254.1| hypothetical protein CICLE_v10013407mg [Citrus clementina]
 gb|ESR43494.1| hypothetical protein CICLE_v10013407mg [Citrus clementina]
Length=463

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/467 (69%), Positives = 399/467 (85%), Gaps = 10/467 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             ++KL +C+C++C  Y++ SW  +++NLCDWY HLL  SP+KTIHIHVL NTITANP+NVE
Sbjct  2     KLKL-WCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVE  60

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+NFPKGK FS ILGDFLG+GIFNVDGDSWRFQ+++AS+EL R S+ SYA E++
Sbjct  61    YMLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIV  120

Query  1513  QTEIDRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
               EI  RL+P+L   AGK+DG V+DLQDVF+RFSFD +C+FSFGLDP+CLE  LPMS+FA
Sbjct  121   NQEIKTRLIPLLSSVAGKEDG-VLDLQDVFKRFSFDSMCKFSFGLDPRCLELSLPMSDFA  179

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
             V+F LASKLSAERAM+ SP+VWKIKR LN+G+EK+L+++I+++++LA+EVI+QRRK+G S
Sbjct  180   VAFDLASKLSAERAMTVSPLVWKIKRMLNLGNEKQLKEAIKMIDLLALEVIKQRRKMGFS  239

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                HKDLLSRFM S+ DD TYLRDIV+SFLLAGRDTVASALTSF WL+  +P     I A
Sbjct  240   --THKDLLSRFMSSVNDD-TYLRDIVVSFLLAGRDTVASALTSFVWLLGKNPRVCSEIRA  296

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             EADR++G+NQ+L + +Q +REL+YLQAAV ES+RL+PPIQFDSKFC EDDVLPDGT VK+
Sbjct  297   EADRILGQNQELTSFDQ-LRELHYLQAAVSESMRLYPPIQFDSKFCEEDDVLPDGTYVKK  355

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGRM  IWG +CLEF PERWL++GVF  ENP+KYPVFQAG RVCLGKEMA
Sbjct  356   GTRVTYHPYAMGRMREIWGQNCLEFNPERWLKNGVFLPENPYKYPVFQAGFRVCLGKEMA  415

Query  622   LLELKSVALSVLRRFRVHLAQPH-HTPRFSPGLTATFRDGLPVFVQQ  485
             L+E+KSVALS++R+F++ L  P+ + PRFSPGLTATF  GLP  V+Q
Sbjct  416   LVEIKSVALSLVRQFQIQLMSPYRNIPRFSPGLTATFNGGLPAMVRQ  462



>ref|XP_006481880.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=504

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/467 (69%), Positives = 399/467 (85%), Gaps = 10/467 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             ++KL +C+C++C  Y++ SW  +++NLCDWY HLL  SP+KTIHIHVL NTITANP+NVE
Sbjct  43    KLKL-WCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVE  101

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+NFPKGK FS ILGDFLG+GIFNVDGDSWRFQ+++AS+EL R S+ SYA E++
Sbjct  102   YMLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIV  161

Query  1513  QTEIDRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
               EI  RL+P+L   AGK+DG V+DLQDVF+RFSFD +C+FSFGLDP+CLE  LPMS+FA
Sbjct  162   NQEIKTRLIPLLSSVAGKEDG-VLDLQDVFKRFSFDSMCKFSFGLDPRCLELSLPMSDFA  220

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
             V+F LASKLSAERAM+ SP+VWKIKR LN+GSEK+L+++I+++++LA+EVI+QRRK+G S
Sbjct  221   VAFDLASKLSAERAMTVSPLVWKIKRMLNLGSEKQLKEAIKMIDLLALEVIKQRRKMGFS  280

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                HKDLLSRFM S+ DD TYLRDIV+SFLLAGRDTVASALTSF WL+  +P     I A
Sbjct  281   --THKDLLSRFMSSVNDD-TYLRDIVVSFLLAGRDTVASALTSFVWLLGKNPRVCSEIRA  337

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             EADR++G+NQ+L + +Q +REL+YLQAAV ES+RL+PPIQFDSKFC EDDVLPDGT VK+
Sbjct  338   EADRILGQNQELTSFDQ-LRELHYLQAAVSESMRLYPPIQFDSKFCEEDDVLPDGTYVKK  396

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGRM  IWG +CLEF PERWL++GVF  ENP+KYPVFQAG RVCLGKEMA
Sbjct  397   GTRVTYHPYAMGRMREIWGQNCLEFNPERWLKNGVFLPENPYKYPVFQAGFRVCLGKEMA  456

Query  622   LLELKSVALSVLRRFRVHLAQPH-HTPRFSPGLTATFRDGLPVFVQQ  485
             L+E+KSVALS++R+F++ L  P+ + PRFSPGLTATF  GLP  V+Q
Sbjct  457   LVEIKSVALSLVRQFQIQLMSPYRNIPRFSPGLTATFNGGLPAMVRQ  503



>ref|XP_006577067.1| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=540

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/475 (69%), Positives = 403/475 (85%), Gaps = 13/475 (3%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             +I  F+CSC+ C AY+++ W   ++NLCDWY HLLRNSP+KTIHIHVLRNTITANP+NVE
Sbjct  53    KIITFFCSCETCQAYLTSGWSKTFDNLCDWYAHLLRNSPTKTIHIHVLRNTITANPDNVE  112

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF NFPKGK FS ILGDFLG+GIFNVDG+SW FQ+K+AS+EL ++S+ S+AFEV+
Sbjct  113   YMLKTRFHNFPKGKTFSTILGDFLGRGIFNVDGESWSFQKKMASLELSKNSIRSFAFEVV  172

Query  1513  QTEIDRRLLPILA-GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
             + EI  RL+P+L   K++  V+DLQDVF+RFSFD ICRFSFGLDP CLE  LP+SEFA+S
Sbjct  173   KFEIKDRLIPLLVLSKQNDCVLDLQDVFKRFSFDSICRFSFGLDPMCLELSLPISEFAMS  232

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLG-TSD  1160
             F LASKLSAERAMS SP++WKIKRFLN+GSEK+LRK+I+++++LA EVIRQRRK+G +S 
Sbjct  233   FDLASKLSAERAMSVSPLIWKIKRFLNVGSEKKLRKAIKMIDILAREVIRQRRKMGFSSI  292

Query  1159  ENHKD-LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
               HKD LLSRFM +I DD TYL+DI++SFLLAGRDTVASALTSFFWL+A HP+    IL 
Sbjct  293   SPHKDDLLSRFMRTITDD-TYLKDIIVSFLLAGRDTVASALTSFFWLLAKHPEVESQILL  351

Query  982   EADRVVGK--NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
             EA++V+G   N+DL + E+ +++L+YLQAA  ES+RL+PPIQFDSKFC+EDDVLPDGT V
Sbjct  352   EAEQVIGSDYNKDLTSYEE-LQQLHYLQAAANESMRLYPPIQFDSKFCLEDDVLPDGTFV  410

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKE  629
             KRGTRVTYHPYAMGR+E IWGSDC EF+PERWL++G+F  +NPFKYPVFQAG+RVCLGKE
Sbjct  411   KRGTRVTYHPYAMGRLEEIWGSDCFEFRPERWLKEGLFCPQNPFKYPVFQAGIRVCLGKE  470

Query  628   MALLELKSVALSVLRRFRVHLA------QPHHTPRFSPGLTATFRDGLPVFVQQR  482
             MALLELKSVALS+LRRF + LA        H TPRFSPGLTATF  GL V V+++
Sbjct  471   MALLELKSVALSLLRRFHIELAAPPPHHHHHSTPRFSPGLTATFSCGLRVKVREQ  525



>ref|XP_007162882.1| hypothetical protein PHAVU_001G188500g [Phaseolus vulgaris]
 gb|ESW34876.1| hypothetical protein PHAVU_001G188500g [Phaseolus vulgaris]
Length=527

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/466 (68%), Positives = 395/466 (85%), Gaps = 6/466 (1%)
 Frame = -2

Query  1870  IKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEY  1691
             I +F+C+C+ C AY+++SW   ++NLCDWY HLLRNSP+KTIHIHVL+NTITANP+NVEY
Sbjct  48    INIFFCNCETCEAYLTSSWSKNFHNLCDWYAHLLRNSPTKTIHIHVLQNTITANPDNVEY  107

Query  1690  MLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQ  1511
             +LK+RF NFPKGK FSAILGDFLG GIFNVDG+SW FQRKIAS+EL ++S+ S+AFEV++
Sbjct  108   VLKTRFNNFPKGKTFSAILGDFLGGGIFNVDGESWCFQRKIASLELSKTSIRSFAFEVVR  167

Query  1510  TEIDRRLLPILA-GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
              EI  RL+P+LA  K++ GV+DLQDVF+RFSFD IC+FSFGLDP CLE  LP+S+FA SF
Sbjct  168   FEIQHRLIPLLALSKQNDGVLDLQDVFKRFSFDSICKFSFGLDPMCLEQSLPISDFARSF  227

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              +ASKLSAERAMS SP++WKIKRFLN+GSEK+L+++++ +N+LA EVIRQRRK+     +
Sbjct  228   DMASKLSAERAMSVSPLIWKIKRFLNVGSEKKLQEAVKTINILAKEVIRQRRKM--EFWS  285

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             H+DLLSRFM  + DD TYL+DI++SFLLAGRDTVASALT+FFWL+  HP+    I+ EA+
Sbjct  286   HEDLLSRFMSCVNDD-TYLKDIIVSFLLAGRDTVASALTTFFWLLTKHPEVVSKIVVEAE  344

Query  973   RVVGKNQDL-IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
              V+G+ +   IAS + ++EL+YL+AA  ES+RL+PPIQ DSKFC+EDDVLPDGT VKRGT
Sbjct  345   GVIGREKSKDIASFEELQELHYLEAAAYESMRLYPPIQLDSKFCLEDDVLPDGTFVKRGT  404

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RV+YHPYAMGR+E +WG DCLEF+PERWL++GVF  ENPFKYPVFQAG+RVCLGKEMALL
Sbjct  405   RVSYHPYAMGRLEELWGRDCLEFRPERWLKNGVFCPENPFKYPVFQAGMRVCLGKEMALL  464

Query  616   ELKSVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQR  482
             ELKSVA+SVLRRF + L  P H TPRFSPGLTAT   GL V V+ +
Sbjct  465   ELKSVAISVLRRFHIELVAPDHRTPRFSPGLTATLSSGLRVKVRDQ  510



>ref|XP_002319770.2| hypothetical protein POPTR_0013s07310g [Populus trichocarpa]
 gb|EEE95693.2| hypothetical protein POPTR_0013s07310g [Populus trichocarpa]
Length=512

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/463 (69%), Positives = 396/463 (86%), Gaps = 9/463 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C++C AY++ SW   ++NLCDWY HLL++SP+KTI IHVL N ITANPEN++YMLK+
Sbjct  41    WCNCEICDAYLNLSWAKSFDNLCDWYAHLLKHSPTKTIPIHVLGNIITANPENIKYMLKT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS ILGDFLG+GIFNVDGD WRFQ+ +AS+EL R S+ S AFE+++ EI+
Sbjct  101   RFDNYPKGKPFSLILGDFLGRGIFNVDGDMWRFQKNMASLELDRLSIRSNAFEIVRCEIE  160

Query  1498  RRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
             +RLLP+L   +GK+DG ++DLQDVFRRFSFD IC+FSFGLDPKCL+  LPMSEFAV+F L
Sbjct  161   KRLLPLLVSFSGKEDG-ILDLQDVFRRFSFDSICQFSFGLDPKCLQLSLPMSEFAVAFDL  219

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             ASK SAERAM+ SP+VWKIKR LNIGSEK+++++I+++++LA EV+RQ+R  G S   HK
Sbjct  220   ASKFSAERAMAVSPLVWKIKRKLNIGSEKKMKEAIKIIDILAQEVMRQKRVKGFS--THK  277

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM ++ DD+TYLRDIVISFLLAGRDTVASALTSFFWL+A HP+   AI  EADRV
Sbjct  278   DLLSRFMRTV-DDDTYLRDIVISFLLAGRDTVASALTSFFWLLAKHPEIGSAIQVEADRV  336

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +G NQ+  + E+ +++L+YLQAAV ES+RL+PPIQFDSKFC +DDVLPDGT VKRGTRVT
Sbjct  337   LGPNQEPKSFEE-IQQLHYLQAAVHESMRLYPPIQFDSKFCQQDDVLPDGTFVKRGTRVT  395

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YHPYAMGRME IWG DCLEFKPERWLRDGVFF ENP+KYP+FQ G RVCLGK+MAL+E+K
Sbjct  396   YHPYAMGRMEEIWGPDCLEFKPERWLRDGVFFSENPYKYPIFQGGFRVCLGKDMALMEIK  455

Query  607   SVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQR  482
             SV LS+L+RF   L  P H TPRFSPGLT+TFRDGL V V+++
Sbjct  456   SVCLSLLQRFHFKLVFPCHSTPRFSPGLTSTFRDGLLVLVREK  498



>ref|XP_009366644.1| PREDICTED: cytochrome P450 94C1-like [Pyrus x bretschneideri]
Length=512

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/466 (68%), Positives = 392/466 (84%), Gaps = 12/466 (3%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             CSC++C  Y+++SW  K+ NLCDWY HLLR+SPSKTIHIHVL+NTITANPENVEY+LK+R
Sbjct  44    CSCEICQIYLTSSWSLKFINLCDWYAHLLRDSPSKTIHIHVLKNTITANPENVEYILKTR  103

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             FEN+PKGK FS ILGDFLGQGIFNVDG SWRFQRK+AS+EL R SV SYA+E++  EI+ 
Sbjct  104   FENYPKGKPFSTILGDFLGQGIFNVDGHSWRFQRKMASLELDRHSVRSYAYEIVNHEIEH  163

Query  1495  RLLPILAG------KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             RL+P+L+         +G V+DLQDVF+RFSFD IC+FSFGLDP CLE  +P+S+F V+F
Sbjct  164   RLIPLLSSVCSNSDNGNGVVLDLQDVFKRFSFDSICKFSFGLDPMCLELSMPLSKFTVAF  223

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              +ASKLSAERAM+ SP++WKIKR LN+GSEK+L++SI +++ LA EVI ++R++G S + 
Sbjct  224   DMASKLSAERAMTPSPIIWKIKRILNLGSEKQLKESINIIDGLAKEVIARKREVGFSTQ-  282

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
              KDLLSRFM S+ +DE+YLRDIV+SFLLAGRDTVASALTSFFWLI  HP+ A AIL EAD
Sbjct  283   -KDLLSRFMRSV-EDESYLRDIVVSFLLAGRDTVASALTSFFWLIGTHPNVASAILLEAD  340

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             RV+G NQ L + +Q M+EL+YLQ+A+ ES+RL+PP+QFDSKFC +DDVLPDGT V++GTR
Sbjct  341   RVLGLNQGLKSFDQ-MQELHYLQSAIYESMRLYPPVQFDSKFCEQDDVLPDGTFVRKGTR  399

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGR++ IWGSDC+EFKP+RWL+DGVFF ENPF+YPVFQ G RVCLGKEMA++E
Sbjct  400   VTYHPYAMGRIQEIWGSDCMEFKPDRWLKDGVFFTENPFQYPVFQPGHRVCLGKEMAVME  459

Query  613   LKSVALSVLRRFRVHLA--QPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K+V LS+LRRF +  A  +    PRFSPGLTAT   GLPV V++R
Sbjct  460   MKTVVLSLLRRFNIEHAAHESSSVPRFSPGLTATLSGGLPVLVKER  505



>ref|XP_009374745.1| PREDICTED: cytochrome P450 94C1-like [Pyrus x bretschneideri]
Length=513

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/468 (68%), Positives = 391/468 (84%), Gaps = 12/468 (3%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
              +CSC++C  Y+++SW  ++ NLCDWY HLL++SPSKTIHIHVLRNTITANPENVEYMLK
Sbjct  43    LWCSCEICQTYLTSSWSLEFVNLCDWYAHLLQDSPSKTIHIHVLRNTITANPENVEYMLK  102

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKGK FS ILGDFLGQGIFNVDG SWRFQRK+AS+EL R SV SYAFE++  EI
Sbjct  103   TRFKNYPKGKPFSTILGDFLGQGIFNVDGHSWRFQRKMASLELDRHSVRSYAFEIVNHEI  162

Query  1501  DRRLLPILA---GKKDGG---VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAV  1340
             + RL+P+L       DGG   V+DLQDVF+RFSFD IC+FSFGLDP CLE  LP+SEFA+
Sbjct  163   EHRLIPLLTSVCSNSDGGNGIVLDLQDVFKRFSFDTICKFSFGLDPMCLELSLPLSEFAI  222

Query  1339  SFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD  1160
             +F +ASKLSAERAM+ SP++WKIKR LN+GSEK+L++SI ++N LA EVI ++R+ G S 
Sbjct  223   AFDMASKLSAERAMTPSPIIWKIKRILNLGSEKQLKESINMINALAKEVIARKRESGFST  282

Query  1159  ENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
             +  +DLLSRFM S+ +DE YLRDIVISFLLAGRDT+ASALTSFFWL+  HP+AA AI  E
Sbjct  283   Q--RDLLSRFMRSV-EDEGYLRDIVISFLLAGRDTMASALTSFFWLMGTHPNAASAIRLE  339

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             ADRV+G NQ L + EQ M+EL+YLQAA+ ES+RL+PP+QFDSKFC +DDVLPDGT V++G
Sbjct  340   ADRVLGINQGLKSFEQ-MQELHYLQAAIYESMRLYPPVQFDSKFCEQDDVLPDGTFVRKG  398

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
             TRVTYHPYAMGR++  WGSDC+EFKP+RWL+DGVFF ENPFKYP+FQ GLRVCLGKEMA+
Sbjct  399   TRVTYHPYAMGRIQESWGSDCMEFKPDRWLKDGVFFMENPFKYPIFQPGLRVCLGKEMAV  458

Query  619   LELKSVALSVLRRFRVHLA--QPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +E+K+V LS+LRRF +  A  +    P+FSPGLTAT   G PV V++R
Sbjct  459   MEMKTVVLSLLRRFNIEHAAHESCRVPKFSPGLTATLSSGFPVLVKER  506



>ref|XP_010244250.1| PREDICTED: cytochrome P450 94C1 [Nelumbo nucifera]
Length=503

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/462 (68%), Positives = 390/462 (84%), Gaps = 7/462 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C CDVC  Y+++SW  +++NLCDWYTHLL+NSPS+TIHIHVL NTITANP+NVEYMLK+
Sbjct  42    WCKCDVCRGYVTSSWSTEFDNLCDWYTHLLKNSPSRTIHIHVLGNTITANPDNVEYMLKT  101

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FSAILGD LG+GIFNVDGD+W+FQRK+AS+ELG  S+ S+AFE++ +EI 
Sbjct  102   RFDNYPKGKPFSAILGDLLGRGIFNVDGDTWKFQRKMASLELGSVSIRSFAFEIVTSEIK  161

Query  1498  RRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
              RLLP L   A  +   V+DLQDVF+RF+FD ICRFSFGLDP CLE  LPMSEFA++F L
Sbjct  162   HRLLPFLSSTASDEQDRVLDLQDVFQRFTFDNICRFSFGLDPGCLELSLPMSEFAMAFDL  221

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             AS+L A+RA+S SP+VWK KR LN+GSEK+L+K+I ++N+LA EVI+QRRKLG S   H 
Sbjct  222   ASRLCAKRALSLSPLVWKAKRLLNLGSEKKLKKAIRLINILADEVIKQRRKLGFS--THL  279

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFMG++ DD  YLRDIV+SFLLAGRDTVA+ALTS FWL+A HP+   AIL E+DRV
Sbjct  280   DLLSRFMGTVNDD-AYLRDIVVSFLLAGRDTVAAALTSIFWLMAKHPEVTTAILEESDRV  338

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +G  Q+L A+ Q++R+++YLQA V ES+RL+PP+QFDSKF  EDDVLPDGT VKRGTRVT
Sbjct  339   MGPTQEL-ATFQQLRDMHYLQATVYESMRLYPPVQFDSKFPQEDDVLPDGTVVKRGTRVT  397

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YHPYAMGRME +WG DCLEFKPERWL+ G+F+ E+PFKYPVFQAG RVCLGK++AL+E+K
Sbjct  398   YHPYAMGRMEEVWGPDCLEFKPERWLKKGIFWPESPFKYPVFQAGFRVCLGKDLALVEIK  457

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             SV L+V+R F + + +P ++PRF+PGLTAT   GLPV V+QR
Sbjct  458   SVMLAVIRGFEIEVDEPDNSPRFAPGLTATVSGGLPVLVRQR  499



>ref|XP_008391766.1| PREDICTED: cytochrome P450 94C1-like [Malus domestica]
Length=512

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/467 (67%), Positives = 391/467 (84%), Gaps = 12/467 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC++C  Y ++SW  K+ NLCDWY HLLR+SPSKTIHIHVL+NTITANPENVEYMLK+
Sbjct  43    WCSCEICQTYXTSSWSLKFINLCDWYAHLLRDSPSKTIHIHVLKNTITANPENVEYMLKT  102

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RFEN+PKGK FS ILGDFLGQGIFNVDG SWRFQRK+AS+EL R SV SYA+E++  EI+
Sbjct  103   RFENYPKGKPFSTILGDFLGQGIFNVDGHSWRFQRKMASLELDRHSVRSYAYEIVNHEIE  162

Query  1498  RRLLPILAG------KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
              RL+P+L+         +G  +DLQDVF+RFSFD IC+FSFGLDP CLE  LP+S+F ++
Sbjct  163   HRLIPLLSSVCSNSDDGNGVFLDLQDVFKRFSFDSICKFSFGLDPMCLELSLPLSKFTIA  222

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F +ASKLSAERAM+ SP++WKIKR LN+GSEK+L++SI +++ LA EVI ++R++G S +
Sbjct  223   FDMASKLSAERAMTPSPIIWKIKRILNLGSEKQLKESINIIDGLAKEVIARKREVGFSTQ  282

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
               KDLLSRFM S+ +DE+YLRDIV+SFLLAGRDTVASALTSFFWLI  HP+ A AI  EA
Sbjct  283   --KDLLSRFMRSV-EDESYLRDIVVSFLLAGRDTVASALTSFFWLIGTHPNVASAIRLEA  339

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             DRV+G NQ L + +Q M+EL+YLQ+A+ ES+RL+PP+QFDSKFC +DDVLPDGT V++GT
Sbjct  340   DRVLGLNQGLKSFDQ-MQELHYLQSAIYESMRLYPPVQFDSKFCEQDDVLPDGTFVRKGT  398

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYHPYAMGR++ IWGSDC+EFKP+RWL+DGVFF+ENPF+YPVFQ G RVCLGKEMA++
Sbjct  399   RVTYHPYAMGRIQEIWGSDCMEFKPDRWLKDGVFFKENPFQYPVFQPGHRVCLGKEMAVM  458

Query  616   ELKSVALSVLRRFRVHLA--QPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K+V LS+LRRF +  A  +    PRFSPGLTAT   GLPV V++R
Sbjct  459   EMKTVVLSLLRRFNIEHAAHESSSVPRFSPGLTATLSGGLPVLVKER  505



>ref|XP_007145327.1| hypothetical protein PHAVU_007G229700g [Phaseolus vulgaris]
 gb|ESW17321.1| hypothetical protein PHAVU_007G229700g [Phaseolus vulgaris]
Length=510

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/457 (68%), Positives = 388/457 (85%), Gaps = 5/457 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             CSC+ C AY+++SW   ++NLCDWYTHLL+ SP+KTIHIHVLRNTITAN ENVEY+LK+R
Sbjct  48    CSCETCQAYLTSSWSQCFHNLCDWYTHLLQTSPTKTIHIHVLRNTITANAENVEYILKTR  107

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F NFPKGK FSAILGDFLG+GIFNVDGD+WRFQ+K+A++EL   ++  + FE++++EI  
Sbjct  108   FHNFPKGKPFSAILGDFLGKGIFNVDGDAWRFQKKMATLELNNHAITFFGFEIVKSEIHN  167

Query  1495  RLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASK  1319
             RL+P+L A  ++G V+DLQDVFRRFSFD ICRFSFGLDPKCLE  LPMSEFAV F LASK
Sbjct  168   RLVPLLHASTRNGVVLDLQDVFRRFSFDSICRFSFGLDPKCLERSLPMSEFAVCFDLASK  227

Query  1318  LSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLL  1139
             LSAERAM+ SP VWK KRF N+GSEK LR+++EV+N LA EVI+Q+R++G S+  +KDLL
Sbjct  228   LSAERAMAFSPSVWKAKRFFNVGSEKRLREAVEVINALAREVIKQKREMGFSE--NKDLL  285

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGK  959
             SRFM ++ DD+TYLRDIV+SFLLAGRDTVASALTSFF+L+  HP+    I  EADRV+G 
Sbjct  286   SRFMSTVHDDDTYLRDIVVSFLLAGRDTVASALTSFFYLLGKHPEVESEIRVEADRVIGP  345

Query  958   NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHP  779
             ++DL  S Q +++L+YL+AA+ ES+RLFPPIQFDSKFC+E+DVLPDGT V+ GTRVTYHP
Sbjct  346   HKDL-TSFQELKQLHYLEAAMHESMRLFPPIQFDSKFCLEEDVLPDGTKVESGTRVTYHP  404

Query  778   YAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             YAMGR+E IWG DCLEF+P+RWL+DGVF  + PFKYP+FQAGLRVC+GK+MAL+ELK+V+
Sbjct  405   YAMGRLEEIWGCDCLEFRPQRWLKDGVFHPKCPFKYPIFQAGLRVCVGKKMALMELKTVS  464

Query  598   LSVLRRFRVHLAQPH-HTPRFSPGLTATFRDGLPVFV  491
             LS+LR+F + L +P    PRFSPGLTATF  GLPV V
Sbjct  465   LSLLRKFHIQLVEPSCGNPRFSPGLTATFSFGLPVKV  501



>gb|KEH42061.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=515

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/467 (68%), Positives = 388/467 (83%), Gaps = 10/467 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC++C AY+S+SW   +NNLCDWY HLL+ SP+KTIHIHVLRN ITAN ENVEY+LK+
Sbjct  48    FCSCEICQAYLSSSWSKDFNNLCDWYAHLLKKSPTKTIHIHVLRNIITANCENVEYILKT  107

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             +FEN+PKGK FS+ILGDFLG+GIFNVDGD W+FQ+K+AS+EL + S+ S+AFEV+  EI+
Sbjct  108   KFENYPKGKPFSSILGDFLGRGIFNVDGDLWKFQKKMASLELNKQSIRSFAFEVVNNEIE  167

Query  1498  RRLLPILAGKKDGGVV-DLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+L  +    VV DLQDVF+RFSFD ICRFSFGLDP CLE+ LPMS+FA+SF LAS
Sbjct  168   NRLIPLLQNQNLNQVVFDLQDVFKRFSFDSICRFSFGLDPMCLETSLPMSDFALSFDLAS  227

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             KLSAERAM  SP++WKIKRF N+GSEKEL+KSI ++NMLA  VI Q+RKLG S  +HKDL
Sbjct  228   KLSAERAMVVSPLIWKIKRFFNMGSEKELQKSINIINMLAKVVINQKRKLGFS--HHKDL  285

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFM +   D+ +LRDIVISFLLAGRDTVAS+LTSFFWL+A +P+  + IL EA+RV+G
Sbjct  286   LSRFMSTTIHDDMFLRDIVISFLLAGRDTVASSLTSFFWLLAKNPEVEKEILLEAERVIG  345

Query  961   KNQDL----IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
              + +     + + +++R+L+YLQAA  ES+RL+PPIQFDSKFC++DDVLPDGT VK GTR
Sbjct  346   PHDENNIFGVTNFEQLRKLHYLQAAAHESMRLYPPIQFDSKFCLDDDVLPDGTKVKSGTR  405

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGR+E +WG DCLEFKPERWL+DGVF   N FKYP+FQAGLRVC+GKEMAL+E
Sbjct  406   VTYHPYAMGRLEELWGPDCLEFKPERWLKDGVFQPSNQFKYPIFQAGLRVCIGKEMALME  465

Query  613   LKSVALSVLRRFRVHLAQP---HHTPRFSPGLTATFRDGLPVFVQQR  482
             LKSVA+S+LR+F + L      H  PRFSPGLTATF  GLPVFV+ R
Sbjct  466   LKSVAISLLRKFHIELEDRTMFHGNPRFSPGLTATFAFGLPVFVRPR  512



>ref|XP_011005435.1| PREDICTED: cytochrome P450 94C1-like [Populus euphratica]
Length=512

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/478 (68%), Positives = 399/478 (83%), Gaps = 13/478 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C++C AY++ SW   ++NLCDWY HLL++SP+KT+ IHVL N ITANPEN++YMLK+
Sbjct  41    WCNCEICDAYLNLSWAKSFDNLCDWYAHLLKHSPTKTVPIHVLGNIITANPENIKYMLKT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS ILGDFLG+GIFNVDGD WRFQ+ +AS+EL R S+ S AFE+++ EI+
Sbjct  101   RFDNYPKGKPFSLILGDFLGRGIFNVDGDMWRFQKNMASLELDRLSIRSNAFEIVRCEIE  160

Query  1498  RRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
             +RLLP+L   +GK+DG ++DLQDVFRRFSFD IC+FSFGLDP+CL+  LPMSEFAV+F L
Sbjct  161   KRLLPLLVSFSGKEDG-ILDLQDVFRRFSFDSICQFSFGLDPRCLQLSLPMSEFAVAFDL  219

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             ASK SAERAM+ SP+VWKIKR LNIGSEK+++++I+++++LA EV+RQ+R  G S   HK
Sbjct  220   ASKFSAERAMAVSPLVWKIKRKLNIGSEKKMKEAIKIIDILAQEVMRQKRVKGFS--THK  277

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM ++ DDETYLRDIVISFLLAGRDTVASALTSFFWL+A HP+   AI  EADRV
Sbjct  278   DLLSRFMRTV-DDETYLRDIVISFLLAGRDTVASALTSFFWLLAKHPEIGSAIQVEADRV  336

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +G NQ   + E+ +++L+YLQAAV ES+RL+PPIQFDSKFC +DDVLPDGT VKRGTRVT
Sbjct  337   LGPNQAPKSFEE-IQQLHYLQAAVHESMRLYPPIQFDSKFCQQDDVLPDGTFVKRGTRVT  395

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YHPYAMGRME IWG DCLEFKPERWLRDGVFF ENP+KYPVFQ G RVCLGK+MAL+E+K
Sbjct  396   YHPYAMGRMEEIWGPDCLEFKPERWLRDGVFFSENPYKYPVFQGGFRVCLGKDMALMEIK  455

Query  607   SVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQR*CPPCLIN*HESYNI  437
             SV LS+L+RF   L  P H TPRFSPGLT+TF DGL V V+++   P     H +Y +
Sbjct  456   SVCLSLLQRFHFKLVFPCHSTPRFSPGLTSTFIDGLLVLVREKVTQPS----HRNYMV  509



>ref|XP_004305353.1| PREDICTED: cytochrome P450 94A1-like [Fragaria vesca subsp. vesca]
Length=495

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/466 (68%), Positives = 388/466 (83%), Gaps = 9/466 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C++C+ Y+++SW  K++NLCDWY HLLR SP+KTIHIHVLRNTITANPENV YMLK+
Sbjct  34    WCNCEICNTYLTSSWSLKFHNLCDWYAHLLRESPTKTIHIHVLRNTITANPENVRYMLKT  93

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              FENFPKGK FS ILGDFLGQGIFNVDG  WRFQRK+AS+EL + SV SY+FE++  EI+
Sbjct  94    NFENFPKGKPFSTILGDFLGQGIFNVDGHPWRFQRKMASLELDKQSVRSYSFEIVNHEIE  153

Query  1498  RRLLPILAG---KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
              R +P+L+    KKD  V+DLQDVF+RFSFD IC+FSFGLDP CL+  LP+SEFAVSF L
Sbjct  154   HRFIPLLSSSSEKKD--VLDLQDVFKRFSFDSICKFSFGLDPMCLDLSLPLSEFAVSFDL  211

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             AS+LSAERAM+ASP+VWKIKR LN+GSEK+L+++I ++++LA EVI  +R++G + +  K
Sbjct  212   ASRLSAERAMTASPIVWKIKRMLNLGSEKQLKEAINMIDVLAREVIVTKRQMGFATQ--K  269

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM S+ DDETYLRDIVISFLLAGRDTVASALTSFFWL+  H     AI AEAD+V
Sbjct  270   DLLSRFMRSV-DDETYLRDIVISFLLAGRDTVASALTSFFWLMTTHKLVESAIRAEADKV  328

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +G +  L + EQ ++EL+YLQAA+ ES+RL+PP+QFDSKFC +DDVLPDGT VK+GTRVT
Sbjct  329   LGPSVGLNSFEQ-LQELHYLQAAIYESMRLYPPVQFDSKFCDQDDVLPDGTFVKKGTRVT  387

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YHPYAMGR+E  WG DC+EFKPERWL++GVFF EN FKYPVFQ GLRVCLGKEMAL+ELK
Sbjct  388   YHPYAMGRIEENWGPDCMEFKPERWLKEGVFFTENQFKYPVFQPGLRVCLGKEMALMELK  447

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR*CPP  470
              VALS+LR F +      + PRFSPGLTATFR GLPV V++R   P
Sbjct  448   VVALSLLRNFEIETTAQFNVPRFSPGLTATFRGGLPVRVRERKTLP  493



>emb|CBI30267.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/467 (69%), Positives = 391/467 (84%), Gaps = 30/467 (6%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R+KL +C+C++C +Y++ SW  +++NLCDWYTHLLRNSP++TIH+HVL NTITAN +NVE
Sbjct  46    RLKL-WCNCEICHSYVTLSWSKQFHNLCDWYTHLLRNSPTQTIHVHVLGNTITANQDNVE  104

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RFEN+PKGK FSAILGDFLG+GIFNVDG+ WRFQRK+AS+ELGR+S+ SYAFE++
Sbjct  105   YMLKTRFENYPKGKPFSAILGDFLGRGIFNVDGELWRFQRKMASLELGRTSIRSYAFEIV  164

Query  1513  QTEIDRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
               EI+RRLLP+L   AG +DG V+DLQDVFRRFSFD ICRFSFGLDP CLE         
Sbjct  165   NYEIERRLLPLLWSVAGNEDG-VLDLQDVFRRFSFDSICRFSFGLDPGCLE---------  214

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
                          AM+ASP+VW+IKR LN+G+EK+LRK+I+++N+LA EVI+Q+RK+G S
Sbjct  215   ------------LAMAASPLVWRIKRVLNLGTEKKLRKAIKLINILAQEVIKQKRKMGFS  262

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                HKDLLS FM ++ DD TYLRDIVISFLLAGRDTVASALTSFFWL++NHP    AI +
Sbjct  263   --AHKDLLSLFMRNLNDD-TYLRDIVISFLLAGRDTVASALTSFFWLLSNHPKVGAAIRS  319

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             EAD+++G +Q++ + EQ M+EL+YLQAAV ES+RL+PPIQFDSKFC EDDVLPDGT V+R
Sbjct  320   EADKIIGPDQEVTSFEQ-MQELHYLQAAVHESMRLYPPIQFDSKFCQEDDVLPDGTFVQR  378

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGR+EGIWG DCLEFKPERWL+DGVFF ENPFKYPVFQAG+RVCLGKEMA
Sbjct  379   GTRVTYHPYAMGRIEGIWGPDCLEFKPERWLKDGVFFPENPFKYPVFQAGIRVCLGKEMA  438

Query  622   LLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L+E KSVALS++RRF + LA P   PRFSPGLTATF  GLPV V+ R
Sbjct  439   LMEFKSVALSLVRRFHIELATPCPIPRFSPGLTATFGSGLPVLVRGR  485



>ref|XP_008443586.1| PREDICTED: cytochrome P450 94C1-like [Cucumis melo]
Length=495

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/465 (67%), Positives = 382/465 (82%), Gaps = 9/465 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             F CSC++C AY+++SW   ++NLCDWY+HLLR SP+KTIHIHVLRNTITANP+NVEY+LK
Sbjct  31    FLCSCEICQAYLASSWSKDFHNLCDWYSHLLRQSPTKTIHIHVLRNTITANPDNVEYILK  90

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             ++FEN+PKGK FS+ILGDFLG+GIFNVDGD W+FQ+K+A +ELG+ S+ SY FE++  EI
Sbjct  91    TKFENYPKGKIFSSILGDFLGRGIFNVDGDLWQFQKKMAIIELGQQSIRSYCFEIVSQEI  150

Query  1501  DRRLLPILAGKKD---GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RLLP+L+   D   GG +DLQDVFRRF+FD IC+FSFGLDP CLE  LPMS+FAV+F 
Sbjct  151   HSRLLPLLSSVADGGSGGALDLQDVFRRFAFDSICKFSFGLDPMCLELSLPMSDFAVAFD  210

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERAM+  P++WKIKR LN+G EKEL+K+I+++NMLA EVIRQRRKLG S   H
Sbjct  211   LASKLSAERAMAVPPLIWKIKRMLNLGREKELKKAIKLINMLAREVIRQRRKLGFS--TH  268

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             +DLLS+FM  I  DET+LRDIV+SFLLAGRDT+ASALTSFFW+I++HP    AI  EADR
Sbjct  269   RDLLSQFM-RIVSDETFLRDIVVSFLLAGRDTIASALTSFFWVISSHPTVESAIQLEADR  327

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
             V+G N +  + +Q +R L+YLQAA+ ES+RL+PPIQFDSKFC  DD+LPDGT V+RGTRV
Sbjct  328   VIGPNSNPTSFDQ-IRNLHYLQAAIFESMRLYPPIQFDSKFCQNDDILPDGTFVRRGTRV  386

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             +YHPYAMGR+E IWG++CLEF PERWL++ +F  ENPFKYP+FQ G R+CLGKEMAL EL
Sbjct  387   SYHPYAMGRVEQIWGTNCLEFNPERWLKNNIFCPENPFKYPIFQGGFRICLGKEMALFEL  446

Query  610   KSVALSVLRRFRVHLAQPHHT--PRFSPGLTATFRDGLPVFVQQR  482
             K VALSV+R FR+    P     PRFSPGLTATF  G  V V ++
Sbjct  447   KIVALSVIRHFRIQSTTPSSVAPPRFSPGLTATFCGGFKVLVSKK  491



>gb|KHN18751.1| Cytochrome P450 94A1 [Glycine soja]
Length=597

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/442 (71%), Positives = 383/442 (87%), Gaps = 7/442 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             +I  F+CSC+ C AY+++ W   ++NLCDWY HLLRNSP+KTIHIHVLRNTITANP+NVE
Sbjct  53    KIITFFCSCETCQAYLTSGWSKTFDNLCDWYAHLLRNSPTKTIHIHVLRNTITANPDNVE  112

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF NFPKGK FS ILGDFLG+GIFNVDG+SW FQ+K+AS+EL ++S+ S+AFEV+
Sbjct  113   YMLKTRFHNFPKGKTFSTILGDFLGRGIFNVDGESWSFQKKMASLELSKNSIRSFAFEVV  172

Query  1513  QTEIDRRLLPILA-GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
             + EI  RL+P+L   K++  V+DLQDVF+RFSFD ICRFSFGLDP CLE  LP+SEFA+S
Sbjct  173   KFEIKDRLIPLLVLSKQNDCVLDLQDVFKRFSFDSICRFSFGLDPMCLELSLPISEFAMS  232

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLG-TSD  1160
             F LASKLSAERAMS SP++WKIKRFLN+GSEK+LRK+I+++++LA EVIRQRRK+G +S 
Sbjct  233   FDLASKLSAERAMSVSPLIWKIKRFLNVGSEKKLRKAIKMIDILAREVIRQRRKMGFSSI  292

Query  1159  ENHKD-LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
               HKD LLSRFM +I DD TYL+DI++SFLLAGRDTVASALTSFFWL+A HP+    IL 
Sbjct  293   SPHKDDLLSRFMRTITDD-TYLKDIIVSFLLAGRDTVASALTSFFWLLAKHPEVESQILL  351

Query  982   EADRVVGK--NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
             EA++V+G   N+DL + E+ +++L+YLQAA  ES+RL+PPIQFDSKFC+EDDVLPDGT V
Sbjct  352   EAEQVIGSDYNKDLTSYEE-LQQLHYLQAAANESMRLYPPIQFDSKFCLEDDVLPDGTFV  410

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKE  629
             KRGTRVTYHPYAMGR+E IWGSDC EF+PERWL++G+F  +NPFKYPVFQAG+RVCLGKE
Sbjct  411   KRGTRVTYHPYAMGRLEEIWGSDCFEFRPERWLKEGLFCPQNPFKYPVFQAGIRVCLGKE  470

Query  628   MALLELKSVALSVLRRFRVHLA  563
             MALLELKSVALS+LRRF + LA
Sbjct  471   MALLELKSVALSLLRRFHIELA  492


 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 61/79 (77%), Gaps = 6/79 (8%)
 Frame = -2

Query  700  VFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHL------AQPHHTPRF  539
            +F  +NPFKYPVFQAG+RVCLGKEMALLELKSVALS+LRRF + L         H TPRF
Sbjct  504  LFCPQNPFKYPVFQAGIRVCLGKEMALLELKSVALSLLRRFHIELEPPPPHHHHHSTPRF  563

Query  538  SPGLTATFRDGLPVFVQQR  482
            SPGLTATF  GL V V+++
Sbjct  564  SPGLTATFSCGLRVKVREQ  582



>gb|KHN48177.1| Cytochrome P450 94A1 [Glycine soja]
Length=493

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/467 (68%), Positives = 387/467 (83%), Gaps = 9/467 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             K F+CSC+ C  Y+++SW   ++NLCDWY HLLRNSP+KTIHIHVLRNTITAN ENVEY+
Sbjct  19    KSFFCSCETCQTYLTSSWSETFDNLCDWYAHLLRNSPNKTIHIHVLRNTITANAENVEYI  78

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVL-SYAFEVIQ  1511
             LK++FENFPKGK FSAILGDFLG+G+FNVDGD+WRFQ+K+AS+ L  +SV+ S+AFE++ 
Sbjct  79    LKTKFENFPKGKPFSAILGDFLGKGVFNVDGDAWRFQKKMASLHLNNNSVVASFAFEIVN  138

Query  1510  TEIDRRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPK-CLESLLPMSEFAVS  1337
              EI  RL P+L   +K+G V+DLQDVF+RFSFDCICRFSFGLDP  CLES   M  FA S
Sbjct  139   DEIKNRLTPLLLMNQKNGVVLDLQDVFQRFSFDCICRFSFGLDPDFCLESG-SMLVFAKS  197

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F LASKLSAERA + SP VWK KR LN+GSEK L+K++ V+N LA EVI+QRR+ G S+ 
Sbjct  198   FDLASKLSAERATAVSPYVWKAKRLLNLGSEKRLKKALRVINALAKEVIKQRREKGFSE-  256

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
              +KDLLSRFM +I DD+TYLRD+V+SFLLAGRDTVASALTSFF+L+  HP+    I  EA
Sbjct  257   -NKDLLSRFMNTIHDDDTYLRDVVVSFLLAGRDTVASALTSFFYLLGKHPEVESLIRDEA  315

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             DRV+G ++DL + E+ +++L+YLQAA  ES+RLFPPIQFDSKFC+EDDVLPDGT V+ GT
Sbjct  316   DRVIGHDKDLTSFEE-LKQLHYLQAATHESMRLFPPIQFDSKFCLEDDVLPDGTKVESGT  374

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYHPYAMGR+E IWG DCLEF+P+RWL+DGVF   NPF+YPVFQAGLRVC+GKE+AL+
Sbjct  375   RVTYHPYAMGRLEEIWGCDCLEFRPQRWLKDGVFQPMNPFEYPVFQAGLRVCVGKEVALM  434

Query  616   ELKSVALSVLRRFRVHLAQP--HHTPRFSPGLTATFRDGLPVFVQQR  482
             E+KSVA+S+LR+F + L  P     PRFSPGLTATF  GLPV V++R
Sbjct  435   EMKSVAVSLLRKFHIELLAPLSFGNPRFSPGLTATFSFGLPVMVRER  481



>ref|XP_003541451.1| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=522

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/467 (68%), Positives = 387/467 (83%), Gaps = 9/467 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             K F+CSC+ C  Y+++SW   ++NLCDWY HLLRNSP+KTIHIHVLRNTITAN ENVEY+
Sbjct  48    KSFFCSCETCQTYLTSSWSETFDNLCDWYAHLLRNSPNKTIHIHVLRNTITANAENVEYI  107

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVL-SYAFEVIQ  1511
             LK++FENFPKGK FSAILGDFLG+G+FNVDGD+WRFQ+K+AS+ L  +SV+ S+AFE++ 
Sbjct  108   LKTKFENFPKGKPFSAILGDFLGKGVFNVDGDAWRFQKKMASLHLNNNSVVASFAFEIVN  167

Query  1510  TEIDRRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPK-CLESLLPMSEFAVS  1337
              EI  RL P+L   +K+G V+DLQDVF+RFSFDCICRFSFGLDP  CLES   M  FA S
Sbjct  168   DEIKNRLTPLLLMNQKNGVVLDLQDVFQRFSFDCICRFSFGLDPDFCLESG-SMLVFAKS  226

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F LASKLSAERA + SP VWK KR LN+GSEK L+K++ V+N LA EVI+QRR+ G S+ 
Sbjct  227   FDLASKLSAERATAVSPYVWKAKRLLNLGSEKRLKKALRVINALAKEVIKQRREKGFSE-  285

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
              +KDLLSRFM +I DD+TYLRD+V+SFLLAGRDTVASALTSFF+L+  HP+    I  EA
Sbjct  286   -NKDLLSRFMNTIHDDDTYLRDVVVSFLLAGRDTVASALTSFFYLLGKHPEVESLIRDEA  344

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             DRV+G ++DL + E+ +++L+YLQAA  ES+RLFPPIQFDSKFC+EDDVLPDGT V+ GT
Sbjct  345   DRVIGHDKDLTSFEE-LKQLHYLQAATHESMRLFPPIQFDSKFCLEDDVLPDGTKVESGT  403

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYHPYAMGR+E IWG DCLEF+P+RWL+DGVF   NPF+YPVFQAGLRVC+GKE+AL+
Sbjct  404   RVTYHPYAMGRLEEIWGCDCLEFRPQRWLKDGVFQPMNPFEYPVFQAGLRVCVGKEVALM  463

Query  616   ELKSVALSVLRRFRVHLAQP--HHTPRFSPGLTATFRDGLPVFVQQR  482
             E+KSVA+S+LR+F + L  P     PRFSPGLTATF  GLPV V++R
Sbjct  464   EMKSVAVSLLRKFHIELLAPLSFGNPRFSPGLTATFSFGLPVMVRER  510



>ref|XP_004149216.1| PREDICTED: cytochrome P450 94A1-like, partial [Cucumis sativus]
 ref|XP_004168802.1| PREDICTED: cytochrome P450 94A1-like, partial [Cucumis sativus]
Length=484

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/465 (66%), Positives = 381/465 (82%), Gaps = 9/465 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             F C+C++C AY+++SW   ++NLCDWY+HLLR SP+KTIHIHVLRNTITANP+NVEY+LK
Sbjct  20    FLCNCEICQAYLASSWSKDFHNLCDWYSHLLRQSPTKTIHIHVLRNTITANPDNVEYILK  79

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             ++FEN+PKGK FS+ILGDFLG+GIFNVDGD WRFQ+K+A +ELG+ S+ SY FE++  EI
Sbjct  80    TKFENYPKGKIFSSILGDFLGRGIFNVDGDLWRFQKKMAIIELGQQSIRSYCFEIVSQEI  139

Query  1501  DRRLLPILAGKKD---GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RLLP+L+   D   GGV+DLQDVFRRF+FD IC+FSFGLDP CLE  LP+S+ AV+F 
Sbjct  140   HSRLLPLLSSVADGGSGGVLDLQDVFRRFAFDSICKFSFGLDPMCLELSLPISDIAVAFD  199

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERAM+  P++WKIKR LN+G EKEL+K+I+++N+LA EVIRQRRKLG S   H
Sbjct  200   LASKLSAERAMAVPPLIWKIKRMLNLGREKELKKAIKLINVLAHEVIRQRRKLGFS--TH  257

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             +DLLS+FM ++  DET+LRDI++SFLLAGRDT+ASALTSFFW+I+ HP    AI  EADR
Sbjct  258   RDLLSQFMRTVS-DETFLRDIIVSFLLAGRDTIASALTSFFWVISTHPAVESAIQLEADR  316

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
             V+G   +  + +Q +R L+YLQAA+ ES+RL+PPIQFDSKFC  DD+LPDGT V+RGTRV
Sbjct  317   VIGPTSNPTSFDQ-IRNLHYLQAAIFESMRLYPPIQFDSKFCQNDDILPDGTFVRRGTRV  375

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             +YHPYAMGRME IWG++CLEF PERWL++ +F  ENPFKYP+FQ G R CLGKEMAL EL
Sbjct  376   SYHPYAMGRMEQIWGTNCLEFNPERWLKNNIFCPENPFKYPIFQGGFRFCLGKEMALFEL  435

Query  610   KSVALSVLRRFRVHLAQPHHT--PRFSPGLTATFRDGLPVFVQQR  482
             K VALSV+R FR+    P  +  PRFSPGLTATF  G  V V ++
Sbjct  436   KIVALSVIRHFRIQSTTPSSSVAPRFSPGLTATFCGGFKVIVSKK  480



>gb|KGN59117.1| hypothetical protein Csa_3G775300 [Cucumis sativus]
Length=495

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/465 (66%), Positives = 381/465 (82%), Gaps = 9/465 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             F C+C++C AY+++SW   ++NLCDWY+HLLR SP+KTIHIHVLRNTITANP+NVEY+LK
Sbjct  31    FLCNCEICQAYLASSWSKDFHNLCDWYSHLLRQSPTKTIHIHVLRNTITANPDNVEYILK  90

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             ++FEN+PKGK FS+ILGDFLG+GIFNVDGD WRFQ+K+A +ELG+ S+ SY FE++  EI
Sbjct  91    TKFENYPKGKIFSSILGDFLGRGIFNVDGDLWRFQKKMAIIELGQQSIRSYCFEIVSQEI  150

Query  1501  DRRLLPILAGKKD---GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RLLP+L+   D   GGV+DLQDVFRRF+FD IC+FSFGLDP CLE  LP+S+ AV+F 
Sbjct  151   HSRLLPLLSSVADGGSGGVLDLQDVFRRFAFDSICKFSFGLDPMCLELSLPISDIAVAFD  210

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERAM+  P++WKIKR LN+G EKEL+K+I+++N+LA EVIRQRRKLG S   H
Sbjct  211   LASKLSAERAMAVPPLIWKIKRMLNLGREKELKKAIKLINVLAHEVIRQRRKLGFS--TH  268

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             +DLLS+FM ++  DET+LRDI++SFLLAGRDT+ASALTSFFW+I+ HP    AI  EADR
Sbjct  269   RDLLSQFMRTVS-DETFLRDIIVSFLLAGRDTIASALTSFFWVISTHPAVESAIQLEADR  327

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
             V+G   +  + +Q +R L+YLQAA+ ES+RL+PPIQFDSKFC  DD+LPDGT V+RGTRV
Sbjct  328   VIGPTSNPTSFDQ-IRNLHYLQAAIFESMRLYPPIQFDSKFCQNDDILPDGTFVRRGTRV  386

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             +YHPYAMGRME IWG++CLEF PERWL++ +F  ENPFKYP+FQ G R CLGKEMAL EL
Sbjct  387   SYHPYAMGRMEQIWGTNCLEFNPERWLKNNIFCPENPFKYPIFQGGFRFCLGKEMALFEL  446

Query  610   KSVALSVLRRFRVHLAQPHHT--PRFSPGLTATFRDGLPVFVQQR  482
             K VALSV+R FR+    P  +  PRFSPGLTATF  G  V V ++
Sbjct  447   KIVALSVIRHFRIQSTTPSSSVAPRFSPGLTATFCGGFKVIVSKK  491



>ref|XP_004516191.1| PREDICTED: cytochrome P450 94A1-like [Cicer arietinum]
Length=520

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/473 (65%), Positives = 381/473 (81%), Gaps = 18/473 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC++C AY+++SW   +NNL DWYTHLL+ SP+KTIHIHVLRNTIT+N ENVEYMLK+
Sbjct  49    FCSCEICQAYLTSSWSKDFNNLSDWYTHLLKKSPTKTIHIHVLRNTITSNSENVEYMLKT  108

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             +FEN+PKGK FS ILGDFLG+GIFNVDG+ W+FQ+K+AS+E+ + S+ S+AFEV+  EI 
Sbjct  109   KFENYPKGKPFSMILGDFLGRGIFNVDGELWKFQKKMASLEINKHSIRSFAFEVVNNEIQ  168

Query  1498  RRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASK  1319
              RL+P+L  + D  V+DLQDVF+R SFD ICRFSFGLDP CLE  LPMS+FA+SF LASK
Sbjct  169   NRLIPLLQNQND-VVLDLQDVFKRLSFDAICRFSFGLDPMCLEKSLPMSDFALSFDLASK  227

Query  1318  LSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLL  1139
             LSAERAM+ SP++WKIKRF N+GSEKEL+KSI ++N LA  VI QRRK+G  D+  KDLL
Sbjct  228   LSAERAMTVSPLIWKIKRFFNLGSEKELKKSITMINTLAKVVINQRRKMGFCDQ--KDLL  285

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGK  959
             SRFM ++ DD  +LRDIVISFLLAGRDTVAS+LTSFFWL+A +P+    IL EA+RV+G 
Sbjct  286   SRFMSTVQDD-IFLRDIVISFLLAGRDTVASSLTSFFWLLAKNPEVESQILLEAERVIGI  344

Query  958   NQDLIASE--------QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
              +    +         +++ +L+YL+AA  ES+RL+PPIQFDSKFC+EDDVLPDGT VK 
Sbjct  345   GKHNKNNNNINVVTNFEQLTKLHYLEAATHESMRLYPPIQFDSKFCLEDDVLPDGTKVKS  404

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGR+E +WG DCLEFKP+RWL+DGVF  +N FKYP+FQ GLRVC+GKEMA
Sbjct  405   GTRVTYHPYAMGRLEELWGPDCLEFKPQRWLKDGVFHPQNQFKYPIFQGGLRVCIGKEMA  464

Query  622   LLELKSVALSVLRRFRVHLAQP------HHTPRFSPGLTATFRDGLPVFVQQR  482
             L+ELK+V LS+L  F   LA        +H PRFSPGLTATF  GLPVFV+QR
Sbjct  465   LMELKTVVLSLLTNFHFELADQNTFHGFNHLPRFSPGLTATFAFGLPVFVRQR  517



>ref|XP_002529058.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33302.1| cytochrome P450, putative [Ricinus communis]
Length=499

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/462 (67%), Positives = 380/462 (82%), Gaps = 7/462 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CD+C +Y++ SW  ++ NLCDWYTHLL+ SP+ TIHIHVL N IT+NPENVEY+LK+
Sbjct  40    WCNCDICKSYITASWAKEFVNLCDWYTHLLKKSPTGTIHIHVLGNIITSNPENVEYILKT  99

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              FEN+PKGK FSA+LGD LG+GIFNVDGDSWRFQRK+AS+ELG  S+  YAFE+I +EI 
Sbjct  100   NFENYPKGKPFSALLGDLLGRGIFNVDGDSWRFQRKMASLELGSVSIRMYAFELIMSEIK  159

Query  1498  RRLLPILAG---KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
              RL+P+L+     KD   +DLQDVFRRFSFD IC+FSFGLDP CL+  LP+SEFA++F  
Sbjct  160   SRLIPLLSSISCDKDQQGIDLQDVFRRFSFDNICKFSFGLDPGCLKLSLPISEFALAFDT  219

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             ASKLSAERA++AS ++WK+KRFLNIGSEK+L+++I+++N LA  VI  RRK G  D  +K
Sbjct  220   ASKLSAERALAASSMIWKMKRFLNIGSEKKLKEAIQMVNELAEGVINHRRKEGCMD--NK  277

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFMGSI DD+ YLRDIVISFLLAGRDTVAS LTSFFWL++ HP    AI  E+DRV
Sbjct  278   DLLSRFMGSINDDK-YLRDIVISFLLAGRDTVASGLTSFFWLLSKHPQVESAIREESDRV  336

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +G +++L + EQ +REL+YL AAV ES+RLFPP+QFDSKF  EDD+LPDGT +++GTRVT
Sbjct  337   MGSSEELTSYEQ-LRELHYLNAAVYESMRLFPPVQFDSKFSQEDDILPDGTFIRKGTRVT  395

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YH YAMGRME IWG DCLEFKPERWL++GVF  E+  KYPVF AG RVCLGKEMAL+E+K
Sbjct  396   YHQYAMGRMERIWGQDCLEFKPERWLKNGVFVPESSSKYPVFHAGFRVCLGKEMALVEMK  455

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             SVAL+++R F V +  P+  PRFSPGLTAT R GLPV +Q+R
Sbjct  456   SVALTMIRAFNVRVVDPNQVPRFSPGLTATMRGGLPVVIQER  497



>ref|XP_006471356.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=502

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/461 (66%), Positives = 378/461 (82%), Gaps = 6/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C CDVC +Y++ SW   +NNLCDWYTHLL  SP+ TIH+H L NT+T+NP NVEY+L++
Sbjct  44    WCQCDVCRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHALGNTVTSNPVNVEYILQT  103

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS ILGD LG+GIFNVDG+SW+FQRKIAS+ELG  ++  Y+FE++  EI 
Sbjct  104   RFDNYPKGKPFSVILGDLLGRGIFNVDGNSWKFQRKIASVELGSFNIKMYSFELVTAEIR  163

Query  1498  RRLLPIL--AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RL+P+L  A  KD  ++DLQDVFRRFSFD ICRFSFGLDP+CL+  LP+S FA +F LA
Sbjct  164   SRLIPLLSSAANKDNNILDLQDVFRRFSFDNICRFSFGLDPECLKLNLPISTFATAFDLA  223

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAERA++ SP+VWKIKR LNIGSEK+L+ +I+++N LA  +I QRR++G S +N  D
Sbjct  224   SKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAIKLVNELAETMIHQRRQMGFSSKN--D  281

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM SI DD+ YLRDIV+SFLLAGRDTVAS LTSFFWL++ HP+   AI  E+D+++
Sbjct  282   LLSRFMASI-DDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHPEVESAIRNESDKIM  340

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               NQ LI+ EQ +RE+NYL AAV ES+RLFPP+QFDSKF  EDD+LPDGT V RGTRVTY
Sbjct  341   KPNQVLISLEQ-LREMNYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVGRGTRVTY  399

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGRME IWG DCLEFKPERWLR+G F  ENPFKYPVFQAG RVCLGK+MAL+E+KS
Sbjct  400   HPYAMGRMERIWGPDCLEFKPERWLRNGRFVPENPFKYPVFQAGHRVCLGKDMALVEMKS  459

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              AL+V+R+F + ++ P+  PRF+PGLTAT   GLPV V++R
Sbjct  460   AALAVVRKFNIRVSDPNQAPRFAPGLTATVSGGLPVMVRER  500



>ref|XP_006424280.1| hypothetical protein CICLE_v10028253mg [Citrus clementina]
 gb|ESR37520.1| hypothetical protein CICLE_v10028253mg [Citrus clementina]
Length=502

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/461 (66%), Positives = 377/461 (82%), Gaps = 6/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C CD C +Y++ SW   +NNLCDWYTHLL  SP+ TIH+HVL NTIT+NP NVEY+LK+
Sbjct  44    WCQCDACRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHVLGNTITSNPGNVEYILKT  103

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS ILGD LG+GIFNVDGDSW FQRK+A  ELG  ++  YA E++  EI 
Sbjct  104   RFDNYPKGKPFSVILGDLLGRGIFNVDGDSWEFQRKMACFELGSFNIKMYALELVTAEIR  163

Query  1498  RRLLPIL--AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RL+P+L  A  KD  ++DLQDVFRRFSFD IC+FSFGLDP+CL   LP+S+FA +F LA
Sbjct  164   SRLIPLLSSAANKDNNILDLQDVFRRFSFDSICKFSFGLDPECLMLNLPVSKFATAFDLA  223

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAERA++ SP+VWKIKR LNIGSEK+L+ +I ++N LA  +I QR+++G S +N  D
Sbjct  224   SKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAINLVNELAETMIHQRQQMGFSKKN--D  281

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM SI DD+ YLRDIV+SFLLAGRDTVAS LTSFFWL++ HP+   AI  E+D+++
Sbjct  282   LLSRFMASI-DDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHPEVESAIRNESDKIM  340

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               NQDL++ EQ +REL+YL AAV ES+RLFPP+QFDSKF  EDD+LPDGT V++GTRVTY
Sbjct  341   KPNQDLVSFEQ-LRELHYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVRKGTRVTY  399

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGRME IWG DCLEFKP+RWLR+G F  ENPFKYPVFQAG RVCLGK++AL+E+KS
Sbjct  400   HPYAMGRMERIWGPDCLEFKPQRWLRNGRFVPENPFKYPVFQAGHRVCLGKDIALVEMKS  459

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             VAL+V+R+F + ++ P+  PRF+PGLTAT R GLPV VQ+R
Sbjct  460   VALAVVRKFNIRVSDPNQAPRFAPGLTATVRGGLPVMVQER  500



>gb|KDO51311.1| hypothetical protein CISIN_1g040199mg [Citrus sinensis]
Length=502

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/461 (66%), Positives = 377/461 (82%), Gaps = 6/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C CD C +Y++ SW   +NNLCDWYTHLL  SP+ TIH+HVL NTIT+NP NVEY+LK+
Sbjct  44    WCQCDACRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHVLGNTITSNPGNVEYILKT  103

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS ILGD LG+GIFNVDGDSW FQRK+A  ELG  ++  YA E++  EI 
Sbjct  104   RFDNYPKGKPFSVILGDLLGRGIFNVDGDSWEFQRKMACFELGSFNIKMYALELVTAEIR  163

Query  1498  RRLLPIL--AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RL+P+L  A  KD  ++DLQDVFRRFSFD IC+FSFGLDP+CL   LP+S+FA +F LA
Sbjct  164   SRLIPLLSSAANKDNNILDLQDVFRRFSFDSICKFSFGLDPECLMLNLPVSKFATAFDLA  223

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAERA++ SP+VWKIKR LNIGSEK+L+ +I ++N LA  +I QR+++G S +N  D
Sbjct  224   SKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAINLVNELAETMIHQRQQMGFSKKN--D  281

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM SI DD+ YLRDIV+SFLLAGRDTVAS LTSFFWL++ HP+   AI  E+D+++
Sbjct  282   LLSRFMASI-DDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHPEVESAIRNESDKIM  340

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               NQDL++ EQ +REL+YL AAV ES+RLFPP+QFDSKF  EDD+LPDGT V++GTRVTY
Sbjct  341   KPNQDLVSFEQ-LRELHYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVRKGTRVTY  399

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGRME IWG DCLEFKP+RWLR+G F  ENPFKYPVFQAG RVCLGK++AL+E+KS
Sbjct  400   HPYAMGRMERIWGPDCLEFKPQRWLRNGRFVPENPFKYPVFQAGHRVCLGKDIALVEMKS  459

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             VAL+V+R+F + ++ P+  PRF+PGLTAT R GLPV VQ+R
Sbjct  460   VALAVVRKFNIRVSDPNQAPRFAPGLTATVRGGLPVMVQER  500



>ref|XP_006471355.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=502

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/461 (66%), Positives = 377/461 (82%), Gaps = 6/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C CD C +Y++ SW   +NNLCDWYTHLL  SP+ TIH+HVL NTIT+NP NVEY+LK+
Sbjct  44    WCQCDACRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHVLGNTITSNPGNVEYILKT  103

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGKAFS ILGD LG+GIFNVDGDSW FQRK+A  ELG  ++  YA E++  EI 
Sbjct  104   RFDNYPKGKAFSVILGDLLGRGIFNVDGDSWEFQRKMACFELGSFNIKMYALELVTAEIR  163

Query  1498  RRLLPIL--AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RL+P+L  A  KD  ++DLQDVFRRFSFD IC+FSFGLDP+CL   LP+S+FA +F LA
Sbjct  164   SRLIPLLSSAANKDNNILDLQDVFRRFSFDSICKFSFGLDPECLMLNLPVSKFATAFDLA  223

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAERA++ SP+VWKIKR LNIGSEK+L+ +I ++N LA  +I QR+++G S +N  D
Sbjct  224   SKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAINLVNELAETMIHQRQQMGFSKKN--D  281

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM SI DD+ YLRDIV+SFLLAGRDTVAS LTSFFWL++ HP+   AI  E+ +++
Sbjct  282   LLSRFMASI-DDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHPEVESAIRNESYKIM  340

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               NQDL++ EQ +REL+YL AAV ES+RLFPP+QFDSKF  EDD+LPDGT V++GTRVTY
Sbjct  341   KPNQDLVSFEQ-LRELHYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVRKGTRVTY  399

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGRME IWG DCLEFKPERWLR+G F  ENPFKYPVFQAG RVCLGK++AL+E+KS
Sbjct  400   HPYAMGRMERIWGPDCLEFKPERWLRNGRFVLENPFKYPVFQAGHRVCLGKDIALVEMKS  459

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             VAL+V+R+F + ++ P+  P+F+PGLTAT R GLPV VQ+R
Sbjct  460   VALAVVRKFNIRVSDPNQAPQFAPGLTATVRGGLPVMVQER  500



>ref|XP_010089862.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXB38478.1| Cytochrome P450 94A1 [Morus notabilis]
Length=492

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/464 (66%), Positives = 381/464 (82%), Gaps = 8/464 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C+VC +++++SW +++ NLCDWYTHLLR SP+ TIH+HVL NTITANPENVEYMLK+
Sbjct  31    WCNCEVCRSFLTSSWTSEFGNLCDWYTHLLRKSPTGTIHVHVLGNTITANPENVEYMLKT  90

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RFEN+PKGK FS ILGD LG+GIFNVDGDSWRFQRK AS+ELG +SV SYAFE+I+TEI 
Sbjct  91    RFENYPKGKPFSMILGDLLGRGIFNVDGDSWRFQRKTASLELGSTSVRSYAFEIIKTEIK  150

Query  1498  RRLLPILA---GKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
              RL+P+LA   GKK+  GGV+DLQDV RRFSFD IC+FSFGLDP  L   LPMSEFA +F
Sbjct  151   SRLIPLLASVSGKKEQEGGVLDLQDVLRRFSFDNICKFSFGLDPGGLRLSLPMSEFAAAF  210

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              LASKLSAERA SASP++WK+KR L IGSE++LR+S+++++ LA E+IR RR+ G SD  
Sbjct  211   DLASKLSAERATSASPLIWKVKRLLGIGSERKLRESVKMVDNLAAEMIRSRREKGFSD--  268

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
              +DLLSRFM S+ DD+ YLRDIV+SFLLAGRDTV+SALTSFF+LI+ HP+  + I  E+D
Sbjct  269   RQDLLSRFMASV-DDDRYLRDIVVSFLLAGRDTVSSALTSFFYLISQHPEVEQKIREESD  327

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             RV+G   D +     M E++YL AA+ ES+RL+PP+QFDSKFC EDDVLPDG  V++GTR
Sbjct  328   RVMGSGSDEVPDFGEMGEMHYLHAAIHESMRLYPPVQFDSKFCQEDDVLPDGALVRKGTR  387

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VT+HPYAMGRME IWG DCLEFKPERW ++GVF     FKYPVFQAG R+CLG+EMA++E
Sbjct  388   VTFHPYAMGRMEQIWGPDCLEFKPERWFKNGVFAPVCLFKYPVFQAGRRICLGREMAVME  447

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +KSVA ++++RF + +  PH  PRF+ GLTAT R GLPV +Q+R
Sbjct  448   MKSVAHTLIKRFNIRVFGPHQEPRFAAGLTATVRGGLPVRIQER  491



>emb|CDP06950.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/464 (64%), Positives = 389/464 (84%), Gaps = 8/464 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSCD C +Y+++SW  ++NNLCDWY+HLL+ SP+ TIH+HVL N ITANP+NVEY++K+
Sbjct  43    WCSCDSCRSYLTSSWSHEFNNLCDWYSHLLQKSPTGTIHVHVLSNIITANPKNVEYIIKT  102

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RFENFPKGK FSA+LGD LG+GIFNVDG+SW+FQRK+AS+ELG  S  SYAF+V+  EI 
Sbjct  103   RFENFPKGKPFSALLGDLLGRGIFNVDGESWKFQRKMASLELGSVSTRSYAFQVVANEIR  162

Query  1498  RRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RL+P+L+    K+G V+DLQDV RRFSFD IC+FSFG+DP CLE  LP+SE A +F LA
Sbjct  163   TRLVPLLSSVAGKEGKVLDLQDVLRRFSFDTICKFSFGMDPSCLELSLPVSELANAFDLA  222

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             ++LSA RA+SASP++WK+KRFLN GSEK+L+++++++N LA  VI+Q+R +G S +  +D
Sbjct  223   TQLSAARAISASPLIWKLKRFLNTGSEKKLKEALKLVNSLAEGVIKQKRNMGFSSQ--QD  280

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFMGSI DD+ YLRDI++SFLLAGRDTVASALT FFWL+A HP+  +AIL E++ ++
Sbjct  281   LLSRFMGSIEDDK-YLRDIIVSFLLAGRDTVASALTCFFWLLAKHPEVKQAILDESNHIM  339

Query  964   GKN--QDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
             G+N   D +AS ++M++++YLQAA+ ES+RL+PP+QFDSK+C EDDVLPDGT VK+GT+V
Sbjct  340   GENISADNLASFEQMQKMHYLQAAIYESMRLYPPVQFDSKYCQEDDVLPDGTFVKKGTKV  399

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             TYHPYAMGRM+ IWG DCLEFKPERWL+DG F  E+PFKYPVFQ GLRVCLGK+MAL+E+
Sbjct  400   TYHPYAMGRMQSIWGPDCLEFKPERWLQDGRFKPESPFKYPVFQGGLRVCLGKDMALVEM  459

Query  610   KSVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQR  482
             KS+ALS++R+F + +  P   TPRF PGLTA+ R GL V +Q+R
Sbjct  460   KSIALSLIRQFDIQVNAPTSDTPRFMPGLTASVRGGLQVQIQER  503



>ref|XP_007010240.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY19050.1| Cytochrome P450 [Theobroma cacao]
Length=502

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/461 (66%), Positives = 376/461 (82%), Gaps = 6/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSCD+C AY+S++W  ++NNLCDWYT+LL+ SPS+TIHIHVL NTITANPENVEYMLK+
Sbjct  40    WCSCDICHAYLSSNWSKEFNNLCDWYTYLLQKSPSQTIHIHVLNNTITANPENVEYMLKT  99

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF ++PKGK+F+ ILGD LG+GIFNVDGD W FQRK+AS+EL   ++ +YAFE++ TEI 
Sbjct  100   RFNDYPKGKSFAMILGDLLGKGIFNVDGDLWMFQRKMASLELANFAIRAYAFEIVATEIK  159

Query  1498  RRLLPILAG--KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RLLP+L+    KDG V+DLQ+VFRRFSFD IC+FSFGLDP CLES LP+S FA +F LA
Sbjct  160   YRLLPLLSSFSGKDGSVLDLQEVFRRFSFDNICKFSFGLDPGCLESSLPISHFADAFDLA  219

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAER M+  P++WKIKR  NIGSEK+L+K+IE +N LAMEVI Q+RKLG S   HKD
Sbjct  220   SKLSAERGMAPVPLLWKIKRIFNIGSEKKLKKAIEAVNGLAMEVIMQKRKLGFS--THKD  277

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM  I DD +YLRDIVISF+LAGRDT+ASALT+ FWL+ANHP A   I  E+D+  
Sbjct  278   LLSRFMACINDD-SYLRDIVISFILAGRDTMASALTTLFWLLANHPLAISEIRKESDQFR  336

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               NQ+  AS  ++R+++YL A V ESLRL+PP+QFDSKF  +DD+LPDGT V++GTRVTY
Sbjct  337   ESNQEF-ASYDQIRKMHYLHATVYESLRLYPPVQFDSKFACKDDILPDGTFVQKGTRVTY  395

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGRME +WGSDC++FKPERWL+DG F  + PFKYPVFQAG+RVCLGKE+AL+E+K 
Sbjct  396   HPYAMGRMENVWGSDCIKFKPERWLKDGTFCPQCPFKYPVFQAGVRVCLGKELALVEMKV  455

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             V LSVLR+F + L  P   P+F PGLTA  R GL V +++R
Sbjct  456   VVLSVLRQFDIELVAPKVAPQFDPGLTAMVRGGLQVVIRKR  496



>ref|XP_002264897.1| PREDICTED: cytochrome P450 94C1 [Vitis vinifera]
 emb|CAN76753.1| hypothetical protein VITISV_011074 [Vitis vinifera]
Length=504

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/461 (66%), Positives = 383/461 (83%), Gaps = 8/461 (2%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C CDVC +Y+S SW  +++NL DWYTHLLR SPS+TIH+HVL N ITANPENVEYMLK+R
Sbjct  45    CDCDVCRSYLSGSWKMEFDNLSDWYTHLLRKSPSRTIHVHVLGNIITANPENVEYMLKTR  104

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F+N+PKGK FSAILGD LG+GIFNVDGDSW+FQRK+AS+ELG  S+ ++AFE++ +EI  
Sbjct  105   FDNYPKGKPFSAILGDLLGRGIFNVDGDSWKFQRKMASLELGSVSIRTFAFEIVTSEIKN  164

Query  1495  RLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
             RL+P++   AG+ +  ++DLQDV RRFSFD ICRFSFGLDP CL+  LPMSEFA +F LA
Sbjct  165   RLIPLMSSIAGRSEA-ILDLQDVLRRFSFDNICRFSFGLDPGCLQLSLPMSEFAEAFDLA  223

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAERAM+ASP++WK+KR LNIGSE++L+++I++++ LA E+I+QRR  G S    +D
Sbjct  224   SKLSAERAMTASPLIWKMKRLLNIGSERKLKEAIKMVDELAHELIKQRRTAGFS--TQRD  281

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM S+ DD+ YLRDIVISFLLAGRDTVASALTSFFWL++ HP+   AI  E+DR++
Sbjct  282   LLSRFMCSVSDDQ-YLRDIVISFLLAGRDTVASALTSFFWLLSQHPEVVSAIREESDRIM  340

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
             G+ ++  + EQ MRE++YLQA+V ES+RLFPPIQFDSKF +++DVLPDGT V++GTRVT+
Sbjct  341   GQTEEQASFEQ-MREMHYLQASVYESMRLFPPIQFDSKFSLQEDVLPDGTFVRKGTRVTF  399

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGRME  WG DCLEFKPERWL++G F  ENPFKYPVFQAG RVCLGKEMA++++KS
Sbjct  400   HPYAMGRMEKAWGPDCLEFKPERWLKNGEFMAENPFKYPVFQAGPRVCLGKEMAVVQMKS  459

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             VAL+++RRF +  A P    RF+PGLTAT R G  V V +R
Sbjct  460   VALALVRRFDIQDAVPSRAQRFAPGLTATVRGGFQVRVHER  500



>ref|XP_010034212.1| PREDICTED: cytochrome P450 94C1-like [Eucalyptus grandis]
 gb|KCW50816.1| hypothetical protein EUGRSUZ_J00477 [Eucalyptus grandis]
Length=509

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/461 (66%), Positives = 385/461 (84%), Gaps = 5/461 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C C+VC+AY+S+SW  +++NLCDWYTHLLR SP+ TIH+HVL N +TANP NVE+ML++R
Sbjct  45    CDCEVCTAYLSSSWTKEFDNLCDWYTHLLRKSPTGTIHVHVLGNVVTANPANVEHMLRTR  104

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F+N+PKGK FSAILGD LG+GIFNVDG+SW+FQRK+AS+ELG  S+ +YAFEV+ +EI+ 
Sbjct  105   FDNYPKGKPFSAILGDLLGRGIFNVDGESWKFQRKMASLELGSVSIRAYAFEVVASEIES  164

Query  1495  RLLPILAG--KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
             RL P+L+    KD  V+DLQDVFRRFSFD IC+FSFGLDP CL+  LP+SEFA +F  AS
Sbjct  165   RLFPLLSSVCGKDDRVLDLQDVFRRFSFDSICKFSFGLDPGCLKLSLPVSEFAEAFDAAS  224

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSAERAMS SP+VW+IKR LNIG E+ L ++I+++N LA EVI+Q+R++G S E H DL
Sbjct  225   RLSAERAMSPSPLVWRIKRLLNIGGERRLGEAIKMVNALADEVIKQKREMGPS-EGHNDL  283

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFM +I DD+ YLRDIV+SFLLAGRDTVASALTSFFWL++ +P+  +AI  E+DRV+G
Sbjct  284   LSRFMINI-DDDRYLRDIVVSFLLAGRDTVASALTSFFWLLSQNPEVRDAIREESDRVMG  342

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
                D +AS ++MR++ YLQAA+ E +RL+PP+QFDSKF  +DDVLPDG  VK+GTRVTYH
Sbjct  343   PTADGLASFEQMRKMPYLQAALYECMRLYPPVQFDSKFAQDDDVLPDGKKVKKGTRVTYH  402

Query  781   PYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             PYAMGRME +WG D L+F+P RWL RDGVF  ENP+KYPVFQAG+RVCLGKEMAL+E+KS
Sbjct  403   PYAMGRMERLWGPDGLKFRPSRWLTRDGVFSPENPYKYPVFQAGVRVCLGKEMALVEMKS  462

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             VAL+++RRF V +A  H  PRF+PGLTAT R GLPV +++R
Sbjct  463   VALALVRRFDVRVADGHRGPRFAPGLTATIRGGLPVEIEER  503



>ref|XP_006424281.1| hypothetical protein CICLE_v10028254mg [Citrus clementina]
 gb|ESR37521.1| hypothetical protein CICLE_v10028254mg [Citrus clementina]
 gb|KDO51312.1| hypothetical protein CISIN_1g010737mg [Citrus sinensis]
Length=502

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/461 (66%), Positives = 376/461 (82%), Gaps = 6/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C CDVC +Y++ SW   +NNLCDWYTHLL  SP+ TIH+H L NT+T+NPENVEY+LK+
Sbjct  44    WCQCDVCRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHALGNTVTSNPENVEYILKT  103

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS ILGD LG GIFNVDG+SW+FQRKIAS+ELG  +   YAFE++  EI 
Sbjct  104   RFDNYPKGKPFSVILGDLLGGGIFNVDGNSWKFQRKIASVELGSFNFKMYAFELVTAEIR  163

Query  1498  RRLLPIL--AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RL+P+L  A  K   ++DLQDVFRRFSFD IC+FSFGLDP+CL   LP+S+FA +F LA
Sbjct  164   FRLIPLLSSAANKVNNILDLQDVFRRFSFDSICKFSFGLDPECLMLNLPVSKFATAFDLA  223

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAERA++ SP+VWKIKR LNIGSEK+L+ +I+++N LA  +I QR+++G S +N  D
Sbjct  224   SKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAIKLVNELAETMIHQRQQMGFSKKN--D  281

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM SI DD+ YLRDIV+SFLLAGRDTVAS LTSFFWL++ H +   AI  E+D+++
Sbjct  282   LLSRFMASI-DDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHSEVESAIRNESDKIM  340

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               NQDL++ EQ +REL+YL AAV ES+RLFPP+QFDSKF  EDD+LPDGT V++GTRVTY
Sbjct  341   KPNQDLVSFEQ-LRELHYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVRKGTRVTY  399

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGRME IWG DC EFKPERWLR+G F  +NPFKYPVFQAG RVCLGK+MAL+E+KS
Sbjct  400   HPYAMGRMERIWGPDCSEFKPERWLRNGTFVPQNPFKYPVFQAGHRVCLGKDMALVEMKS  459

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              AL+V+R+F + ++ P+  PRF+PGLTAT   GLPV VQ+R
Sbjct  460   AALAVVRKFNIRVSDPNQAPRFAPGLTATVSGGLPVMVQER  500



>ref|XP_010658738.1| PREDICTED: cytochrome P450 94C1-like [Vitis vinifera]
Length=506

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/461 (65%), Positives = 378/461 (82%), Gaps = 6/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CD+C  Y+++SW  ++ NLCDWYTHLL+ SP+ TIHIHVL NTITANP+NVEYMLK+
Sbjct  43    WCNCDICCGYLTSSWLMEFGNLCDWYTHLLQKSPTHTIHIHVLGNTITANPDNVEYMLKT  102

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS ILGD LG+GIFNVDGDSW FQRK+AS+ELG  S+ S+AFEV+  EI 
Sbjct  103   RFDNYPKGKPFSTILGDLLGKGIFNVDGDSWVFQRKMASLELGSVSIRSFAFEVVMAEIK  162

Query  1498  RRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RLLP+L+   +KDG V+DLQDVFRRF+FD IC+FSFGLDP CLE  LP+S+FA SF LA
Sbjct  163   HRLLPLLSSYAEKDGSVLDLQDVFRRFTFDNICKFSFGLDPGCLELALPISQFAESFDLA  222

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             +KLSAERAM ASP++WKIKR LN+GSE+ L+++I+ +N+LA E+I Q+RKLG S   H+D
Sbjct  223   TKLSAERAMVASPLIWKIKRLLNLGSERRLKEAIKKVNVLAKELIIQKRKLGFS--THQD  280

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM  I DD+ YLRDIVISF+LAGRDT+ASALT+FFWL+A HP+    I  EADR++
Sbjct  281   LLSRFMACIKDDD-YLRDIVISFILAGRDTMASALTTFFWLVATHPEVESKIRDEADRIM  339

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               NQ+   S + +RE++YL AAV ESLRL+PP+QFDSKF  +DDVL DGT V +GTRVTY
Sbjct  340   HPNQEF-PSFELIREMHYLHAAVHESLRLYPPVQFDSKFARQDDVLRDGTFVMKGTRVTY  398

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGR+E IWG DC+EF+P+RWL +G FF ++PFK+PVFQAG+RVCLGKEMA++ +KS
Sbjct  399   HPYAMGRIEAIWGPDCMEFRPQRWLNNGTFFPQSPFKFPVFQAGIRVCLGKEMAVVAMKS  458

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             VA +VLR F +H+   +  PRF  GLTAT R GLPV V++R
Sbjct  459   VAAAVLRPFNIHVVHANVAPRFDSGLTATVRGGLPVVVRER  499



>gb|AED99869.1| cytochrome P450 [Panax notoginseng]
Length=489

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/463 (65%), Positives = 373/463 (81%), Gaps = 7/463 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             YC C+    ++S  W  KYNNLCDWYTHLL+ SP+ TIH+HVL N IT+NPENVEYMLK+
Sbjct  28    YCGCETSRTFLSAGWNLKYNNLCDWYTHLLQESPTGTIHVHVLDNIITSNPENVEYMLKT  87

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+N+PKGK FS ILGD LG+GIFNVDG+ W+FQRK+AS+ELG  S+ SYAFE +  EI+
Sbjct  88    NFDNYPKGKPFSTILGDLLGKGIFNVDGEKWKFQRKMASLELGSLSIRSYAFETVTWEIN  147

Query  1498  RRLLPILA----GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              RL+P+L+    G K  GVVDLQD+FRRFSFD IC+FSFG+DP CL+  LP+SEFA +F 
Sbjct  148   NRLIPLLSSSAVGCKKSGVVDLQDIFRRFSFDNICKFSFGVDPGCLKLSLPLSEFAEAFD  207

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSA+RA++ASPVVWK+KR LN+GSEK+LRK+I+ +++LA EVIRQ+R +G S   +
Sbjct  208   LASKLSAQRALTASPVVWKVKRLLNLGSEKKLRKAIKKVDVLAEEVIRQKRLMGFS--TN  265

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFMGSI DD+ YLRDIVISFLLAGRDTVASALTSFFWL+  HP    +I  E   
Sbjct  266   DDLLSRFMGSINDDK-YLRDIVISFLLAGRDTVASALTSFFWLLDQHPGVVTSIRDELSS  324

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
               G  Q  +A   ++RE +YLQAA+ ES+RL+PP+QFDSKFC +DDVLPDGT V++GTR+
Sbjct  325   PSGGQQHKLAGVDQLREFHYLQAALYESMRLYPPVQFDSKFCQQDDVLPDGTFVRKGTRL  384

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             TYHPYAMGRME IWGSDCL+FKP+RWL +GVF  E+P+KYPVFQAGLRVCLGKEMAL+E+
Sbjct  385   TYHPYAMGRMESIWGSDCLQFKPQRWLENGVFQPESPYKYPVFQAGLRVCLGKEMALMEM  444

Query  610   KSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             KSVA+++++RF +    P  T  F+PGLTAT R G PV +++R
Sbjct  445   KSVAVALIQRFDIQXVAPSSTMLFAPGLTATMRGGFPVTIRER  487



>ref|XP_009589328.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana tomentosiformis]
Length=499

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/467 (64%), Positives = 379/467 (81%), Gaps = 4/467 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C C++C  Y+STSW  ++ NLCDWY HLL+ SP+ TIH+HVL N ITANP+NVEYMLK++
Sbjct  30    CECEICKGYLSTSWTLQFKNLCDWYAHLLKKSPTGTIHVHVLGNVITANPKNVEYMLKTK  89

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             FENFPKG+ F+ ILGD LG+GIF VDG+ W+ QRK+AS+ELG  S+ SYAF++++ EI  
Sbjct  90    FENFPKGRQFATILGDLLGRGIFAVDGELWKLQRKMASLELGSVSIRSYAFDIVRDEIRN  149

Query  1495  RLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKL  1316
             RL+P+L   + G V+DLQDVFRRFSFD IC+FSFG+DP CL+  LP+S+  V+F LASKL
Sbjct  150   RLIPLLESNQSGTVLDLQDVFRRFSFDSICKFSFGMDPGCLKLSLPVSDLQVAFDLASKL  209

Query  1315  SAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLS  1136
             SAERAM+ASP+VWKIKR LNIGSEK+L+++I+++++LA E+I  +RK G S +N  DLLS
Sbjct  210   SAERAMTASPLVWKIKRALNIGSEKKLKEAIKMVDILAEEMISHKRKNGFSSQN--DLLS  267

Query  1135  RFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKN  956
             RFM +I DD+  LRDIVISFLLAGRDTVASALT+FFWL++ HP+  + I AE+ RV+GK 
Sbjct  268   RFMRNINDDK-LLRDIVISFLLAGRDTVASALTTFFWLLSQHPEVTDEIRAESSRVMGKT  326

Query  955   Q-DLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHP  779
             + + +AS + +R+++YL AA+ ES+RLFPPIQFDSKFC EDD LPDGT V +GTRVTYHP
Sbjct  327   EKEKLASFEEIRKMHYLTAALHESMRLFPPIQFDSKFCQEDDTLPDGTFVAKGTRVTYHP  386

Query  778   YAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             YAMGRME IWG DCLEFKPERWL+DGVF  + PFKYPVFQ GLRVCLGK++A++E+KSVA
Sbjct  387   YAMGRMESIWGQDCLEFKPERWLQDGVFKPQCPFKYPVFQGGLRVCLGKDLAIVEMKSVA  446

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR*CPPCLIN  458
             L+++R+F   +     TPRF PGLTAT R GLPV VQ+R     +IN
Sbjct  447   LALIRQFDFQVVAKEQTPRFMPGLTATVRGGLPVMVQERRQQSSVIN  493



>gb|AJD25222.1| cytochrome P450 CYP94C55 [Salvia miltiorrhiza]
Length=488

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/462 (67%), Positives = 380/462 (82%), Gaps = 9/462 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             K  +CSC++C  Y  + W  ++ NLCDWYTHLL+NSP++T+HIHVL NTITANP+NVEYM
Sbjct  34    KRVWCSCEICETYSESQWRIQFQNLCDWYTHLLKNSPNRTVHIHVLNNTITANPDNVEYM  93

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+RF+NFPKGK FSAILGDFLG+GIFNVDG  W FQRK+A++EL R S  +Y+F V+  
Sbjct  94    LKTRFDNFPKGKPFSAILGDFLGRGIFNVDGTFWTFQRKMATLELARVSTRAYSFHVVNL  153

Query  1507  EIDRRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
             EI +RL+P++A  +   ++DLQD+FR+FSFDCI RF FGLDP  LE  LP+S+F  SF L
Sbjct  154   EIQQRLMPLMASTQ---ILDLQDLFRKFSFDCISRFCFGLDPTRLELSLPLSDFVASFDL  210

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             ASKLSAERA++ SPVVWK+KRFLNIGSE+ LR++I  ++++A + IR+RRKLG S+   +
Sbjct  211   ASKLSAERALATSPVVWKVKRFLNIGSERRLRRAIGTIHVIARDFIRERRKLGFSER--Q  268

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM S+GDD+ +L DIVISFLLAGRDTVASALTSFFWL+A HPD   AILAEA+ V
Sbjct  269   DLLSRFMSSVGDDK-FLIDIVISFLLAGRDTVASALTSFFWLVACHPDVEAAILAEAEEV  327

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +      + S  ++REL+YL AAV ES+RL+PPIQFDSKFC+EDDVLPDG+ VK GTRVT
Sbjct  328   IPAE---LRSCDQLRELHYLHAAVYESMRLYPPIQFDSKFCLEDDVLPDGSFVKGGTRVT  384

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             +HPYAMGRME IWGSDCLEFKP+RW+RDGVF  ENPFK P+FQAG+RVCLGKE+AL+ELK
Sbjct  385   FHPYAMGRMEEIWGSDCLEFKPQRWMRDGVFVHENPFKCPIFQAGIRVCLGKELALMELK  444

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +VALSVLRRFRV L QP   P FSPGLTATF+DGL   ++ R
Sbjct  445   TVALSVLRRFRVELDQPDQPPCFSPGLTATFKDGLRARIRAR  486



>emb|CAN66874.1| hypothetical protein VITISV_021428 [Vitis vinifera]
Length=671

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/461 (66%), Positives = 377/461 (82%), Gaps = 6/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CD+C  Y+++SW  ++ NLCDWYTHLL+ SP+ TIHIHVL NTITANP+NVEYMLK+
Sbjct  208   WCNCDICCGYLTSSWLMEFGNLCDWYTHLLQKSPTHTIHIHVLGNTITANPDNVEYMLKT  267

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS ILGD LG+GIFNVDGDSW FQRK+AS+ELG  S+ S+AFEV+  EI 
Sbjct  268   RFDNYPKGKPFSTILGDLLGKGIFNVDGDSWVFQRKMASLELGSVSIRSFAFEVVMAEIK  327

Query  1498  RRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RLLP+L+   +KDG V+DLQDVFRRF+FD IC+FSFGLDP CLE  LP+S+FA SF LA
Sbjct  328   HRLLPLLSSYAEKDGSVLDLQDVFRRFTFDNICKFSFGLDPGCLELALPISQFAESFDLA  387

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             +KLSAERAM ASP++WKI R LN+GSE+ L+++I+ +N+LA EVI Q+RKLG S   H+D
Sbjct  388   TKLSAERAMVASPLIWKINRLLNLGSERRLKEAIKKVNVLAKEVIIQKRKLGFS--THQD  445

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM  I DD  YL+DIVISF+LAGRDT+ASALT+FFWL+A HP+    I  EADR++
Sbjct  446   LLSRFMACIKDD-NYLKDIVISFILAGRDTMASALTTFFWLVATHPEVESKIRDEADRIM  504

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               NQ+  + EQ +RE++YL AAV ESLRL+PP+QFDSKF  +DDVL DGT V +GTRVTY
Sbjct  505   HPNQEFPSFEQ-IREMHYLHAAVYESLRLYPPVQFDSKFARQDDVLRDGTFVMKGTRVTY  563

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGR+E IWG DC+EFKP+RWL +G FF ++PFKYPVFQAG+RVCLGKEMA++ +KS
Sbjct  564   HPYAMGRIEAIWGPDCMEFKPQRWLNNGTFFPQSPFKYPVFQAGIRVCLGKEMAVVAMKS  623

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             VA +VLR F +H+   +  PRF  GLTAT R GLPV V++R
Sbjct  624   VAAAVLRPFDIHVVHANVAPRFDSGLTATXRGGLPVVVRER  664



>ref|XP_011024239.1| PREDICTED: cytochrome P450 94C1-like [Populus euphratica]
Length=499

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/467 (65%), Positives = 377/467 (81%), Gaps = 7/467 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R K   C+C++C+ Y+ + W  ++ N+CDWYTHLL+NSP +TIHIHVL NTITANP+NVE
Sbjct  33    RSKFRCCNCEICTNYLLSGWSREFKNICDWYTHLLQNSPRQTIHIHVLGNTITANPDNVE  92

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             Y+LK++FEN+PKG+ FS ILGDFLG+GIFNVDGD W FQRK+AS+EL   S+ +YAFE++
Sbjct  93    YILKTKFENYPKGRPFSMILGDFLGKGIFNVDGDLWLFQRKMASLELASVSIRNYAFEIV  152

Query  1513  QTEIDRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
              TEI  RLLP+L   A   DG ++DLQDVFRRFSFD ICRFSFGLDP CLES LP+S FA
Sbjct  153   NTEIKCRLLPLLTSAAKSTDGDLIDLQDVFRRFSFDNICRFSFGLDPGCLESSLPISVFA  212

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
              SF LASKLSAERAM+  P+VWKIKR+ NIG+EK L+++IEV+N+LA EVI Q+RKLG S
Sbjct  213   ESFDLASKLSAERAMATLPLVWKIKRYFNIGTEKNLKEAIEVVNILADEVIMQKRKLGFS  272

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                ++DLLSRFM  I DD  YLRDIVISF+LAGRDT+ASALT+FFWL+A+HP+    I  
Sbjct  273   --TNQDLLSRFMACITDDR-YLRDIVISFILAGRDTMASALTTFFWLLASHPNVVSKIRE  329

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             E++RV+  NQ+  AS +++RE++YL A V ESLRL+PP+QFDSKF +EDDVLPDGT V+R
Sbjct  330   ESNRVMASNQE-SASYEQIREMHYLHAVVNESLRLYPPVQFDSKFAMEDDVLPDGTPVRR  388

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGRME IWG DCLEF+PERWL +G F   +PFK PVFQAG+RVCLGKEM+
Sbjct  389   GTRVTYHPYAMGRMERIWGIDCLEFRPERWLENGTFCPISPFKCPVFQAGIRVCLGKEMS  448

Query  622   LLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L+E+K VALSV+RRF + +  P  +PRF+ GLTA    GL   +++R
Sbjct  449   LVEMKIVALSVVRRFDIKIVPPEVSPRFNSGLTAMLSGGLQAEIRER  495



>ref|XP_011088865.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94C1 [Sesamum 
indicum]
Length=505

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/464 (63%), Positives = 371/464 (80%), Gaps = 8/464 (2%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             CSC++C +++++SW  +YNNLCDWY+HLL  SP+ TIH+HVL N ITANPENVE+MLK+R
Sbjct  42    CSCEICQSFLTSSWTLEYNNLCDWYSHLLSKSPTGTIHVHVLGNVITANPENVEHMLKTR  101

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F+N+PKGK FSAILGD LG+GIFN DGD WRFQRK+AS+ELG  SV SYAF ++ TEI+ 
Sbjct  102   FDNYPKGKPFSAILGDLLGRGIFNADGDLWRFQRKMASLELGSVSVRSYAFNIVTTEIES  161

Query  1495  RLLPILAGKKD------GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             RL+P+L+   D       G +DLQD+ RRFSFD ICRFSFGLDP CL   LP+SEFA +F
Sbjct  162   RLIPLLSSVADKCNNDSSGSLDLQDILRRFSFDSICRFSFGLDPGCLRLSLPISEFAAAF  221

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              LASKLSAERA++ SP++WK+KRF N+GSEK+L+++I+ ++ LA EVIR +R     D +
Sbjct  222   DLASKLSAERAITTSPMIWKLKRFFNLGSEKQLKQAIKSVHELAEEVIRHKRNNARPDSS  281

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             H DLLS F+ +  DD+ +LRDIV+SFLLAGRDTVASALTSFFW+++ +    E I  E++
Sbjct  282   HDDLLSHFICTT-DDDIFLRDIVVSFLLAGRDTVASALTSFFWILSKNTHVVEKIREESN  340

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             RV+G+  + +    ++RE++YLQAAV ES+RLFPP+QFDSKFC EDDVL DGT V RGTR
Sbjct  341   RVMGQETEKMVEFAQLREMHYLQAAVHESMRLFPPVQFDSKFCEEDDVLADGTFVTRGTR  400

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGRME IWG DCLEFKP+RWLR GVF Q +PFKYPVFQAG RVCLGKEMA++E
Sbjct  401   VTYHPYAMGRMERIWGPDCLEFKPDRWLRGGVFKQADPFKYPVFQAGRRVCLGKEMAIVE  460

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K+VALS++RRF + +A     P F PGLTAT R GLP+ V++R
Sbjct  461   MKTVALSLIRRFDIQVAMA-RAPTFMPGLTATLRGGLPIVVRER  503



>ref|XP_002312905.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE86860.2| cytochrome P450 family protein [Populus trichocarpa]
Length=490

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/460 (66%), Positives = 367/460 (80%), Gaps = 5/460 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CDVC  Y+S+SW   + NLCDWYTHLLR S + TIH+HVL N ITANPENVE+MLK+
Sbjct  33    WCNCDVCKTYLSSSWTKDFANLCDWYTHLLRKSKTGTIHVHVLGNIITANPENVEHMLKT  92

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             +FEN+PKGK FSA+LGD LG+GIFNVDG+ W+FQRK+AS+ELG  S+  +AF++I +EI 
Sbjct  93    KFENYPKGKPFSALLGDLLGRGIFNVDGNHWKFQRKMASLELGSVSIRMHAFDLIMSEIR  152

Query  1498  RRLLPILAGKKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RLLP+L+   D   V+DLQDVFRRFSFD IC+FSFGLDP CLE  LP  +FA +F  AS
Sbjct  153   SRLLPLLSSVADEQRVLDLQDVFRRFSFDNICKFSFGLDPGCLELSLPACKFAAAFDTAS  212

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             KLSAERA++ SP+VWKIKR L+IGSEKEL+++I+ +N LA  VI +RRK G S  N  DL
Sbjct  213   KLSAERALAPSPIVWKIKRLLSIGSEKELKEAIKKVNELAEGVINERRKAGFSKNN--DL  270

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFM SI  DE YLRDIV+SFLLAGRDTVAS LTSFFWL++  P+   AI AE ++V+G
Sbjct  271   LSRFMTSI-TDEKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQRPEVESAIRAETEKVMG  329

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
              NQDL  S Q MRE++ L AAV ESLRL+PP+QFDSKF  EDD+LPDGT V +GTRVTYH
Sbjct  330   LNQDL-PSFQEMREMHCLNAAVHESLRLYPPVQFDSKFSQEDDILPDGTFVPKGTRVTYH  388

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
              YAMGRME IWG DCLEFKPERWL++ VF   NPFKY VF AG+R+CLGKEMAL+E+K+V
Sbjct  389   QYAMGRMEQIWGPDCLEFKPERWLKNAVFVPANPFKYTVFHAGVRICLGKEMALVEMKAV  448

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             AL+++R F   +  P+  PRFSPGLTAT R GLPV +Q+R
Sbjct  449   ALAIIRGFNTRVVDPNQVPRFSPGLTATVRGGLPVVIQER  488



>ref|XP_007015870.1| Cytochrome P450 94A1 [Theobroma cacao]
 gb|EOY33489.1| Cytochrome P450 94A1 [Theobroma cacao]
Length=516

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/476 (62%), Positives = 388/476 (82%), Gaps = 11/476 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R+KL +C+C++C AY+++SW  +++NLCDWYTHLL+ SP+ TIHIHVL NTITA+P NVE
Sbjct  38    RLKL-WCNCEICQAYLTSSWTKEFDNLCDWYTHLLKKSPTGTIHIHVLGNTITASPANVE  96

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             ++LK+RFEN+PKGK FSA+LGD LG+GIFNVDG+SWRFQRK+AS+ELG  S+  +AF+++
Sbjct  97    HILKTRFENYPKGKQFSALLGDLLGKGIFNVDGESWRFQRKMASLELGSISIRMHAFDIV  156

Query  1513  QTEIDRRLLPILAG-KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
              +EI  RL+P+L+    +  V+DLQDV RRFSFD IC+FSFGLDP CL   LP+SEFA +
Sbjct  157   NSEIQTRLIPLLSSVSSEEQVLDLQDVLRRFSFDNICKFSFGLDPGCLMLSLPISEFAEA  216

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F LASKLSA+R +++SP +WK+KR LN+G+EK+L+++I++++  A E+I QRR+ G SD 
Sbjct  217   FDLASKLSAQRGLASSPSIWKVKRLLNLGTEKQLKEAIKMVDEFAQEMINQRREKGFSDS  276

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             N  DLLSRFMG++ DD+ YLRDIVISFLLAGRDTVAS LTSFFWL++ HP+   AI  E 
Sbjct  277   N--DLLSRFMGTVSDDK-YLRDIVISFLLAGRDTVASGLTSFFWLLSQHPEVESAIRDEL  333

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             +RV+G +Q   AS  +MRE++YL AA+ ESLRLFPP+QFDSKF  EDD+LPDGT V++GT
Sbjct  334   ERVMGSSQQF-ASFDQMREMHYLHAALYESLRLFPPVQFDSKFAQEDDILPDGTFVRKGT  392

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYHPYAMGRME +WGSDCLE+KP+RWL++G++  ENP+KYPVFQAG RVCLGKE++L+
Sbjct  393   RVTYHPYAMGRMERVWGSDCLEYKPDRWLKNGIYNPENPYKYPVFQAGQRVCLGKEISLV  452

Query  616   ELKSVALSVLRRFRVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQR*C----PPCL  464
             E+K V L+V+ RF + +A   +  PRF+PGLTAT R GLP+ VQ+R      P CL
Sbjct  453   EMKCVVLAVISRFNIRVATDLNQAPRFAPGLTATVRGGLPILVQEREANYSSPSCL  508



>ref|XP_008228870.1| PREDICTED: cytochrome P450 94C1 [Prunus mume]
Length=501

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/465 (62%), Positives = 379/465 (82%), Gaps = 8/465 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC +++++SW   ++NLCDWYTHLLR SP+ TIH+HVL N I A+PENVE++LK+
Sbjct  37    WCNCHVCRSFLTSSWSKDFDNLCDWYTHLLRKSPTGTIHLHVLGNVIIADPENVEHILKT  96

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             +F N+PKGK F+ ILGD LG+GIFNVDG++W FQRK+AS+ELG  SV SYA E++ +EI 
Sbjct  97    KFHNYPKGKPFTTILGDLLGRGIFNVDGNAWLFQRKMASLELGSVSVRSYALEIVSSEIQ  156

Query  1498  RRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RL+P+LA   +     VDLQD+FRRFSFD IC+FSFGLDP CL+  LP+S FAV+F  A
Sbjct  157   SRLIPLLASFAEDQNSAVDLQDLFRRFSFDNICKFSFGLDPGCLQLSLPISGFAVAFDTA  216

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAERAM++SP+VWKIKRF NIGSE++LR ++++++ LA  +I QRR++G      KD
Sbjct  217   SKLSAERAMTSSPIVWKIKRFFNIGSERQLRDAVKMVDSLAKSMIEQRREMGNF-STQKD  275

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM +I DD+ YLRDIV+SFLLAGRDT+AS LTS F+L++ HP+   AIL E+DR++
Sbjct  276   LLSRFMANI-DDDQYLRDIVVSFLLAGRDTIASGLTSLFYLLSQHPEVKRAILEESDRIM  334

Query  964   GKN----QDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             G++    +  +AS ++MRE+ YL A + E++RL+PPIQFDSK+C EDDVLPDGT V+ GT
Sbjct  335   GRSGSGSRSWVASFEQMREMPYLHAVIYETMRLYPPIQFDSKYCQEDDVLPDGTFVQSGT  394

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME +WGSDCLEFKPERWL++G+F  E+PFKYPVFQ G RVCLGKE+ALL
Sbjct  395   RVTYHQYAMGRMERVWGSDCLEFKPERWLKNGLFTPESPFKYPVFQGGERVCLGKELALL  454

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+KSVA++++RRF + +++P  TPRF+PGLTAT R GLPV +Q+R
Sbjct  455   EMKSVAVALVRRFDIQVSEPDRTPRFAPGLTATVRGGLPVRIQER  499



>ref|XP_009766870.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana sylvestris]
Length=488

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/459 (63%), Positives = 373/459 (81%), Gaps = 4/459 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C C++C  Y+STSW  ++ NLCDWY+HL + SP+ TIH+HVL N ITANP+NVEYMLK++
Sbjct  30    CECEICKGYLSTSWTLEFKNLCDWYSHLFKKSPTGTIHVHVLGNVITANPKNVEYMLKTK  89

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             FENFPKG+ F+ ILGD LG+GIF VDG+ W+ QRK+AS+ELG  S+ SYAF+ +  EI  
Sbjct  90    FENFPKGRQFATILGDLLGRGIFAVDGELWKLQRKMASLELGSVSIRSYAFDTVGGEIRN  149

Query  1495  RLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKL  1316
             RL+P+L    +  V+DLQDVFRRFSFD IC+FSFG+DP CL+  LP+S+F V+F LASKL
Sbjct  150   RLIPLLESNNNDTVLDLQDVFRRFSFDSICKFSFGMDPGCLKLSLPVSDFQVAFDLASKL  209

Query  1315  SAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLS  1136
             SAERAM+ASP+VWKIKR LNIGSEK+L+++I+++++L+ E+I  +RK   S +N  DLLS
Sbjct  210   SAERAMTASPLVWKIKRALNIGSEKKLKEAIKMVDILSEEMISHKRKNDFSSQN--DLLS  267

Query  1135  RFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKN  956
             RFM +I DD+  LRDIVISFLLAGRDTVASALT+FFWL++ HP+  + I AE+ RV+GK 
Sbjct  268   RFMRNINDDK-LLRDIVISFLLAGRDTVASALTTFFWLLSQHPEVKDEIRAESTRVMGKT  326

Query  955   Q-DLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHP  779
             + + +AS + +R+++YL AA+ ES+RLFPP+QFDSKFC EDD LPDGT V +GTRVTYHP
Sbjct  327   EKEKLASFEEIRKMHYLTAALHESIRLFPPVQFDSKFCQEDDTLPDGTFVAKGTRVTYHP  386

Query  778   YAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             YAMGRME IWG DCLEF+PERWL+DGVF  + PFKYPVFQ GLRVCLGK++A++E+KSVA
Sbjct  387   YAMGRMESIWGQDCLEFRPERWLQDGVFKPQCPFKYPVFQGGLRVCLGKDLAIVEMKSVA  446

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L+++R+F   +     TPRF PGLTAT R GLPV VQ+R
Sbjct  447   LALIRQFDFQVVAKEQTPRFMPGLTATVRGGLPVVVQER  485



>ref|XP_007205046.1| hypothetical protein PRUPE_ppa004592mg [Prunus persica]
 gb|EMJ06245.1| hypothetical protein PRUPE_ppa004592mg [Prunus persica]
Length=501

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/465 (63%), Positives = 378/465 (81%), Gaps = 8/465 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC +++++SW   ++NLCDWYTHLLR SP+ TIH+HVL N ITA+PENVE++LK+
Sbjct  37    WCNCHVCRSFLTSSWSKDFDNLCDWYTHLLRKSPTGTIHLHVLGNIITADPENVEHILKT  96

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             +F N+PKGK F+ ILGD LG+GIFNVDG++W FQRK+AS+ELG  SV SYA E++ +EI 
Sbjct  97    KFHNYPKGKPFTTILGDLLGRGIFNVDGNAWLFQRKMASLELGSVSVRSYALEIVSSEIQ  156

Query  1498  RRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RL+P+LA   +     VDLQD+FRRFSFD IC+FSFGLDP CL+  LP+S+FAV+F  A
Sbjct  157   SRLIPLLASLAEDRNSAVDLQDLFRRFSFDNICKFSFGLDPGCLQLSLPISDFAVAFDTA  216

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAERAM++SP+VWKIKRF NIGSE++LR ++++++ LA  +I QRR++G      KD
Sbjct  217   SKLSAERAMTSSPIVWKIKRFFNIGSERQLRDAVKMVDSLAKSMIEQRREMGNF-STQKD  275

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM +I DD+ YLRDIV+SFLLAGRDT+AS LTS F+L++ HP+   AIL E DRV+
Sbjct  276   LLSRFMANI-DDDKYLRDIVVSFLLAGRDTIASGLTSLFYLLSQHPEVKRAILEELDRVM  334

Query  964   GKN----QDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             G++    +   AS ++MRE++YL A + E++RL+PPIQFDSK+C EDDVLPDGT V  GT
Sbjct  335   GRSGSESRSWAASFEQMREMHYLHAVIYETMRLYPPIQFDSKYCQEDDVLPDGTFVPSGT  394

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME +WGSDCLEFKPERWL++G+F  E PFKYPVFQ G RVCLGKE+ALL
Sbjct  395   RVTYHQYAMGRMERVWGSDCLEFKPERWLKNGLFTPECPFKYPVFQGGERVCLGKELALL  454

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+KSVA++++RRF + +++P  TPRF+PGLTAT R GLPV +Q+R
Sbjct  455   EMKSVAVALVRRFDIQVSEPDRTPRFAPGLTATVRGGLPVRIQER  499



>ref|XP_011044868.1| PREDICTED: cytochrome P450 94C1-like [Populus euphratica]
Length=490

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/460 (66%), Positives = 368/460 (80%), Gaps = 5/460 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CDVC  Y+S+SW   + NLCDWYTHLLR S + TIH+HVL N ITANPENVE+MLK+
Sbjct  33    WCNCDVCKTYLSSSWTNDFANLCDWYTHLLRKSKTGTIHVHVLGNIITANPENVEHMLKT  92

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             +FEN+PKGK FS++LGD LG+GIFNVDGD W+FQRK+AS+ELG  S+  +AF++I +EI 
Sbjct  93    KFENYPKGKPFSSLLGDLLGRGIFNVDGDHWKFQRKMASLELGSVSIRIHAFDLIMSEIR  152

Query  1498  RRLLPILAGKKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RLLP+L+   D   V+DLQDVFRRFSFD IC+FSFGLDP CLE  LP  +FA +F  AS
Sbjct  153   SRLLPLLSSVADEQRVLDLQDVFRRFSFDNICKFSFGLDPGCLELSLPACKFAAAFDTAS  212

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             KLSAERA++ SP+VWKIKR L+IGSEKEL+++I+ +N LA  +I +RRK G S  N  DL
Sbjct  213   KLSAERALAPSPIVWKIKRLLSIGSEKELKEAIKKVNDLAEGMINERRKAGFSKNN--DL  270

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFM SI  DE YLRDIVISFLLAGRDTVAS LTSFFWL++  P+   AI AE ++V+G
Sbjct  271   LSRFMMSI-TDEKYLRDIVISFLLAGRDTVASGLTSFFWLLSQRPEVVSAIRAETEKVMG  329

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
              NQDL  S Q MRE++ L AAV ESLRL+PP+QFDSKF  EDD+LP+GT V +GTRVTYH
Sbjct  330   LNQDL-PSFQEMREMHCLNAAVHESLRLYPPVQFDSKFSQEDDILPNGTFVPKGTRVTYH  388

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
              YAMGRME IWG DCLEFKPERWL++GVF   NPFKY VF AG+R+CLGKEMAL+E+K+V
Sbjct  389   QYAMGRMEQIWGPDCLEFKPERWLKNGVFVPANPFKYTVFHAGVRICLGKEMALVEMKAV  448

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             AL+++R F   +  P+  PRFSPGLTAT R GLPV +Q+R
Sbjct  449   ALAIIRGFDTRVVDPNQVPRFSPGLTATVRGGLPVVIQER  488



>ref|XP_002315447.2| hypothetical protein POPTR_0010s24310g [Populus trichocarpa]
 gb|EEF01618.2| hypothetical protein POPTR_0010s24310g [Populus trichocarpa]
Length=499

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/467 (64%), Positives = 375/467 (80%), Gaps = 7/467 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R K   C+C++C+ Y+ + W  ++ N+CDWYTHLL+NS  +TIHIHVL NTITANP+NVE
Sbjct  33    RSKFRCCNCEICTNYLLSGWSREFKNICDWYTHLLQNSSRQTIHIHVLGNTITANPDNVE  92

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             Y+LK++FEN+PKG+ FS ILGDFLG+GIFNVDGD W FQRK+AS+EL   S+ +YAFE++
Sbjct  93    YILKTKFENYPKGRPFSMILGDFLGKGIFNVDGDLWLFQRKMASLELASVSIRNYAFEIV  152

Query  1513  QTEIDRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
              TEI  RLLP+L   A   DGG++DLQDVFRRFSFD  C+FSFGLDP CLES LP+S FA
Sbjct  153   DTEIKCRLLPLLTSAAKSTDGGLIDLQDVFRRFSFDNNCKFSFGLDPGCLESSLPISVFA  212

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
              SF LASKLSAERAM+  P+VWKIKR+ NIG+EK L+++IEV+N+LA EVI Q+RKLG S
Sbjct  213   ESFDLASKLSAERAMATLPLVWKIKRYFNIGTEKNLKEAIEVVNILADEVIMQKRKLGFS  272

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                ++DLLSRFM  I DD  YLRDIVISF+LAGRDT+ASALT+ FWL+A+HP+    I  
Sbjct  273   --TNQDLLSRFMACITDDR-YLRDIVISFILAGRDTMASALTTLFWLLASHPNVVSMIRE  329

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             E++RV+  NQ+  AS +++RE++YL A V ESLRL+PP+QFDSKF +EDDVLPDGT V+R
Sbjct  330   ESNRVMASNQE-SASYEQIREMHYLHAVVNESLRLYPPVQFDSKFAMEDDVLPDGTLVRR  388

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYHPYAMGRME IWG DC+EF+PERWL +G F   +PFK PVFQAG+RVCLGKEM+
Sbjct  389   GTRVTYHPYAMGRMERIWGIDCMEFRPERWLENGTFCPISPFKCPVFQAGIRVCLGKEMS  448

Query  622   LLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L+E+K VALSV+RRF V +  P  +PRF+ GLTA    GL   +++R
Sbjct  449   LVEMKIVALSVVRRFDVKIVPPEVSPRFNSGLTAMLSGGLQAEIRER  495



>ref|XP_006592314.1| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=502

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/464 (63%), Positives = 372/464 (80%), Gaps = 9/464 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CD+C +Y++ SW  K+ NLCDWYTHLLR SP+ TIH+HVL NTIT+NP NVE++LK+
Sbjct  42    WCNCDLCKSYLTVSWLKKFPNLCDWYTHLLRKSPTGTIHVHVLGNTITSNPHNVEHILKT  101

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+N+PKGK FS ILGD LG+GIFNVDG+SW+FQRK+AS+ELG  ++ +YA E++  EI 
Sbjct  102   NFQNYPKGKPFSTILGDLLGRGIFNVDGESWKFQRKMASLELGSVAIRTYAMELVNEEIH  161

Query  1498  RRLLPILAGKKDGG-----VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
              RL+PI+     G      V+DLQD+ RRFSFD IC+FSFGLDP CL   LP+S+ AV+F
Sbjct  162   ARLIPIMESTARGELNSVCVLDLQDILRRFSFDNICKFSFGLDPGCLLPNLPVSDLAVAF  221

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              LASKLSAERAM+ASP +WK+KR LNIGSEK+LR++I V+N +A E+I+QRR++G    N
Sbjct  222   DLASKLSAERAMNASPFIWKLKRLLNIGSEKKLRETINVVNDVAKEMIKQRREMGFKTRN  281

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
               DLLSRFMGSI DD+ YLRDIV+SFLLAGRDT+A+ LT FF L++  P+  E I  E  
Sbjct  282   --DLLSRFMGSI-DDDVYLRDIVVSFLLAGRDTIAAGLTGFFMLLSKSPEVEELIREEVG  338

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             RV+G  Q+  + EQ +RE++YL AA+ +S+RLFPPIQFDSKF  EDDVLPDGT V++G+R
Sbjct  339   RVMGPGQEFPSFEQ-IREMHYLNAAIHDSMRLFPPIQFDSKFATEDDVLPDGTFVRKGSR  397

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGRME IWG DCL+F+PERWLRDGVF  E PFKYPVFQAG+RVCLGK++AL+E
Sbjct  398   VTYHPYAMGRMENIWGPDCLDFRPERWLRDGVFVPECPFKYPVFQAGVRVCLGKDLALME  457

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +KSV ++++RRF + +AQP   PRF+PGLTAT R G PV V +R
Sbjct  458   MKSVVVALVRRFDIRVAQPDQEPRFAPGLTATLRGGFPVRVCER  501



>gb|EYU35153.1| hypothetical protein MIMGU_mgv1a026773mg [Erythranthe guttata]
Length=511

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/474 (65%), Positives = 379/474 (80%), Gaps = 15/474 (3%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C+C +C AY+ +SW  ++ NLCDWYTHLLRNSP++TIHIH L NTITANPENVE+MLK+R
Sbjct  40    CNCGICKAYIESSWRVRFPNLCDWYTHLLRNSPTRTIHIHALNNTITANPENVEHMLKTR  99

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F N+PKGK FSAILGDFLG+GIFN DGDSWRFQR+IAS+ELGR S+ +Y+ +V   EI R
Sbjct  100   FHNYPKGKPFSAILGDFLGRGIFNSDGDSWRFQRRIASLELGRVSIRAYSSDVANQEIRR  159

Query  1495  RLLPILAG-----KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESL--LPMSEFAVS  1337
              LLP++       +   G +DLQDVFRRFSF  ICRFSFGLDP   +    LP+S+FA +
Sbjct  160   YLLPVMESAAAAGRGGNGALDLQDVFRRFSFFSICRFSFGLDPDIFDDHLSLPLSQFAAA  219

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGT  1166
             F  AS+LSAERAMSASP++WK+KR LN+GSE++LR++I  +++LA E I QRR+     +
Sbjct  220   FDSASELSAERAMSASPIIWKVKRLLNVGSERKLRRAIGTVHVLAGEFISQRRRSADFKS  279

Query  1165  SDENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAIL  986
             S +  KDL+SRFM S+  DETYLRDI++SFLLAGRDTVASALTSFF L+A HP     IL
Sbjct  280   SSDQKKDLMSRFMASVA-DETYLRDIIVSFLLAGRDTVASALTSFFMLVARHPRVEATIL  338

Query  985   AEADRVVG-KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
              EA++V+G  N++  AS +++REL+YL AAV ES+RL+PPIQF+SKFC  DDVLPDGT V
Sbjct  339   LEAEKVIGPHNENRPASYEQLRELHYLHAAVHESMRLYPPIQFNSKFCSNDDVLPDGTFV  398

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQ-ENPFKYPVFQAGLRVCLG  635
             K+GTRVTYHPYAMGRME IWG DCL+FKPERWL +DGVFF  +NPFKYPVFQAG+RVCLG
Sbjct  399   KKGTRVTYHPYAMGRMEEIWGPDCLDFKPERWLNKDGVFFHDQNPFKYPVFQAGIRVCLG  458

Query  634   KEMALLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR*CP  473
             +E+AL+E+K+VA+S+LR F + L    + PRFSPGLTATFR GL VFV+ R  P
Sbjct  459   REVALVEIKTVAISLLRSFHLELVD-ENIPRFSPGLTATFRHGLQVFVRARIQP  511



>ref|XP_004291623.1| PREDICTED: cytochrome P450 94A1-like [Fragaria vesca subsp. vesca]
Length=509

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/463 (62%), Positives = 370/463 (80%), Gaps = 7/463 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC +++++SW   + N CDWY HLLR SP+ TIHIHVL N +T+NPENVEYMLK+
Sbjct  48    WCNCHVCRSFLTSSWTKDFANFCDWYAHLLRKSPTGTIHIHVLGNIVTSNPENVEYMLKT  107

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK F+ +LGD LG+GIFNVDGD WRFQRK+AS+ELG  +V S+A EV+  EI 
Sbjct  108   RFDNYPKGKPFTVLLGDLLGRGIFNVDGDMWRFQRKMASLELGSVTVRSHALEVVAAEIQ  167

Query  1498  RRLLPILA----GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              RL+P++A       D GV+DLQD+FRRFSFD IC+FSFGLDP CLE  LP+S+FA +F 
Sbjct  168   SRLIPLMASVSGNDSDAGVLDLQDLFRRFSFDNICKFSFGLDPGCLEPSLPVSKFADAFD  227

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERAM++SPV WKIKRF N+GSEK L++++ +++  A E+I+QRRK+G   +N 
Sbjct  228   LASKLSAERAMTSSPVFWKIKRFFNVGSEKRLKEAVRIIDDQAKEMIKQRRKMGYVAKN-  286

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFM  + DD+ YLRDIV+SFLLAGRDT++S LTS F+L++ HP+   AI  E+D+
Sbjct  287   -DLLSRFMAIVNDDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLSQHPEVTRAIREESDQ  345

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
             V+G+    I S ++MRE++YL A + E++RLFPP+QFDSK+C EDDVLPDGT VK GTRV
Sbjct  346   VMGR-AGAIPSFEQMREMHYLHAVLYETMRLFPPVQFDSKYCQEDDVLPDGTFVKSGTRV  404

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             TYHPYAMGRME IWG DCL+FKPERWL++GV+   +P+KYPVFQ G RVCLGKE+AL+E+
Sbjct  405   TYHPYAMGRMESIWGPDCLDFKPERWLKNGVYSPVSPYKYPVFQGGDRVCLGKELALVEM  464

Query  610   KSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             K  A +++ RF + ++QP   PRF+PGLTAT R GLPV V++R
Sbjct  465   KCAAAALVGRFDIRVSQPGQAPRFAPGLTATVRGGLPVRVEER  507



>ref|XP_011046266.1| PREDICTED: cytochrome P450 94C1-like [Populus euphratica]
Length=490

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/462 (64%), Positives = 367/462 (79%), Gaps = 9/462 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CDVC AY+S SW   + NLCDWYTHLLRNS + TIH+HVL N ITANPENVE+M+K+
Sbjct  33    WCNCDVCEAYLSASWTKDFTNLCDWYTHLLRNSKTGTIHLHVLGNIITANPENVEHMIKT  92

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             +F+N+PKGK FS +LGD LG+GIFNVDGDSW+FQRK+AS ELG  S+  YAF++I TEI 
Sbjct  93    KFDNYPKGKPFSDLLGDLLGRGIFNVDGDSWKFQRKMASFELGSVSIRMYAFDLITTEIR  152

Query  1498  RRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
             +RL+P+L   A K++  V+DLQDVFRRFSFD IC+FSFGLDP CLE  LP+ EFA++F +
Sbjct  153   KRLIPLLSSAAAKQE--VLDLQDVFRRFSFDNICKFSFGLDPGCLELSLPVCEFALAFDV  210

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             ASKLSAERA+ ASP+VWKIKR LNIGSE+EL+++I+ ++ LA  +I Q+RK G S  N  
Sbjct  211   ASKLSAERAIVASPMVWKIKRLLNIGSERELKEAIKKVDELAERMINQKRKEGFS--NIS  268

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM SI DD  YLRDIVISFLLAGRDTVAS LTSFFW+++ HP+   AI  E ++V
Sbjct  269   DLLSRFMTSISDDR-YLRDIVISFLLAGRDTVASGLTSFFWILSQHPEVVSAIREEIEKV  327

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
              G NQ+L  + Q M +++YL AA+ ESLRL+PP+QFDSKF  EDD+LPDGT V +GTR T
Sbjct  328   TGPNQEL-PNFQEMLQMHYLNAAIYESLRLYPPVQFDSKFAQEDDILPDGTFVPKGTRAT  386

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YH YAMGRME IWG DCL FKPERWL+ GVF   NPFKY VF AG R+C+GKE+AL+E+K
Sbjct  387   YHQYAMGRMEQIWGPDCLAFKPERWLKKGVFVAANPFKYTVFHAGHRICIGKELALVEMK  446

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +VAL+++R F   +  P+  PRF PG TAT R GLPV +Q+R
Sbjct  447   TVALAIIRGFNTVVEDPNQIPRFIPGFTATVRGGLPVLIQER  488



>ref|XP_010932013.1| PREDICTED: cytochrome P450 94C1-like [Elaeis guineensis]
Length=509

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/461 (63%), Positives = 371/461 (80%), Gaps = 5/461 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC AY+S+SW A++ NLCDWYTHLLR SP++TIHIHVL NT+TA+P NVEYML++
Sbjct  42    WCNCHVCKAYLSSSWTAEFTNLCDWYTHLLRQSPTRTIHIHVLDNTVTADPANVEYMLQT  101

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK FS+ILGD LG+GIFNVDGD+W+FQRK+AS+ELG  SV S+AF ++ TE+ 
Sbjct  102   RFDNFPKGKPFSSILGDLLGRGIFNVDGDTWQFQRKMASLELGSLSVRSHAFRIVSTEVR  161

Query  1498  RRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
             RRL+P+L +   DG V+DLQDVFRR +FD IC+ SFGLDP CLE+ LP+SEFA +F  AS
Sbjct  162   RRLIPLLTSASSDGRVIDLQDVFRRLAFDNICKISFGLDPGCLEASLPISEFAAAFDTAS  221

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA RA + +P +WK+KR LN+GSE+ELR+ I ++N+LA EVIRQ+RK G +  +  DL
Sbjct  222   RLSARRATAVAPALWKLKRILNVGSERELRRVIGLVNVLADEVIRQKRKHGVASSD--DL  279

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE-ADRVV  965
             LSRFM S+ DD  YLRDI ISFLLAGRDTVAS LTSFF L++ HP    AI  E AD + 
Sbjct  280   LSRFMCSVNDDR-YLRDITISFLLAGRDTVASGLTSFFLLLSKHPAVTAAIRDEIADVMR  338

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
             G   D +AS ++++E++Y+ AA+ E+LR++PP+QFDSK+CVEDD LPDG+ V++GTRVTY
Sbjct  339   GTGDDEVASLEQLKEMHYVHAAMYETLRVYPPVQFDSKYCVEDDTLPDGSLVRKGTRVTY  398

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGRME IWG DC EFKPERWLRDG F   +PFKYPVFQAG+RVCLGKEMAL+E+K+
Sbjct  399   HPYAMGRMESIWGPDCEEFKPERWLRDGKFVPASPFKYPVFQAGVRVCLGKEMALMEMKT  458

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             + +SV+ RF V +     +P+F+ GLTA+   GLP  V++R
Sbjct  459   IVVSVVPRFDVQVLDVGRSPKFAAGLTASIDGGLPAQVRRR  499



>ref|XP_006384629.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP62426.1| cytochrome P450 family protein [Populus trichocarpa]
Length=490

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/462 (64%), Positives = 368/462 (80%), Gaps = 9/462 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CDVC AY+S SW   + NLCDWYTHLLRNS + TIH+HVL N ITANPENVE+M+K+
Sbjct  33    WCNCDVCKAYLSASWTKDFTNLCDWYTHLLRNSKTGTIHLHVLGNIITANPENVEHMVKT  92

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             +F+N+PKGK FS +LGD LG+GIFNVDGDSW+FQRK+AS+ELG  S+  YAF++I TEI 
Sbjct  93    KFDNYPKGKPFSDLLGDLLGRGIFNVDGDSWKFQRKMASLELGSVSIRMYAFDLIITEIR  152

Query  1498  RRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
             +RLLP+L   A K++  V+DLQDVFRRFSFD IC+FSFGLDP CLE  LP+ EFA++F  
Sbjct  153   KRLLPLLSSAAAKQE--VLDLQDVFRRFSFDNICKFSFGLDPGCLELSLPVCEFALAFDA  210

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             ASKLSAERA++ASP+VWKIKR LNIGSE+EL+++I+ ++ LA  +I Q+RK G S  N  
Sbjct  211   ASKLSAERAIAASPMVWKIKRLLNIGSERELKEAIKKVDELAERMINQKRKEGFS--NIG  268

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM SI DD  YLRDIVISFLLAGRDTVAS LTSFFW+++ HP+   AI  E ++V
Sbjct  269   DLLSRFMTSISDDR-YLRDIVISFLLAGRDTVASGLTSFFWILSQHPEVVSAIREEIEKV  327

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
              G NQ+L  + Q M +++YL AA+ ESLRL+PP+QFDSKF  EDD+LPDGT + +GTR T
Sbjct  328   TGPNQEL-PNFQEMLQMHYLNAAIYESLRLYPPVQFDSKFAQEDDILPDGTFMPKGTRAT  386

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YH YAMGRME IWG DCL FKPERWL+ GVF   NPFKY VF AG R+C+GKE+AL+E+K
Sbjct  387   YHQYAMGRMEQIWGPDCLAFKPERWLKKGVFEPANPFKYTVFHAGHRICIGKELALVEMK  446

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +VAL+++R F   +  P+  PRF PG TAT R GLPV +Q+R
Sbjct  447   TVALAIIRGFNTVVEDPNQVPRFIPGFTATVRGGLPVLIQER  488



>ref|XP_008376983.1| PREDICTED: cytochrome P450 94C1-like [Malus domestica]
 ref|XP_008343326.1| PREDICTED: cytochrome P450 94C1-like [Malus domestica]
Length=533

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/465 (61%), Positives = 374/465 (80%), Gaps = 8/465 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC +++++SW   ++NLCDWYTHLLR SP+ TI +HVL N ITANPENVE+++K+
Sbjct  69    WCNCHVCRSFLTSSWLGSFDNLCDWYTHLLRKSPTGTIQVHVLGNIITANPENVEHIIKT  128

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK F+ ILGD LG+GIFNVDGD+WRFQRK+AS+ELG  SV SYA E++ TEI 
Sbjct  129   NFHNYPKGKLFTTILGDLLGRGIFNVDGDAWRFQRKMASLELGSVSVRSYAHEIVSTEIQ  188

Query  1498  RRLLPILAG----KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              RL+P+ A     + + GV DLQD+FRRFSFD IC+FSFGLDP+CL+  LP+S+FAV+F 
Sbjct  189   SRLIPLFASVAGSEGENGVFDLQDLFRRFSFDNICKFSFGLDPECLQLSLPISDFAVAFD  248

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERAM++SP+VWKIKRF N+GSE++L++++ +++ LA  +I QRR++GT     
Sbjct  249   LASKLSAERAMTSSPIVWKIKRFFNLGSERQLKEAVNMVDNLAKTMIEQRREMGTF-LTQ  307

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             KDLLSRFM +I DD+ YLRDIV+SFLLAGRDT++S LTS F+L+A HP+    I  E D 
Sbjct  308   KDLLSRFMANIDDDQ-YLRDIVVSFLLAGRDTISSGLTSLFYLLAKHPEVKREIREELDH  366

Query  970   VVGKNQDLIASEQ--RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             V+G  ++ +A+    +MREL+YL A + E++RL+PP+QFDSKFC EDDVLPDGT V+RGT
Sbjct  367   VMGPTREGLATASFDQMRELHYLHAVLYETMRLYPPVQFDSKFCQEDDVLPDGTFVRRGT  426

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME IWGSDCL+FKP+RW++ GVF  E+P+KYP+FQ G RVCLGKE+AL+
Sbjct  427   RVTYHQYAMGRMESIWGSDCLDFKPDRWMKKGVFSPESPYKYPIFQGGERVCLGKELALM  486

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K VA++++RRF + +  P   P+F PGLTAT R GLP+ +++R
Sbjct  487   EMKCVAVALVRRFDIQVLDPERRPQFVPGLTATVRGGLPIRIKER  531



>ref|XP_004139575.1| PREDICTED: cytochrome P450 94A1-like [Cucumis sativus]
 ref|XP_004161430.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94A1-like [Cucumis 
sativus]
Length=504

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/459 (63%), Positives = 377/459 (82%), Gaps = 4/459 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C+C  C AY+S+SW + + NL DWYTHLL +SP+ T+H+HV+ N +TANP+NV+++LKS 
Sbjct  46    CNCSFCRAYLSSSWSSSFPNLSDWYTHLLSHSPTATLHLHVISNIVTANPDNVQHILKSN  105

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F N+PKGK FS+ILGD LG GIFNVDG SWRFQRK+AS+ELG  S+ S+AFE++ TEI  
Sbjct  106   FHNYPKGKPFSSILGDLLGHGIFNVDGHSWRFQRKMASLELGSLSLRSHAFEILTTEIRS  165

Query  1495  RLLPILAG-KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASK  1319
             RLLP + G  K   VVDLQDVFRRFSFD ICRFSFGLDP CL   LP SEFAV+F LAS+
Sbjct  166   RLLPTMKGVGKTMEVVDLQDVFRRFSFDNICRFSFGLDPGCLRLWLPTSEFAVAFDLASR  225

Query  1318  LSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLL  1139
             LSAERAM+ASP++W+IK+ + +GSE++LR++I++++ LAMEVIRQRRK+G S+ N  DLL
Sbjct  226   LSAERAMAASPIIWRIKKMMRVGSERKLREAIKMVDRLAMEVIRQRRKMGFSNRN--DLL  283

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGK  959
             SRFM S  DD  YLRDIV+SFLLAGRDTVASALTS FWL++ +P+    I++E+DR++G 
Sbjct  284   SRFMASTNDDR-YLRDIVVSFLLAGRDTVASALTSLFWLLSQNPEVETEIISESDRIMGP  342

Query  958   NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHP  779
             ++D + S   ++E++YLQA V E++RLFPP+QFDSKF  EDD+LPDGT V++GTRVTYHP
Sbjct  343   DRDAVPSFDNLKEMHYLQAVVYENMRLFPPVQFDSKFAEEDDILPDGTFVQKGTRVTYHP  402

Query  778   YAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             YAMGRM+ IWG DCL+FKPERWL++G F  ENPFK+PVFQAGLRVCLGKE+A++++K VA
Sbjct  403   YAMGRMDRIWGLDCLQFKPERWLKNGYFTPENPFKFPVFQAGLRVCLGKELAVMDVKCVA  462

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             + ++R+F++ LA      RF+PGLTA++R GLPV +++R
Sbjct  463   VVLIRKFKIRLAGTDRIARFAPGLTASWRGGLPVRIEER  501



>gb|KGN64915.1| hypothetical protein Csa_1G154090 [Cucumis sativus]
Length=531

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/459 (63%), Positives = 377/459 (82%), Gaps = 4/459 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C+C  C AY+S+SW + + NL DWYTHLL +SP+ T+H+HV+ N +TANP+NV+++LKS 
Sbjct  73    CNCSFCRAYLSSSWSSSFPNLSDWYTHLLSHSPTATLHLHVISNIVTANPDNVQHILKSN  132

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F N+PKGK FS+ILGD LG GIFNVDG SWRFQRK+AS+ELG  S+ S+AFE++ TEI  
Sbjct  133   FHNYPKGKPFSSILGDLLGHGIFNVDGHSWRFQRKMASLELGSLSLRSHAFEILTTEIRS  192

Query  1495  RLLPILAG-KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASK  1319
             RLLP + G  K   VVDLQDVFRRFSFD ICRFSFGLDP CL   LP SEFAV+F LAS+
Sbjct  193   RLLPTMKGVGKTMEVVDLQDVFRRFSFDNICRFSFGLDPGCLRLWLPTSEFAVAFDLASR  252

Query  1318  LSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLL  1139
             LSAERAM+ASP++W+IK+ + +GSE++LR++I++++ LAMEVIRQRRK+G S+ N  DLL
Sbjct  253   LSAERAMAASPIIWRIKKMMRVGSERKLREAIKMVDRLAMEVIRQRRKMGFSNRN--DLL  310

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGK  959
             SRFM S  DD  YLRDIV+SFLLAGRDTVASALTS FWL++ +P+    I++E+DR++G 
Sbjct  311   SRFMASTNDDR-YLRDIVVSFLLAGRDTVASALTSLFWLLSQNPEVETEIISESDRIMGP  369

Query  958   NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHP  779
             ++D + S   ++E++YLQA V E++RLFPP+QFDSKF  EDD+LPDGT V++GTRVTYHP
Sbjct  370   DRDAVPSFDNLKEMHYLQAVVYENMRLFPPVQFDSKFAEEDDILPDGTFVQKGTRVTYHP  429

Query  778   YAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             YAMGRM+ IWG DCL+FKPERWL++G F  ENPFK+PVFQAGLRVCLGKE+A++++K VA
Sbjct  430   YAMGRMDRIWGLDCLQFKPERWLKNGYFTPENPFKFPVFQAGLRVCLGKELAVMDVKCVA  489

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             + ++R+F++ LA      RF+PGLTA++R GLPV +++R
Sbjct  490   VVLIRKFKIRLAGTDRIARFAPGLTASWRGGLPVRIEER  528



>gb|KCW87400.1| hypothetical protein EUGRSUZ_B03878 [Eucalyptus grandis]
Length=500

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/459 (65%), Positives = 376/459 (82%), Gaps = 3/459 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             CSCDVC++Y+S+SW +++ NLCDWYTHLLR+SP+ TIH+HVLRNTITANP NVE+++++R
Sbjct  38    CSCDVCASYLSSSWSSEFPNLCDWYTHLLRSSPTGTIHVHVLRNTITANPVNVEHIVRAR  97

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F+N+PKGK F+AILGD LG+GIFN DG+SWRFQRK+AS+ELG  SV +YAF++++ EI+ 
Sbjct  98    FDNYPKGKPFNAILGDLLGRGIFNADGESWRFQRKMASLELGSVSVRAYAFDIVRGEIET  157

Query  1495  RLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKL  1316
             RL+P+LA +   G VDLQDVFRRFSFD IC+FSFGLDP CL+  LP+S FA++F LAS+L
Sbjct  158   RLVPLLASRMGCGNVDLQDVFRRFSFDSICKFSFGLDPGCLQLSLPVSSFALAFDLASRL  217

Query  1315  SAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLS  1136
             SAERA   S  VWK KR LN+GSE+ LR +I+++N LA EVIRQRR+LG S     DLLS
Sbjct  218   SAERAAHVSHGVWKAKRLLNVGSERRLRDAIKLVNALAEEVIRQRRRLG-SFATRNDLLS  276

Query  1135  RFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKN  956
             RFMG++ DD+ YLRDIVISFLLAGRDTVASALT FFWL++ +P+    I  E+D V+G +
Sbjct  277   RFMGTV-DDDVYLRDIVISFLLAGRDTVASALTGFFWLLSRNPEVERLIRGESDLVMGSS  335

Query  955   Q-DLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHP  779
               D++AS ++M+ ++YL AAV ES+RLFPP+QFDSKF   DD+LPDGTAV  GTRVTYHP
Sbjct  336   AGDVLASFEQMQHMHYLHAAVHESMRLFPPVQFDSKFASADDMLPDGTAVGGGTRVTYHP  395

Query  778   YAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             YAMGRM+ IWG DCLEF+PERWL+DGVF  E+ +K+PVFQAG R CLGKEMA++E+KSVA
Sbjct  396   YAMGRMQRIWGPDCLEFRPERWLQDGVFRPESLYKFPVFQAGPRACLGKEMAVVEMKSVA  455

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L+++RRF V +       RFSPGLTAT   GLPV VQ+R
Sbjct  456   LALVRRFDVRVVGTDQQARFSPGLTATMSGGLPVIVQER  494



>ref|XP_010045242.1| PREDICTED: cytochrome P450 94C1-like [Eucalyptus grandis]
Length=511

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/459 (65%), Positives = 376/459 (82%), Gaps = 3/459 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             CSCDVC++Y+S+SW +++ NLCDWYTHLLR+SP+ TIH+HVLRNTITANP NVE+++++R
Sbjct  43    CSCDVCASYLSSSWSSEFPNLCDWYTHLLRSSPTGTIHVHVLRNTITANPVNVEHIVRAR  102

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F+N+PKGK F+AILGD LG+GIFN DG+SWRFQRK+AS+ELG  SV +YAF++++ EI+ 
Sbjct  103   FDNYPKGKPFNAILGDLLGRGIFNADGESWRFQRKMASLELGSVSVRAYAFDIVRGEIET  162

Query  1495  RLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKL  1316
             RL+P+LA +   G VDLQDVFRRFSFD IC+FSFGLDP CL+  LP+S FA++F LAS+L
Sbjct  163   RLVPLLASRMGCGNVDLQDVFRRFSFDSICKFSFGLDPGCLQLSLPVSSFALAFDLASRL  222

Query  1315  SAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLS  1136
             SAERA   S  VWK KR LN+GSE+ LR +I+++N LA EVIRQRR+LG S     DLLS
Sbjct  223   SAERAAHVSHGVWKAKRLLNVGSERRLRDAIKLVNALAEEVIRQRRRLG-SFATRNDLLS  281

Query  1135  RFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKN  956
             RFMG++ DD+ YLRDIVISFLLAGRDTVASALT FFWL++ +P+    I  E+D V+G +
Sbjct  282   RFMGTV-DDDVYLRDIVISFLLAGRDTVASALTGFFWLLSRNPEVERLIRGESDLVMGSS  340

Query  955   Q-DLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHP  779
               D++AS ++M+ ++YL AAV ES+RLFPP+QFDSKF   DD+LPDGTAV  GTRVTYHP
Sbjct  341   AGDVLASFEQMQHMHYLHAAVHESMRLFPPVQFDSKFASADDMLPDGTAVGGGTRVTYHP  400

Query  778   YAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             YAMGRM+ IWG DCLEF+PERWL+DGVF  E+ +K+PVFQAG R CLGKEMA++E+KSVA
Sbjct  401   YAMGRMQRIWGPDCLEFRPERWLQDGVFRPESLYKFPVFQAGPRACLGKEMAVVEMKSVA  460

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L+++RRF V +       RFSPGLTAT   GLPV VQ+R
Sbjct  461   LALVRRFDVRVVGTDQQARFSPGLTATMSGGLPVIVQER  499



>ref|XP_010322431.1| PREDICTED: cytochrome P450 94C1 [Solanum lycopersicum]
Length=485

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/462 (63%), Positives = 372/462 (81%), Gaps = 8/462 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             YC C++C +Y++++W  ++ NLCDWY++LL+ SP+ TIH+HVL N IT+NP NVEYMLK+
Sbjct  26    YCECEICKSYLNSTWSLEFKNLCDWYSYLLKKSPTGTIHVHVLGNVITSNPNNVEYMLKT  85

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGK FS ILGD LG+GIF VDG+ W+FQRK+AS+ELGR S+ SYAF+++  EI 
Sbjct  86    NFDNFPKGKQFSTILGDLLGRGIFAVDGEMWKFQRKMASLELGRVSIRSYAFDIVSDEIR  145

Query  1498  RRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASK  1319
              RL+P+L       V+DLQDV RRFSFD IC+FSFG+DP CL+  LP S+   SF LASK
Sbjct  146   NRLIPLLESNIHT-VLDLQDVLRRFSFDSICKFSFGMDPGCLKLSLPDSDLQESFDLASK  204

Query  1318  LSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLL  1139
             LSAERAM+ SP+VWKIKR LNIGSEK+L+++IE +++LA EVI Q+RK   S +N  D+L
Sbjct  205   LSAERAMTVSPLVWKIKRSLNIGSEKKLKEAIEKVDVLAEEVIIQKRKNDFSSQN--DVL  262

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGK  959
             SRFM +I DD+  LRDI++SFLLAGRDTVAS LT+FFWL+A HP     I AE++RV+GK
Sbjct  263   SRFMRNI-DDDKLLRDIIVSFLLAGRDTVASGLTTFFWLLAQHPHVINEIRAESNRVMGK  321

Query  958   NQD-LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
               +  +A+ + +RE+++L AA+ ES+RLFPP+QFDSKFC EDD LPDGT V +GTRVTYH
Sbjct  322   TVNGTLATFEGIREMHFLTAAIHESIRLFPPVQFDSKFCQEDDTLPDGTFVAKGTRVTYH  381

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             PYAMGRMEGIWG DCLEFKPERWL DGVF  + PFKYPVFQ G+RVCLGK+++++E+KSV
Sbjct  382   PYAMGRMEGIWGKDCLEFKPERWLEDGVFKAQCPFKYPVFQGGVRVCLGKDLSIVEMKSV  441

Query  601   ALSVLRR--FRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             AL+++R+  F+VHLA+    P+F PGLTAT R GLP+ VQ+R
Sbjct  442   ALALIRQFDFQVHLAK-DQAPKFMPGLTATVRGGLPIMVQKR  482



>ref|XP_010912256.1| PREDICTED: cytochrome P450 94C1-like [Elaeis guineensis]
Length=508

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/460 (63%), Positives = 368/460 (80%), Gaps = 5/460 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC AY+S+SW A++ NLCDWYTHLLR SP+ TI IHVL NTIT NP+NVEYMLK+
Sbjct  41    WCNCHVCKAYLSSSWTAEFANLCDWYTHLLRESPTGTIDIHVLGNTITTNPDNVEYMLKT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK FS++LGDFLG+GIFNVDG+SW+FQRK+AS+ELG     S+AF+++ TE+ 
Sbjct  101   RFDNFPKGKPFSSLLGDFLGRGIFNVDGESWQFQRKMASLELGSVYARSFAFDIVSTEVR  160

Query  1498  RRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASK  1319
             RRLLP+     +  V+DLQD+FRRF+FD IC+ SFGLDP CLE  LPMSEFA +F  AS+
Sbjct  161   RRLLPLFTTVSER-VIDLQDMFRRFAFDNICKISFGLDPGCLEVSLPMSEFAAAFDTASR  219

Query  1318  LSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLL  1139
             LSA RA + +P VWK+KR LN+GSE+ELR++I ++N+LA EVIRQRRKLG +  ++ DLL
Sbjct  220   LSAGRATAVAPAVWKLKRLLNVGSERELRRAIRMVNVLANEVIRQRRKLGFA--SNLDLL  277

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV-G  962
             SRFM S+ DD+ YLRDIVISFLLAGRDTVAS LTSFF L++ HP+   AI  E   V+ G
Sbjct  278   SRFMSSV-DDDRYLRDIVISFLLAGRDTVASGLTSFFLLLSKHPEVTAAIRDEIANVMRG  336

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
                D +AS  +++E++Y+ AA+ ES+RL+PPIQFDSKFC+ED VLPDGT V++GTRVTYH
Sbjct  337   SGDDEVASLNQLKEMHYVHAAMYESMRLYPPIQFDSKFCIEDAVLPDGTFVRKGTRVTYH  396

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             PYAMGRME IWG DC +FKPERWL D  F  ++PFKY VFQAGLRVCLGKEMAL+E+K+V
Sbjct  397   PYAMGRMESIWGPDCEKFKPERWLHDRKFVPQSPFKYSVFQAGLRVCLGKEMALMEMKTV  456

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              +SV+R F V +      P+F+PGLTA+ R GL   V++R
Sbjct  457   IVSVVRSFDVQVLDGDQPPKFAPGLTASIRGGLSARVRRR  496



>gb|AJD25221.1| cytochrome P450 CYP94C54 [Salvia miltiorrhiza]
Length=491

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/458 (63%), Positives = 361/458 (79%), Gaps = 7/458 (2%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C C+ C  ++++ W  +YNNLCDWY+HLL  SP+ TIH+HVL N ITANPENVE+MLK++
Sbjct  37    CGCETCQTFLTSRWALEYNNLCDWYSHLLAKSPTGTIHVHVLGNVITANPENVEHMLKTK  96

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             FEN+PKGK FSAILGD LG+GIFNVDGD WRFQRK+A +ELG  SV S+AF+++ +EI+ 
Sbjct  97    FENYPKGKQFSAILGDLLGRGIFNVDGDLWRFQRKMACLELGSVSVRSHAFDIVTSEIES  156

Query  1495  RLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKL  1316
             RL+P+L    D    DLQD+FRRFSFD ICRFSFGLDP CL   LP  EFA +F LASKL
Sbjct  157   RLVPLLRSSSD---FDLQDIFRRFSFDSICRFSFGLDPGCLAPSLPACEFAAAFDLASKL  213

Query  1315  SAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLS  1136
             SAERA++ SP+VWK+KRFLN+GSE+ L+++I  ++ LA  VIR +R+ G +   H DLLS
Sbjct  214   SAERAIATSPLVWKVKRFLNLGSERRLKQAIRSVHELAEGVIRHKREHGGA---HGDLLS  270

Query  1135  RFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKN  956
             RFMG+  DD+ +LRDIVISFLLAGRDTVASALTSFFWL++ +P   +AI  E+DRV+G +
Sbjct  271   RFMGTT-DDDVFLRDIVISFLLAGRDTVASALTSFFWLLSRNPAVVDAIREESDRVIGGD  329

Query  955   QDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPY  776
             ++   +  ++RE+++LQAAV ES+RLFPP+QFDSKFC  DDVL DGT V RGTRVTYHPY
Sbjct  330   REETVTFAQLREMHHLQAAVHESMRLFPPVQFDSKFCENDDVLADGTFVSRGTRVTYHPY  389

Query  775   AMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVAL  596
             AMGRME IWG   L+F PERWL +GVF  ++PFKYPVFQ G+RVCLGKEMAL+E+K+VAL
Sbjct  390   AMGRMERIWGEAPLQFAPERWLENGVFKHKDPFKYPVFQGGIRVCLGKEMALVEMKAVAL  449

Query  595   SVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             S++RRF + +      P+F PGLTA+ R GLP  V  R
Sbjct  450   SIIRRFDIEVIGSGQAPKFMPGLTASIRGGLPAIVTVR  487



>ref|XP_010907146.1| PREDICTED: cytochrome P450 94C1-like [Elaeis guineensis]
Length=505

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/468 (62%), Positives = 373/468 (80%), Gaps = 8/468 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC A++S+SW A++ NL DWYTHLLR SP+ TI+IHVL NT+TANP+NVEYMLK+
Sbjct  42    WCNCHVCKAFLSSSWTAEFTNLSDWYTHLLRRSPTGTINIHVLGNTVTANPDNVEYMLKT  101

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK FS++LGD LG+GIFNVDGDSW+FQRK+AS+ELG  SV SYAF ++  EI 
Sbjct  102   RFDNFPKGKPFSSLLGDLLGRGIFNVDGDSWQFQRKMASLELGSVSVRSYAFHIVTAEIR  161

Query  1498  RRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASK  1319
             RRL+P+ A   DG V+DLQDVFRRF+FD IC+ SFGL P CLE+ LPMSEFA +F  AS+
Sbjct  162   RRLIPLFASLSDG-VIDLQDVFRRFAFDSICKISFGLYPGCLEASLPMSEFAAAFDTASR  220

Query  1318  LSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLL  1139
             LSA+R  + +P +WK+KR LN+GSE+EL+++I ++N+LA EVIRQRR+LG++  +  DLL
Sbjct  221   LSAKRGTAVAPALWKLKRLLNVGSERELKRAIRLVNVLADEVIRQRRELGSASSH--DLL  278

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV-G  962
             SRFM S+ DD  YLRDIVISFLLAGRDTVAS LT+FF +++ HP    AI  E   V+ G
Sbjct  279   SRFMCSVNDDR-YLRDIVISFLLAGRDTVASGLTTFFLVLSKHPAVTAAIREEIANVMRG  337

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
                D +AS +++++++Y+ AA+ ESLRL+PP+QFDSKFCVEDDVLPDGT V++GTRVTYH
Sbjct  338   SGDDDVASFEQLKKMHYVHAAMYESLRLYPPVQFDSKFCVEDDVLPDGTFVRKGTRVTYH  397

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             PYAMGRME IWG DC EFKPERWL DG F   +PFKYPVFQ GLRVCLGKEMAL+E+K+V
Sbjct  398   PYAMGRMESIWGPDCEEFKPERWLHDGKFVPASPFKYPVFQGGLRVCLGKEMALMEMKAV  457

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR*CP---PC  467
              +SV+ RF + +     + +F+PGL+A+   GLP  V++R  P   PC
Sbjct  458   IVSVVPRFDLRVLDTGRSLKFAPGLSASIDGGLPAQVRRRRSPAHGPC  505



>ref|XP_004506151.1| PREDICTED: cytochrome P450 94A1-like [Cicer arietinum]
Length=505

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/462 (62%), Positives = 368/462 (80%), Gaps = 6/462 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C+ C +Y++ +W   + NLCD+YTHLL+NS + TIHIHVL NTIT+NP+NVE++LK+
Sbjct  41    WCNCNTCKSYLTMNWSKNFTNLCDYYTHLLQNSRTGTIHIHVLANTITSNPQNVEHILKT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK FSAILGD LG+GIFN DGDSW+FQRK+AS+ELG  ++ SYA E++  EI 
Sbjct  101   NFNNYPKGKPFSAILGDLLGRGIFNADGDSWKFQRKMASLELGSVAIRSYAMELVTEEIK  160

Query  1498  RRLLPILAGKKDGG--VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RL+PI+A   +     +DLQD+ RRFSFD IC+FSFGLDP CL   LP+S  A +F LA
Sbjct  161   TRLIPIIATNIENNETCLDLQDILRRFSFDNICKFSFGLDPCCLVPSLPVSNLANAFDLA  220

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKLSAERAM+ASP++WK+KRF N+GSEK+LR+SI+V+N L  E+I+QRR++G    N  D
Sbjct  221   SKLSAERAMTASPLIWKMKRFFNVGSEKKLRESIKVVNDLTNEMIKQRREIGFDSRN--D  278

Query  1144  LLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             LLSRFMGS+  +D+ YLRDIV+SFLLAGRDT+ASALT FF L++ +P+    I  E DRV
Sbjct  279   LLSRFMGSLNVNDDEYLRDIVVSFLLAGRDTIASALTGFFILLSKNPNVEAKIRVELDRV  338

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             +    +    EQ  RE++Y+ AA+ ES+RLFPPIQFDSK+ +EDDVLPDGT V++G+RVT
Sbjct  339   MDPVHECATFEQ-TREMHYVTAAIYESMRLFPPIQFDSKYAIEDDVLPDGTLVRKGSRVT  397

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YHPYAMGRME IWG DCLEFKPERWL+DGVF  + PFKYPVFQAGLRVCLGKE+A++E+K
Sbjct  398   YHPYAMGRMEKIWGPDCLEFKPERWLKDGVFVPKCPFKYPVFQAGLRVCLGKELAIVEMK  457

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             SV  +++RRF V + +P+   RF+PGLTATFR GLP+ V +R
Sbjct  458   SVVAALVRRFDVRVVEPNRDIRFAPGLTATFRGGLPIKVYER  499



>ref|XP_006347236.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=489

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/462 (62%), Positives = 368/462 (80%), Gaps = 7/462 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             YC C++C  Y++++W  ++ NLCDWY++LL+ SPS TIH+HVL N ITANP NVEYMLK+
Sbjct  29    YCECEICKGYLNSTWSLEFKNLCDWYSYLLKKSPSGTIHVHVLGNVITANPNNVEYMLKT  88

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGK FS ILGD LG+GIF VDG+ W+FQRK+AS+ELG  S+ SYAF+++  EI 
Sbjct  89    NFDNFPKGKQFSTILGDLLGRGIFAVDGEMWKFQRKMASLELGSVSIRSYAFDIVSDEIR  148

Query  1498  RRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASK  1319
              RL+P+L       V+DLQDV RRFSFD IC+FSFG+DP CL+  LP S    SF LASK
Sbjct  149   NRLIPLLKSNIHT-VLDLQDVLRRFSFDSICKFSFGMDPGCLKLSLPDSNLQESFDLASK  207

Query  1318  LSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLL  1139
             LSAERAM+ SP+VWKIKR LNIGSEK+L+++I+ +++LA EVI Q+RK   S +N  DLL
Sbjct  208   LSAERAMTVSPLVWKIKRGLNIGSEKKLKEAIKKVDILAEEVIIQKRKNDFSSQN--DLL  265

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV-VG  962
             +RFM ++ DD+  LRDI++SFLLAGRDTVAS LT+FFWL+A HP   + I AE+ RV V 
Sbjct  266   ARFMRNMNDDK-LLRDIIVSFLLAGRDTVASGLTTFFWLLAQHPRVIDEIRAESSRVMVR  324

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
             + ++ +AS + +RE++YL AA+ ES+RLFPP+QFDSKFC EDD LPDGT V +GTRVTYH
Sbjct  325   REKETLASFEEIREMHYLTAAIHESIRLFPPVQFDSKFCQEDDTLPDGTFVAKGTRVTYH  384

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             PYAMGRMEGIWG DCLEFKPERWL +G+F  + PFKYPVFQ G+RVCLGK+++++E+KSV
Sbjct  385   PYAMGRMEGIWGKDCLEFKPERWLEEGLFKAQCPFKYPVFQGGVRVCLGKDLSIVEMKSV  444

Query  601   ALSVLRR--FRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             AL+++R+  F+VH+A     P+F PGLTAT R GLP+ VQ+R
Sbjct  445   ALALIRQFDFQVHVATKEQAPKFMPGLTATVRGGLPIMVQER  486



>ref|XP_009403729.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=496

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/460 (63%), Positives = 361/460 (78%), Gaps = 4/460 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY+S+SW A+++NLCDWY HLLR SP+ TIHIHVL NT+TANP NVEYML++
Sbjct  32    WCSCHVCEAYLSSSWAAEFDNLCDWYAHLLRESPTGTIHIHVLGNTVTANPANVEYMLRT  91

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK FSA+LGD LGQGIFNVDGD+WRFQRK+AS+ LG  +V SYAF ++  EI 
Sbjct  92    RFDNFPKGKPFSALLGDLLGQGIFNVDGDAWRFQRKMASLALGSVAVRSYAFGIVSDEIR  151

Query  1498  RRLLPILAGKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
             R LLP+L+   D   GVVDLQDVFR+F+FD IC+ SFGLD  CLE  +PMSEFA +F  A
Sbjct  152   RCLLPLLSSVADRGDGVVDLQDVFRKFAFDTICKISFGLDRGCLELSMPMSEFAAAFDTA  211

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             S+LSA R  + +PVVWK+KR LN+GSE+EL+++I ++NMLA EVIRQRRK G +  +  D
Sbjct  212   SRLSARRGTATAPVVWKLKRLLNVGSERELKRAIRMINMLAEEVIRQRRKQGFASSH--D  269

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFMGS+ +++ YLRDIVISFLLAGRD VAS LTSFF L++ H D A A+  E   V 
Sbjct  270   LLSRFMGSVEEEDKYLRDIVISFLLAGRDAVASGLTSFFLLLSRHEDVAAAMRDEIASVT  329

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               + D + S +R++E++Y+ AA+ ES+RLFPP+QFDSKFC+EDDVLPDGT V R TRVTY
Sbjct  330   KGDGDDVVSYERLKEMHYVHAAIYESMRLFPPVQFDSKFCLEDDVLPDGTFVSRNTRVTY  389

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGRME IWG D  EFKPERWLR GVF  E+ FKYPVFQAG RVCLGKE+A++E+K+
Sbjct  390   HPYAMGRMESIWGPDWGEFKPERWLRGGVFTPESLFKYPVFQAGQRVCLGKELAMVEMKT  449

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             V +S++ +F   + Q   T +F PGLTAT   G+P  V +
Sbjct  450   VIVSMVTKFDFKVLQGGRTIKFVPGLTATISGGVPARVTR  489



>gb|EYU36964.1| hypothetical protein MIMGU_mgv1a023150mg, partial [Erythranthe 
guttata]
Length=476

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/466 (62%), Positives = 362/466 (78%), Gaps = 14/466 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             YCSCD C +++++SW  +YNNLCDWYTHLL  SP+ TIH+HVL N IT+NP+NVE++LK+
Sbjct  12    YCSCDTCQSFLTSSWSLRYNNLCDWYTHLLSQSPTGTIHVHVLNNIITSNPKNVEHVLKT  71

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS +LGD LG+GIFNVDGD W+ QRK+A +ELG  S+ SYAF ++ +EI+
Sbjct  72    RFDNYPKGKPFSTLLGDLLGRGIFNVDGDLWKLQRKMAILELGSISIRSYAFGIVSSEIE  131

Query  1498  RRLLPILAG-KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL P+L         VDLQD+FRRFSFD ICRFSFG+DP CL   LP+SEFA +F LAS
Sbjct  132   SRLTPLLTSFSGTDTAVDLQDIFRRFSFDSICRFSFGMDPGCLNLSLPVSEFAYAFDLAS  191

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---------LG  1169
             KLSAERA++  P+VWK+KRF N+GSEK+LR++I+ ++ LA  VIR +R            
Sbjct  192   KLSAERAITTPPLVWKLKRFFNVGSEKQLREAIKSIHELADGVIRHKRNQVIAATAATAA  251

Query  1168  TSDEN--HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAE  995
              +D+N  H+DLLSRFMG+I DD  +LRDIVISFLLAGRDTVAS+LT FF L+A +P A E
Sbjct  252   AADDNFSHEDLLSRFMGTINDD-VFLRDIVISFLLAGRDTVASSLTGFFLLLAENPGAVE  310

Query  994   AILAEADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGT  815
             +I  E+DRV+G+      +  ++RE+ YLQAAV ES+RL PP+QFDSKFC EDD L DGT
Sbjct  311   SIREESDRVMGRENKEPVTFSQLREMQYLQAAVHESMRLLPPVQFDSKFCDEDDYLADGT  370

Query  814   AVKRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCL  638
              V +GTRVTYHPYAMGRME IWG DCLEFKPERWL  +G+F QENPFKYPVFQAG RVCL
Sbjct  371   FVAKGTRVTYHPYAMGRMEKIWGGDCLEFKPERWLNENGLFKQENPFKYPVFQAGPRVCL  430

Query  637   GKEMALLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLP  500
             G EMA++E+K+VALS++RRF   +A P   P+F PGLTAT R GLP
Sbjct  431   GMEMAVVEMKTVALSLIRRFDFRVADPGRAPKFVPGLTATVRGGLP  476



>ref|XP_003538134.1| PREDICTED: cytochrome P450 94A2-like [Glycine max]
Length=506

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/464 (63%), Positives = 362/464 (78%), Gaps = 11/464 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CDVC +Y++ SW  K+ NLCDWYTHLLR SP+ TIH+HVL NTIT+NP NVEY+LK+
Sbjct  42    WCNCDVCKSYLTVSWLNKFPNLCDWYTHLLRKSPTGTIHVHVLENTITSNPVNVEYILKT  101

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+N+PKGK FS ILGD LG+GIFNVDG+SW+ QRK+AS+ELG  ++ + A E++  EI 
Sbjct  102   NFQNYPKGKPFSVILGDLLGRGIFNVDGESWKLQRKMASLELGSVAIRTNAMELVNEEIH  161

Query  1498  RRLLPILAG-------KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAV  1340
              RL+P + G            V+DLQD+ RRFSFD IC+FSFGLDP CL   LP+S  A 
Sbjct  162   ARLIPFIMGSVTHDELNDSVCVLDLQDILRRFSFDNICKFSFGLDPGCLLPNLPVSNLAD  221

Query  1339  SFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD  1160
             +F LASKLSAERAM+ASP +WK+KR LN+GSE++LR++I V+N +A E+I+QR ++G + 
Sbjct  222   AFDLASKLSAERAMNASPFIWKLKRLLNVGSERKLREAINVVNDVANEMIKQRIEMGFNT  281

Query  1159  ENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
              N  DLLSRF GSI DD  YLRDIV+SFLLAGRDT+AS LT FF L++  P+  E I  E
Sbjct  282   RN--DLLSRFTGSINDD-VYLRDIVVSFLLAGRDTIASGLTGFFMLLSKSPEVEELIREE  338

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             A RVVG  Q+  + EQ +RE++YL AA+ ES+RLFPPIQFDSKF  EDDVLPDGT V++G
Sbjct  339   AGRVVGPGQEFPSFEQ-IREMHYLNAAIHESMRLFPPIQFDSKFATEDDVLPDGTFVRKG  397

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
             +RVTYHPYAMGRME IWG DCLEF+PERWLRDGVF    PFKYPVFQAG+RVCLGK++AL
Sbjct  398   SRVTYHPYAMGRMENIWGPDCLEFRPERWLRDGVFVPACPFKYPVFQAGVRVCLGKDLAL  457

Query  619   LELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQ  488
             +E+KSV L+++RRF + + Q    PRF PGLTAT R GLPV V+
Sbjct  458   MEMKSVVLALVRRFDIRVVQSGQEPRFEPGLTATLRGGLPVRVR  501



>ref|XP_008461642.1| PREDICTED: cytochrome P450 94C1 [Cucumis melo]
Length=504

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/459 (62%), Positives = 377/459 (82%), Gaps = 4/459 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C+C +C AY+S+SW + + NL DWYTHLL +SP+ T+H+HV+ N +TANP+NV+++LKS 
Sbjct  46    CNCSLCRAYLSSSWSSSFPNLSDWYTHLLSHSPTATLHLHVISNIVTANPDNVQHILKSN  105

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F N+PKGK FS+ILGD LG GIFNVDG SWR+QRK+AS+ELG  S+ S+AFE++ TEI  
Sbjct  106   FHNYPKGKPFSSILGDLLGHGIFNVDGHSWRYQRKMASLELGSLSLRSHAFEILTTEIRS  165

Query  1495  RLLPILAG-KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASK  1319
             RL+P + G  +   VVDLQDVFRRFSFD ICRFSFGLDP CL   LPMSEFAV+F LAS+
Sbjct  166   RLVPTVNGIGRTMEVVDLQDVFRRFSFDNICRFSFGLDPGCLRLWLPMSEFAVAFDLASR  225

Query  1318  LSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLL  1139
             LSAERAM+ SP++W+IK+ L +GSE++LR++I++++ LAMEVIRQRR++G S+ N  DLL
Sbjct  226   LSAERAMAPSPIMWRIKKMLRVGSERKLREAIKMVDGLAMEVIRQRREMGFSNRN--DLL  283

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGK  959
             SRFM S  DD  YLRDIV+SFLLAGRDTVASALTS FWL++ +P+    I++E+DR++G 
Sbjct  284   SRFMASTNDDR-YLRDIVVSFLLAGRDTVASALTSLFWLLSQNPEVETEIISESDRIMGP  342

Query  958   NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHP  779
             ++D   S   ++E++YLQA V E++RLFPP+QFDSKF  EDD+LPDGT V++GTRVTYHP
Sbjct  343   DRDRFPSFDNLKEMHYLQAVVYENMRLFPPVQFDSKFAEEDDILPDGTFVQKGTRVTYHP  402

Query  778   YAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             YAMGRM+ IWG DCL+FKPERWL++G F  ENPFK+PVFQAGLRVCLGKE+A++++K VA
Sbjct  403   YAMGRMDRIWGLDCLQFKPERWLKNGYFTPENPFKFPVFQAGLRVCLGKELAVMDVKCVA  462

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             + ++R+F++ LA      RF+PGLTA++R GLPV +++R
Sbjct  463   VVLIRKFKIRLAGTDRIARFAPGLTASWRGGLPVRIEER  501



>ref|XP_010541286.1| PREDICTED: cytochrome P450 94C1-like [Tarenaya hassleriana]
Length=498

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/464 (62%), Positives = 374/464 (81%), Gaps = 8/464 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
              +C+C++C  ++S  W  +++NL DWYT LLR S + T+H+HV+ NT+TANP NVE++LK
Sbjct  32    LWCTCEICDTFVSGRWRRRFDNLSDWYTDLLRRSATTTVHVHVINNTVTANPMNVEHILK  91

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             + F+N+PKGK FSAILGD LG+GIFNVDGDSWRFQ+K+AS+ELG +S  S+AF+V+  EI
Sbjct  92    TNFDNYPKGKPFSAILGDLLGRGIFNVDGDSWRFQKKLASLELGSASTRSFAFDVVTFEI  151

Query  1501  DRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              +RLLP+L   +G+ D  V+DLQD+ RRF+FD IC+FSFGLDP CL   LP+SEFA +F 
Sbjct  152   RQRLLPLLTSVSGRSDS-VLDLQDILRRFTFDTICKFSFGLDPGCLRLPLPVSEFATAFD  210

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
              AS+LSA RA+ A P+VWKIKR LNIGSEK+LR+SI+++N LA E+I +RR+ G SD++ 
Sbjct  211   AASRLSAGRALVAVPLVWKIKRLLNIGSEKKLRESIQLVNRLAEELISERREKGFSDKH-  269

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFMG+I DD+ YLRDIVISF+LAGRDTVASALTSFFWL+  +P A  +I  E D+
Sbjct  270   -DLLSRFMGAINDDK-YLRDIVISFILAGRDTVASALTSFFWLLTQNPTAESSIRLELDQ  327

Query  970   VVGKNQD-LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             V+G   D + A+  + RE++YL AA+ ES+RL+PP+QFDSKF ++DDVL DGT VK+GT+
Sbjct  328   VMGPGPDPVTATYDQTREMHYLHAALHESMRLYPPVQFDSKFSLDDDVLTDGTFVKKGTK  387

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGRM+ IWG DC EF+PERWL+DG F  ENPFKYPVFQAGLRVCLGKEM+L+E
Sbjct  388   VTYHPYAMGRMDMIWGPDCDEFRPERWLKDGKFSSENPFKYPVFQAGLRVCLGKEMSLVE  447

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K VA++++RRFR+ +A P   P F  GLTAT R GLPV +++R
Sbjct  448   MKCVAIALIRRFRIRVADPGWIPIFEAGLTATVRGGLPVLIEER  491



>ref|XP_008790927.1| PREDICTED: cytochrome P450 94C1-like [Phoenix dactylifera]
Length=514

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/466 (62%), Positives = 369/466 (79%), Gaps = 10/466 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC AY+S+SW  ++ NLCDWYTHLLR SP++TI+IHVL NT+TANP+NVEYML +
Sbjct  40    WCNCHVCKAYLSSSWTGEFTNLCDWYTHLLRQSPTRTINIHVLGNTVTANPDNVEYMLAT  99

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF NFPKGK FS++LGD LG+GIFNVDG+SW+FQRK+AS+ELG  SV SYAF ++  E+ 
Sbjct  100   RFANFPKGKPFSSLLGDLLGRGIFNVDGESWQFQRKMASLELGSVSVRSYAFHIVSAEVR  159

Query  1498  RRLLPILAGKKDGG------VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
             RRL+P+     DGG      V+DLQDVFRRF+FD IC+ SFGLDP CLE+ LP+SEFA +
Sbjct  160   RRLIPLFTSVSDGGAAAAAGVIDLQDVFRRFAFDNICKISFGLDPGCLEASLPISEFAAA  219

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  AS++SA R  + +P VWK+KR LN+GSE+EL+++I +++ LA E+IRQRRKLG +  
Sbjct  220   FDTASRMSALRGTAVAPAVWKLKRLLNLGSERELKRAIRLVDELADELIRQRRKLGYASS  279

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE-  980
             +  DLLSRFM S+ DD  YLRDIVISFLLAGRDTVAS LT FF L++ HP+   AI  E 
Sbjct  280   H--DLLSRFMCSVNDDR-YLRDIVISFLLAGRDTVASGLTCFFLLLSKHPEVTAAIRDEI  336

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             AD + G   D +AS +++++++Y+ AA+ ESLRL+PP+Q DSKFCVEDD+LPDGT V++G
Sbjct  337   ADVIGGSGDDELASFEQLKKMHYVHAAMYESLRLYPPVQIDSKFCVEDDMLPDGTFVRKG  396

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
             TRVTYHPYAMGRME IWG DC EFKPERWLRDG F   +PFKYPVFQAGLRVCLGKEMAL
Sbjct  397   TRVTYHPYAMGRMERIWGPDCEEFKPERWLRDGKFVPASPFKYPVFQAGLRVCLGKEMAL  456

Query  619   LELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +E+K+V +SV+ RF V +     +P+F+PGL A+   GLP  V++R
Sbjct  457   MEMKTVIVSVVPRFDVQVLDAGRSPKFAPGLAASIDGGLPAQVRRR  502



>ref|XP_009348573.1| PREDICTED: cytochrome P450 94C1-like, partial [Pyrus x bretschneideri]
Length=533

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/465 (60%), Positives = 372/465 (80%), Gaps = 8/465 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC +++++SW   ++NLCDWYTHLLR SP+ TIH+HVL N ITANPENVE+++K+
Sbjct  68    WCNCHVCRSFLTSSWLGSFDNLCDWYTHLLRKSPTGTIHVHVLGNIITANPENVEHIIKT  127

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK F+ ILGD LG+GIFNVDGD+WRFQRK+AS+ELG  SV SYA E++ TEI 
Sbjct  128   NFHNYPKGKLFTTILGDLLGRGIFNVDGDAWRFQRKMASLELGSVSVRSYAHEIVSTEIQ  187

Query  1498  RRLLPILAG----KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              RL+P+ A     + + GV DLQD+FRRFSFD IC+FSFGLDP+CL+  LP+S+FAV+F 
Sbjct  188   SRLIPLFASVAGSEGENGVFDLQDLFRRFSFDNICKFSFGLDPECLQLSLPISDFAVAFD  247

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERA+++SP+VWKIKRF N+GSE++L++++++++ LA  +I QRR++GT     
Sbjct  248   LASKLSAERAITSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSMIEQRREMGTF-LTQ  306

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             KDLLSRFM +I DD+ YLRDIV+SFLLAGRDT++S LTS F+L+A HP+    I  E D 
Sbjct  307   KDLLSRFMANIDDDQ-YLRDIVVSFLLAGRDTISSGLTSLFYLLAKHPEVKREIREELDH  365

Query  970   VVGKNQDLIASEQ--RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             V+G  ++ +A+    +MREL+YL A + E++RL+PP+QFDSKFC EDDVLPDGT V+ GT
Sbjct  366   VMGPTREGLATASFDQMRELHYLHAVLYETMRLYPPVQFDSKFCQEDDVLPDGTFVRSGT  425

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME IWGSDCL+FKP+RW++ G F  E+P+KYP+FQ G RVCLGKE+A++
Sbjct  426   RVTYHQYAMGRMESIWGSDCLDFKPDRWMKKGAFSPESPYKYPIFQGGERVCLGKELAVM  485

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K VA++++R+F + +  P   P+F PG TAT   GLPV +++R
Sbjct  486   EMKCVAVALVRKFDIQVLDPERRPQFVPGFTATVSGGLPVRIKER  530



>ref|XP_009800093.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana sylvestris]
Length=521

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/464 (63%), Positives = 364/464 (78%), Gaps = 8/464 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             F+C+CD+C  Y+++SW  ++ NL DWY HLLRNS S+TIHIHVL N ITANP NVEYMLK
Sbjct  54    FWCTCDICHCYITSSWRKEFTNLVDWYAHLLRNSLSQTIHIHVLGNIITANPRNVEYMLK  113

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             ++F N+PKGK FS ILGD LG GIFNVDGD W FQRK+AS+ELG  S+ SYAF  ++ EI
Sbjct  114   TKFLNYPKGKPFSIILGDLLGDGIFNVDGDLWTFQRKMASLELGSMSIRSYAFNNVKNEI  173

Query  1501  DRRLLPILA--GKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
               RLLP+L+   ++D  G  +DLQDVFRRFSFD IC+FSFGLDP CLE  LP+S FA+SF
Sbjct  174   KFRLLPLLSSIAQEDFRGTSLDLQDVFRRFSFDNICKFSFGLDPGCLELSLPLSHFALSF  233

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              LA+KLSAERAM+ASP++WKIKR L+IG+E++LRK+IE +++LA EVIRQ+RKLG S  N
Sbjct  234   DLATKLSAERAMAASPLIWKIKRLLDIGTERKLRKAIENIDVLAREVIRQKRKLGYS--N  291

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             H+DLLSRFMG I D+E YLRDIVISF+LAGRDTVASALTS FWL+ +HPD    I  E  
Sbjct  292   HQDLLSRFMGII-DNEKYLRDIVISFILAGRDTVASALTSIFWLLTSHPDVELRIREELS  350

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             RV+ ++QD +  EQ + +++YL A + ES+RL+PP+QFDSKF  E+D LPDGT V +  R
Sbjct  351   RVMRQDQDFLMFEQ-INQMHYLNAVIHESMRLYPPVQFDSKFACENDSLPDGTFVAKNAR  409

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYH YAMGRME +WG D ++FKPERWL++G F +E+PFKYPVFQ G+RVCLGKEMAL+E
Sbjct  410   VTYHVYAMGRMENLWGQDYMDFKPERWLKNGTFLRESPFKYPVFQGGVRVCLGKEMALME  469

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K V  S+L+ F V         RF PGLTAT R GLPV V+ R
Sbjct  470   MKCVVASMLQHFDVRAVAAGGDLRFDPGLTATMRGGLPVVVRWR  513



>ref|XP_009401100.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=494

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/459 (63%), Positives = 361/459 (79%), Gaps = 6/459 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             CSCDVC AY+S+SW A+++NLCDWY HLLR SP+ TIHIHVL NT+TANP NVEYML++R
Sbjct  33    CSCDVCKAYVSSSWAAEFDNLCDWYAHLLRESPTGTIHIHVLGNTVTANPANVEYMLRTR  92

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F+NFPKGK FSA+LGD LGQGIFNVDGD+WRFQRK+AS+ LG  +V SYAF ++  EI R
Sbjct  93    FDNFPKGKPFSALLGDLLGQGIFNVDGDAWRFQRKMASLALGSVAVRSYAFGIVAGEIGR  152

Query  1495  RLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              LLP+L   A + DG VVDLQDVFRRF+FD IC+ SFGLD  CLE  +PMSEFA +F  A
Sbjct  153   GLLPLLSSIADRGDGAVVDLQDVFRRFAFDTICKISFGLDRGCLELPMPMSEFAAAFDTA  212

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             S+LSA R  + +P++WK+KR LN+GSE+EL+++I ++N+LA EVIRQRRKLG +  +  D
Sbjct  213   SRLSARRGTATAPLIWKLKRLLNVGSERELKRTIRMINVLAEEVIRQRRKLGFASSH--D  270

Query  1144  LLSRFMGSI-GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             LLSRFMGS+  DD+ Y+RDIVISFLLAGRD VAS L+SFF L++ H + A+A+  E   V
Sbjct  271   LLSRFMGSVVDDDDKYIRDIVISFLLAGRDAVASGLSSFFLLLSRHHNVAKAMREEIAGV  330

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
                +   + S ++++E++Y+ AA+ ES+RLFPP+QFDSKFC+EDDVLPDGT V R TRVT
Sbjct  331   TKADGADVVSYEQLKEMHYVHAAIYESMRLFPPVQFDSKFCLEDDVLPDGTFVSRNTRVT  390

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YHPYAMGRM+ IWG DC EF+P RWLR GVF  E+ FKYPVFQAG RVCLGKE+AL+E+K
Sbjct  391   YHPYAMGRMDSIWGPDCDEFRPGRWLRGGVFTPESLFKYPVFQAGQRVCLGKELALMEMK  450

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFV  491
             +V +SV+ +F V +       +F PGLTAT   GLP  V
Sbjct  451   TVIVSVVSKFDVEVLPGGRPLKFVPGLTATINGGLPARV  489



>ref|XP_009338687.1| PREDICTED: cytochrome P450 94C1-like [Pyrus x bretschneideri]
Length=581

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/465 (60%), Positives = 372/465 (80%), Gaps = 8/465 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC +++++SW   ++NLCDWYTHLLR SP+ TIH+HVL N ITANPENVE+++K+
Sbjct  116   WCNCHVCRSFLTSSWLGSFDNLCDWYTHLLRKSPTGTIHVHVLGNIITANPENVEHIIKT  175

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK F+ ILGD LG+GIFNVDGD+WRFQRK+AS+ELG  SV SYA E++ TEI 
Sbjct  176   NFHNYPKGKLFTTILGDLLGRGIFNVDGDAWRFQRKMASLELGSVSVRSYAHEIVSTEIQ  235

Query  1498  RRLLPILAG----KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              RL+P+ A     + + GV DLQD+FRRFSFD IC+FSFGLDP+CL+  LP+S+FAV+F 
Sbjct  236   SRLIPLFASVAGSEGENGVFDLQDLFRRFSFDNICKFSFGLDPECLQLSLPISDFAVAFD  295

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERA+++SP+VWKIKRF N+GSE++L++++++++ LA  +I QRR++GT     
Sbjct  296   LASKLSAERAITSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSMIEQRREMGTF-LTQ  354

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             KDLLSRFM +I DD+ YLRDIV+SFLLAGRDT++S LTS F+L+A HP+    I  E D 
Sbjct  355   KDLLSRFMANI-DDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLAKHPEVKREIREELDH  413

Query  970   VVGKNQDLIASEQ--RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             V+G  ++ +A+    +MREL+YL A + E++RL+PP+QFDSKFC EDDVLPDGT V+ GT
Sbjct  414   VMGPTREGLATASFDQMRELHYLHAVLYETMRLYPPVQFDSKFCQEDDVLPDGTFVRSGT  473

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME IWGSDCL+FKP+RW++ G F  E+P+KYP+FQ G RVCLGKE+A++
Sbjct  474   RVTYHQYAMGRMESIWGSDCLDFKPDRWMKKGAFSPESPYKYPIFQGGERVCLGKELAVM  533

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K VA++++R+F + +  P   P+F PG TAT   GLPV +++R
Sbjct  534   EMKCVAVALVRKFDIQVLDPERRPQFVPGFTATVSGGLPVRIKER  578



>ref|XP_009411963.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=506

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/467 (63%), Positives = 368/467 (79%), Gaps = 6/467 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R   ++CSC VC AY++ SW A+++NLCDWY HLLR SP++TIHIHVLRNT+TANP+NVE
Sbjct  35    RCMPWWCSCPVCEAYVTKSWAARFDNLCDWYAHLLRESPTRTIHIHVLRNTVTANPDNVE  94

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             +ML++RF+N+PKGK FSAILGD LG+GIFNVDGD WRFQRK+AS ELG ++V  +A  ++
Sbjct  95    HMLRARFDNYPKGKPFSAILGDLLGRGIFNVDGDPWRFQRKMASAELGSTAVRFFACCIV  154

Query  1513  QTEIDRRLLPILAGKKDG-GVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
               E+  RLLP+      G  V+DLQDVFRRF+FD +C+ SFGLDP CLE  LP SEFA +
Sbjct  155   TAEVRERLLPLFDAACAGYAVLDLQDVFRRFAFDNMCKISFGLDPGCLELSLPASEFAAA  214

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  AS LSA RA S  P+VW+ KR LN GSE+ELR +I ++N+LA E+IRQRRKLG S  
Sbjct  215   FDKASMLSAWRATSTMPIVWRAKRLLNRGSERELRDAIRLVNLLAKELIRQRRKLGFS-S  273

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             NH DLLSRFM  + DD+ YLRDI ISFLLAGRDTVASALTSFF L++ HPD   A+  E 
Sbjct  274   NH-DLLSRFMACV-DDDKYLRDITISFLLAGRDTVASALTSFFLLLSRHPDVRSAMRDEI  331

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             DRVVG+     AS   +R+L+Y+ AA+ ES+RL+PP+QFDSKFC++DDVLPDGT V RGT
Sbjct  332   DRVVGRGA-ATASYDHLRDLHYVHAAIHESMRLYPPVQFDSKFCLDDDVLPDGTFVGRGT  390

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME +WGSDC EF+P+RWLR+G F  E+P+KYPVFQ GLRVCLGKEMAL+
Sbjct  391   RVTYHAYAMGRMEELWGSDCHEFRPQRWLRNGTFAPESPYKYPVFQGGLRVCLGKEMALM  450

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR*C  476
             E+K+V ++V+R+F + + Q    P+F+PGLTA+ + GLPV +++  C
Sbjct  451   EMKTVIVAVVRQFDIDV-QAAWPPKFAPGLTASLKGGLPVRIRRNAC  496



>ref|XP_003606223.1| Cytochrome P450 94A1 [Medicago truncatula]
 gb|ABC59093.1| cytochrome P450 monooxygenase CYP94C9 [Medicago truncatula]
 gb|AES88420.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=517

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/472 (60%), Positives = 367/472 (78%), Gaps = 14/472 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C+ C  +++ SW  K+ NL D+YTHLL+ SP+ TIH+HVL NTIT+NPENVEY+LK+
Sbjct  46    WCNCNTCKTFLTMSWSNKFVNLVDYYTHLLQESPTGTIHVHVLGNTITSNPENVEYILKT  105

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK FS ILGD LG+GIFNVDG SW+FQRK+AS+ELG   + SYA E++  EI 
Sbjct  106   NFNNYPKGKQFSTILGDLLGRGIFNVDGHSWKFQRKMASLELGSVVIRSYAMELVIEEIK  165

Query  1498  RRLLPILAG--------KKDGG----VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPM  1355
              RLLP++A         K D      ++D+QD+ RRFSFD IC+FSFGLDP CL   LP+
Sbjct  166   TRLLPLIASVAEKKTASKADNTSEDVLLDMQDILRRFSFDNICKFSFGLDPCCLVPSLPV  225

Query  1354  SEFAVSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK  1175
             S  A +F L+S LSA+RA++ASP++WK+KRF NIGSEK+L+++I+++N LA E+I+QRR+
Sbjct  226   SNLANAFDLSSTLSAQRALTASPLIWKMKRFFNIGSEKKLKEAIKIVNDLANEMIKQRRE  285

Query  1174  LGTSDENHKDLLSRFMGSIGD-DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAA  998
             +    E+ KDLLSRFMG++   D+ YLRDIV+SFLLAGRDTVASALT FF L++ +P   
Sbjct  286   IENGVESRKDLLSRFMGALNSHDDEYLRDIVVSFLLAGRDTVASALTGFFILLSKNPKVE  345

Query  997   EAILAEADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDG  818
             E I  E DRV+  NQ+    EQ  RE++YL  A+ ES+RLFPP+QFDSKF +EDDVLPDG
Sbjct  346   EKIRVELDRVMNPNQECATFEQ-TREMHYLNGAIHESMRLFPPVQFDSKFALEDDVLPDG  404

Query  817   TAVKRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCL  638
             T +K+G+RVTYHPYAMGRME IWG DCLEFKPERWL+DGVF  + PFKYPVFQAG RVCL
Sbjct  405   TFIKKGSRVTYHPYAMGRMENIWGPDCLEFKPERWLKDGVFVPKCPFKYPVFQAGSRVCL  464

Query  637   GKEMALLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             GKE+A++E+KSV  S+++RF V +  P+  P+F+PGLTA+FR GLPV + +R
Sbjct  465   GKELAIVEMKSVVASLVKRFDVRVVGPNQEPQFAPGLTASFRGGLPVKIYER  516



>ref|XP_008801229.1| PREDICTED: cytochrome P450 94C1 [Phoenix dactylifera]
Length=522

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/467 (63%), Positives = 370/467 (79%), Gaps = 6/467 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R + ++C+C VC AY+++SW A ++NL DWYTHLLR SP++TIHIHVLRNTITANP+NVE
Sbjct  32    RSRPWWCNCPVCEAYVTSSWRADFDNLSDWYTHLLRQSPTRTIHIHVLRNTITANPDNVE  91

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             +MLKSRF+N+PKGK FS+ILGDFLG+GIFNVDGD WRFQR +AS ELG  SV S+AF ++
Sbjct  92    HMLKSRFDNYPKGKPFSSILGDFLGRGIFNVDGDLWRFQRMLASAELGSMSVRSFAFRIV  151

Query  1513  QTEIDRRLLPILAGKKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
              +E+ RRLLP+L    D G V+D Q+VFRRF+FD IC+ SFGLDP CLE  LPMSEFA +
Sbjct  152   SSEVCRRLLPLLDSAADTGQVLDFQNVFRRFAFDNICKISFGLDPGCLELSLPMSEFAAA  211

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  AS+LSA RA +  P +WK KR LN GSE+ELR++I V+++LA E+I QRRKLG S  
Sbjct  212   FDTASRLSARRAAATVPAIWKAKRLLNSGSERELRRAIRVLDLLAEELICQRRKLGFSSS  271

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             +  DLLSRFM S+ DD+ YLRDIV+SF+LAGRDTV+SALTSFF L++ HP A   I +E 
Sbjct  272   H--DLLSRFMVSV-DDDRYLRDIVVSFMLAGRDTVSSALTSFFMLLSRHPAAQSKIRSEI  328

Query  976   DRVV--GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             ++V   G      AS  ++RE++Y++AA+ ES+RL+PP+QF+SKF V+DD+LPDGT + R
Sbjct  329   EQVTWSGGGGGGGASYDQLREMHYVRAALYESMRLYPPVQFNSKFSVDDDILPDGTFISR  388

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYH YAMGRME +WG+DC EF+PERWL++GVF  ENPFKYPVFQ GLRVCLGKEMA
Sbjct  389   GTRVTYHAYAMGRMEELWGTDCGEFRPERWLKNGVFACENPFKYPVFQGGLRVCLGKEMA  448

Query  622   LLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L+E+K+V  SV++ F V +      P+FSPGLTA    GLPV V++R
Sbjct  449   LMEMKTVIASVVQGFDVDVIDGSRPPKFSPGLTAGLEGGLPVRVRRR  495



>ref|XP_009414947.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=503

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/469 (62%), Positives = 364/469 (78%), Gaps = 8/469 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC AY+S++W A+++NLCDWY HLLR SP+ T+ IHVL NTITANP+NVEYMLK+
Sbjct  37    WCNCSVCRAYLSSTWTAEFDNLCDWYAHLLRQSPTGTVQIHVLGNTITANPDNVEYMLKT  96

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGK FS ILGD LG GIFNVDG++WRFQRK+AS+ELG +S+ SYAF ++  E+ 
Sbjct  97    NFDNFPKGKPFSTILGDLLGHGIFNVDGEAWRFQRKMASLELGSASLRSYAFRIVSGEVH  156

Query  1498  RRLLPILAGKKD---GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
              RLLP+LA   D      V+LQDVFRRF+FD +C+ SFGLDP CLE  LPMSEFA++F  
Sbjct  157   HRLLPLLAFVSDPSGDNTVELQDVFRRFAFDTVCKISFGLDPGCLELSLPMSEFAMAFDR  216

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             AS L A R  + +P+VWK+KRFLN+GSE+ELR+SI  +N+LA EVIRQRR LG++  +  
Sbjct  217   ASTLLARRGATIAPLVWKLKRFLNVGSERELRRSIRRVNVLADEVIRQRRVLGSASGH--  274

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFM S+ DD  YLRDIVISFLLAGRDTVAS+LTS F+L++ HP    AI  E   V
Sbjct  275   DLLSRFMSSVEDDR-YLRDIVISFLLAGRDTVASSLTSVFFLLSQHPKVVAAIRDEVAAV  333

Query  967   V-GKNQ-DLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
               GK++ D + + ++++ ++Y+ A + ESLRL+PP+QFDSKFC+EDDVLPDGT V +  R
Sbjct  334   TKGKDENDEVPTYEQLKGMHYVTAVLHESLRLYPPVQFDSKFCLEDDVLPDGTMVTKNAR  393

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGRME IWGSDC +FKPERWLRDG+F  E  FKYPVFQAGLRVCLGKEMAL+E
Sbjct  394   VTYHPYAMGRMERIWGSDCFDFKPERWLRDGLFTPEGLFKYPVFQAGLRVCLGKEMALME  453

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR*CPPC  467
             +K+V +SV+ RF + +     +P F+PGLTAT   GL V V +R    C
Sbjct  454   MKAVIVSVVPRFDIEVINGGRSPHFTPGLTATITGGLSVRVHRRTATAC  502



>ref|XP_010067149.1| PREDICTED: cytochrome P450 94C1-like [Eucalyptus grandis]
 gb|KCW65215.1| hypothetical protein EUGRSUZ_G02702 [Eucalyptus grandis]
Length=512

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/460 (61%), Positives = 364/460 (79%), Gaps = 6/460 (1%)
 Frame = -2

Query  1855  CSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKSR  1676
             C C +C +Y ++SW  +++NLCDWYTHLL+ SPS+TIHIHVL N ITANP  VEYMLK+R
Sbjct  48    CRCHICDSYRTSSWANEFDNLCDWYTHLLKKSPSQTIHIHVLGNVITANPVVVEYMLKTR  107

Query  1675  FENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDR  1496
             F N+PKGK FS ILGDFLG+GIFNVDGD W FQRK+AS+ELG  ++ S+A++ +  EI+ 
Sbjct  108   FNNYPKGKPFSMILGDFLGKGIFNVDGDWWMFQRKMASLELGSIAIRSHAYKTVTKEIET  167

Query  1495  RLLPILAGKKDGG--VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
             RLLP+L+   + G  ++DLQDVF+RFSFD IC FSFG+DP CLES +P+S FA SF+LA+
Sbjct  168   RLLPLLSAAAEDGKKILDLQDVFQRFSFDNICNFSFGVDPGCLESSMPISSFAESFNLAT  227

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             KLSAERA++ +P+VWK+KR LN+GSEK+L  +I+V+ +LA +VI Q+RKLG S  NH+DL
Sbjct  228   KLSAERALAITPLVWKMKRLLNVGSEKKLNDAIKVVKVLAKDVISQKRKLGFS--NHQDL  285

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFM  + DD+ +L DIVISF+LAG+DT+ASAL++FFWL+  HP+    I +EA  V+ 
Sbjct  286   LSRFMACVNDDK-FLVDIVISFILAGQDTMASALSAFFWLLGKHPETVSRIRSEAKEVMD  344

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
              +Q+  + EQ +R L+YL A V ESLRL PPIQFDSKF ++DDVLPDGT VK GTRVTYH
Sbjct  345   GDQEFASFEQ-IRGLHYLHAVVYESLRLLPPIQFDSKFALKDDVLPDGTTVKEGTRVTYH  403

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             PYAM RM+ IWG DC++FKPERW+ +G F   N +KYPVFQAG RVCLGKEMA++E+K V
Sbjct  404   PYAMARMDQIWGPDCMKFKPERWIENGKFCPPNAYKYPVFQAGSRVCLGKEMAIVEMKIV  463

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             ALSVLR+F + +  P   PRFSPGLTA  + G+ V V+++
Sbjct  464   ALSVLRKFDITVVSPASGPRFSPGLTAIMKGGVKVLVKKK  503



>ref|XP_008784226.1| PREDICTED: cytochrome P450 94C1-like [Phoenix dactylifera]
Length=514

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/465 (62%), Positives = 363/465 (78%), Gaps = 9/465 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC AY+S+SW  ++ NLCDW+THLLR SP+ T+ IHVL NTIT NP NVEYML++
Sbjct  41    WCNCHVCRAYLSSSWTTEFENLCDWFTHLLRESPTGTMDIHVLGNTITTNPNNVEYMLRT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK FS++LGDFLG+GIFNVDG+SW+FQRK+AS+ELG  S  SYAF ++ +E+ 
Sbjct  101   RFDNFPKGKPFSSLLGDFLGRGIFNVDGESWQFQRKMASLELGSVSARSYAFHIVSSEVR  160

Query  1498  RRLLPILAGKKD-----GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             RRLLP+ A   +       V+DLQDVFRRF+FD ICR SFGLDP CLE  LP SEFA +F
Sbjct  161   RRLLPLFATVSERSIAADSVIDLQDVFRRFTFDNICRISFGLDPGCLEGSLPASEFAEAF  220

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS+LSA RA + +P VWK+KR LN+GSE+EL+++I +++ LA EVIR+RRKLG +  +
Sbjct  221   DTASRLSAGRATTVAPAVWKLKRLLNVGSERELKRAIRMVSALADEVIRRRRKLGFA--S  278

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE-A  977
             + DLLSRFMGS+ DD+ YLRDIVISFLLAGRDTVAS LTSFF +++ HP    AI  E A
Sbjct  279   NLDLLSRFMGSV-DDDRYLRDIVISFLLAGRDTVASGLTSFFLILSKHPAVTAAIRDEIA  337

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             D + G   D  AS ++++E++Y+ AA+ ES+RL+PP+QFDSKFCVED VLPDGT V++G 
Sbjct  338   DVMSGSGDDEEASLKQLKEMHYVHAAMYESMRLYPPVQFDSKFCVEDAVLPDGTFVRKGA  397

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYHPYAMGRME IWG DC EFKPERWL +  F   +PFKYPVF AG RVCLGKEMAL+
Sbjct  398   RVTYHPYAMGRMEDIWGPDCEEFKPERWLHNRKFVPASPFKYPVFHAGPRVCLGKEMALM  457

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K+V +SV+R F V +      PRF+PGLTA+ R GL   V++R
Sbjct  458   EMKTVIVSVVRSFDVQVLDGGRPPRFAPGLTASIRGGLSARVRRR  502



>ref|XP_009338906.1| PREDICTED: cytochrome P450 94C1-like, partial [Pyrus x bretschneideri]
Length=514

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/465 (60%), Positives = 373/465 (80%), Gaps = 8/465 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C +C +++S+SW   ++NLCDWYTHLL+ S S TIH+HVL N ITANPENVE+++K+
Sbjct  50    WCNCHICRSFLSSSWSGSFDNLCDWYTHLLKKSLSGTIHVHVLGNIITANPENVEHIIKT  109

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK F+ ILGD LG GIFNVDGD W+FQRK+AS+ELG  SV SYA E++  EI 
Sbjct  110   NFHNYPKGKLFTTILGDLLGLGIFNVDGDGWQFQRKMASLELGSVSVRSYALEIVSAEIQ  169

Query  1498  RRLLPILA----GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              RL+P+LA     + + GVVD+QD+FRRFSFD IC+FSFGLDP CL+  LP+S+ AV+F 
Sbjct  170   SRLIPLLASVAGNEGENGVVDIQDLFRRFSFDNICKFSFGLDPGCLQLSLPISDVAVAFD  229

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERAM++SP+VWKIKRF N+GSE++L++++++++ LA  +I+QRR++GT     
Sbjct  230   LASKLSAERAMTSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSIIKQRREMGTF-STQ  288

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             KDLLSRFM +I DD+ YLRDIV+SFLLAGRDT++S LTS F+L+A HP+    I  E D+
Sbjct  289   KDLLSRFMANIEDDQ-YLRDIVVSFLLAGRDTISSGLTSLFYLLARHPEVKREIRKELDQ  347

Query  970   VVGKNQDLIASEQ--RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             V+G  ++ +A+    +MRE++YL A + E++RL+PPIQFDSKFC EDDVLPDGT V+ GT
Sbjct  348   VMGPTREGLATASFDQMREMHYLHAVLYETMRLYPPIQFDSKFCQEDDVLPDGTFVRSGT  407

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME IWGSDCL+FKP+RWL+ G+F  E+P+KYP+FQ G RVCLGKE+A++
Sbjct  408   RVTYHQYAMGRMESIWGSDCLDFKPDRWLKKGLFSPESPYKYPIFQGGERVCLGKELAVM  467

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K VA++++ RF + + +P   P+F PGLTAT R GLPV +++R
Sbjct  468   EMKCVAVALVGRFDIQILEPERRPQFVPGLTATVRGGLPVRIEER  512



>ref|XP_008371286.1| PREDICTED: cytochrome P450 94C1-like [Malus domestica]
Length=501

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/465 (60%), Positives = 374/465 (80%), Gaps = 8/465 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C +C +++S+SW   ++NLCDWYTHLL+ S S TIH+HVL N ITANPENVE+++ +
Sbjct  37    WCNCHICRSFLSSSWSGSFDNLCDWYTHLLKKSLSGTIHVHVLGNIITANPENVEHIINT  96

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK F+ ILGD LG+GIFNVDG+ WRFQRK+AS+ELG  SV SYA E++  EI 
Sbjct  97    NFHNYPKGKLFTTILGDLLGRGIFNVDGNGWRFQRKMASLELGSVSVRSYALEIVSAEIQ  156

Query  1498  RRLLPILA----GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              RL+P+LA     + + GVVDLQD+FRRFSFD IC+FSFGLDP CL+  LP+S+FAV+F 
Sbjct  157   SRLIPLLASVAGNEGENGVVDLQDLFRRFSFDNICKFSFGLDPGCLQLSLPISDFAVAFD  216

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERAM++SP+VWKIKRF N+GSE++L++++++++ LA  +I+QRR++GT     
Sbjct  217   LASKLSAERAMTSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSMIKQRREMGTF-STQ  275

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             KDLLSRFM ++ DD+ YLRDIV+SFLLAGRDT++S LTS F+L+A HP+    I  E D+
Sbjct  276   KDLLSRFMANM-DDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLAKHPEVKREIREEMDQ  334

Query  970   VVGKNQDLIASEQ--RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             V+G  ++ +A+    +MRE++YL A + E++RL+PPIQFDSKFC EDDVLPDGT V+ GT
Sbjct  335   VMGPTREGLATASFDQMREMHYLHAVLYETMRLYPPIQFDSKFCQEDDVLPDGTFVRSGT  394

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME IWGSDCL+FKP+RWL+ G+F  E+P+KYP+FQ G RVCLGKE+A++
Sbjct  395   RVTYHQYAMGRMESIWGSDCLDFKPDRWLKKGLFSPESPYKYPIFQGGERVCLGKELAVM  454

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K VA++++RRF + + +P    +F PGLTAT R GLPV +++R
Sbjct  455   EMKCVAVALVRRFDIQILEPERRXQFVPGLTATVRGGLPVRIEER  499



>ref|XP_009393377.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=520

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/468 (63%), Positives = 371/468 (79%), Gaps = 11/468 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++CSC VC AY++ SW A+++NLCDWY HLLR SP++TIHIHVLRNT+TANP+NVE+ML+
Sbjct  44    WWCSCPVCEAYVTNSWAARFDNLCDWYAHLLRESPTRTIHIHVLRNTVTANPDNVEHMLR  103

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKGK FSAILGD LG+GIFNVDGD W FQRK+AS ELG +SV  +A   + +E+
Sbjct  104   ARFDNYPKGKPFSAILGDLLGRGIFNVDGDPWCFQRKMASAELGGASVRFFASCAVASEV  163

Query  1501  DRRLLPILAGKKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
               RLLP+L     GG V+DLQDVFRRF+FD +C+ SFGLDP CLE  LPMS+FA +F  A
Sbjct  164   RGRLLPLLDVACGGGRVLDLQDVFRRFAFDSMCKISFGLDPGCLELSLPMSDFAAAFDKA  223

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             S+LSA RA +  P+VWK KR LN GSE+EL  +I ++N+LA E+IRQRRKLG S  NH D
Sbjct  224   SRLSAWRATATMPLVWKAKRLLNWGSERELGDAIGLVNLLAKELIRQRRKLGFS-SNH-D  281

Query  1144  LLSRFMGSIGDDET-YLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             LLSRFM  + DD+  YLRDI+ISFLLAGRDTVASALT FF+L++ HPD   AI  E DRV
Sbjct  282   LLSRFMACVDDDDDKYLRDIIISFLLAGRDTVASALTCFFFLLSRHPDVRSAIRDEIDRV  341

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             V ++  + AS  ++R+L Y+ AA+ ES+RL+PP+QFDSKFC+EDDVLPDGTAV+RGTRVT
Sbjct  342   VERDA-VTASYDQLRDLQYVHAAIYESMRLYPPVQFDSKFCLEDDVLPDGTAVRRGTRVT  400

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YH YAMGRME +WGSDC EF+PERWLR+G F  E+P+KYPVFQ G+RVCLGKEMAL+E+K
Sbjct  401   YHAYAMGRMEELWGSDCSEFRPERWLRNGAFNPESPYKYPVFQGGVRVCLGKEMALMEMK  460

Query  607   SVALSVLRRFRVHLAQP------HHTPRFSPGLTATFRDGLPVFVQQR  482
             +V  +V+R+F V +         +  P+F+ GLTA+ + GLPV V++R
Sbjct  461   TVITAVVRQFDVEVISADEGGGGNRPPKFATGLTASLKGGLPVRVRRR  508



>ref|XP_007132406.1| hypothetical protein PHAVU_011G092100g [Phaseolus vulgaris]
 gb|ESW04400.1| hypothetical protein PHAVU_011G092100g [Phaseolus vulgaris]
Length=499

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/464 (62%), Positives = 359/464 (77%), Gaps = 13/464 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C +C +Y++ SW  K+ NLCDWYTHLLR SPS TIH+HVL NTIT+NP+NVEY+LK+
Sbjct  42    WCNCLLCKSYLTLSWARKFTNLCDWYTHLLRKSPSGTIHMHVLGNTITSNPDNVEYILKT  101

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK FSAILGD LG+GIFNVDGDSWRFQRK+AS+ELG  ++ SYA E++  EI 
Sbjct  102   NFHNYPKGKPFSAILGDLLGKGIFNVDGDSWRFQRKMASLELGSVAIRSYAMELVNEEIH  161

Query  1498  RRLLPILAGKKDG-----GVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
              RLLPI      G      V+DLQD+ RRFSFD IC+ SFGLDP CL   LP+S+ A +F
Sbjct  162   SRLLPIAVSTARGEMNKEKVLDLQDILRRFSFDNICKISFGLDPGCLLPSLPVSDLADAF  221

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              LASKLSAERAM++SP VW+ KR L IGSEK L+++I+V+N +A  +I+QRR++G +  N
Sbjct  222   DLASKLSAERAMTSSPCVWQAKRLLGIGSEKRLKEAIKVVNDVADGMIKQRREMGFNSRN  281

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
               DLLSRFMGS+ DD+ YLRDIV+SFLLAGRDT+ASALT FF L++  P+    I  E  
Sbjct  282   --DLLSRFMGSV-DDDAYLRDIVVSFLLAGRDTIASALTGFFSLLSKSPEVEARIREE--  336

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
               VG   +    EQ +RE++YL  AV ES+RLFPPIQFDSKF  EDDVLPDGT V++G+R
Sbjct  337   --VGPGPEPPTFEQ-IREMHYLNGAVHESMRLFPPIQFDSKFAKEDDVLPDGTFVRKGSR  393

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGRME IWG DCL+F+PERWLRDGVF    PFKYPVFQAG+RVCLGK++AL E
Sbjct  394   VTYHPYAMGRMENIWGPDCLQFRPERWLRDGVFVPPCPFKYPVFQAGVRVCLGKDLALTE  453

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +KSV ++++RRF + + +P    RF+PGLTAT R GLPV V +R
Sbjct  454   MKSVVVALIRRFDIRVVEPDQELRFAPGLTATLRGGLPVRVFER  497



>ref|XP_009364325.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94C1 [Pyrus x 
bretschneideri]
Length=635

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/465 (60%), Positives = 373/465 (80%), Gaps = 8/465 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C +C +++S+SW   ++NLCDWYTHLL+ S S TIH+HVL N ITANPENVE+++K+
Sbjct  171   WCNCHICRSFLSSSWSGSFDNLCDWYTHLLKKSLSGTIHVHVLGNIITANPENVEHIIKT  230

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK F+ ILGD LG GIFNVDGD W+FQRK+AS+ELG  SV SYA E++  EI 
Sbjct  231   NFHNYPKGKLFTTILGDLLGLGIFNVDGDGWQFQRKMASLELGSVSVRSYALEIVSAEIQ  290

Query  1498  RRLLPILA----GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
              RL+P+LA     + + GVVD+QD+FRRFSFD IC+FSFGLDP CL+  LP+S+ AV+F 
Sbjct  291   SRLIPLLASVAGNEGENGVVDIQDLFRRFSFDNICKFSFGLDPGCLQLSLPISDVAVAFD  350

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             LASKLSAERAM++SP+VWKIKRF N+GSE++L++++++++ LA  +I+QRR++GT     
Sbjct  351   LASKLSAERAMTSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSIIKQRREMGTF-STQ  409

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             KDLLSRFM +I DD+ YLRDIV+SFLLAGRDT++S LTS F+L+A HP+    I  E D+
Sbjct  410   KDLLSRFMANIEDDQ-YLRDIVVSFLLAGRDTISSGLTSLFYLLARHPEVKREIRKELDQ  468

Query  970   VVGKNQDLIASEQ--RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             V+G  ++ +A+    +MRE++YL A + E++RL+PPIQFDSKFC EDDVLPDGT V+ GT
Sbjct  469   VMGPTREGLATASFDQMREMHYLHAVLYETMRLYPPIQFDSKFCQEDDVLPDGTFVRSGT  528

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME IWGSDCL+FKP+RWL+ G+F  E+P+KYP+FQ G RVCLGKE+A++
Sbjct  529   RVTYHQYAMGRMESIWGSDCLDFKPDRWLKKGLFSPESPYKYPIFQGGERVCLGKELAVM  588

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K VA++++ RF + + +P   P+F PGLTAT R GLPV +++R
Sbjct  589   EMKCVAVALVGRFDIQILEPERRPQFVPGLTATVRGGLPVRIEER  633



>ref|XP_006361448.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=509

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/466 (61%), Positives = 353/466 (76%), Gaps = 10/466 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CD+C  Y+++SW  ++ NL DWY HLLRNSPS+TI IH L N ITANP NVEYMLK+
Sbjct  44    WCTCDICHCYLTSSWRKEFTNLGDWYAHLLRNSPSQTIRIHALDNIITANPRNVEYMLKT  103

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F N+PKGK FS ILGD LG GIFNVDGD W FQRK++S+ELG  S+ SYAF  ++ EI+
Sbjct  104   NFLNYPKGKPFSMILGDLLGDGIFNVDGDLWMFQRKMSSLELGSMSIRSYAFNNVKNEIN  163

Query  1498  RRLLPILAG-------KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAV  1340
              RL+P+L+        + D   +DLQDVFRRFSFD IC+FSFGLDP CLE  LP+S FA 
Sbjct  164   FRLIPLLSSHVVVSSSQHDFKSLDLQDVFRRFSFDNICKFSFGLDPCCLELSLPLSHFAY  223

Query  1339  SFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD  1160
             SF LA+KLSAERAM ASP++WKIKR  +IG+EK+L+ +IE +N+LA EVIRQ+RKLG S 
Sbjct  224   SFDLATKLSAERAMVASPLIWKIKRLFDIGTEKKLKGAIEDINVLANEVIRQKRKLGYS-  282

Query  1159  ENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
              NH+DLLSRFM  + D++ YLRDIVISF+LAGRDTVAS LTS FWL+ +HPD    I  E
Sbjct  283   -NHQDLLSRFMTMV-DNDVYLRDIVISFILAGRDTVASGLTSVFWLLTSHPDVELRIREE  340

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
               RV+ KN +     + M +++YL A + ES+RL+PP+QFDSKF  E+DV  DGT V + 
Sbjct  341   TSRVMEKNDEGFLKFEEMNQMHYLNAVIHESMRLYPPVQFDSKFASENDVFVDGTFVGKN  400

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
              RVTYH YAMGRME IWG D +EFKPERWL++G+F Q++PFKYPVFQ G+RVCLGKE+AL
Sbjct  401   DRVTYHVYAMGRMENIWGKDYMEFKPERWLKNGIFCQQSPFKYPVFQGGIRVCLGKELAL  460

Query  619   LELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +E+K V  S+L+ F +        PRF PGLTAT R GLPV V++R
Sbjct  461   MEMKCVVASMLQHFEIRAMAVGGEPRFDPGLTATVRGGLPVVVRRR  506



>ref|XP_006481812.1| PREDICTED: cytochrome P450 94A1-like isoform X2 [Citrus sinensis]
Length=451

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/465 (61%), Positives = 353/465 (76%), Gaps = 57/465 (12%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             ++KL +C+C++C  Y++ SW  +++NLCDWY HLL  SP+KTIHIHVL NTITANP+NVE
Sbjct  43    KLKL-WCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVE  101

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             YMLK+RF+NFPKGK FS ILGDFLG+GIFNVDGDSWRFQ+++AS+EL R S+ SYA E++
Sbjct  102   YMLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIV  161

Query  1513  QTEIDRRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
               EI  RL+P+L                                                
Sbjct  162   NQEIKTRLIPLL------------------------------------------------  173

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
                S ++AERAM+ SP+VWKIKR LN+GSEK+L+++I+++++LA+EVI+QRRK+G S   
Sbjct  174   ---SSVAAERAMTVSPLVWKIKRMLNLGSEKQLKEAIKMIDLLALEVIKQRRKMGFS--T  228

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             HKDLLSRFM S+ DD TYLRDIVISFLLAGRDTVASALTSF WL+  +P     I AEAD
Sbjct  229   HKDLLSRFMSSVNDD-TYLRDIVISFLLAGRDTVASALTSFVWLLGKNPRVCSEIRAEAD  287

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             R++G+NQ+L + +Q +REL+YLQAAV ES RL+PPIQFDSKFC EDDVLPDGT VK+GTR
Sbjct  288   RILGQNQELTSFDQ-LRELHYLQAAVSESTRLYPPIQFDSKFCEEDDVLPDGTYVKKGTR  346

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYHPYAMGRM  IWG +CLEF PERWL++GVF  ENP+KYPVFQAG RVCLGKEMAL+E
Sbjct  347   VTYHPYAMGRMREIWGQNCLEFNPERWLKNGVFLPENPYKYPVFQAGFRVCLGKEMALVE  406

Query  613   LKSVALSVLRRFRVHLAQPH-HTPRFSPGLTATFRDGLPVFVQQR  482
             +KSVALS++R+F++ L  P+ + PRFSPGLTATF  GLPV +QQR
Sbjct  407   IKSVALSLVRQFQIQLMSPYRNIPRFSPGLTATFNGGLPVLLQQR  451



>ref|XP_006294094.1| hypothetical protein CARUB_v10023087mg [Capsella rubella]
 gb|EOA26992.1| hypothetical protein CARUB_v10023087mg [Capsella rubella]
Length=492

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/469 (61%), Positives = 354/469 (75%), Gaps = 9/469 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C+AY+++SW   + NL DWYTHLLR SP+ TI +HVL + ITANP NVE++
Sbjct  25    KLRYCNCEICNAYLTSSWRKDFVNLSDWYTHLLRRSPTSTIKVHVLNSVITANPSNVEHI  84

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+ F N+PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A E+++ 
Sbjct  85    LKTHFHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVRN  144

Query  1507  EIDRRLLPILAGKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RLLPIL    D  G V+DLQDVFRRFSFD I + SFG DP CL   LP SEFAV+F
Sbjct  145   EIETRLLPILTSFSDSPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPLPTSEFAVAF  204

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA+++ P++WK+KRF  IGSEK+L++SI+V+N LA ++I+QRR  G    N
Sbjct  205   DTASTLSAKRALASFPLLWKLKRFFRIGSEKKLKESIDVINRLAGDLIKQRRLTGLVGNN  264

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
               DL+SRFM  +  DD+ YLRDIV+SFLLAGRDTVA+ LT FFWL+  HP     I  E 
Sbjct  265   --DLISRFMAVVAEDDDEYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKVENRIQEEL  322

Query  976   DRVVGKNQD-LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DRV+G   D + AS   MR++NYL A + ES+RLFPP+QFDSKF + DDVL DGT VKRG
Sbjct  323   DRVMGTGFDSVTASCNEMRDMNYLHATLYESMRLFPPVQFDSKFALNDDVLADGTFVKRG  382

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYH YAMGRM  IWG DC EFKPERWL  D  F  ENP KYPVFQAG RVC+GKEMA
Sbjct  383   TRVTYHAYAMGRMGRIWGPDCEEFKPERWLDNDSKFRPENPVKYPVFQAGARVCVGKEMA  442

Query  622   LLELKSVALSVLRRFRVHLAQPHHTP--RFSPGLTATFRDGLPVFVQQR  482
             ++E+KS+A++++RRF   +A P  T   RF+PGLTAT   GLPV +Q+R
Sbjct  443   IMEMKSIAVAIIRRFETRVACPESTDMLRFAPGLTATVSGGLPVLIQER  491



>ref|XP_008776666.1| PREDICTED: cytochrome P450 94C1-like [Phoenix dactylifera]
Length=515

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/469 (62%), Positives = 370/469 (79%), Gaps = 8/469 (2%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R + ++C+C VC AY+++SW A ++NLCDWY HLL+ SP++TIHIHVL NTITANP+NVE
Sbjct  32    RSRPWWCNCPVCEAYVTSSWTADFDNLCDWYAHLLQQSPTRTIHIHVLCNTITANPDNVE  91

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             +MLK+RF+N+PKGK FS ILGDFLG+GIFNVDGD WRFQRKI S+ LG +SV S+A  ++
Sbjct  92    HMLKTRFDNYPKGKPFSLILGDFLGRGIFNVDGDVWRFQRKITSIALGSTSVRSFACRIV  151

Query  1513  QTEIDRRLLPILAGKKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
              +EI  RLLP+L    + G   D QDVFRRF+FD IC+ SFGLD  CLE  LPMSEFA +
Sbjct  152   SSEIRHRLLPLLDSLANTGQAFDFQDVFRRFAFDNICKISFGLDSGCLELSLPMSEFAAA  211

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  AS+LSA RA +A+PVVWK KRFLN GSE+ELR++I+++N+LA E IRQRRKLG S  
Sbjct  212   FDTASRLSALRAAAAAPVVWKAKRFLNWGSERELRRAIQLVNLLAEEAIRQRRKLGFSSS  271

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             +  DLLSRFM SI D++ YLRDIVISF+LAGRDTVASALTSFF L++ HP     I  E 
Sbjct  272   H--DLLSRFMASI-DNDCYLRDIVISFMLAGRDTVASALTSFFMLLSRHPAVLSNIRREI  328

Query  976   DRVVGKNQD----LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
             + V     D     +AS ++++E++Y+ AA+ ES+RL+PP+QFDSKFCV+DDVLPDGT V
Sbjct  329   ELVTRSGGDGSGSAVASYEQLKEMHYVHAALYESMRLYPPVQFDSKFCVDDDVLPDGTFV  388

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKE  629
              RGT+VTYH YAMGRME +WGSDC EF+PERWLR+G+F  ENPF+YPVFQ GLRVCLGKE
Sbjct  389   SRGTKVTYHAYAMGRMEELWGSDCREFQPERWLRNGMFTCENPFRYPVFQGGLRVCLGKE  448

Query  628   MALLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             MAL+E+K+V ++V++ F V +      P+FSPGLTA+   GLPV V++R
Sbjct  449   MALMEMKNVIVAVVQGFDVDMVDGSRPPKFSPGLTASLGGGLPVRVRRR  497



>ref|XP_010683845.1| PREDICTED: cytochrome P450 94C1-like [Beta vulgaris subsp. vulgaris]
Length=515

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/469 (60%), Positives = 357/469 (76%), Gaps = 12/469 (3%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             + F+C CD+C  Y++++W  K+ N+CDWYTHLL+NSPSKTIHIHVL N ITANP+NVEYM
Sbjct  39    RYFHCKCDICHTYVTSNWSKKFPNICDWYTHLLQNSPSKTIHIHVLDNIITANPKNVEYM  98

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+ F N+PKGK FS ILGD LG GIFNVDGD+WRFQRK+AS+EL R SV SY+F+V++ 
Sbjct  99    LKTNFNNYPKGKPFSTILGDLLGHGIFNVDGDAWRFQRKMASLELDRYSVRSYSFQVVKE  158

Query  1507  EIDRRLLPILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLL-PMSEFAVSFH  1331
             +ID  LLP L  K DG +VDLQ++FR FS   I +FSFG+  + L  ++ P  +F+ SF 
Sbjct  159   QIDNHLLPYLYAKMDGQIVDLQEIFRAFSLSTISKFSFGVKIEPLHDIVSPFKDFSSSFD  218

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD---  1160
             LA+KLSA+RA+    + W++KRFL IG EK LR +I+ ++++AMEVI+QRRK  +S    
Sbjct  219   LATKLSAKRALEVCSISWRLKRFLGIGEEKNLRDAIKEIDVIAMEVIKQRRKKLSSSPSL  278

Query  1159  ---ENHKDLLSRFM-GSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEA  992
                E   +LLSRFM  S+ D++ YLRDI++SFLLAGRD+VASALTS F L+A HP    A
Sbjct  279   IIHEEENNLLSRFMKSSVKDNDQYLRDIIVSFLLAGRDSVASALTSIFLLMAQHPRVEFA  338

Query  991   ILAEADRVVGK-NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDG-  818
             IL EA+RV+G+  Q  ++S  ++ ELNYLQA + ES+RL+PP+QFDSK+ + +DV PD  
Sbjct  339   ILLEANRVLGQGQQQHVSSYDQLGELNYLQAVIFESMRLYPPVQFDSKYALNNDVFPDKI  398

Query  817   TAVKRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCL  638
             T V +GTRVTYHPYAMGRM+ IWG DCLEF PERWL+DGVF  EN FKYPVFQAG+RVCL
Sbjct  399   TKVMKGTRVTYHPYAMGRMKQIWGKDCLEFNPERWLKDGVFMHENAFKYPVFQAGVRVCL  458

Query  637   GKEMALLELKSVALSVLRRFRVHLAQPHH--TPRFSPGLTATFRDGLPV  497
             GKEMAL+E+K V LS+L+ F   L    +  TPRFS GLTA+F  GLPV
Sbjct  459   GKEMALMEIKCVVLSLLKEFHFQLPNTSYCQTPRFSTGLTASFSGGLPV  507



>ref|XP_002880978.1| CYP94C1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57237.1| CYP94C1 [Arabidopsis lyrata subsp. lyrata]
Length=498

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/469 (61%), Positives = 356/469 (76%), Gaps = 9/469 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C AY+++SW   + NL DWYTHLLR SP+ TI +HVL + ITANP NVE++
Sbjct  28    KLRYCNCEICHAYLTSSWRKDFINLSDWYTHLLRRSPTSTIKVHVLNSVITANPSNVEHI  87

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+ F ++PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A E+++T
Sbjct  88    LKTHFHSYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKT  147

Query  1507  EIDRRLLPILAGKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RLLPIL    D  G V+DLQDVFRRFSFD I + SFG DP CL    PMSEFAV+F
Sbjct  148   EIETRLLPILTSFSDNPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPMSEFAVAF  207

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA++  P++WKIKRFL IGSEK+L++SI V+N LA ++I+ RR  G   +N
Sbjct  208   DTASTLSAKRALAPFPLLWKIKRFLRIGSEKKLKESINVINRLAGDLIKHRRLTGLMGKN  267

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
               DL+SRFM  +  DD+ YLRDIV++FLLAGRDTVA+ LT FFWL+  HPD    I  E 
Sbjct  268   --DLISRFMAVVAEDDDEYLRDIVVNFLLAGRDTVAAGLTGFFWLLMRHPDVENRIREEL  325

Query  976   DRVVGKNQDLIASE-QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DRV+G   D + +    MRE++YL AA+ ES+RLFPP+QFDSKF + DDVL DGT VKRG
Sbjct  326   DRVMGTGFDSVTARCDEMREMDYLHAALYESMRLFPPVQFDSKFALNDDVLSDGTFVKRG  385

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYH YAMGRM+ IWG D  EFKPERWL  +G F  ENP KYPVFQAG RVC+GKEMA
Sbjct  386   TRVTYHAYAMGRMDRIWGPDYEEFKPERWLDNEGKFRPENPVKYPVFQAGARVCVGKEMA  445

Query  622   LLELKSVALSVLRRFRVHLA--QPHHTPRFSPGLTATFRDGLPVFVQQR  482
             ++E+KS+A++++RRF+  LA  +   T RF+PGLTAT   GLPV +Q+R
Sbjct  446   IMEMKSIAVAIIRRFKTRLASLESTKTLRFAPGLTATVNGGLPVMIQER  494



>ref|XP_006436643.1| hypothetical protein CICLE_v10033768mg [Citrus clementina]
 ref|XP_006492206.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
 gb|ESR49883.1| hypothetical protein CICLE_v10033768mg [Citrus clementina]
Length=510

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/468 (62%), Positives = 365/468 (78%), Gaps = 9/468 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             F+C+C++CS+Y+S+SW  ++ NLCDWYTHLL+ S ++TI IHVL NTITANP+NVEY+LK
Sbjct  42    FWCNCEICSSYISSSWSNEFKNLCDWYTHLLQKSKNQTIQIHVLNNTITANPDNVEYILK  101

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF N+PKGK FS ILGD LG+GIFNVDGD W FQRKIA++ L   S+ +YAFE++  EI
Sbjct  102   TRFNNYPKGKPFSMILGDLLGKGIFNVDGDLWIFQRKIATLVLASISIRTYAFELVTNEI  161

Query  1501  DRRLLPILAGKK--------DGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEF  1346
               RLLP+L+           +  VVDLQ VFRRFSFD IC+FSFGLDP  LES LP+S+F
Sbjct  162   KYRLLPLLSSSLANNDTTSNNNSVVDLQGVFRRFSFDNICKFSFGLDPYYLESSLPISQF  221

Query  1345  AVSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGT  1166
             A +F LASKLSAERAM+A P+ WKIKR  N+G+EK L+K+IEV+N LAMEVI Q+RKL  
Sbjct  222   ANAFDLASKLSAERAMAALPLAWKIKRLFNMGTEKRLKKAIEVVNDLAMEVIMQKRKLDL  281

Query  1165  SDENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAIL  986
             S EN +DLLSRFM  I DD  YLRDIV+SF+LAGRDT+A+ALT+FF+L+A+HP     I 
Sbjct  282   STENSQDLLSRFMNCISDD-NYLRDIVVSFILAGRDTMAAALTTFFFLLAHHPQVVLKIR  340

Query  985   AEADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVK  806
              E D+V+  +Q+++AS  ++RE++YL AAV ESLRL+PP+QFDSKF   DD+L DGT V 
Sbjct  341   QEFDQVMSLDQEVLASYNQIREMHYLHAAVNESLRLYPPVQFDSKFAQADDILADGTYVN  400

Query  805   RGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEM  626
             +GTRVTYHPYAMGRME IWG D +EFKPERWL++ +F  +  +KYPVFQAG R CLGKE+
Sbjct  401   KGTRVTYHPYAMGRMEKIWGQDFMEFKPERWLKNAMFCPQCQYKYPVFQAGARACLGKEL  460

Query  625   ALLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             AL E+K VALSVL +F + + +P   PRF  GLTA  RDGL V +++R
Sbjct  461   ALAEIKMVALSVLSKFDIEIVEPRGAPRFDNGLTAMLRDGLQVLIKER  508



>ref|XP_009414555.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=512

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/466 (60%), Positives = 366/466 (79%), Gaps = 6/466 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             RI+ ++C+C VC AY+++SW A ++NLCDWYTHLLR SP++T+ +HVL  T+TAN +NVE
Sbjct  32    RIRPWWCNCAVCQAYVTSSWAADFDNLCDWYTHLLRTSPTRTVTVHVLGCTVTANSDNVE  91

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             +MLK+RF+N+PKGK F+ ILGD LG+GIFNVDGD WRFQRK+AS ELG ++V ++A   +
Sbjct  92    HMLKTRFDNYPKGKPFATILGDLLGRGIFNVDGDLWRFQRKMASTELGSAAVRAFASRTV  151

Query  1513  QTEIDRRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
               E+  RLLP+L    + G V+DLQDVF+RF+FD IC+ SFGLDP C E  L +SEFA +
Sbjct  152   AAEVGGRLLPLLDVACECGRVLDLQDVFQRFAFDNICKISFGLDPGCFELSLSLSEFAAA  211

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  A++LSA RA    P++WK KR  N GSE+ELR++I ++++LA EVI QRRKLG + +
Sbjct  212   FDKATRLSARRATHTIPLIWKAKRLFNWGSERELREAIGLVDLLAKEVILQRRKLGFASD  271

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
               +DLLSRFMG + D++ YLRDIV+SF+LAGRDTVASALTSFF L++ HP A  AI  E 
Sbjct  272   --QDLLSRFMGCV-DNDKYLRDIVVSFMLAGRDTVASALTSFFMLLSRHPAACTAIRDEV  328

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             + +VG +Q L + +Q +R+++YL AA+CES+RL+PP+QFDSKFC++DDVLPDGT V++GT
Sbjct  329   ELIVGNSQALPSCDQ-LRKMHYLNAAICESMRLYPPVQFDSKFCLDDDVLPDGTFVRKGT  387

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLR-DGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
             R+TYH YAMGRME +WGSD  EF+PERWLR  G F  E+PFKYPVFQ GLRVCLGKEMAL
Sbjct  388   RMTYHVYAMGRMEDLWGSDWAEFRPERWLRHTGAFTPESPFKYPVFQGGLRVCLGKEMAL  447

Query  619   LELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +E+KSV  SV+R F V + + +  P+F+PGLTA F  GL V V +R
Sbjct  448   MEMKSVIASVVREFDVEVIEGNRPPKFAPGLTAIFSGGLAVRVHRR  493



>ref|XP_009421132.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/462 (61%), Positives = 354/462 (77%), Gaps = 6/462 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC AY+S+SW A+++NLCDW+ HLLR SP+ TIH+HVL +TITANP NVEYMLK+
Sbjct  33    WCTCHVCRAYLSSSWAAEFDNLCDWHAHLLRESPTGTIHVHVLGSTITANPTNVEYMLKT  92

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK FSA+LGD LG GIFNVDGDSWRFQRK+AS+ LG  SV SYA  ++ +EI 
Sbjct  93    RFDNFPKGKGFSALLGDLLGDGIFNVDGDSWRFQRKMASLALGSISVRSYALGIVSSEIS  152

Query  1498  RRLLPILAGKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
             R+LLP+L+   D   GVVDLQDVFRRF+FD IC+ SFGLD  CLE  +PMSEFA +F  A
Sbjct  153   RKLLPLLSSVADRRDGVVDLQDVFRRFAFDTICKISFGLDRSCLERSMPMSEFAAAFDAA  212

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             SKL A R M+ + ++WK+KR  N+GSE++LR++I  +NMLA ++IRQRR+LG +  +  D
Sbjct  213   SKLLARRGMATASMLWKLKRLFNVGSERKLRRAIRKINMLAEDIIRQRRRLGFTSGH--D  270

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFM  + DD+ +LRDIVISFLLAGRD VAS LTSFF L++ +P  A A+  E   V+
Sbjct  271   LLSRFMCLVDDDDKFLRDIVISFLLAGRDAVASGLTSFFLLLSQNPYTAAAMRDEIAGVI  330

Query  964   GK-NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
                N+D +  EQ ++E++Y+ A + ESLRLFPP+QFDSKFC+EDDVLPDGT V + TRVT
Sbjct  331   KDGNEDTVNYEQ-LKEMHYVHAVLYESLRLFPPVQFDSKFCLEDDVLPDGTFVSKNTRVT  389

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YHPYAMGRME IWG DC EFKPERWLR GVF   N F YPVFQAG RVCLGKE+AL E+K
Sbjct  390   YHPYAMGRMESIWGPDCREFKPERWLRGGVFTPANLFNYPVFQAGQRVCLGKELALEEMK  449

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +V +SV+ +F V + Q     +F  GLTAT   G+   V +R
Sbjct  450   AVVVSVVSKFDVEVLQGAQPLKFDVGLTATINGGVSARVSRR  491



>ref|XP_002458797.1| hypothetical protein SORBIDRAFT_03g040440 [Sorghum bicolor]
 gb|EES03917.1| hypothetical protein SORBIDRAFT_03g040440 [Sorghum bicolor]
Length=528

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/462 (58%), Positives = 354/462 (77%), Gaps = 9/462 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW A ++NLCDWY HLLR SP++T+H+HVLRN +TANP  V++ML+
Sbjct  52    WWCACPVCEAYLTASWAADFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANPATVDHMLR  111

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKG  FSAIL DFLG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  112   ARFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAVRVVASEL  171

Query  1501  DRRLLPILAGK------KDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAV  1340
               RL+P+L         ++G V+DLQDVFRRF+FDCIC+ SFGLDP CLE  +P+S F  
Sbjct  172   RSRLIPLLHSASREREGEEGRVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSSFER  231

Query  1339  SFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD  1160
             +F +AS LSA RA     ++WK+KR LN G E+ LR ++ +++ LA EVIRQRRKLG + 
Sbjct  232   AFDMASTLSARRATVPMHIIWKLKRLLNFGDERRLRDAVHLVDTLAAEVIRQRRKLGGAA  291

Query  1159  ENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
                 DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVASALT+FF L+++HP+ A AI  E
Sbjct  292   SGGSDLLSRFMGSINDDK-YLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVAAAIRDE  350

Query  979   ADRVVGKNQDLIASE-QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             A RV G +  L AS   +++ ++Y+ AA+ ES+RLFPP+QFDSKF   DD LPDGTAV +
Sbjct  351   ATRVAGDDVRLTASTFNKLKGMHYVHAALSESMRLFPPVQFDSKFAAGDDTLPDGTAVAK  410

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYH YAMGRME +WG DC EF+PERWL++G F  ENP++YPVFQAG RVC+GKE+A
Sbjct  411   GTRVTYHAYAMGRMESVWGPDCGEFRPERWLQNGRFVPENPYRYPVFQAGARVCIGKELA  470

Query  622   LLELKSVALSVLRRFRVHLA-QPHHTPRFSPGLTATFRDGLP  500
             L+E+K+V ++V+R F +    +    P+F+PGLTATF  GLP
Sbjct  471   LMEMKAVIVAVVRSFDIEATDRSSRRPKFAPGLTATFAGGLP  512



>ref|XP_010521668.1| PREDICTED: cytochrome P450 94C1-like [Tarenaya hassleriana]
Length=493

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/471 (60%), Positives = 365/471 (77%), Gaps = 10/471 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C AY+++SW  +++NLCDWY+HLLR SP+ TI +HVL N +TANP NVE++
Sbjct  22    KLRYCNCEICHAYLTSSWRNEFDNLCDWYSHLLRRSPTSTIKVHVLNNVVTANPANVEHV  81

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+RF+N+PKGK FS ILGD LG+GIFN DGD+WRFQRK++S+ELG  SV ++A ++++ 
Sbjct  82    LKTRFDNYPKGKQFSDILGDLLGRGIFNSDGDAWRFQRKLSSIELGSVSVRAFAHDIVRD  141

Query  1507  EIDRRLLPIL----AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAV  1340
             EI+ RL+P+L      + D   +DLQDVFRRFSFD I + SFGLDP CL   L  SEFAV
Sbjct  142   EIETRLVPLLQHFDDDRGDDLDLDLQDVFRRFSFDTISKLSFGLDPVCLRLPLTTSEFAV  201

Query  1339  SFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD  1160
             +F +AS LSA+RA+S SP+ WKIKRFLNIGSEK+L++SI+V+N LA E+I QRRK G   
Sbjct  202   AFDIASTLSAQRALSPSPIFWKIKRFLNIGSEKKLKQSIDVINRLAGELINQRRKTGLGM  261

Query  1159  ENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
             +N+ DL+SRFM  +GDD+ YLRDIV+SFLLAGRDTVAS LT  FWL+  HP+    IL E
Sbjct  262   DNN-DLISRFMAVVGDDDEYLRDIVVSFLLAGRDTVASGLTGVFWLLNRHPEVKNRILEE  320

Query  979   ADRVVGKNQD-LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
              DRV+G   D + A+  +MRE+NYL A + ES+RL PP+QFDSKF + DDVL DGT V+ 
Sbjct  321   LDRVMGPGLDPVTATFDQMREMNYLHATLYESMRLLPPVQFDSKFALNDDVLADGTFVEI  380

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEM  626
             GTRVTYHPYAM RM  +WG DC EF+PERWL + G F  ENP KYPVFQAG R+C+GK++
Sbjct  381   GTRVTYHPYAMARMGRVWGPDCEEFRPERWLDKTGNFRPENPVKYPVFQAGARICIGKDL  440

Query  625   ALLELKSVALSVLRRF--RVHLAQP-HHTPRFSPGLTATFRDGLPVFVQQR  482
             A++E+KSVA +++RRF  RV +  P   TP+F+PGLTAT   GLPV V+QR
Sbjct  441   AIMEMKSVAAAIIRRFEIRVVVTDPISRTPKFAPGLTATMSGGLPVRVRQR  491



>ref|NP_180337.1| cytochrome P450, family 94, subfamily C, polypeptide 1 [Arabidopsis 
thaliana]
 sp|Q9ZUX1.1|C94C1_ARATH RecName: Full=Cytochrome P450 94C1 [Arabidopsis thaliana]
 gb|AAK43912.1|AF370593_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAL58931.1|AF462844_1 At2g27690/F15K20.21 [Arabidopsis thaliana]
 gb|AAC73031.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|ABA61324.1| cytochrome P450 CYP94C1 [Arabidopsis thaliana]
 gb|ABH04493.1| At2g27690 [Arabidopsis thaliana]
 gb|AEC08026.1| cytochrome P450, family 94, subfamily C, polypeptide 1 [Arabidopsis 
thaliana]
Length=495

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/469 (60%), Positives = 352/469 (75%), Gaps = 9/469 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C AY+++SW   + NL DWYTHLLR SP+ TI +HVL + ITANP NVE++
Sbjct  28    KLRYCNCEICHAYLTSSWKKDFINLSDWYTHLLRRSPTSTIKVHVLNSVITANPSNVEHI  87

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+ F N+PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A E+++T
Sbjct  88    LKTNFHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKT  147

Query  1507  EIDRRLLPILAGKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RLLPIL    D  G V+DLQDVFRRFSFD I + SFG DP CL    P+SEFAV+F
Sbjct  148   EIETRLLPILTSFSDNPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPISEFAVAF  207

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA++  P++WK KR L IGSEK+L++SI V+N LA ++I+QRR  G   +N
Sbjct  208   DTASLLSAKRALAPFPLLWKTKRLLRIGSEKKLQESINVINRLAGDLIKQRRLTGLMGKN  267

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
               DL+SRFM  +  DD+ YLRDIV+SFLLAGRDTVA+ LT FFWL+  HP+    I  E 
Sbjct  268   --DLISRFMAVVAEDDDEYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPEVENRIREEL  325

Query  976   DRVVGKNQDLIASE-QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DRV+G   D + +    MRE++YL A++ ES+RLFPP+QFDSKF + DDVL DGT V  G
Sbjct  326   DRVMGTGFDSVTARCDEMREMDYLHASLYESMRLFPPVQFDSKFALNDDVLSDGTFVNSG  385

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYH YAMGRM+ IWG D  EFKPERWL  +G F  ENP KYPVFQAG RVC+GKEMA
Sbjct  386   TRVTYHAYAMGRMDRIWGPDYEEFKPERWLDNEGKFRPENPVKYPVFQAGARVCIGKEMA  445

Query  622   LLELKSVALSVLRRFRVHLAQPHHTP--RFSPGLTATFRDGLPVFVQQR  482
             ++E+KS+A++++RRF   +A P  T   RF+PGLTAT   GLPV +Q+R
Sbjct  446   IMEMKSIAVAIIRRFETRVASPETTETLRFAPGLTATVNGGLPVMIQER  494



>ref|XP_010510742.1| PREDICTED: cytochrome P450 94C1-like [Camelina sativa]
Length=495

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/469 (59%), Positives = 349/469 (74%), Gaps = 9/469 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C AY+++SW   + NL DWYTHLLR SP+ TI +HVL + +TANP NVE++
Sbjct  28    KLRYCNCEICHAYLTSSWRKDFVNLSDWYTHLLRRSPTSTIKVHVLNSVVTANPSNVEHI  87

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+ F N+PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A E+++ 
Sbjct  88    LKTHFHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVRN  147

Query  1507  EIDRRLLPILAGKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RL+PIL    D  G V+DLQDVFRRFSFD I + SFG DP CL   LP SEFAV+F
Sbjct  148   EIETRLVPILTSFSDSLGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPLPTSEFAVAF  207

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA++  P++WK+KRF  IGSEK+L++SI+V+N LA ++I+QRR  G    N
Sbjct  208   DTASTLSAKRALAPFPLLWKLKRFFRIGSEKKLKESIDVINRLAGDLIKQRRLTGLVGNN  267

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
               DL+SRFM  +  DD+ YLRDIV+SFLLAGRDTVAS LT FFWL+  HP     I  E 
Sbjct  268   --DLISRFMAVVAEDDDEYLRDIVVSFLLAGRDTVASGLTGFFWLLTRHPKVENRIREEL  325

Query  976   DRVVGKN-QDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DRV+G     + A    MR++NYL A + ES+RL+PP+QFDSKF + DDVL DGT VKRG
Sbjct  326   DRVMGTGFGSVTAGYDEMRDMNYLHATLYESMRLYPPVQFDSKFALNDDVLSDGTFVKRG  385

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYH YAMGRM  IWG D  EFKPERWL + G F  ENP KYPVFQAG RVC+GKEMA
Sbjct  386   TRVTYHAYAMGRMGRIWGPDYEEFKPERWLDNQGKFRPENPVKYPVFQAGARVCVGKEMA  445

Query  622   LLELKSVALSVLRRFRVHLAQPHHTP--RFSPGLTATFRDGLPVFVQQR  482
             ++E+KS+A++++RRF   +A P  T   RF+PGLTA    GLPV +Q+R
Sbjct  446   IMEMKSIAVAIIRRFETRVAGPESTDMLRFAPGLTAMVNGGLPVMIQER  494



>ref|XP_009103613.1| PREDICTED: cytochrome P450 94C1 [Brassica rapa]
Length=497

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/468 (59%), Positives = 352/468 (75%), Gaps = 7/468 (1%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YCSC++C AY+++SW   + NL DWY HLLR SP+ TI +HVL + +TANP NVE+M
Sbjct  24    KLRYCSCEICHAYLTSSWRNDFVNLGDWYAHLLRRSPTSTIKVHVLNSVVTANPSNVEHM  83

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+RF N+PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A E+++T
Sbjct  84    LKTRFHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKT  143

Query  1507  EIDRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RL+P+L     + G V+DLQDVFRRFSFD I + SFG DP CL    P SEFAV+F
Sbjct  144   EIETRLIPVLNSFSTEPGSVLDLQDVFRRFSFDTISKLSFGFDPNCLRFPFPTSEFAVAF  203

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA++  P++WK+KR   IGSEKEL++SI V+N LA ++I+QRR  G +++N
Sbjct  204   DTASTLSAKRALAPFPLLWKVKRMFKIGSEKELKESINVINRLAGDLIKQRRLTGLTNKN  263

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             + DL+SRFM  +  DD+ YLRDIV+SFLLAGRDTVA+ LT FFWL+  HP     I  E 
Sbjct  264   N-DLISRFMAVVAEDDDKYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKMENRIREEL  322

Query  976   DRVVGKNQD-LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DRV+G   D   AS   MRE++YL AA+ ES+RL+PP+QFDSKF + DDVL DGT V  G
Sbjct  323   DRVMGPGFDSFTASCGEMREMHYLHAALYESMRLYPPVQFDSKFALNDDVLADGTRVTGG  382

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYHPYAMGRM  IWG D  EFKPERWL ++G F  ENP KYP+FQAG RVC+GKEMA
Sbjct  383   TRVTYHPYAMGRMSRIWGPDYEEFKPERWLDKEGKFRSENPVKYPIFQAGARVCVGKEMA  442

Query  622   LLELKSVALSVLRRFRVHL-AQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             ++E+KS+A++++++F   +      T RF+PGLTAT   GLPV +Q+R
Sbjct  443   IMEMKSIAVAMIKKFETRVKGGSTETLRFAPGLTATVNGGLPVLIQER  490



>ref|XP_006409751.1| hypothetical protein EUTSA_v10016556mg [Eutrema salsugineum]
 gb|ESQ51204.1| hypothetical protein EUTSA_v10016556mg [Eutrema salsugineum]
Length=497

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/468 (59%), Positives = 355/468 (76%), Gaps = 8/468 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C AY+++SW   + NL DWY HLLR SP+ TI +HVL + ITANP NVE++
Sbjct  28    KLRYCNCEICHAYLTSSWRKDFVNLSDWYAHLLRRSPTSTIKVHVLNSVITANPSNVEHI  87

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+RF N+PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A  +++T
Sbjct  88    LKTRFHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHAIVRT  147

Query  1507  EIDRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RL+P+L     + G V+DLQDVFRRFSFD I + SFG DP CL    P SEFAV+F
Sbjct  148   EIETRLIPVLTSFSSEPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPTSEFAVAF  207

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA++ SP++WKIKR L IGSEK+L++SI+V+N LA ++I+ RR  G +++N
Sbjct  208   DTASTLSAKRALAPSPLLWKIKRVLRIGSEKQLKESIDVINRLAGDLIKHRRLTGLTEKN  267

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             + DL+SRFM  +  +D+ YLRDIV+SFLLAGRDTVA+  T FFWL+ +HP     I  E 
Sbjct  268   N-DLISRFMAVVAEEDDEYLRDIVVSFLLAGRDTVAAGSTGFFWLLIHHPKVENRIREEL  326

Query  976   DRVVGKN-QDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DRV+G   + + AS   MR+++YL AA+ ES+RL+PP+QFDSKF + DDVL DGT VKRG
Sbjct  327   DRVMGPGFESVTASCDEMRDMDYLHAALYESMRLYPPVQFDSKFALNDDVLSDGTFVKRG  386

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYHPYAMGRM  IWG D  EFKPERWL + G F  ENP KYPVFQAG RVC+GKEMA
Sbjct  387   TRVTYHPYAMGRMGRIWGPDYQEFKPERWLNNEGKFRPENPVKYPVFQAGARVCVGKEMA  446

Query  622   LLELKSVALSVLRRFRVHLAQPHHTP--RFSPGLTATFRDGLPVFVQQ  485
             ++E+KS+A++++RRF++  A    T   RF PGLTAT   GLPV +Q+
Sbjct  447   IMEMKSIAVAIIRRFKIRAAGLGFTETLRFMPGLTATVNGGLPVLIQE  494



>gb|AFW78139.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/456 (58%), Positives = 352/456 (77%), Gaps = 4/456 (1%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW A+++NLCDWY HLL  +P +T+H+HVL N +TANP  V++ML+
Sbjct  51    WWCACAVCEAYVTASWTAEFDNLCDWYAHLLSRAPGRTVHVHVLGNVLTANPPTVDHMLR  110

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
              RF+N+PKG  FSAIL DFLG+GIFNVDGDSW FQRK+A+ EL   ++  +A  V+ +E+
Sbjct  111   GRFDNYPKGAPFSAILADFLGRGIFNVDGDSWLFQRKLAAAELASPALRCFAAGVVASEL  170

Query  1501  DRRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
               RL+P+L +   D  ++DLQDVFRRF+FDCICR SFGLDP CLE  LPMS FA +F  A
Sbjct  171   RCRLIPLLHSSAGDEKLLDLQDVFRRFAFDCICRISFGLDPGCLELSLPMSAFADAFDTA  230

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             S LSA RA +   V WK+KR LN+G E++LR +I +++ LA EVIRQRRKLGT+  +  D
Sbjct  231   SMLSARRATAPMHVFWKLKRLLNVGEERQLRDAIGLVDTLAAEVIRQRRKLGTA-ASGDD  289

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFMGSI DD+ YLRDIV+SF+LAGRDTVASALT+FF L+++HPD A AI  E  RV 
Sbjct  290   LLSRFMGSI-DDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPDVATAIRDEVSRVT  348

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
             G      A+ +++++++Y+ AA+ E +RLFPP+QFDSKF   DD+LPDGT V RGTRVTY
Sbjct  349   GDGDGHAATSEKLKDMHYVHAALHECMRLFPPVQFDSKFAAGDDMLPDGTFVARGTRVTY  408

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             H YAMGRME +WG DC EF+P RWL DG F  E+P++YPVFQ G+RVC+G+E+A++E+KS
Sbjct  409   HAYAMGRMESVWGPDCAEFRPGRWLHDGRFVPESPYRYPVFQGGVRVCIGRELAIMEMKS  468

Query  604   VALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLP  500
             V +SV++ F +  +++  H P+F+PGLTATF  G+P
Sbjct  469   VIVSVVQSFDIEAVSRSSHRPKFAPGLTATFAGGVP  504



>emb|CDY04506.1| BnaA07g13320D [Brassica napus]
Length=492

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/468 (59%), Positives = 351/468 (75%), Gaps = 7/468 (1%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C AY+++SW   + NL DWY HLLR SP+ TI +HVL + ITANP NVE+M
Sbjct  24    KLRYCNCEICHAYLTSSWRNDFVNLGDWYAHLLRRSPTSTIKVHVLNSVITANPSNVEHM  83

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+RF N+PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A E+++T
Sbjct  84    LKTRFHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKT  143

Query  1507  EIDRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RL+P+L     + G V+DLQDVFRRFSFD I + SFG DP CL    P SEFAV+F
Sbjct  144   EIETRLIPVLNSFSTEPGSVLDLQDVFRRFSFDTISKLSFGFDPNCLRFPFPTSEFAVAF  203

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA++  P++WK+KR   IGSEKEL++SI  +N LA ++I+QRR  G +++N
Sbjct  204   DTASMLSAKRALAPFPLLWKVKRMFKIGSEKELKESINAINRLAGDLIKQRRLTGLTNKN  263

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             + DL+SRFM  +  DD+ YLRDIV+SFLLAGRDTVA+ LT FFWL+  HP     I  E 
Sbjct  264   N-DLISRFMAVVAEDDDKYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKMENRIREEL  322

Query  976   DRVVGKNQD-LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DRV+G   D   AS   MRE++YL AA+ ES+RL+PP+QFDSKF + DDVL DGT V  G
Sbjct  323   DRVMGPGFDSFTASCGEMREMHYLHAALYESMRLYPPVQFDSKFALNDDVLADGTRVTGG  382

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYHPYAMGRM  IWG D  EFKPERWL ++G F  ENP KYP+FQAG RVC+GKEMA
Sbjct  383   TRVTYHPYAMGRMSRIWGPDYEEFKPERWLDKEGKFRSENPVKYPIFQAGARVCVGKEMA  442

Query  622   LLELKSVALSVLRRFRVHL-AQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             ++E+KS+A++++++F   +      T RF+PGLTAT   GLPV +Q+R
Sbjct  443   IMEMKSIAVAMIKKFETRVKGGSTETLRFAPGLTATVNGGLPVIIQER  490



>emb|CDX71432.1| BnaC04g16670D [Brassica napus]
Length=493

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/469 (59%), Positives = 354/469 (75%), Gaps = 8/469 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C AY+++SW   + NL DWY HLLR SP+ TI +HVL++ ITANP NVE++
Sbjct  24    KLRYCNCEICHAYLTSSWRNNFVNLGDWYAHLLRRSPTSTIKVHVLKSVITANPSNVEHI  83

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+RF N+PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A E+++T
Sbjct  84    LKTRFHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKT  143

Query  1507  EIDRRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RL+P+L     + G V+DLQDVFRRFSFD I + SFG DP CL    P SEFAV+F
Sbjct  144   EIETRLIPVLNSFSTEPGSVLDLQDVFRRFSFDTISKLSFGFDPNCLRFPFPTSEFAVAF  203

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA++  P++WK+KR   IGSEKEL++SI V+N LA ++I+QRR  G +++N
Sbjct  204   DTASMLSAKRALAPFPLLWKVKRMFKIGSEKELKESINVINRLAGDLIKQRRLTGLTNKN  263

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             + DL+SRFM  +  DD+ YLRDIV+SFLLAGRDTVA+ LT FFWL+  HP     I  E 
Sbjct  264   N-DLISRFMAVVAEDDDKYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKMENRIREEL  322

Query  976   DRVVGKNQD-LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DRV+G   D   AS   MRE++YL AA+ ES+RL+PP+QFDSKF ++DDVL DGT V  G
Sbjct  323   DRVMGPGFDSFTASCGEMREMHYLHAALYESMRLYPPVQFDSKFALKDDVLADGTRVTGG  382

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYHPYAMGRM  IWG D  EFKPERWL ++G F  E+P KYP+FQAG RVC+GKEMA
Sbjct  383   TRVTYHPYAMGRMIRIWGPDYEEFKPERWLDKEGKFRSESPVKYPIFQAGARVCVGKEMA  442

Query  622   LLELKSVALSVLRRFRVHLAQPHHTP--RFSPGLTATFRDGLPVFVQQR  482
             ++E+KS+A++++R+F   +  P  T   RFSPGLTAT   GLPV ++ R
Sbjct  443   IMEMKSIAVAMIRKFETRVKGPGSTETLRFSPGLTATVNGGLPVIIKVR  491



>ref|XP_002439880.1| hypothetical protein SORBIDRAFT_09g021890 [Sorghum bicolor]
 gb|EES18310.1| hypothetical protein SORBIDRAFT_09g021890 [Sorghum bicolor]
Length=535

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/464 (58%), Positives = 357/464 (77%), Gaps = 12/464 (3%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW A+++NLCDWY HLLR +P +T+H+HVL N +TANP  +++ML+
Sbjct  55    WWCACAVCEAYVTASWAAEFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPPTIDHMLR  114

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
              RF+N+PKG  FSAIL DFLG+GIFNVDGDSW FQRK+A+ EL   ++  +A  V+ +E+
Sbjct  115   GRFDNYPKGAPFSAILADFLGRGIFNVDGDSWLFQRKLAAAELASPALRCFAAGVVASEL  174

Query  1501  DRRLLPIL---AGKKDGG---VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAV  1340
               RL+P+L   AG  D     ++DLQDVFRRF+FDCICR SFGLDP CLE  LPMS FA 
Sbjct  175   RCRLIPLLYSAAGDGDSSGDRLLDLQDVFRRFAFDCICRISFGLDPGCLELSLPMSAFAD  234

Query  1339  SFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD  1160
             +F  AS LSA RA +   V+WK+KR LN+G E+ELR +I +++ LA EVIRQRRKLGT+ 
Sbjct  235   AFDTASMLSARRATAPMHVLWKLKRLLNVGEERELRDAIRLVDTLAAEVIRQRRKLGTA-  293

Query  1159  ENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
              +  DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVASALT+FF L+++HPD A AI  E
Sbjct  294   ASGDDLLSRFMGSINDDK-YLRDIVVSFMLAGRDTVASALTAFFLLLSDHPDVATAIRDE  352

Query  979   ADRVVG---KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
               RV G   ++    AS +++++++Y+ AA+ E +RLFPP+QFDSKF   DD+LPDGT V
Sbjct  353   VSRVAGDDDRDGHAAASSEKLKDMHYVHAALHECMRLFPPVQFDSKFAAGDDMLPDGTFV  412

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKE  629
              RGTRVTYH YAMGRME +WG DC EF+P+RWL DG F  E+P++YPVFQ G+RVC+G+E
Sbjct  413   ARGTRVTYHAYAMGRMESVWGPDCAEFRPDRWLHDGRFVPESPYRYPVFQGGVRVCIGRE  472

Query  628   MALLELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLP  500
             +A++E+KSV +SV++ F +  + +  H P+F+PGLTATF  G+P
Sbjct  473   LAIMEMKSVIVSVVQSFDIEAVGRSSHRPKFAPGLTATFAGGVP  516



>ref|XP_010557399.1| PREDICTED: cytochrome P450 94C1-like [Tarenaya hassleriana]
Length=492

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/468 (58%), Positives = 357/468 (76%), Gaps = 7/468 (1%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
              L +C+C++C AY+++SW   ++NLCDWY+HLLR SP+ TI +HVL N ITANP+NVE++
Sbjct  24    NLRHCNCEICHAYITSSWRNDFDNLCDWYSHLLRRSPTLTIQVHVLNNVITANPDNVEHV  83

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+RF+N+PKGK FS ILGD LG+GIFN DGD+WRFQRK++S+ELG  SV  +A ++I+ 
Sbjct  84    LKTRFDNYPKGKQFSDILGDLLGRGIFNSDGDTWRFQRKLSSLELGSVSVRIFAHDIIKN  143

Query  1507  EIDRRLLPILAGKKDGGV-VDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
             EI+ RL+P+L    D G+ +DLQD FRRFSFD I + SFG DP CL   L  SE   +F 
Sbjct  144   EIEMRLVPLLNSFGDHGLDLDLQDAFRRFSFDTISKLSFGFDPVCLRLPLTSSELVDAFD  203

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
             +AS LSA RA++ SP+ WKIKRFLNIGSEK+L++SI+V+N L  ++I+QRRK G S  N+
Sbjct  204   MASTLSAHRALAPSPLFWKIKRFLNIGSEKKLKQSIDVINRLVGDLIKQRRKKG-SGMNN  262

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DL+SRFM  +GDD+ YLRDIV++FLLAGRDTVA+ LT FFWL+  HP+    I  E +R
Sbjct  263   NDLISRFMAVVGDDDEYLRDIVVNFLLAGRDTVAAGLTGFFWLLNRHPEVENRIREELER  322

Query  970   VVGKNQD-LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             V+G   D + AS  +M+E+NYL + V ES+RL PP+QFDSKF + +D+L DGT V+ G R
Sbjct  323   VMGPGLDPVTASFNQMQEMNYLHSTVYESMRLLPPVQFDSKFALNNDILADGTFVESGAR  382

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             VTYHPYAMGRM+ +WG DC EF+PERWL   G F  ENP KYPVFQAG RVC+GK+MA++
Sbjct  383   VTYHPYAMGRMDRVWGPDCEEFRPERWLDSAGKFRPENPVKYPVFQAGPRVCVGKDMAIM  442

Query  616   ELKSVALSVLRRFRVHLAQPH---HTPRFSPGLTATFRDGLPVFVQQR  482
             E+KSVA++++RRF + +   +     PRF+PGLTAT   GLP+ V++R
Sbjct  443   EMKSVAVTIIRRFEIRVVGSNPISRAPRFAPGLTATVSGGLPIRVRER  490



>ref|XP_004487513.1| PREDICTED: cytochrome P450 94A1-like [Cicer arietinum]
Length=498

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/460 (60%), Positives = 357/460 (78%), Gaps = 6/460 (1%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC++C +Y++ SW  ++ N+ DWYTHLL+ SP+ TIHIHVL NTIT NP+N+E++LK+
Sbjct  44    WCSCNICWSYLTMSWANEFINISDWYTHLLKKSPTGTIHIHVLNNTITCNPKNIEHILKT  103

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FSAILGD LG GIFNVDG SW FQRK+AS+EL   +V S+A ++I  EI 
Sbjct  104   RFDNYPKGKPFSAILGDLLGNGIFNVDGVSWNFQRKMASLELTSVTVRSHALQIITEEIH  163

Query  1498  RRLLP-ILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P +++  +   V+DLQD+ RRFSFD IC+FSFG DP CL+  LP+SE A +F +AS
Sbjct  164   TRLIPFMISSARAEKVIDLQDIMRRFSFDNICKFSFGWDPLCLQPNLPVSELAENFDIAS  223

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             KLSA RAMS  P+ WKIKRFLN+GSEK+L+++I V+N L  ++I + R++G S  N  DL
Sbjct  224   KLSAMRAMSVLPLTWKIKRFLNVGSEKKLKEAILVVNNLTEKIINKCREIGFSTRN--DL  281

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFM S+ DD+ YLRDIVISFLLAGRDTVA+ LT  FWL+  +    + IL E +RV+ 
Sbjct  282   LSRFMCSVNDDK-YLRDIVISFLLAGRDTVAAGLTCLFWLLKRNQRVEKIILEEVNRVMN  340

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
               Q+    EQ +RE+NYL A V E++RL+PP+QFDSKF  EDDVLPDG+ VK+G+RVTYH
Sbjct  341   PVQEYPNFEQ-IREMNYLNAVVYETMRLYPPVQFDSKFAKEDDVLPDGSYVKKGSRVTYH  399

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             PYAMGRME +WGSDC EFKPERWL+DGVF  E+ FKYPVFQ G+RVCLGKE+AL+E+K V
Sbjct  400   PYAMGRMERVWGSDCCEFKPERWLKDGVFVNESVFKYPVFQGGVRVCLGKELALMEMKCV  459

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              ++++RRF V + + +   +F PGLT T RDGLPV V ++
Sbjct  460   IVALVRRFEVRV-EGNGEIQFVPGLTTTLRDGLPVRVFEK  498



>ref|XP_009388367.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=502

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/465 (59%), Positives = 360/465 (77%), Gaps = 5/465 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R + ++C+C VC AY+++SW A+++NLCDWY HLLR SP++TI +HVL  T+TANP+NVE
Sbjct  32    RTRPWWCNCAVCKAYVTSSWSAEFDNLCDWYAHLLRESPTRTITVHVLGCTVTANPDNVE  91

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             +MLK+RFEN+PKGK F++ILGD LG+GIFNVDG+ WRFQRK+AS ELG ++V  +A +++
Sbjct  92    HMLKTRFENYPKGKPFASILGDLLGRGIFNVDGEHWRFQRKMASAELGSAAVRVFASQIV  151

Query  1513  QTEIDRRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
               E+  RLLP+L    K+  V+DLQDVFRR +FD IC+ SFGLDP CL+  LPMSEFA +
Sbjct  152   AEEVGFRLLPLLDMACKNDAVLDLQDVFRRLAFDSICKISFGLDPGCLQLSLPMSEFAAA  211

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  A++L A RA    P +WK+KR  N GSE ++R++IE++++LA EV+ QRRK G + +
Sbjct  212   FDKATRLLAGRATHTIPAIWKVKRLFNRGSEGQIREAIELVDLLAKEVVHQRRKYGFASD  271

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
               +DLLSRFM  I D++ YLRDIVISF+LAGRDTVASALTSFF L++ +P    AI  E 
Sbjct  272   --QDLLSRFMRCI-DNDRYLRDIVISFVLAGRDTVASALTSFFMLLSRYPAVCSAIRDEV  328

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             + +VG N   +AS  ++REL+YL AA+ ES+RL+PP+QFDSKFC++DDVLPDGT V++GT
Sbjct  329   EDIVG-NAPALASYDQLRELHYLHAALYESMRLYPPVQFDSKFCLDDDVLPDGTFVRKGT  387

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             R+TYH YAMGRME +WGSD  EF+PERW+R G F  E+PFKYPVF  GLRVCLGKEMAL+
Sbjct  388   RMTYHAYAMGRMEELWGSDYAEFRPERWIRHGQFVPESPFKYPVFHGGLRVCLGKEMALM  447

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+KSV   V+R F V +   +  P+F+PGLTAT   GL V  ++R
Sbjct  448   EMKSVVALVIRDFDVDVLGGNRPPKFAPGLTATLSGGLAVRARRR  492



>ref|XP_010473161.1| PREDICTED: cytochrome P450 94C1 [Camelina sativa]
Length=498

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/469 (59%), Positives = 349/469 (74%), Gaps = 9/469 (2%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C  Y+++SW   + NL DWYTHLLR S + TI +HVL + +TANP NVE++
Sbjct  28    KLRYCNCEICHGYLTSSWRKDFVNLSDWYTHLLRRSRTSTIKVHVLNSVVTANPSNVEHI  87

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+ F N+PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A E+++T
Sbjct  88    LKTHFHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVRT  147

Query  1507  EIDRRLLPILAGKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RL+PIL    D  G V+DLQDVFRRFSFD I + SFG DP CL   LP SEFAV+F
Sbjct  148   EIETRLVPILTSFSDSPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPLPTSEFAVAF  207

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA++  P++WK+KRF  IGSEK+LR+SI+V+N LA ++I+QRR  G    N
Sbjct  208   DTASTLSAKRALAPFPLLWKLKRFFRIGSEKKLRESIDVINRLAGDLIKQRRLTGLVGNN  267

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
               DL+SRFM  +  DD+ YLRDIV+SFLLAGRDTVA+ LT FFWL+  HP     I  E 
Sbjct  268   --DLISRFMAVVAEDDDEYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKVENRIREEL  325

Query  976   DRVVGKN-QDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DR++G   + + A    MR++NYL A + ES+RL+PP+QFDSKF + DDVL DGT VKRG
Sbjct  326   DRIMGTGFESVTAGCDEMRDMNYLHATLYESMRLYPPVQFDSKFALNDDVLSDGTFVKRG  385

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYH YAMGRM  IWG D  EFKPERWL + G F  ENP KYPVFQAG RVC+GKEMA
Sbjct  386   TRVTYHAYAMGRMGRIWGPDYEEFKPERWLDNQGKFRPENPVKYPVFQAGARVCVGKEMA  445

Query  622   LLELKSVALSVLRRFRVHLAQPHHTP--RFSPGLTATFRDGLPVFVQQR  482
             ++E+KS+A++++RRF   +A    T   RF+PGLTAT   GLPV +Q+R
Sbjct  446   IMEMKSIAVAIIRRFETRVAGSESTEMLRFAPGLTATVNGGLPVLIQER  494



>gb|EAY76557.1| hypothetical protein OsI_04502 [Oryza sativa Indica Group]
Length=524

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/459 (57%), Positives = 357/459 (78%), Gaps = 7/459 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C C VC AY++ SW  +++NLCDWY HLLR SP++T+H+HVLRN +TANP  V+++L+
Sbjct  51    WWCDCTVCEAYLTASWAGEFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANPVTVDHVLR  110

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKG  FSAIL DFLG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  111   ARFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAARVVASEL  170

Query  1501  DRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RL+P+L   + + +G V+DLQD+FRRF+FD IC+ SFGLDP CLE  +P+S    +F 
Sbjct  171   RCRLIPLLHSASREGNGKVLDLQDMFRRFAFDSICKISFGLDPGCLELSMPVSTLVEAFD  230

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
              AS LSA RA     ++W++KRFLN+G E++LR ++ +++ LA EVIRQRRKLG +    
Sbjct  231   TASTLSARRATVPMQIIWRLKRFLNVGDERKLRDAVRLVDALAAEVIRQRRKLGGA-ATG  289

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFMGSI DD+ YLRDIV+SF+LAGRDT+ASALT+FF L+++HP+ A AI  E  R
Sbjct  290   SDLLSRFMGSI-DDDKYLRDIVVSFMLAGRDTIASALTAFFLLLSDHPEVATAIRDEVAR  348

Query  970   VVGK-NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             V G  N+ + A+  ++++++Y+ AA+ ES+RLFPP+QFDSKF   DD LPDGT V +GTR
Sbjct  349   VTGDGNRTMAATFDKLKDMHYVHAAMYESMRLFPPVQFDSKFAAGDDTLPDGTVVAKGTR  408

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYH YAMGRME +WG DC EF+PERWLRDG F  E+P++YPVFQAG+RVC+GKE+AL+E
Sbjct  409   VTYHAYAMGRMESVWGPDCAEFRPERWLRDGRFVPESPYRYPVFQAGVRVCIGKELALME  468

Query  613   LKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLP  500
             +K+V ++V+R F +  +A+    P+F+PGLTATF  GLP
Sbjct  469   MKAVIVAVVRSFDIEAIARSSRRPKFAPGLTATFAGGLP  507



>dbj|BAK08034.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/469 (57%), Positives = 361/469 (77%), Gaps = 7/469 (1%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW  +++NLCDWY HLLR SPS+T+H+HVLRN +TANP  V++ML+
Sbjct  42    WWCNCAVCEAYLTASWAGEFDNLCDWYAHLLRRSPSQTVHVHVLRNVLTANPVTVDHMLR  101

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKGK FSAIL D LG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  102   ARFDNYPKGKPFSAILADLLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAAGVVASEL  161

Query  1501  DRRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
               RLLP+L +      V+DLQDVFRRF+FDCIC+ SFGLDP CLE  +P+S F  +F  A
Sbjct  162   RGRLLPLLHSACSSSKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSAFVDAFDTA  221

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
             S LSA RA +   ++W++KRF N+G E++LR+S+ +++  A EV RQR KLG +  +  D
Sbjct  222   SMLSARRATAPMQIIWRLKRFFNVGDERKLRESVRLVDGFAAEVTRQRHKLGGA-ASGSD  280

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LLSRFMGSI  DE YLRDIV+SF+LAGRDTVASALT+FF L+++HP+ A AI  E  RV 
Sbjct  281   LLSRFMGSIS-DEKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVAAAIRDEVSRVT  339

Query  964   GKNQDLI-ASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
             G + D    S  ++++++Y+ AA+ ES+RLFPP+QFDSKF   DD LPDGT V +GTRVT
Sbjct  340   GDDDDRPRPSFSKLKDMHYVHAAMYESMRLFPPVQFDSKFAAGDDKLPDGTVVAKGTRVT  399

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELK  608
             YH YAMGRME +WG+DC EF+PERWLRDG F   +P++YPVFQAG+RVC+GK++AL+E++
Sbjct  400   YHAYAMGRMESVWGADCSEFRPERWLRDGQFVPVSPYRYPVFQAGVRVCVGKDLALMEME  459

Query  607   SVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLPVFVQQ--R*CPP  470
             +V ++V+R F +  + +  H P+F+PGLTATF  GLPV V++  R CPP
Sbjct  460   AVIVAVVRSFDIEAIDRSSHRPKFAPGLTATFAGGLPVRVRRRARGCPP  508



>ref|XP_003596778.1| Cytochrome P450 [Medicago truncatula]
 gb|AES67029.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=498

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/465 (58%), Positives = 354/465 (76%), Gaps = 6/465 (1%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVE  1694
             R+KL +C+C +C +Y++ +W  ++ NL DWYTHLL+ SP+ TIHIHVL NTIT NP+N+E
Sbjct  39    RMKL-WCNCHICWSYITMNWAKEFINLSDWYTHLLKKSPTGTIHIHVLNNTITCNPQNIE  97

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             +MLK+RF+N+PKGK FS ILGD LG GIFNVDG SW FQRK+AS+EL   +V SYA E+I
Sbjct  98    HMLKTRFDNYPKGKPFSTILGDLLGNGIFNVDGVSWNFQRKMASLELTSVTVRSYALEII  157

Query  1513  QTEIDRRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
               EI  RL+P L +  +D  V DLQD+ RRFSFD IC+FSFG DP+CL+  LP+S+ A +
Sbjct  158   NEEIHTRLVPFLFSFSRDEKVFDLQDIMRRFSFDNICKFSFGWDPQCLQLSLPVSDLAAA  217

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  ASK+SA RA+S SP++WKIKRF NIGSEK+L+++I V+N L  ++I+ R+++G S  
Sbjct  218   FDTASKISARRALSPSPLIWKIKRFFNIGSEKKLKEAINVVNKLTEKIIKNRKEIGFSAR  277

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             N  DLLSRFM S+ ++E YLRDIV SFLLAGRDTVA+ LT  FWL++ + +  E I  E 
Sbjct  278   N--DLLSRFMCSV-NEEKYLRDIVASFLLAGRDTVAAGLTCLFWLLSKNQEVEEKIQEEV  334

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             +RV+    +  AS + +RE++YL A V E+LRLFPP+QFDSKF   DDVLPDG+ V +G+
Sbjct  335   NRVMNPAHEY-ASFKEIREMHYLNAVVYETLRLFPPVQFDSKFAKNDDVLPDGSYVTKGS  393

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYHPYAMGRME +WGSDC  FKPERWL+DGVF  E+ FKYPVFQ G RVCLGKE+AL+
Sbjct  394   RVTYHPYAMGRMERVWGSDCRVFKPERWLKDGVFVSESMFKYPVFQGGARVCLGKELALM  453

Query  616   ELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K V + ++RRF + +   +   +F PGLTA+ +DGL V V Q+
Sbjct  454   EMKCVVVGLIRRFEIRVDGDNQELKFGPGLTASLKDGLMVRVFQK  498



>ref|NP_001172660.1| Os01g0858350 [Oryza sativa Japonica Group]
 dbj|BAB63711.1| putative cytochrome P450-dependent fatty acid hydroxylase [Oryza 
sativa Japonica Group]
 gb|EAZ14211.1| hypothetical protein OsJ_04135 [Oryza sativa Japonica Group]
 dbj|BAG87747.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91390.1| Os01g0858350 [Oryza sativa Japonica Group]
Length=524

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/459 (56%), Positives = 357/459 (78%), Gaps = 7/459 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C C VC A+++ SW  +++NLCDWY HLLR SP++T+H+HVLRN +TANP  V+++L+
Sbjct  51    WWCDCTVCEAFLTASWAGEFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANPVTVDHVLR  110

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKG  FSAIL DFLG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  111   ARFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAARVVASEL  170

Query  1501  DRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RL+P+L   + + +G V+DLQD+FRRF+FD IC+ SFGLDP CLE  +P+S    +F 
Sbjct  171   RCRLIPLLHSASREGNGKVLDLQDMFRRFAFDSICKISFGLDPGCLELSMPVSTLVEAFD  230

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
              AS LSA RA     ++W++KRFLN+G E++LR ++ +++ LA EVIRQRRKLG +    
Sbjct  231   TASTLSARRATVPMQIIWRLKRFLNVGDERKLRDAVRLVDALAAEVIRQRRKLGGA-ATG  289

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFMGSI DD+ YLRDIV+SF+LAGRDT+ASALT+FF L+++HP+ A AI  E  R
Sbjct  290   SDLLSRFMGSI-DDDKYLRDIVVSFMLAGRDTIASALTAFFLLLSDHPEVATAIRDEVAR  348

Query  970   VVGK-NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             V G  N+ + A+  ++++++Y+ AA+ ES+RLFPP+QFDSKF   DD LPDGT V +GTR
Sbjct  349   VTGDGNRTMAATFDKLKDMHYVHAAMYESMRLFPPVQFDSKFAAGDDTLPDGTVVAKGTR  408

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYH YAMGRME +WG DC EF+PERWLRDG F  E+P++YPVFQAG+RVC+GKE+AL+E
Sbjct  409   VTYHAYAMGRMESVWGPDCAEFRPERWLRDGRFVPESPYRYPVFQAGVRVCIGKELALME  468

Query  613   LKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLP  500
             +K+V ++V+R F +  +A+    P+F+PGLTATF  GLP
Sbjct  469   MKAVIVAVVRSFDIEAIARSSRRPKFAPGLTATFAGGLP  507



>ref|XP_006645049.1| PREDICTED: cytochrome P450 94A1-like [Oryza brachyantha]
Length=523

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/459 (57%), Positives = 359/459 (78%), Gaps = 7/459 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C C VC AY++ SW  +++NLCDWY HLLR+SP++T+H+HVLRN +TANP  V+++L+
Sbjct  50    WWCDCAVCEAYLTGSWAGEFDNLCDWYAHLLRSSPAQTVHLHVLRNVLTANPVTVDHVLR  109

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKG  FSAIL DFLG+GIFNVDGDSW FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  110   ARFDNYPKGAPFSAILADFLGRGIFNVDGDSWLFQRKLAAAELASPALRAFAARVVSSEL  169

Query  1501  DRRLLPIL---AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RL+P+L   + + +G V+DLQDVFRRF+FDCIC+ SFGLDP CLE  +P+S    +F 
Sbjct  170   RCRLIPLLHSASREGNGKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSTLVEAFD  229

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
              AS LSA RA     ++W++KR LN+G EK+LR ++ +++ LA EVIRQRRKLG +  + 
Sbjct  230   TASNLSARRATVPMQIIWRLKRLLNVGDEKKLRDAVRLVDALAAEVIRQRRKLGGA-ASG  288

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFMGSI DD+ YLRDIV+SF+LAGRDT+ASALT+FF L+++HP+ A AI  E +R
Sbjct  289   SDLLSRFMGSI-DDDKYLRDIVVSFMLAGRDTIASALTAFFLLLSDHPEVAAAIRDEVNR  347

Query  970   VVGK-NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             V G  N+ + A+ +++++++Y+ AA+ ES+RLFPP+QFDSKF   DD L DGT V +GTR
Sbjct  348   VTGDGNRPIAATFEKLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDTLTDGTVVAKGTR  407

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYH YAMGRME +WG DC EF+P+RWLRDG F  E+P++YPVFQAG+RVC+GKE+AL+E
Sbjct  408   VTYHAYAMGRMESVWGPDCAEFRPDRWLRDGRFVPESPYRYPVFQAGVRVCVGKELALME  467

Query  613   LKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLP  500
             +K+V ++V+R F +  +A+    P+F+PGLTA F  GLP
Sbjct  468   MKAVIVAVVRSFDIEAIARSSRRPKFAPGLTAPFAGGLP  506



>ref|XP_004970645.1| PREDICTED: cytochrome P450 94A1-like [Setaria italica]
Length=528

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/461 (57%), Positives = 354/461 (77%), Gaps = 11/461 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW  +++NLCDWY HLLR+SP++T+H+HVLRN +TANP  V++ML+
Sbjct  52    WWCACHVCEAYLTASWAGEFDNLCDWYAHLLRSSPAQTVHVHVLRNVLTANPVTVDHMLR  111

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
              RF+N+PKG  FSAIL DFLG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  112   GRFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAVRVVASEL  171

Query  1501  DRRLLPIL-------AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFA  1343
               RL+P+L        G+  G V+DLQDVFRRF+FDCIC+ SFGLDP CLE  +P+S F 
Sbjct  172   RSRLIPLLHSASRQGKGRGKGKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSSFE  231

Query  1342  VSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTS  1163
              +F +AS LSA RA     ++W++KRF N G E++LR ++ +++ LA EVIRQRRKLG +
Sbjct  232   NAFDVASTLSARRATVPMQIIWRLKRFFNYGDERKLRDAVRLVDRLAEEVIRQRRKLGGA  291

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
               +  DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVASALT+FF L+++HP+ A AI  
Sbjct  292   -ASGSDLLSRFMGSINDDK-YLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVAAAIRD  349

Query  982   EADRVVGKNQDLIASE-QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVK  806
             E  RV G +  L AS   ++++++Y+ AA+ ES+RLFPP+QFDSKF   DD LPDGTAV 
Sbjct  350   EVARVGGDDDRLTASTFSKLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDKLPDGTAVA  409

Query  805   RGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEM  626
             +GTRVTYH YAMGRME +WG DC EF+PERWLR+G F  E+P++YPVFQAG RVC+GKE+
Sbjct  410   KGTRVTYHAYAMGRMESVWGPDCGEFRPERWLRNGRFVPESPYRYPVFQAGARVCIGKEL  469

Query  625   ALLELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDG  506
             AL+E+K+V  +V+R F +  + +    P+F+PGLTATF  G
Sbjct  470   ALVEMKAVIFAVVRSFDIEAIDRSSRRPKFAPGLTATFASG  510



>ref|XP_008657035.1| PREDICTED: cytochrome P450 94C1-like [Zea mays]
 gb|AFW84499.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=549

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/475 (57%), Positives = 358/475 (75%), Gaps = 22/475 (5%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW   ++NLCDWY HLLR SP++T+H+HVLRN +TANP  V++ML+
Sbjct  53    WWCACPVCEAYLTASWAGDFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANPATVDHMLR  112

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKG  FSAIL DFLG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  113   ARFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAVRVVASEL  172

Query  1501  DRRLLPIL------AGKKDGG------VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLP  1358
               RL+P+L      +G++ GG      V+DLQDVFRRF+FDCIC+ SFGLDP CL+  +P
Sbjct  173   RGRLIPLLRSAACASGREGGGGGGGGRVLDLQDVFRRFAFDCICKISFGLDPGCLQLSMP  232

Query  1357  MSEFAVSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRR  1178
             +S F  +F  AS LSA RA +   VVWK+KR LN+G E+ LR ++ +++ LA EVIRQRR
Sbjct  233   VSSFEDAFDTASTLSARRATAPMHVVWKLKRLLNLGDERRLRDAVHLVDALAAEVIRQRR  292

Query  1177  KLGTSDENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAA  998
             KLG +  +  DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVASALT+FF L+++HP+ A
Sbjct  293   KLGGAASSGSDLLSRFMGSI-DDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVA  351

Query  997   EAILAEADRVVGKNQDLIASEQRMRE--------LNYLQAAVCESLRLFPPIQFDSKFCV  842
              AI  EA RV G + D    + R+ +        ++Y+ AA+ ES+RLFPP+QFDSKF  
Sbjct  352   AAIRDEAARVAGDDDDGDGDDGRLTDSAFGKLKGMHYVHAALYESMRLFPPVQFDSKFAA  411

Query  841   EDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVF  662
              DD LPDGTAV +GTRVTYH YAMGRME +WG DC EF+PERWLRDG F  E+P++YPVF
Sbjct  412   GDDTLPDGTAVAKGTRVTYHAYAMGRMESVWGPDCGEFRPERWLRDGRFVPESPYRYPVF  471

Query  661   QAGLRVCLGKEMALLELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLP  500
             QAG RVC+GKE+AL+E+K+V ++V+R F +  + +    PRF+PGLTATF  GLP
Sbjct  472   QAGARVCVGKELALMEMKAVIVAVVRGFDIEAVGRSSRRPRFAPGLTATFAGGLP  526



>ref|XP_010232583.1| PREDICTED: cytochrome P450 94C1 [Brachypodium distachyon]
Length=529

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/468 (56%), Positives = 356/468 (76%), Gaps = 10/468 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C C VC AY++ SW  +++NLCDWY HLLR SP++T+H+HVLRN +TANP  V++ML+
Sbjct  56    WWCDCAVCEAYLTASWSGEFDNLCDWYAHLLRRSPAQTVHVHVLRNVLTANPAAVDHMLR  115

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKG  FSAIL DFLG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  116   ARFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAANVVSSEL  175

Query  1501  DRRLLPIL------AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAV  1340
               RLLP+L      + + +  V+DLQDVFRRF+FDCIC+ SFGLDP CLE  +P+  F  
Sbjct  176   RTRLLPLLHSASSQSHEDNNKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVLAFVD  235

Query  1339  SFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD  1160
             +F  AS LSA RA     ++W++KR  N+G E+ LR ++ +++  A EVIRQR KLG + 
Sbjct  236   AFDTASMLSARRATVPMQIIWRLKRLFNVGDERRLRDAVRLVDAFATEVIRQRHKLGGA-  294

Query  1159  ENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
              +  DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVASALT+FF L+++HP+ A AI  E
Sbjct  295   ASGSDLLSRFMGSISDDK-YLRDIVVSFMLAGRDTVASALTAFFLLLSDHPETAAAIRDE  353

Query  979   ADRVVGKN-QDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
               RV G +  D   S  R+++++Y+ AA+ ES+RLFPP+QFDSKF   DD LPDGTAV +
Sbjct  354   VSRVAGDDYDDDRPSFGRLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDTLPDGTAVAK  413

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYH YAMGRME +WG DC EF+PERWLRDG F   +P++YPVFQAG+RVC+GK++A
Sbjct  414   GTRVTYHAYAMGRMESVWGRDCGEFRPERWLRDGQFVPVSPYRYPVFQAGVRVCVGKDLA  473

Query  622   LLELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L+E+K+V ++V+R F +  +A+    P+F+PGLTATF  GLPV V++R
Sbjct  474   LMEMKAVIVAVVRGFDIEAIARSSRRPKFAPGLTATFAGGLPVRVRRR  521



>ref|XP_004961922.1| PREDICTED: cytochrome P450 94A2-like [Setaria italica]
Length=524

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/458 (59%), Positives = 348/458 (76%), Gaps = 8/458 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW  +++NLCDWY HLLR +P +T+H+HVL N +TANP  V++ML+
Sbjct  51    WWCACAVCEAYVTASWAGEFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPPTVDHMLR  110

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
              RF+N+PKG  FSAIL DFLG GIFNVDGDSW FQRK+A+ EL   ++  YA  V+ +E+
Sbjct  111   GRFDNYPKGAPFSAILADFLGCGIFNVDGDSWLFQRKLAAAELAAPALRGYATGVVASEL  170

Query  1501  DRRLLPILAGKKDGG--VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHL  1328
               RL+P+L     GG  ++DLQDVFRRF+FDCICR SFGLDP CLE  LPMS FA +F  
Sbjct  171   RCRLIPLLHSASSGGEKLLDLQDVFRRFAFDCICRISFGLDPGCLELSLPMSAFADAFDT  230

Query  1327  ASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK  1148
             AS LSA RA +   V WK+KR LN+G E+ELR +I +++ LA EVIRQRRKLGT+  +  
Sbjct  231   ASMLSARRATAPMHVFWKLKRLLNVGEERELRDAIRLVDTLAAEVIRQRRKLGTA-ASGD  289

Query  1147  DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVAS LT+FF L+++HPD A AI  E   V
Sbjct  290   DLLSRFMGSINDDK-YLRDIVVSFMLAGRDTVASGLTAFFLLLSDHPDVATAIRDEVSGV  348

Query  967   VGKNQD---LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
              G   D     A+ +++++++Y+ AA+ E +RLFPP+QFDSKF   DD LPDGT V RGT
Sbjct  349   AGGRGDDPAAAATSEKLKDMHYVHAALYECMRLFPPVQFDSKFAAGDDTLPDGTFVARGT  408

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME +WG DC EF+PERWLRDG F  E+P++YPVFQ G+RVC+GKE+A++
Sbjct  409   RVTYHAYAMGRMESVWGPDCAEFRPERWLRDGRFVPESPYRYPVFQGGVRVCVGKELAIM  468

Query  616   ELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDG  506
             E+KSV +SV++ F +  + +  H P+F+PGLTATF  G
Sbjct  469   EMKSVIVSVVQSFDIEAVGRSSHRPKFAPGLTATFAGG  506



>emb|CDM80095.1| unnamed protein product [Triticum aestivum]
Length=527

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/459 (57%), Positives = 353/459 (77%), Gaps = 8/459 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C C VC AY++ SW  +++NLCDWY HLLR SPS+T+H+HVLRN +TANP  V++ML+
Sbjct  53    WWCDCAVCEAYLTASWAGEFDNLCDWYAHLLRRSPSQTVHVHVLRNVLTANPVTVDHMLR  112

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKGK FSAIL D LG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  113   ARFDNYPKGKPFSAILADLLGRGIFNVDGDAWLFQRKLAAAELASPALRAFASGVVASEL  172

Query  1501  DRRLLPIL----AGKKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
               RL+P+L    +   DGG V+DLQDVFRRF+FDCIC+ SFGLDP CLE  +P+S F  +
Sbjct  173   RGRLVPLLDSACSHDDDGGKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSAFVDA  232

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  AS LSA RA +   ++W++KRF N+G E++LR+S+ +++  A EV RQR KLG +  
Sbjct  233   FDTASMLSARRATAPLQIIWRLKRFFNVGDERKLRESVRLVDGFAAEVTRQRHKLGGA-A  291

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             +  DLLSRFMGSI D E YLRDIV+SF+LAGRDTVASALT+FF L+++HP+ A AI  E 
Sbjct  292   SGSDLLSRFMGSISD-EKYLRDIVVSFVLAGRDTVASALTAFFLLLSDHPEVAAAIRDEV  350

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
              RV G + +   S  ++++++Y+ AA+ ES+RLFPP+QFDSKF   DD LPDGTAV +GT
Sbjct  351   SRVAGDDDNDRPSFSKLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDTLPDGTAVAKGT  410

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME +WG DC EF+PERWLRDG F   +P++YPVFQAG+RVC+GK++AL+
Sbjct  411   RVTYHAYAMGRMESVWGPDCSEFRPERWLRDGQFVPVSPYRYPVFQAGVRVCVGKDLALM  470

Query  616   ELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGL  503
             E+K+V ++V+R F +  + +    P+F+PGLTATF  GL
Sbjct  471   EMKAVIVAVVRSFDIEAIGRSSRRPKFAPGLTATFAGGL  509



>ref|XP_006851517.1| hypothetical protein AMTR_s00040p00166370 [Amborella trichopoda]
 gb|ERN13098.1| hypothetical protein AMTR_s00040p00166370 [Amborella trichopoda]
Length=538

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/508 (53%), Positives = 357/508 (70%), Gaps = 53/508 (10%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+C VC  Y++ SW ++++NLCD+YTHLL++S ++TI +HVL N ITANP+NVE++LK+
Sbjct  34    WCNCKVCRTYLTKSWVSQFSNLCDFYTHLLKSSKTQTIKVHVLNNIITANPKNVEHILKT  93

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             +FEN+PKGK F  IL D LG+GIFNVDG+ WRFQRK+AS ELG  +V +   + +  EI+
Sbjct  94    QFENYPKGKPFHTILHDLLGRGIFNVDGELWRFQRKMASYELGSQAVRAMVAKTVLAEIE  153

Query  1498  RRLLPILAGK-KDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL PILA     G  +DLQDV ++F+FD IC+ SFGLDP CLE   P+SEFA +F  AS
Sbjct  154   TRLEPILADSVSKGSKLDLQDVLKKFTFDNICKISFGLDPCCLELTQPISEFAQAFDRAS  213

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
              L A RA+ A  ++WKIK+FLN+GSE+ LR++I +++++A+EVIRQR+ +G+      DL
Sbjct  214   HLCAGRAVVAPSLIWKIKKFLNLGSERSLREAINMVDLMAIEVIRQRKVVGS---EASDL  270

Query  1141  LSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVG  962
             LSRFM ++ DD+ +LRDI++SFLLAGRDTVASALTSFFWL+A HP+  E +  E  RV+G
Sbjct  271   LSRFMTTVSDDK-FLRDIIVSFLLAGRDTVASALTSFFWLMAKHPEVEEKVHDEIVRVMG  329

Query  961   KN------------------------------------------------QDLIASEQRM  926
             K                                                 +++IAS  ++
Sbjct  330   KGVEREREEGGAREGESGVERGERVSEELRERGKWGRDKEEREGEDFRERKEVIASYGKL  389

Query  925   RELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWG  746
             RE++YL AA+ ES+RL+PP+QFDSKF  +DD+LPDGT VK+GTRVTYHPYAMGRME IWG
Sbjct  390   REMHYLHAALSESMRLYPPVQFDSKFAEKDDILPDGTVVKKGTRVTYHPYAMGRMESIWG  449

Query  745   SDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHL  566
              DC+EF PERWL +G F  ENPFKYPVFQAGLRVCLGKEMA L++KSV  SV+ + ++ L
Sbjct  450   KDCMEFNPERWLENGFFVPENPFKYPVFQAGLRVCLGKEMAFLQMKSVVASVVYKHKLVL  509

Query  565   AQPHHTPRFSPGLTATFRDGLPVFVQQR  482
               P +TPRF   LTA    GL VFV+ R
Sbjct  510   VNPDYTPRFVTSLTANVSGGLEVFVESR  537



>dbj|BAJ94069.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85878.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/468 (56%), Positives = 349/468 (75%), Gaps = 10/468 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW  +++NLCDW+ HLLR  P +T+H+HVL N +TANP  VE+ML+
Sbjct  48    WWCACSVCEAYLTASWTGEFDNLCDWFAHLLRREPGRTVHVHVLGNVLTANPATVEHMLR  107

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
              RF+N+PKG  FSAIL DFLG+GIFNVDGD W FQRK+A+ EL   ++ ++   V+ +E+
Sbjct  108   GRFDNYPKGAPFSAILADFLGRGIFNVDGDPWLFQRKLAAAELASPAIRAFTASVVSSEL  167

Query  1501  DRRLLPIL----AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
               RL+P+L    AG+    ++DLQDVFRRF+FDCIC+ SFGLDP CLE  LPMS FA +F
Sbjct  168   RCRLIPLLHSATAGQGGDKLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPMSAFANAF  227

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA RA +   V+WK+KR LNIG E+ELR +I +++ LA EVIRQRRKL  S  +
Sbjct  228   DTASMLSARRATAPMHVLWKLKRLLNIGDERELRDAIGLVDDLAAEVIRQRRKL-RSATS  286

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
               DLLSRFMGSI DD+ YLRDI++SF+LAGRDTVASALT+FF L+++HP  A+AI  E  
Sbjct  287   GDDLLSRFMGSINDDK-YLRDIIVSFMLAGRDTVASALTAFFLLLSDHPHVADAIRDEVF  345

Query  973   RVVG---KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             RV G   +     A+   ++ ++Y+ AA+ E +RLFPP+QFDSKF   +D LPDGT V +
Sbjct  346   RVAGGRGEGHPTTATSGELKRMHYVHAALFECMRLFPPVQFDSKFAAGEDTLPDGTPVAK  405

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             GTRVTYH YAMGRME +WG DC EF+PERWLR G F  E+P++YPVFQ G+RVC+GKE+A
Sbjct  406   GTRVTYHAYAMGRMESVWGPDCAEFRPERWLRGGQFVPESPYRYPVFQGGVRVCIGKELA  465

Query  622   LLELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             ++E+K+  ++V++ F +  + +    P+F+ GLTATF  G+PV V++R
Sbjct  466   IMEMKAAIVAVVQSFDIEAVGRSSRRPKFAAGLTATFVGGVPVRVRRR  513



>ref|XP_002862559.1| CYP94C1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38817.1| CYP94C1 [Arabidopsis lyrata subsp. lyrata]
Length=487

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/469 (59%), Positives = 343/469 (73%), Gaps = 20/469 (4%)
 Frame = -2

Query  1867  KLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYM  1688
             KL YC+C++C AY+++SW   + NL DWYTHLLR SP+ TI +HVL + ITANP NVE++
Sbjct  28    KLRYCNCEICHAYLTSSWRKDFINLSDWYTHLLRRSPTSTIKVHVLNSVITANPSNVEHI  87

Query  1687  LKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQT  1508
             LK+ F ++PKGK FS ILGD LG+GIFN DGD+WRFQRK+AS+ELG  SV  +A E+++T
Sbjct  88    LKTHFHSYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKT  147

Query  1507  EIDRRLLPILAGKKD--GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
             EI+ RLLPIL    D  G V+DLQDVFRRFSFD I + SFG DP CL    PMSEFAV+F
Sbjct  148   EIETRLLPILTSFSDNPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPMSEFAVAF  207

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
               AS LSA+RA++  P++WKIKR L IGSEK+L++SI V+N LA ++I+ RR  G   +N
Sbjct  208   DTASTLSAKRALAPFPLLWKIKRLLRIGSEKKLKESINVINRLAGDLIKHRRLTGLMGKN  267

Query  1153  HKDLLSRFMGSIG-DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
               DL+SRFM  +  DD+ YLRDIV++FLLAGRDTVA+ LT FFWL+  HPD    I  E 
Sbjct  268   --DLISRFMAVVAEDDDEYLRDIVVNFLLAGRDTVAAGLTGFFWLLMRHPDVENRIREEL  325

Query  976   DRVVGKNQDLIASE-QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             DRV+G   D + +    MRE++YL AA+ ES+RLFPP+QFDSKF + DDVL DGT VKRG
Sbjct  326   DRVMGTGFDSVTARCDEMREMDYLHAALYESMRLFPPVQFDSKFALNDDVLSDGTFVKRG  385

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             TRVTYH YAMGRM+ IWG D  EFKPERWL  +G F  ENP KYPVFQAG R        
Sbjct  386   TRVTYHAYAMGRMDRIWGPDYEEFKPERWLDSEGKFRPENPVKYPVFQAGAR--------  437

Query  622   LLELKSVALSVLRRFRVHLA--QPHHTPRFSPGLTATFRDGLPVFVQQR  482
                +KS+A+++ RRF+  LA  +   T RF+PGLTAT   GLPV +Q+R
Sbjct  438   ---MKSIAVAINRRFKTRLASLESTKTLRFAPGLTATVNGGLPVIIQER  483



>ref|XP_006654479.1| PREDICTED: cytochrome P450 94A2-like [Oryza brachyantha]
Length=524

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/460 (57%), Positives = 348/460 (76%), Gaps = 8/460 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW  +++NLCDWY HLLR +P +T+H+HVL N +TANP  V++ML+
Sbjct  51    WWCACPVCEAYVTASWAREFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPATVDHMLR  110

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
              RF+N+PKG  FSAIL DFLG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  111   CRFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPAIRAFAGNVVASEL  170

Query  1501  DRRLLPILAGKKDGG---VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RL+P+L      G   ++DLQDVFRRF+FDCIC+ SFGLDP CLE  LP+S FA +F 
Sbjct  171   RCRLVPLLHSASSDGSERLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPISAFADAFD  230

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
              AS LSA RA     VVWK+KR LNIG E+ELR +I +++ LA EVIRQRRKLG++   +
Sbjct  231   TASMLSARRATVPMHVVWKLKRLLNIGEERELRDAIHLVDALAAEVIRQRRKLGSAASGY  290

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVASALT+FF L+++HP+ A AI  E  R
Sbjct  291   -DLLSRFMGSINDDK-YLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVAAAIRDEVFR  348

Query  970   VVGKNQDLIASEQ--RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             V G    + AS +  ++++++Y+ AA+ ES+RLFPP+QFDSKF   +D LPDGT V +GT
Sbjct  349   VAGGRDPIAASFEFDKLKDMHYVHAALYESMRLFPPVQFDSKFAAGEDTLPDGTFVAKGT  408

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME +WG DC  F+PERWL  G F  E+P+ YPVFQ G+RVC+GK++A++
Sbjct  409   RVTYHAYAMGRMESVWGPDCAAFRPERWLSGGQFVPESPYHYPVFQGGVRVCIGKDLAIM  468

Query  616   ELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLP  500
             E+K+V ++V+  F V  + +    P+F+PGLTATF  G+P
Sbjct  469   EMKAVIVAVVLSFDVEAVDRSSRRPKFAPGLTATFAGGVP  508



>gb|EAY98229.1| hypothetical protein OsI_20140 [Oryza sativa Indica Group]
Length=519

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/466 (56%), Positives = 350/466 (75%), Gaps = 8/466 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW  +++NLCDWY HLLR +P +T+H+HVL N +TANP  V++ML+
Sbjct  50    WWCACPVCEAYVTASWAREFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPATVDHMLR  109

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
              RF+N+PKG  FSAIL DFLG+GIFNVDGD W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  110   CRFDNYPKGAPFSAILADFLGRGIFNVDGDGWLFQRKLAAAELASPAIRAFAANVVASEL  169

Query  1501  DRRLLPILAGKKDGG---VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RL+P+L      G   ++DLQDVFRRF+FDCIC+ SFGLDP CLE  LP+S FA +F 
Sbjct  170   RCRLIPLLRSASSYGSERLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPISAFADAFD  229

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
              AS LSA RA     VVWK+KR LNIG E+ELR +I +++ LA EVIRQRRKLG++  + 
Sbjct  230   TASMLSARRATVPMHVVWKLKRLLNIGEERELRDAIRLVDALAAEVIRQRRKLGSA-ASG  288

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVAS LT+FF L+++HP+ A AI  E  R
Sbjct  289   DDLLSRFMGSINDDK-YLRDIVVSFMLAGRDTVASGLTAFFLLLSDHPEVAAAIRDEVFR  347

Query  970   VVGKNQDLIAS--EQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             V G      AS    ++++++Y+ AA+ ES+RLFPP+QFDSKF   +D LPDGT V +GT
Sbjct  348   VAGGRDPTAASFDFDKLKDMHYVHAALYESMRLFPPVQFDSKFAAGEDTLPDGTFVAKGT  407

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME +WG DC  F+PERWL  G F  E+P++YPVFQ G+RVC+GK++A++
Sbjct  408   RVTYHAYAMGRMESLWGPDCAVFRPERWLSGGRFVPESPYRYPVFQGGVRVCIGKDLAIM  467

Query  616   ELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K+V ++V+  F V  + +    P+F+PGLTATF  G+PV V++R
Sbjct  468   EMKAVIVAVVLSFDVEAVDRSSRRPKFAPGLTATFAGGVPVRVRRR  513



>ref|XP_003566202.1| PREDICTED: cytochrome P450 94C1-like [Brachypodium distachyon]
Length=529

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/476 (57%), Positives = 357/476 (75%), Gaps = 14/476 (3%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC  Y+S SW  +++NLCDWY HLLR  P +T+H+HVL N +TANP  VE+ML+
Sbjct  55    WWCACAVCECYLSASWAGEFDNLCDWYAHLLRAVPGRTVHVHVLGNVLTANPPTVEHMLR  114

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
             +RF+N+PKG  FSAIL DFLG+GIFNVDGD+W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  115   ARFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPAIRAFAANVVASEL  174

Query  1501  DRRLLPILAGKKDGG---VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RL+P+L G        ++DLQDVFRRF+FDCIC+ SFGLDP CLE  LPMS FA +F 
Sbjct  175   RCRLIPLLHGSASSSASKLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPMSAFADAFD  234

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
              AS LSA RA +   V+WK+KR LN+G E+ELR +I +++ LA EVIRQRRKL +S    
Sbjct  235   AASMLSARRAAAPMHVLWKLKRLLNVGEERELRDAIGLVDALAAEVIRQRRKLASSGGG-  293

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVASALT+FF L+++HP  A+AI  E  R
Sbjct  294   DDLLSRFMGSINDDK-YLRDIVVSFMLAGRDTVASALTAFFLLLSDHPRVADAIRDEVSR  352

Query  970   VVGKNQDL-IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
             V  ++  L IA+ +++++++Y+  A+ E +RLFPP+QFDSKF   DD LPDGT V RGTR
Sbjct  353   VTKEDNPLTIATPEKLKDMHYVHTALYECMRLFPPVQFDSKFAAGDDTLPDGTFVARGTR  412

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             VTYH YAMGRME +WGSDC EF+PERWLR G F  E+P++YPVFQ G+RVC+GKE+A++E
Sbjct  413   VTYHAYAMGRMESVWGSDCAEFRPERWLRGGRFVPESPYRYPVFQGGVRVCIGKELAIME  472

Query  613   LKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLPV-------FVQQR*CPP  470
             +K+  ++V++RF +  + +    P+F+PGLTATF  GLPV        V  + CPP
Sbjct  473   MKAAIVAVVQRFDIEAVGRSSRRPKFAPGLTATFAGGLPVRVRRRREHVGGQECPP  528



>ref|NP_001055681.1| Os05g0445100 [Oryza sativa Japonica Group]
 gb|AAU44273.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF17595.1| Os05g0445100 [Oryza sativa Japonica Group]
 dbj|BAG97167.1| unnamed protein product [Oryza sativa Japonica Group]
Length=519

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/466 (56%), Positives = 349/466 (75%), Gaps = 8/466 (2%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW  +++NLCDWY HLLR +P +T+H+HVL N +TANP  V++ML+
Sbjct  50    WWCACPVCEAYVTASWAREFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPATVDHMLR  109

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
              RF+N+PKG  FSAIL DFLG+GIFNVDGD W FQRK+A+ EL   ++ ++A  V+ +E+
Sbjct  110   CRFDNYPKGAPFSAILADFLGRGIFNVDGDGWLFQRKLAAAELASPAIRAFAANVVASEL  169

Query  1501  DRRLLPILAGKKDGG---VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFH  1331
               RL+P+L      G   ++DLQDVFRRF+FDCIC+ SFGLDP CLE  LP+S FA +F 
Sbjct  170   RCRLIPLLRSASSYGSERLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPISAFADAFD  229

Query  1330  LASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH  1151
              AS LSA RA     VVWK+KR  NIG E+ELR +I +++ LA EVIRQRRKLG++  + 
Sbjct  230   TASMLSARRATVPMHVVWKLKRLRNIGEERELRDAIRLVDALAAEVIRQRRKLGSA-ASC  288

Query  1150  KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
              DLLSRFMGSI DD+ YLRDIV+SF+LAGRDTVAS LT+FF L+++HP+ A AI  E  R
Sbjct  289   DDLLSRFMGSINDDK-YLRDIVVSFMLAGRDTVASGLTAFFLLLSDHPEVAAAIRDEVFR  347

Query  970   VVGKNQDLIAS--EQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             V G      AS    ++++++Y+ AA+ ES+RLFPP+QFDSKF   DD LPDGT V +GT
Sbjct  348   VAGGRDPTAASFDFDKLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDTLPDGTFVAKGT  407

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             RVTYH YAMGRME +WG DC  F+PERWL  G F  E+P++YPVFQ G+RVC+GK++A++
Sbjct  408   RVTYHAYAMGRMESLWGPDCAVFRPERWLSGGRFVPESPYRYPVFQGGVRVCVGKDLAIM  467

Query  616   ELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             E+K+V ++V+  F V  + +    P+F+PGLTATF  G+PV V++R
Sbjct  468   EMKAVIVAVVLSFDVEAVDRSSRRPKFAPGLTATFAGGVPVRVRRR  513



>emb|CBI40252.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/456 (58%), Positives = 331/456 (73%), Gaps = 60/456 (13%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C+CD+C  Y+++SW  ++ NLCDWYTHLL+ SP+ TIHIHVL NTITANP+NVEYMLK+
Sbjct  6     WCNCDICCGYLTSSWLMEFGNLCDWYTHLLQKSPTHTIHIHVLGNTITANPDNVEYMLKT  65

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK FS ILGD LG+GIFNVDGDSW FQRK+AS+ELG  S+ S+AFEV+  EI 
Sbjct  66    RFDNYPKGKPFSTILGDLLGKGIFNVDGDSWVFQRKMASLELGSVSIRSFAFEVVMAEIK  125

Query  1498  RRLLPILA--GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLA  1325
              RLLP+L+   +KDG V+DLQDVFRRF+FD IC+FSFGLDP                   
Sbjct  126   HRLLPLLSSYAEKDGSVLDLQDVFRRFTFDNICKFSFGLDP-------------------  166

Query  1324  SKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKD  1145
                  ERAM ASP++WKIKR LN+GSE+ L+++I+ +N                      
Sbjct  167   -----ERAMVASPLIWKIKRLLNLGSERRLKEAIKKVN----------------------  199

Query  1144  LLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
                        D+ YLRDIVISF+LAGRDT+ASALT+FFWL+A HP+    I  EADR++
Sbjct  200   -----------DDDYLRDIVISFILAGRDTMASALTTFFWLVATHPEVESKIRDEADRIM  248

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
               NQ+   S + +RE++YL AAV ESLRL+PP+QFDSKF  +DDVL DGT V +GTRVTY
Sbjct  249   HPNQEF-PSFELIREMHYLHAAVHESLRLYPPVQFDSKFARQDDVLRDGTFVMKGTRVTY  307

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             HPYAMGR+E IWG DC+EF+P+RWL +G FF ++PFK+PVFQAG+RVCLGKEMA++ +KS
Sbjct  308   HPYAMGRIEAIWGPDCMEFRPQRWLNNGTFFPQSPFKFPVFQAGIRVCLGKEMAVVAMKS  367

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPV  497
             VA +VLR F +H+   +  PRF  GLTAT R GLPV
Sbjct  368   VAAAVLRPFNIHVVHANVAPRFDSGLTATVRGGLPV  403



>ref|XP_010686047.1| PREDICTED: cytochrome P450 94C1 [Beta vulgaris subsp. vulgaris]
Length=496

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/470 (56%), Positives = 351/470 (75%), Gaps = 20/470 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C C++C +++++SW  K+ NL DWY HLL+NSP+ TIHIH L NT+ A+P+NVE++L++
Sbjct  34    WCKCEICQSFITSSWREKFTNLPDWYAHLLQNSPTNTIHIHTLNNTVIAHPKNVEHILRT  93

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+N+PKGK  S ILGD LG+GIF VDGD WRFQRK+AS+ELG  SV +YA EV+  EI+
Sbjct  94    NFDNYPKGKPMSTILGDLLGRGIFIVDGDHWRFQRKLASLELGSVSVRAYAHEVLNKEIE  153

Query  1498  RRLLPIL-----AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSF  1334
              +L+P L     + +    V+DLQ  FR+FSF  IC+FSFG+DP  L+ L      A +F
Sbjct  154   AKLVPALLKVPSSPQPPSSVIDLQVEFRKFSFVNICKFSFGVDPTGLDGL------AEAF  207

Query  1333  HLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN  1154
              +ASKLS+ERA+S S + W+ KR  N+GSEK L+ +I  +N LA  ++++RRK+G + + 
Sbjct  208   DVASKLSSERALSPSWITWRAKRLFNVGSEKRLKGAISKVNALAENIMQERRKIGFTTK-  266

Query  1153  HKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
               DLLSRFMGS+ DD+ YLRDIV+SFLLAGRDTVAS LT FF+L+A +P A   I+ E++
Sbjct  267   -MDLLSRFMGSVSDDK-YLRDIVVSFLLAGRDTVASGLTMFFYLMARNPIAEARIIEESN  324

Query  973   RVVGKNQDLIAS-----EQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
             R +G      +S      + +R+++YLQAA+ E+LRL+PP+Q DSKF + DDVLPDGT V
Sbjct  325   RAMGPQHSSNSSINFPTLEELRKMHYLQAAIYETLRLYPPVQIDSKFAINDDVLPDGTFV  384

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLR-DGVFFQENPFKYPVFQAGLRVCLGK  632
             K+GTRV+YHPY+MGRME IWG D LEFKPERWL  DGVF   +P+KYPVFQAG+RVCLGK
Sbjct  385   KKGTRVSYHPYSMGRMESIWGPDYLEFKPERWLNDDGVFSPVSPYKYPVFQAGVRVCLGK  444

Query  631   EMALLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +M++L +K VAL ++RRF + LA  + TP F PGLTAT +DGLPV V +R
Sbjct  445   DMSMLSMKVVALILVRRFHITLADLNWTPHFVPGLTATLKDGLPVVVTER  494



>ref|NP_001066166.2| Os12g0150200 [Oryza sativa Japonica Group]
 dbj|BAF29185.2| Os12g0150200, partial [Oryza sativa Japonica Group]
Length=511

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/475 (56%), Positives = 353/475 (74%), Gaps = 21/475 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C C VC AY++ SW  ++ NL DWY  LLR SP+ T+H+HVL  T+TANP NVEYMLK+
Sbjct  40    WCGCHVCRAYLAGSWRREFANLGDWYADLLRRSPTGTVHVHVLGCTVTANPANVEYMLKT  99

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKG+ F+A+LGD LG GIFNVDGD+WR QRK+AS+ELG  +V SYA++++  E++
Sbjct  100   RFDNFPKGRPFAALLGDLLGDGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIVAQEVE  159

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+LA   D G VVDLQDVFRRF+FD IC+ SFGLDP CL+  +P+SE A +F  AS
Sbjct  160   ARLMPVLANAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDAAS  219

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP++WK+KRFLN+GSE+EL+K+I++++ LA  +IR+RRKLG +  N  DL
Sbjct  220   RLSAMRGAAASPLLWKMKRFLNVGSERELKKAIKLIDGLAAAMIRERRKLGVA--NSHDL  277

Query  1141  LSRFMGSIGD------DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
             LSRFM S GD      D+ +LRDIV+SFLLAGRDTV+SALT+ F +++ +PD A A+ AE
Sbjct  278   LSRFMASSGDDARGAADDKFLRDIVVSFLLAGRDTVSSALTTLFMILSKNPDVAAAMRAE  337

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             A    G++  +  S + ++ LNY  A + E++RLFPP+QFDSKFC   DVLPDGT V  G
Sbjct  338   AGAAAGESAAV--SYEHLKRLNYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVDGG  395

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEM  626
              RV YHPYAMGRM  IWG+DC  F+PERWL    G F  E+ FKYPVFQAGLRVCLGKE+
Sbjct  396   ARVMYHPYAMGRMPRIWGADCDAFRPERWLTGAGGAFVPESLFKYPVFQAGLRVCLGKEL  455

Query  625   ALLELKSVALSVLRRFRVHLAQPH--------HTPRFSPGLTATFRDGLPVFVQQ  485
             A+ E+K+V+++V+R F V +   +          PRF PGLTA+   GLPV +++
Sbjct  456   AITEMKAVSVAVVRAFDVEVVGENGRCGGGAAAAPRFVPGLTASISGGLPVKIRR  510



>emb|CBX25407.1| hypothetical_protein [Oryza brachyantha]
Length=502

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/472 (57%), Positives = 348/472 (74%), Gaps = 21/472 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY HLLR SP+ T+H+HVL  T+TANP NVEYMLK+
Sbjct  37    WCSCHVCRAYLTGSWRRDFTNLGDWYAHLLRRSPTGTVHVHVLGCTVTANPANVEYMLKT  96

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK F+A+LGD LG GIFNVDGD WR QRK+AS+ELG  SV SYAF+++  E++
Sbjct  97    RFDNFPKGKPFAALLGDLLGDGIFNVDGDMWRHQRKMASLELGSVSVRSYAFKIVAQEVE  156

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+L+   D G V+DLQDVFRRF+FD IC+ SFGLDP CL+  +P+SE A +F  AS
Sbjct  157   TRLMPVLSDAADRGAVLDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDTAS  216

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP++WK+KR LNIGSE+EL+K+I +++ LA  +IR+R+KLG    N  DL
Sbjct  217   RLSAMRGAAASPLLWKMKRLLNIGSERELKKAIRLIDGLAAAMIRERQKLGVG--NSHDL  274

Query  1141  LSRFMGSIGD-----DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             LSRFM S GD     ++ +LRDIV+SFLLAGRDTV+SALT+ F L++ HPD A A+ AEA
Sbjct  275   LSRFMASAGDAHSAAEDKFLRDIVVSFLLAGRDTVSSALTTLFMLLSKHPDVAAAMRAEA  334

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
                     +  A+ + ++ L+Y  A V E++RLFPP+QFDSKFC   DVLPDGT V    
Sbjct  335   -----GAGEKPATYEHLKRLHYTHAVVYENMRLFPPVQFDSKFCAAADVLPDGTYVDGDA  389

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             RV YHPYAMGRM  IWG+DC  F+P+RWL    G F  E+ +KYPVFQAGLRVCLGKE+A
Sbjct  390   RVMYHPYAMGRMPRIWGADCDAFRPDRWLTGAGGTFVPESLYKYPVFQAGLRVCLGKELA  449

Query  622   LLELKSVALSVLRRFRVHL------AQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             + E+K+V+++V+R F V +      +     PRF PGLTA+ R GLPV +++
Sbjct  450   VTEMKAVSVAVVRAFDVEVVGENGRSSAAAAPRFVPGLTASIRGGLPVKIRR  501



>gb|ABA95812.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAY82271.1| hypothetical protein OsI_37479 [Oryza sativa Indica Group]
 dbj|BAG89061.1| unnamed protein product [Oryza sativa Japonica Group]
Length=509

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/475 (56%), Positives = 353/475 (74%), Gaps = 21/475 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C C VC AY++ SW  ++ NL DWY  LLR SP+ T+H+HVL  T+TANP NVEYMLK+
Sbjct  38    WCGCHVCRAYLAGSWRREFANLGDWYADLLRRSPTGTVHVHVLGCTVTANPANVEYMLKT  97

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKG+ F+A+LGD LG GIFNVDGD+WR QRK+AS+ELG  +V SYA++++  E++
Sbjct  98    RFDNFPKGRPFAALLGDLLGDGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIVAQEVE  157

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+LA   D G VVDLQDVFRRF+FD IC+ SFGLDP CL+  +P+SE A +F  AS
Sbjct  158   ARLMPVLANAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDAAS  217

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP++WK+KRFLN+GSE+EL+K+I++++ LA  +IR+RRKLG +  N  DL
Sbjct  218   RLSAMRGAAASPLLWKMKRFLNVGSERELKKAIKLIDGLAAAMIRERRKLGVA--NSHDL  275

Query  1141  LSRFMGSIGD------DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
             LSRFM S GD      D+ +LRDIV+SFLLAGRDTV+SALT+ F +++ +PD A A+ AE
Sbjct  276   LSRFMASSGDDARGAADDKFLRDIVVSFLLAGRDTVSSALTTLFMILSKNPDVAAAMRAE  335

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             A    G++  +  S + ++ LNY  A + E++RLFPP+QFDSKFC   DVLPDGT V  G
Sbjct  336   AGAAAGESAAV--SYEHLKRLNYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVDGG  393

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEM  626
              RV YHPYAMGRM  IWG+DC  F+PERWL    G F  E+ FKYPVFQAGLRVCLGKE+
Sbjct  394   ARVMYHPYAMGRMPRIWGADCDAFRPERWLTGAGGAFVPESLFKYPVFQAGLRVCLGKEL  453

Query  625   ALLELKSVALSVLRRFRVHLAQPH--------HTPRFSPGLTATFRDGLPVFVQQ  485
             A+ E+K+V+++V+R F V +   +          PRF PGLTA+   GLPV +++
Sbjct  454   AITEMKAVSVAVVRAFDVEVVGENGRCGGGAAAAPRFVPGLTASISGGLPVKIRR  508



>dbj|BAJ99856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/471 (56%), Positives = 347/471 (74%), Gaps = 20/471 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC +Y++ SW   + NL DWY HLLR SP+ T+ +HVL  TITANP NVE+ML +
Sbjct  45    WCSCHVCRSYLTGSWARDFTNLGDWYAHLLRCSPTGTVAVHVLGCTITANPANVEHMLHT  104

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK FSA+LGD LG GIFNVDG +WR QRK+AS+ELG  +V SYA+ ++  E++
Sbjct  105   RFDNFPKGKPFSAVLGDLLGGGIFNVDGAAWRHQRKMASLELGSVAVRSYAYGIVAEEVE  164

Query  1498  RRLLPILAGKKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RLLP+LA   D G V+DLQDVFRRF+FD IC+ SFGLDP CLE  +PMS+ A +F  AS
Sbjct  165   ARLLPLLADAADNGRVIDLQDVFRRFAFDTICKISFGLDPGCLELDMPMSKLAAAFDTAS  224

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP+VW++KR LN+GSE+ELRKSI +++ LA  +IRQRRKLG +  +  DL
Sbjct  225   RLSAMRGAAASPLVWRVKRLLNVGSERELRKSIRLVDELAAAMIRQRRKLGVAGSH--DL  282

Query  1141  LSRFMGS----IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDA-----AEAI  989
             LSRFM S       D+ YLRDIV+SFLLAGRDTV+SALT+ F L++ +P       AEA 
Sbjct  283   LSRFMASEAHGTAVDDKYLRDIVVSFLLAGRDTVSSALTTIFMLLSKNPAVAAGMRAEAA  342

Query  988   LAEADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
              +E  R+  K      + + ++ L+Y  A + E++RLFPP+QFDSKFC  DDVLPDGT V
Sbjct  343   ASEKTRMASKT-----TYEHLKSLHYTHAVLYENMRLFPPVQFDSKFCAADDVLPDGTYV  397

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWL--RDGVFFQENPFKYPVFQAGLRVCLG  635
               G RV YHPYAMGRM  IWG DC +F+PERWL    G F  E+ ++YPVFQAGLRVCLG
Sbjct  398   TAGARVMYHPYAMGRMPRIWGDDCEKFRPERWLTGTGGTFVPESLYRYPVFQAGLRVCLG  457

Query  634   KEMALLELKSVALSVLRRFRVH-LAQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             KE+A++E+K+V+++V+++F V  + +    PRF+PGLTA+   GLPV V++
Sbjct  458   KELAVMEMKAVSVAVVKQFDVEVVGEQGAAPRFAPGLTASISGGLPVRVRR  508



>ref|XP_008662461.1| PREDICTED: cytochrome P450 94C1-like [Zea mays]
 gb|AFW56035.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=509

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/468 (57%), Positives = 345/468 (74%), Gaps = 11/468 (2%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY HLLR SP+ T+H+HVL  T+TANP NVEYMLK+
Sbjct  41    WCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESPTGTVHVHVLGCTVTANPANVEYMLKT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGK F+A+LGD LG+GIFNVDG +WR QRK+AS+ELG  +V SYAF +I  E++
Sbjct  101   NFDNFPKGKTFAALLGDLLGRGIFNVDGHAWRHQRKMASLELGSVTVRSYAFGIIAQEVE  160

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RLLP+LAG  D G VVDLQDVFRRF+FD IC+ SFGLDP CLE  +P+SE A +F  A+
Sbjct  161   ARLLPLLAGAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLEPEMPVSELADAFDTAT  220

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +A+P++W+ KR LN+GSE+ELR +I++++ LA  VIR+RRKLG +   H DL
Sbjct  221   RLSATRGAAAAPLLWRAKRLLNVGSERELRAAIKLVDELAATVIRERRKLGVAPSGH-DL  279

Query  1141  LSRFMGSIG--DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             LSRFM S G  DD+ YLRDIV+SFLLAGRDTV+SALT+ F L++ +P  A A+ AEA   
Sbjct  280   LSRFMASAGADDDDRYLRDIVVSFLLAGRDTVSSALTTLFMLLSENPGVAAAMRAEAGDG  339

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
              G     +  E  ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDGT V  GTRV 
Sbjct  340   DGGPAPPLTYEH-LKRLHYTHAVLYENMRLFPPVQFDSKFCAGPDVLPDGTYVPGGTRVM  398

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             YHPYAMGRM  IWG+D   F+P RWL    G F  E+ ++YPVFQAGLRVCLGKE+A+ E
Sbjct  399   YHPYAMGRMPRIWGADHGAFRPGRWLTGAGGSFVPESLYRYPVFQAGLRVCLGKELAVTE  458

Query  613   LKSVALSVLRRFRVHLAQPHHT----PRFSPGLTATFRDGLPVFVQQR  482
             +K+VA++V+R F VH+     +    P+F  GLTA+   GLPV + +R
Sbjct  459   MKAVAVAVVRAFDVHVVGDSSSAACKPKFVSGLTASISGGLPVRISRR  506



>ref|XP_008662467.1| PREDICTED: cytochrome P450 94C1-like [Zea mays]
 gb|AFW56045.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=507

 Score =   534 bits (1375),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 268/468 (57%), Positives = 345/468 (74%), Gaps = 13/468 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY HLLR S + T+H+HVL  T+TANP NVEYMLK+
Sbjct  41    WCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESATGTVHVHVLGCTVTANPANVEYMLKT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGK F+A+LGD LG+GIFNVDG +WR QRK+AS+ELG  +V SYAF +I  E++
Sbjct  101   NFDNFPKGKTFAALLGDLLGRGIFNVDGHAWRHQRKMASLELGSVTVRSYAFGIIAQEVE  160

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RLLP++A   D G VVDLQDVFRRF+FD IC+ SFGLDP CLE  +PMSE A +   A+
Sbjct  161   ARLLPLVASAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLEPEMPMSELADALDTAT  220

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +A+P++W+ KR LN+GSE+ELR +I++++ LA  VIR+RRKLG +   H DL
Sbjct  221   RLSATRGAAAAPLLWRAKRLLNVGSERELRAAIKLVDELAAAVIRERRKLGVAASGH-DL  279

Query  1141  LSRFMGSIG--DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV  968
             LSRFM S G  DD+ YLRDIV+SFLLAGRDTV+SALT+ F L++ +P  A A+ AEA   
Sbjct  280   LSRFMASAGADDDDRYLRDIVVSFLLAGRDTVSSALTTLFMLLSENPGVAAAMRAEAGD-  338

Query  967   VGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVT  788
              G    L  + + ++ ++Y  A + E++RLFPP+QFDSKFCV  DVLPDGT V  GTRVT
Sbjct  339   GGPAPPL--TYEHLKRMHYTHAVLYENMRLFPPVQFDSKFCVGPDVLPDGTYVPGGTRVT  396

Query  787   YHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             YHPYAMGRM  IWG+D   F+P RWL    G F  E+ +KYPVFQAGLRVCLGKE+A+ E
Sbjct  397   YHPYAMGRMPRIWGADHGAFRPGRWLTGAGGSFVPESLYKYPVFQAGLRVCLGKELAVTE  456

Query  613   LKSVALSVLRRFRVHLAQPHHT----PRFSPGLTATFRDGLPVFVQQR  482
             +K+VA++V+R F VH+     +    P+F  GLTA+   GLPV + +R
Sbjct  457   MKAVAVAVVRAFDVHVVGDSGSAACKPKFVSGLTASISGGLPVRISRR  504



>dbj|BAJ85532.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   531 bits (1368),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 261/466 (56%), Positives = 338/466 (73%), Gaps = 16/466 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C C VC AY++ SW   + NL DWY HLLR SP+ T+ +HVL  T+TANP NVEYMLK+
Sbjct  42    WCGCHVCQAYLTGSWAKDFTNLADWYAHLLRESPTGTVQLHVLGCTVTANPANVEYMLKT  101

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK F+A+LGD LG GIFNVDGD+WR QRK+AS++LG  +V SYA++++  E++
Sbjct  102   RFDNFPKGKRFAALLGDLLGDGIFNVDGDAWRHQRKMASLQLGSVTVRSYAYKIVAQEVE  161

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RLLP+LA   D G VVDLQDVFRRF+FD IC+ SFGLDP CL+  +PMS+ A +F  AS
Sbjct  162   SRLLPVLADAADKGKVVDLQDVFRRFAFDTICKISFGLDPGCLDLDMPMSDLANAFDDAS  221

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +L A R  +ASP+VWK+KR LNIGSE+EL+K+I +++ LA  +I QRR LG   +N  DL
Sbjct  222   RLCAMRGAAASPLVWKVKRMLNIGSERELKKAINLVDDLASAMILQRRSLGF--DNSHDL  279

Query  1141  LSRFMGS-IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV  965
             LSRFM S +G D+ YLRDIV+SFLLAGRDTVASALT+ F  +  +P+   AI AEA    
Sbjct  280   LSRFMASDVGMDDKYLRDIVVSFLLAGRDTVASALTTLFIHLHKNPEVTAAIRAEA----  335

Query  964   GKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTY  785
                 D  ++ + +  L Y  A + E++RLFPP+QFDSKFC   DVLPDGT V+  +RV Y
Sbjct  336   --GGDKPSTYEHLMSLQYTHAVLFENMRLFPPVQFDSKFCAAADVLPDGTYVEGESRVMY  393

Query  784   HPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             HPYAMGRM  IWG+D   F+P+RWL    G F   N +KYPVFQAGLRVCLGKE+A++E+
Sbjct  394   HPYAMGRMPSIWGADYEAFRPDRWLTGPGGSFAPANLYKYPVFQAGLRVCLGKELAVIEM  453

Query  610   KSVALSVLRRFRVHLAQPHH----TPRFSPGLTATFRDGLPVFVQQ  485
             K+V ++V+  F V +   +      P FSPGLTA+   GLPV +++
Sbjct  454   KAVGVAVVTAFDVEVVGENGRSGWAPTFSPGLTASISGGLPVRIKR  499



>ref|XP_003577893.2| PREDICTED: cytochrome P450 94C1-like [Brachypodium distachyon]
Length=515

 Score =   531 bits (1368),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 264/467 (57%), Positives = 343/467 (73%), Gaps = 12/467 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C C VC AY++ SW   + NL DWY HLLR SP+ T+ +HVL   +TA+P NVE++L+ 
Sbjct  46    WCGCHVCRAYLTGSWAKDFVNLGDWYAHLLRRSPTGTLAVHVLGCVVTASPANVEHVLRH  105

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+N+PKGK F+A+LGD LG GIFNVDGD+WR QRK+AS+ELG  +V SYA+ ++  E+ 
Sbjct  106   RFDNYPKGKPFAAVLGDLLGGGIFNVDGDAWRRQRKMASLELGSVAVRSYAYSIVNQEVH  165

Query  1498  RRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RLLP+L A   +G VVDLQDVFRRF+FD IC+ SFGLDP CLE  +PMSE A +F  AS
Sbjct  166   GRLLPVLAAAAGNGAVVDLQDVFRRFAFDTICKISFGLDPGCLELDMPMSELAAAFDTAS  225

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP VWK KR LN+GSE+ELRK+I +++ LA  +IRQRRKLG   +N  DL
Sbjct  226   RLSAMRGAAASPAVWKAKRLLNVGSERELRKAIALVDELAAAMIRQRRKLGF--DNSHDL  283

Query  1141  LSRFM-GSIGDDE---TYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             LSRFM  S GDDE    YLRDIV+SFLLAGRDTV+SALT+ F L++ HP  A AI AE D
Sbjct  284   LSRFMAASAGDDEHDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSEHPAVASAIRAELD  343

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
              +    + +  + ++++ L+Y  A V E++RL+PP+QFDSKFC   DVLPDGT V  G R
Sbjct  344   -LATSPESMATTYEQLKSLHYAHAVVYENMRLYPPVQFDSKFCAAADVLPDGTYVAAGAR  402

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
             V YHPYAMGRM  IWG DC  F+P+RWL    G F   + ++YPVFQAGLRVCLGKE+A+
Sbjct  403   VMYHPYAMGRMPTIWGDDCESFRPDRWLTGAGGAFQPASLYRYPVFQAGLRVCLGKELAV  462

Query  619   LELKSVALSVLRRFRVHLAQPH--HTPRFSPGLTATFRDGLPVFVQQ  485
             +E+K+ A++V+R F V +   +   +P+F+PGLTA+   GLPV V++
Sbjct  463   MEMKAAAVAVVREFDVEIINGNGGASPKFAPGLTASISGGLPVRVRR  509



>ref|XP_004977561.1| PREDICTED: cytochrome P450 94A1-like [Setaria italica]
Length=503

 Score =   526 bits (1356),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 266/469 (57%), Positives = 347/469 (74%), Gaps = 18/469 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY HLLR SP+ T+H+HVL  T+TANP NVEYMLK+
Sbjct  39    WCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESPTGTVHVHVLGCTVTANPANVEYMLKT  98

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGK F+A+LGD LG GIFNVDGD+WR QRK+AS+ELG  +V SYA+++I  E++
Sbjct  99    NFDNFPKGKTFAALLGDLLGGGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIIAQEVE  158

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+LA   D G VVDLQDVFRRF+FD IC+ SFGLDP CLE  +PMS+ A +F  A+
Sbjct  159   ARLMPVLADAADRGAVVDLQDVFRRFAFDTICKISFGLDPGCLEREMPMSKLADAFDTAT  218

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +L A R  +ASP++W++KR LNIGSE+EL+K+I++++ LA  +IR+RRKLG +  N  DL
Sbjct  219   RLCAMRGAAASPLLWRMKRLLNIGSERELKKAIKLVDELAAAMIRERRKLGFA--NSHDL  276

Query  1141  LSRFMGSIGD----DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             LSRFM S GD    D+ YLRDIV+SFLLAGRDTV+SALT  F L++ +PD A A+ AEA 
Sbjct  277   LSRFMASAGDAHAVDDKYLRDIVVSFLLAGRDTVSSALTMLFMLLSKNPDVAAAMRAEA-  335

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
                G +   +  E  ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDGT V  G R
Sbjct  336   ---GDDSTPVTYEH-LKGLHYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVSGGAR  391

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
             V YHPYAMGRM  IWG+D  EF+P+RWL    G F  E+ +KYPVFQAGLRVCLGKE+A+
Sbjct  392   VMYHPYAMGRMPRIWGADHGEFRPDRWLTGAGGSFVPESLYKYPVFQAGLRVCLGKELAI  451

Query  619   LELKSVALSVLRRFRVHLAQPHHT----PRFSPGLTATFRDGLPVFVQQ  485
              E+K+V+++V+R F V +     +    P+F  GLTA+   GLPV +++
Sbjct  452   TEMKAVSVAVVRAFDVEVVGESGSGACAPKFVSGLTASISGGLPVRIRR  500



>emb|CBX25324.1| hypothetical_protein [Oryza brachyantha]
Length=509

 Score =   521 bits (1341),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 341/473 (72%), Gaps = 21/473 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW  ++ NL DWY HLLR SP+ T+H+HVL  T+TANP NVEYMLK+
Sbjct  40    WCSCHVCRAYLTGSWAREFTNLGDWYAHLLRLSPTGTVHVHVLGCTVTANPANVEYMLKT  99

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK F+A+LGD LG GIFNVDG +WR QRK+AS+ELG  +V SYA+++I  E+D
Sbjct  100   RFDNFPKGKPFAALLGDLLGNGIFNVDGGAWRHQRKMASLELGSVAVRSYAYKIIAQEVD  159

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+L    D G V+DLQDVFRRF+FD IC+ SFGLDP CL+  +P+SE A +F  AS
Sbjct  160   ARLMPVLTDAADRGAVLDLQDVFRRFAFDTICKISFGLDPCCLDREMPVSELADAFDTAS  219

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP++WK+KRFLNIGSE+EL+K+I++++ LA  +IR+R+KLG    +  DL
Sbjct  220   RLSAMRGAAASPLLWKMKRFLNIGSERELKKAIKIVDELAAAMIRERQKLGVGSSH--DL  277

Query  1141  LSRFMGSIG-----DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             LSRFM S G      D+ +LRDIV+SFLLAGRDTV++ALT+ F +++ +P+    + A  
Sbjct  278   LSRFMASTGVDPHAADDKFLRDIVVSFLLAGRDTVSTALTTLFMILSKNPE----VAAAM  333

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
                 G  +    + + ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDGT V+   
Sbjct  334   RAEAGAGEKGATTYEHLKGLHYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVEGDA  393

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             RV YHPYAMGRM  IWG+D   F+PERWL      F   NP+K+PVFQAG RVCLGKE+A
Sbjct  394   RVMYHPYAMGRMPHIWGADHGAFRPERWLTGPGASFVPANPYKFPVFQAGQRVCLGKELA  453

Query  622   LLELKSVALSVLRRFRVHLAQPH-------HTPRFSPGLTATFRDGLPVFVQQ  485
             + E+K+V+++V+R F + +   +         PRF PGLTA+   GL V V++
Sbjct  454   ITEMKAVSVAVVRAFDIEVVGENGRTGGAAAAPRFVPGLTASISGGLQVRVKR  506



>ref|XP_002450277.1| hypothetical protein SORBIDRAFT_05g003100 [Sorghum bicolor]
 gb|EES09265.1| hypothetical protein SORBIDRAFT_05g003100 [Sorghum bicolor]
Length=509

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 258/470 (55%), Positives = 343/470 (73%), Gaps = 16/470 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY HLLR+SP+ T+H+HVL  T+TANP NVEYML++
Sbjct  41    WCSCHVCRAYLTGSWARDFTNLGDWYAHLLRDSPTGTVHVHVLGCTVTANPANVEYMLRT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGKAF+A+LGD LG GIFNVDG +W  QRK+AS+ELG  +V SYAF ++  E++
Sbjct  101   NFDNFPKGKAFAAVLGDLLGGGIFNVDGHAWLHQRKMASLELGSVAVRSYAFGIVAQEVE  160

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+LA   D G VVDLQDVFRRF+FD IC+ SFGLDP CL+  +P+S+ A +F  A+
Sbjct  161   SRLVPVLASAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLDLEMPVSKLADAFDTAT  220

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +L A R  +ASP++WK KR LN+GSE+ELR++I++++ L+  +IR+RRKLG +  +  DL
Sbjct  221   RLCAMRGAAASPLLWKAKRLLNVGSERELREAIKLVDELSAAMIRERRKLGVAGSH--DL  278

Query  1141  LSRFMGSIGD-----DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             LSRFM S GD     D+ YLRDIV+SFLLAGRDTV+SALT+ F L++ +P  A A+ AEA
Sbjct  279   LSRFMASSGDARHDVDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPAVASAMRAEA  338

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
                 G       + + ++ L+Y  A + E++RLFPP+QFDSKF    DVLPDGT V  GT
Sbjct  339   --AGGDESTAALTYEHLKRLHYTHAVLYENMRLFPPVQFDSKFSAGSDVLPDGTYVAGGT  396

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             RVTYHPYAMGRM  IWG+D   F+P+RWL    G F  E+ ++YPVFQAGLRVCLGKE+A
Sbjct  397   RVTYHPYAMGRMPRIWGADHGAFRPDRWLTGPGGTFVPESLYRYPVFQAGLRVCLGKELA  456

Query  622   LLELKSVALSVLRRFRVHL----AQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             + E+K+VA++V+R F V +          P+F  GLTA+   GLPV +++
Sbjct  457   VTEMKAVAVAVVRAFDVEVVGDGGNAACAPKFVSGLTASISGGLPVRIRR  506



>ref|NP_001065766.1| Os11g0151400 [Oryza sativa Japonica Group]
 gb|AAX92767.1| Cytochrome P450 [Oryza sativa Japonica Group]
 gb|AAX94835.1| Cytochrome P450 [Oryza sativa Japonica Group]
 gb|ABA91454.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27611.1| Os11g0151400 [Oryza sativa Japonica Group]
 gb|EEC67683.1| hypothetical protein OsI_35132 [Oryza sativa Indica Group]
 emb|CBX25523.1| hypothetical_protein [Oryza glaberrima]
Length=520

 Score =   521 bits (1341),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 257/474 (54%), Positives = 343/474 (72%), Gaps = 17/474 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW  ++ NL DWY HLLR SP+ T+H+HVL  T+TANP NVE+ML++
Sbjct  46    WCSCHVCRAYLTGSWAREFTNLGDWYAHLLRRSPTGTVHVHVLGCTVTANPANVEHMLRT  105

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKG+ F+A+LGD LG GIFNVDG +WR QRK+AS+ELG  +V SYA+++I  E++
Sbjct  106   RFDNFPKGRPFAALLGDLLGDGIFNVDGHAWRHQRKMASLELGSVAVRSYAYKIIAQEVE  165

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+LA   D G V+DLQDVFRRF+FD IC+ SFGLDP CL+  +P+SE A +F  AS
Sbjct  166   ARLMPVLADAADRGAVLDLQDVFRRFAFDNICKISFGLDPGCLDREMPVSELADAFDAAS  225

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP++W+ KRFLN+GSE+ELRK+I+V++ LA  +IR+R+KLG    +  DL
Sbjct  226   RLSAMRGAAASPLLWRAKRFLNVGSERELRKAIKVVDELAAAMIRERQKLGVGSSH--DL  283

Query  1141  LSRFMGSIG-----DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             LSRFM S G      D+ +LRDIV+SFLLAGRDTV++ALT+ F L++ +P+ A A+ AEA
Sbjct  284   LSRFMASTGVDDAAADDKFLRDIVVSFLLAGRDTVSTALTTLFMLLSKNPEVAAAMRAEA  343

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             +   G       + + ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDGT V    
Sbjct  344   EAGDGGETGAAITYEHLKGLHYTHAVLHENMRLFPPVQFDSKFCAAADVLPDGTYVGGDA  403

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             RV YHPYAMGRM  IWG+D   F+P RWL      F   NP+KYPVFQAG RVCLGKE+A
Sbjct  404   RVMYHPYAMGRMPHIWGADYAAFRPARWLTGPGASFVPANPYKYPVFQAGQRVCLGKELA  463

Query  622   LLELKSVALSVLRRFRVHLAQPH-------HTPRFSPGLTATFRDGLPVFVQQR  482
             + E+K+ +++V+R F V +   +         PRF PGLTA+   GL V V++R
Sbjct  464   VTEMKAASVAVVRAFDVEVVGENGRSGGAAAAPRFVPGLTASISGGLQVRVRRR  517



>dbj|BAJ88829.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   515 bits (1326),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 265/469 (57%), Positives = 340/469 (72%), Gaps = 19/469 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC  Y++ SW   + NL DWY HLLR SP+ T+HIHVL  T+TANP NVEYMLK+
Sbjct  39    WCSCHVCRTYLTGSWAKDFTNLGDWYAHLLRESPTGTVHIHVLGCTVTANPANVEYMLKT  98

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGK F+A+LGD LG GIFNVDGD+WR QRK+AS+ELG  +V SYA++++  E++
Sbjct  99    NFDNFPKGKRFAALLGDLLGGGIFNVDGDAWRHQRKMASLELGSVTVRSYAYKIVAHEVE  158

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RLLP+LA   D G VVDLQDVFRRF+FD IC+ SFGLDP CL+  +PMS+ A +F  AS
Sbjct  159   TRLLPVLADAADKGKVVDLQDVFRRFAFDTICKISFGLDPGCLDLDMPMSDLANAFDTAS  218

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP VWK+KR LNIGSE+EL+K+I++++ LA  +I QRRKLG   EN  DL
Sbjct  219   RLSAMRGAAASPFVWKLKRMLNIGSERELKKAIKLVDDLASAMILQRRKLGF--ENSHDL  276

Query  1141  LSRFMGSIGD----DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             LSRFM S GD    D  YLRDIV+SFLLAGRDTVASALT+ F  ++ +P+ A AI  EA 
Sbjct  277   LSRFMASDGDVQAMDNKYLRDIVVSFLLAGRDTVASALTTLFIHLSKNPEVAAAIRTEA-  335

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
                    D  ++ + ++ L Y  A + E++RLFPP+QFDSKF    DVLPDGT V+  +R
Sbjct  336   -----GGDKPSTYEHLKSLQYTHAVLYENMRLFPPVQFDSKFSAAADVLPDGTYVEGESR  390

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
             V YHPYAMGRM  IWG+D   F+P+RWL    G F   + +KYPVFQAGLRVCLGKE+A+
Sbjct  391   VMYHPYAMGRMPSIWGADYEAFRPDRWLTGPGGSFAPASLYKYPVFQAGLRVCLGKELAV  450

Query  619   LELKSVALSVLRRFRVHLAQPHH----TPRFSPGLTATFRDGLPVFVQQ  485
              E+K+V+++V+R F V +   +      PRF  GLTA+   GLPV +++
Sbjct  451   TEMKAVSVAVVRAFDVEVVGENGRSGWAPRFVAGLTASISGGLPVRIKR  499



>ref|XP_006662735.1| PREDICTED: cytochrome P450 94A1-like [Oryza brachyantha]
Length=511

 Score =   514 bits (1323),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 253/475 (53%), Positives = 340/475 (72%), Gaps = 23/475 (5%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW  ++ NL DWY HLLR SP+ T+H+HVL  T+TANP NVEYMLK+
Sbjct  40    WCSCHVCRAYLTGSWAREFTNLGDWYAHLLRLSPTGTVHVHVLGCTVTANPANVEYMLKT  99

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK F+A+LGD LG GIFNVDG +WR QRK+AS+ELG  +V SYA+++I  E+D
Sbjct  100   RFDNFPKGKPFAALLGDLLGNGIFNVDGGAWRHQRKMASLELGSVAVRSYAYKIIAQEVD  159

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+L    D G V+DLQDVFRRF+FD IC+ SFGLDP CL+  +P+SE A +F  AS
Sbjct  160   ARLMPVLTDAADRGAVLDLQDVFRRFAFDTICKISFGLDPCCLDREMPVSELADAFDTAS  219

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP++WK+KRFLNIGSE+EL+K+I++++ LA  +IR+R+KLG    +  DL
Sbjct  220   RLSAMRGAAASPLLWKMKRFLNIGSERELKKAIKIVDELAAAMIRERQKLGVGSSH--DL  277

Query  1141  LSR--FMGSIG-----DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
             LSR   M S G      D+ +LRDIV+SFLLAGRDTV++ALT+ F +++ +P+    + A
Sbjct  278   LSRVMVMASTGVDPHAADDKFLRDIVVSFLLAGRDTVSTALTTLFMILSKNPE----VAA  333

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
                   G  +    + + ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDGT V+ 
Sbjct  334   AMRAEAGAGEKGATTYEHLKGLHYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVEG  393

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKE  629
               RV YHPYAMGRM  IWG+D   F+PERWL      F   NP+K+PVFQAG RVCLGKE
Sbjct  394   DARVMYHPYAMGRMPHIWGADHGAFRPERWLTGPGASFVPANPYKFPVFQAGQRVCLGKE  453

Query  628   MALLELKSVALSVLRRFRVHLAQPH-------HTPRFSPGLTATFRDGLPVFVQQ  485
             +A+ E+K+V+++V+R F + +   +         PRF PGLTA+   GL V V++
Sbjct  454   LAITEMKAVSVAVVRAFDIEVVGENGRTGGAAAAPRFVPGLTASISGGLQVRVKR  508



>ref|XP_003578905.1| PREDICTED: cytochrome P450 94C1-like [Brachypodium distachyon]
Length=518

 Score =   512 bits (1318),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 268/474 (57%), Positives = 347/474 (73%), Gaps = 15/474 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY HLLR SP+ T+H+HVL  T+TANP NVEYML++
Sbjct  41    WCSCHVCRAYLTGSWAKDFTNLGDWYAHLLRASPTGTVHVHVLGCTVTANPGNVEYMLRT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKGK F+A+LGD LG GIFNVDGD+WR QRK+AS+ELG  SV SYA++++  E++
Sbjct  101   RFDNFPKGKQFAALLGDLLGGGIFNVDGDAWRHQRKMASLELGSVSVRSYAYKIVAQEVE  160

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RLLP+LA   D G VVDLQDVFRRF+FD IC+ SFGLDP CL+  +PMS+ A SF  AS
Sbjct  161   TRLLPVLADAADKGKVVDLQDVFRRFAFDTICKISFGLDPGCLDLDMPMSDLAESFDAAS  220

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP+VWK+KRFLN+GSE+ELRK+I +++ LA  +I QRRKLG   EN  DL
Sbjct  221   RLSAMRGAAASPLVWKLKRFLNVGSERELRKAIRLVDDLAAAMILQRRKLGF--ENSHDL  278

Query  1141  LSRFM-----GSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             LSRFM     G+   D+ YLRDIV+SFLLAGRDTVASALT+ F  ++++P+ A AI AEA
Sbjct  279   LSRFMASADAGAGAMDDKYLRDIVVSFLLAGRDTVASALTTLFIHLSSNPEVAAAIRAEA  338

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
                  ++ +  +S + ++ L Y  A + E++RLFPP+QFDSKFC   DVLPDGT V   +
Sbjct  339   -GAGDEDDNKPSSYEHLKGLQYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVAAES  397

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             RV YHPYAMGRM  IWG+DC  F+P RWL    G F   + +KYPVFQAGLRVCLGKE+A
Sbjct  398   RVMYHPYAMGRMPSIWGADCEAFRPARWLTGPGGSFAPPSLYKYPVFQAGLRVCLGKELA  457

Query  622   LLELKSVALSVLRRFRVHL----AQPHHTPRFSPGLTATFRDGLPVFVQQR*CP  473
             + E+K+V ++++R F V +     +    P+F PGLTA+   GLP  +++   P
Sbjct  458   ITEMKTVCVAMVRSFDVEVLGENGRAGCKPKFVPGLTASISGGLPARIKRAPAP  511



>ref|NP_001183398.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACR36647.1| unknown [Zea mays]
 tpg|DAA59256.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=513

 Score =   507 bits (1305),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 334/473 (71%), Gaps = 16/473 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY HL+R S + T+H+HVL  T+TANP NVEYMLK+
Sbjct  40    WCSCHVCRAYLTGSWERDFTNLGDWYAHLIRESATGTVHVHVLGCTVTANPANVEYMLKT  99

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKG+ F+ +LGD LG GIFNVDG +WR+QRK+AS+ELG  +V SYAF +I  E++
Sbjct  100   NFDNFPKGETFATLLGDLLGCGIFNVDGHAWRYQRKMASLELGSVAVRSYAFGIIAREVE  159

Query  1498  RRLLP-ILAGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P +      G VVDLQDVFRRF+FD IC+ SFGLDP CLE  +PMS+ A +F  A+
Sbjct  160   ARLMPLLAGAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLEREMPMSKLADAFDTAT  219

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +L A R  +ASP++W+ KR LN+GSE+ELR++I +++ LA  VIR+RRKLG +  +  DL
Sbjct  220   RLCAMRGAAASPLLWRAKRLLNVGSERELREAIRLVDELAAAVIRERRKLGVASSH--DL  277

Query  1141  LSRFM-------GSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
             LSRFM          G D+ YLRDIV+SFLLAGRDTV+SALT+ F L++ +P    A+ A
Sbjct  278   LSRFMVASAGGDAHPGVDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPAVVAAMRA  337

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             EA    G       + + ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDG  V  
Sbjct  338   EAGDGDGDGDSAPLTYEHLKRLHYTHAVLYENMRLFPPVQFDSKFCAGPDVLPDGIYVSG  397

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKE  629
             GTRV YHPYAMGRM  IWG+D   F+P+RWL    G F  E+ +KYPVFQAGLRVCLGKE
Sbjct  398   GTRVMYHPYAMGRMPRIWGADHDAFRPDRWLTGAGGSFVPESLYKYPVFQAGLRVCLGKE  457

Query  628   MALLELKSVALSVLRRFRVHLAQPHHT----PRFSPGLTATFRDGLPVFVQQR  482
             +A+ E+K+V ++V+R F VH+     +    P+F  GLTA+   GLPV + +R
Sbjct  458   LAITEMKAVGVAVVRAFDVHVVGDSGSAACAPKFVSGLTASISGGLPVRISRR  510



>ref|XP_004978691.1| PREDICTED: cytochrome P450 94A1-like [Setaria italica]
Length=501

 Score =   506 bits (1302),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 260/469 (55%), Positives = 342/469 (73%), Gaps = 17/469 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY H LR S + TIH+HVL  T+TANP NVEYMLK+
Sbjct  36    WCSCHVCRAYLTGSWARDFTNLGDWYAHQLRESATGTIHVHVLGCTVTANPANVEYMLKT  95

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGK F+A+LGD LG GIFNVDG +WR QRK+AS+ELG  +V SYA+++I  E++
Sbjct  96    NFDNFPKGKTFAALLGDLLGGGIFNVDGHAWRHQRKMASLELGSVAVRSYAYKIIAQEVE  155

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+L    D G VVDLQDVFRRF+FD IC+ SFGLDP CLE  +P+S+ A +F  A+
Sbjct  156   ARLMPVLTDAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLEREMPVSKLANAFDAAT  215

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +L A R  +ASP++WK+KR LN+GSE+EL+K+I+++N LA  +IR+RRKLG +  N  DL
Sbjct  216   RLCAMRGAAASPLLWKVKRMLNVGSERELKKAIKLVNELAAAMIRERRKLGFA--NSHDL  273

Query  1141  LSRFMGSIGD----DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD  974
             LSRFM S GD    D+ YLRDIV+SFLLAGRDTV+SALT+ F L++ +P  A A+ AEA 
Sbjct  274   LSRFMASAGDAHAVDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPAVAAAMRAEA-  332

Query  973   RVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTR  794
                G +     + + ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDGT V  G R
Sbjct  333   ---GGDDSTPVTYEHLKSLHYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVSGGAR  389

Query  793   VTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMAL  620
             V YHPY+MGRM  IWG+D   F+P+RWL    G F  E+ +KYPVFQAGLRVCLGKE+A+
Sbjct  390   VMYHPYSMGRMPRIWGADHGVFRPDRWLTGAGGSFVPESLYKYPVFQAGLRVCLGKELAI  449

Query  619   LELKSVALSVLRRFRVHLAQPHHT----PRFSPGLTATFRDGLPVFVQQ  485
              E+K+VA++V+R F V +     +    P+F  GLTA+   GLPV +++
Sbjct  450   TEMKAVAVAVVRGFDVEVVGESGSGACAPKFVSGLTASISGGLPVRIRR  498



>ref|XP_002442803.1| hypothetical protein SORBIDRAFT_08g003110 [Sorghum bicolor]
 gb|EES16641.1| hypothetical protein SORBIDRAFT_08g003110 [Sorghum bicolor]
Length=509

 Score =   493 bits (1268),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 267/473 (56%), Positives = 345/473 (73%), Gaps = 21/473 (4%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY HLLR SPS T+H+HVL  T+TANP NVEYMLK+
Sbjct  41    WCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESPSGTVHVHVLGCTVTANPANVEYMLKT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGK F+A+LGD LG GIFNVDG +WR QRK+AS+ELG  +V SYAF +I  E++
Sbjct  101   NFDNFPKGKTFAALLGDLLGGGIFNVDGHAWRHQRKMASLELGSVAVRSYAFRIIAQEVE  160

Query  1498  RRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+L A    G VVDLQDVFRRF+FD IC+ SFGLDP CLE  +P+S+ A +F  A+
Sbjct  161   ARLMPVLAAAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLEKEMPVSKLADAFDTAT  220

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +L A R  +ASP++WK KR LN+GSE+ELR++I++++ LA  +IR+RRKLG +  N  DL
Sbjct  221   RLCAMRGAAASPLLWKAKRLLNVGSERELREAIKLVDELAAAMIRERRKLGVA--NSHDL  278

Query  1141  LSRFMGSIGDDET-------YLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
             LSRFM S GDD         YLRDIV+SFLLAGRDTV+SALT+ F L++ +P  A+A+ A
Sbjct  279   LSRFMASAGDDAHHDDVDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPAVADAMRA  338

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             EA    G ++  +  EQ ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDGT V  
Sbjct  339   EA----GGSEAPLTYEQ-LKRLHYTHAVLYENMRLFPPVQFDSKFCAGPDVLPDGTYVSG  393

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKE  629
             GTRV YHPYAMGRM  IWG+D   F+P+RWL    G F  E+ +KYPVFQAGLRVCLGKE
Sbjct  394   GTRVMYHPYAMGRMPRIWGADHGAFRPDRWLTGAGGSFVPESLYKYPVFQAGLRVCLGKE  453

Query  628   MALLELKSVALSVLRRFRVHLAQPHHT----PRFSPGLTATFRDGLPVFVQQR  482
             +A+ E+K+VA++V+R F V +     +    P+F  GLTA+   GLPV + +R
Sbjct  454   LAITEMKAVAVAVVRAFDVQVVGDSGSAACAPKFVSGLTASISGGLPVRISRR  506



>ref|XP_008664407.1| PREDICTED: cytochrome P450 94C1-like [Zea mays]
 gb|ACG28209.1| cytochrome P450 CYP94C20 [Zea mays]
Length=507

 Score =   489 bits (1259),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 261/463 (56%), Positives = 337/463 (73%), Gaps = 15/463 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW   + NL DWY HLLR SP+ TIH+HVL  T+TANP NVEYML++
Sbjct  41    WCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESPTGTIHVHVLGCTVTANPANVEYMLRT  100

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
              F+NFPKGKAF+A+LGD LG GIFNVDG +WR QRK+AS+ELG  +V SYAF ++  E++
Sbjct  101   NFDNFPKGKAFAALLGDLLGGGIFNVDGHAWRHQRKMASLELGSVAVRSYAFGIVAQEVE  160

Query  1498  RRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+L A    G VVDLQDVFRRF+FD IC+ SFGLDP CLE  +P+S  A +F +A+
Sbjct  161   SRLVPVLAAAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLEREMPVSRLADAFDVAT  220

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +L A R  +ASP+VW+ KR LN+GSE+ELR++I +++ LA  VIR+RRKLG +  +  DL
Sbjct  221   RLCAMRGAAASPLVWRAKRLLNVGSERELREAIALVDELAAAVIRERRKLGVAGSH--DL  278

Query  1141  LSRFMGSIG---DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADR  971
             LSRFM S G    D+ YLRDIV+SFLLAGRDTV+SALT+ F L++ +P  A A+ AEA  
Sbjct  279   LSRFMASAGAGDGDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPGVAAAMRAEAGD  338

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
               G++   +  E  ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDGT V  GTRV
Sbjct  339   --GESAAPLTYEH-LKGLHYTHAVLYENMRLFPPVQFDSKFCAGPDVLPDGTYVAGGTRV  395

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMALL  617
             TYHPYAMGRM  IWG+D   F+P+RWL      F  E+ ++YPVFQAGLRVCLGKE+A+ 
Sbjct  396   TYHPYAMGRMPRIWGADHGAFRPDRWLTGAGASFVPESLYRYPVFQAGLRVCLGKELAVT  455

Query  616   ELKSVALSVLRRFRVHL----AQPHHTPRFSPGLTATFRDGLP  500
             E+K VA++V+R F V +          P+F  GLTA+   GLP
Sbjct  456   EMKVVAVAVVRAFDVEVVGDSGATACAPKFVSGLTASISGGLP  498



>gb|EAZ17458.1| hypothetical protein OsJ_32985 [Oryza sativa Japonica Group]
Length=499

 Score =   486 bits (1250),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 246/474 (52%), Positives = 327/474 (69%), Gaps = 38/474 (8%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +CSC VC AY++ SW  ++ NL DWY HLLR SP+ T+H+HVL  T+TANP NVE+ML++
Sbjct  46    WCSCHVCRAYLTGSWAREFTNLGDWYAHLLRRSPTGTVHVHVLGCTVTANPANVEHMLRT  105

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKG+ F+A+LGD LG GIFNVDG +WR QRK+AS+ELG  +V SYA+++I  E++
Sbjct  106   RFDNFPKGRPFAALLGDLLGDGIFNVDGHAWRHQRKMASLELGSVAVRSYAYKIIAQEVE  165

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+LA   D G V+DLQDVFRRF+FD IC+ SFGLDP CL+  +P+SE A +     
Sbjct  166   ARLMPVLADAADRGAVLDLQDVFRRFAFDNICKISFGLDPGCLDREMPVSELADA-----  220

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
                              KRFLN+GSE+ELRK+I+V++ LA  +IR+R+KLG    +  DL
Sbjct  221   ----------------AKRFLNVGSERELRKAIKVVDELAAAMIRERQKLGVGSSH--DL  262

Query  1141  LSRFMGSIG-----DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             LSRFM S G      D+ +LRDIV+SFLLAGRDTV++ALT+ F L++ +P+ A A+ AEA
Sbjct  263   LSRFMASTGVDDAAADDKFLRDIVVSFLLAGRDTVSTALTTLFMLLSKNPEVAAAMRAEA  322

Query  976   DRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGT  797
             +   G       + + ++ L+Y  A + E++RLFPP+QFDSKFC   DVLPDGT V    
Sbjct  323   EAGDGGETGAAITYEHLKGLHYTHAVLHENMRLFPPVQFDSKFCAAADVLPDGTYVGGDA  382

Query  796   RVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             RV YHPYAMGRM  IWG+D   F+P RWL      F   NP+KYPVFQAG RVCLGKE+A
Sbjct  383   RVMYHPYAMGRMPHIWGADYAAFRPARWLTGPGASFVPANPYKYPVFQAGQRVCLGKELA  442

Query  622   LLELKSVALSVLRRFRVHLAQPH-------HTPRFSPGLTATFRDGLPVFVQQR  482
             + E+K+ +++V+R F V +   +         PRF PGLTA+   GL V V++R
Sbjct  443   VTEMKAASVAVVRAFDVEVVGENGRSGGAAAAPRFVPGLTASISGGLQVRVRRR  496



>gb|EAZ19658.1| hypothetical protein OsJ_35235 [Oryza sativa Japonica Group]
Length=515

 Score =   484 bits (1245),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 238/410 (58%), Positives = 309/410 (75%), Gaps = 13/410 (3%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C C VC AY++ SW  ++ NL DWY  LLR SP+ T+H+HVL  T+TANP NVEYMLK+
Sbjct  38    WCGCHVCRAYLAGSWRREFANLGDWYADLLRRSPTGTVHVHVLGCTVTANPANVEYMLKT  97

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKG+ F+A+LGD LG GIFNVDGD+WR QRK+AS+ELG  +V SYA++++  E++
Sbjct  98    RFDNFPKGRPFAALLGDLLGDGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIVAQEVE  157

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+LA   D G VVDLQDVFRRF+FD IC+ SFGLDP CL+  +P+SE A +F  AS
Sbjct  158   ARLMPVLANAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDAAS  217

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP++WK+KRFLN+GSE+EL+K+I++++ LA  +IR+RRKLG +  N  DL
Sbjct  218   RLSAMRGAAASPLLWKMKRFLNVGSERELKKAIKLIDGLAAAMIRERRKLGVA--NSHDL  275

Query  1141  LSRFMGSIGD------DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
             LSRFM S GD      D+ +LRDIV+SFLLAGRDTV+SALT+ F +++ +PD A A+ AE
Sbjct  276   LSRFMASSGDDARGAADDKFLRDIVVSFLLAGRDTVSSALTTLFMILSKNPDVAAAMRAE  335

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             A    G++  +  S + ++ LNY  A + E++RLFPP+QFDSKFC   DVLPDGT V  G
Sbjct  336   AGAAAGESAAV--SYEHLKRLNYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVDGG  393

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQA  656
              RV YHPYAMGRM  IWG+DC  F+PERWL    G F  E+ FKYPVFQ 
Sbjct  394   ARVMYHPYAMGRMPRIWGADCDAFRPERWLTGAGGAFVPESLFKYPVFQG  443



>emb|CBX24475.1| hypothetical_protein [Oryza glaberrima]
Length=479

 Score =   481 bits (1237),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 249/475 (52%), Positives = 329/475 (69%), Gaps = 51/475 (11%)
 Frame = -2

Query  1858  YCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLKS  1679
             +C C VC AY++ SW  ++ NL DWY                              MLK+
Sbjct  38    WCGCHVCRAYLAGSWRREFANLGDWY------------------------------MLKT  67

Query  1678  RFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEID  1499
             RF+NFPKG+ F+A+LGD LG GIFNVDGD+WR QRK+AS+ELG  +V SYA++++  E++
Sbjct  68    RFDNFPKGRPFAALLGDLLGDGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIVAQEVE  127

Query  1498  RRLLPILAGKKD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLAS  1322
              RL+P+LA   D G VVDLQDVFRRF+FD IC+ SFGLDP CL+  +P+SE A +F  AS
Sbjct  128   ARLMPVLANAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDAAS  187

Query  1321  KLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDL  1142
             +LSA R  +ASP++WK+KRFLN+GSE+EL+K+I++++ LA  +IR+RRKLG +  N  DL
Sbjct  188   RLSAMRGAAASPLLWKMKRFLNVGSERELKKAIKLIDGLAAAMIRERRKLGVA--NSHDL  245

Query  1141  LSRFMGSIGD------DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
             LSRFM S GD      D+ +LRDIV+SFLLAGRDTV+SALT+ F +++ +PD A A+ AE
Sbjct  246   LSRFMASSGDDARGAADDKFLRDIVVSFLLAGRDTVSSALTTLFMILSKNPDVAAAMRAE  305

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
             A    G++  +  S + ++ LNY  A + E++RLFPP+QFDSKFC   DVLPDGT V  G
Sbjct  306   AGAAAGESAAV--SYEHLKRLNYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVDGG  363

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLR--DGVFFQENPFKYPVFQAGLRVCLGKEM  626
              RV YHPYAMGRM  IWG+DC  F+PERWL    G F  E+ FKYPVFQAGLRVCLGKE+
Sbjct  364   ARVMYHPYAMGRMPRIWGADCDAFRPERWLTGAGGAFVPESLFKYPVFQAGLRVCLGKEL  423

Query  625   ALLELKSVALSVLRRFRVHLA--------QPHHTPRFSPGLTATFRDGLPVFVQQ  485
             A+ E+K+V+++V+R F V +              PRF PGLTA+   GLPV +++
Sbjct  424   AITEMKAVSVAVVRAFDVEVVGENGRCGGGGAAAPRFVPGLTASISGGLPVKIRR  478



>ref|XP_009150186.1| PREDICTED: cytochrome P450 94B3 [Brassica rapa]
Length=502

 Score =   440 bits (1132),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 221/459 (48%), Positives = 309/459 (67%), Gaps = 19/459 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+    + L  WYT LLR SPS+TI I +L   R  +T NPENVEY+LK+ F NFPKG+ 
Sbjct  47    SFNKNRHRLLQWYTKLLRLSPSQTITIPLLGNRRTIVTTNPENVEYILKTNFFNFPKGRP  106

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ +LGD LGQGIFNVDG SW  QRK+AS E    S+ S+AFEV++ E++ R++P+L+  
Sbjct  107   FTDLLGDLLGQGIFNVDGHSWSSQRKLASHEFSTRSLRSFAFEVLREEVETRIVPVLSTA  166

Query  1468  KD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D G  VDLQDVF+RF+FD +C+ S G DP CL+   P++  A +F  A+++SA RA   
Sbjct  167   ADVGTTVDLQDVFKRFAFDVVCKVSLGWDPDCLDLTRPVNPLAEAFDTAAEISARRATEP  226

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGS  1121
                VWK KR LN+GSE+ LR++I  ++ L  E++R +RK   +GT  E  +DLLSRF+ S
Sbjct  227   LYAVWKAKRVLNVGSERRLREAIRTVHELVSEIVRAKRKSLEIGTGQEAKQDLLSRFLAS  286

Query  1120  IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA  941
              G D   +RD+VISF++AGRDT ++A+T  FWL++ + D  + +L E + ++     L  
Sbjct  287   -GHDSEAVRDMVISFIMAGRDTTSAAMTWLFWLLSENDDVEKKLLQEVEPLMS----LGL  341

Query  940   SEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRM  761
               + ++E++Y++A +CE++RL+PP+ +DSK    DDVLPDGT VK+G +VTY PY MGRM
Sbjct  342   GFEELKEMSYMKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRVKKGDKVTYFPYGMGRM  401

Query  760   EGIWGSDCLEFKPERW------LRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             E +WG DC EFKP RW      + + V    +PFK+PVFQAG RVC+GKEMA +++K V 
Sbjct  402   ENLWGKDCEEFKPSRWFDSEPGITEPVLKPVSPFKFPVFQAGPRVCIGKEMAFMQMKFVV  461

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              SVL RF + +    H P F P LTA    GL V +++R
Sbjct  462   GSVLSRFEI-IPVSKHKPVFVPLLTAHMAGGLKVKIKRR  499



>emb|CDY59153.1| BnaC08g48490D [Brassica napus]
Length=506

 Score =   429 bits (1103),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 215/451 (48%), Positives = 302/451 (67%), Gaps = 19/451 (4%)
 Frame = -2

Query  1795  LCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAFSAILGDF  1625
             L  WYT LLR SPS+TI I +L   R  +TANPENVEY+LK+ F NFPKGK F+ +LGD 
Sbjct  56    LLQWYTELLRLSPSQTISIPLLGNRRTIVTANPENVEYILKTNFFNFPKGKPFTDLLGDL  115

Query  1624  LGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGKKDGGV-VD  1448
             LG+GIFNVDG +W  QRK+AS      S+ S++FEV++ E++ RL+P+L    D G+ VD
Sbjct  116   LGKGIFNVDGHAWSSQRKLASHVFSARSLRSFSFEVLKEEVENRLVPVLLAAADAGMAVD  175

Query  1447  LQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWKIK  1268
             LQDV +RF+FD +C+ S G DP CL+   P++  A +F  A+++SA RA      VWK+K
Sbjct  176   LQDVLKRFAFDVVCKVSLGWDPDCLDLTRPVNPLAEAFDTAAEISARRATEPVYAVWKVK  235

Query  1267  RFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGSIGDDETYL  1097
             R LN+GSE+ LR++I  +++L  E++R ++K   +GT +E  +DLLSRF+ + G D   +
Sbjct  236   RALNVGSERRLREAIRTVHVLVSEIVRAKKKSLEIGTGEEAKQDLLSRFLAA-GHDGESV  294

Query  1096  RDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMREL  917
             RD+VISF++AGRDT ++A+T  FWL++ + D    +L E D ++     L    + ++E+
Sbjct  295   RDMVISFIMAGRDTTSAAMTWLFWLLSENGDVERKLLEEVDPLI----SLGLGFEELKEM  350

Query  916   NYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDC  737
             +Y +A +CE++RL+PP+ +DSK    DDVLPDGT VK+G +VTY PY MGRME +WG D 
Sbjct  351   SYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRVKKGDKVTYFPYGMGRMENLWGKDW  410

Query  736   LEFKPERWLRDG------VFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFR  575
              EFKP RW          V    +PFK+PVFQAG RVC+GKEMA +++K V   VL RF 
Sbjct  411   DEFKPSRWFDSKPGSTRPVLKPVSPFKFPVFQAGPRVCVGKEMAFMQMKYVVGYVLSRFE  470

Query  574   VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             + +    H P F P LTA    GL V +++R
Sbjct  471   I-VTVNKHKPAFVPLLTAHMAGGLKVKIKRR  500



>gb|ADE75655.1| unknown [Picea sitchensis]
Length=559

 Score =   429 bits (1104),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 224/490 (46%), Positives = 314/490 (64%), Gaps = 51/490 (10%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             +W   +L  SP++TI +  L   R  +TANPEN+E++LK+RF+N+PKG  F+AIL D LG
Sbjct  68    EWAAEMLAESPTQTIVVERLGGIRTVLTANPENLEHILKTRFDNYPKGNPFTAILHDLLG  127

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGKKDGG-VVDLQ  1442
             +GIFN DGD+W+ QRK+AS E    S+ ++  +V++ E+  RLLP+L    + G  ++LQ
Sbjct  128   KGIFNADGDTWKLQRKVASYEFSSGSLRNFVLKVVE-EVTDRLLPMLHNASETGRCLNLQ  186

Query  1441  DVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWKIKRF  1262
             D+ +RF+FD IC+ +FG+DP  L+     SE A +  +A+KLSA R+ +   +VWK+KR 
Sbjct  187   DILQRFAFDTICKVAFGVDPAWLDGRFAESELAGALDVAAKLSAGRSAAPIQLVWKMKRM  246

Query  1261  LNIGSEKELRKSIEVMNMLAMEVIRQRRK--------LGTSDENHKDLLSRFM--GSIGD  1112
             LNIGSEK L +++ V++  AMEVIR+RR            S     DLLSRFM   S   
Sbjct  247   LNIGSEKRLSEAVAVVHEFAMEVIRRRRSQISNGGCTASDSKWEQSDLLSRFMVLSSTNS  306

Query  1111  DET------------------------YLRDIVISFLLAGRDTVASALTSFFWLIANHPD  1004
             + T                        +LRD++ISF+LAGRDT +SALT FFWL+++HP 
Sbjct  307   NSTCKGHGHDMPTDAMGVEREDCCSDEFLRDMIISFILAGRDTTSSALTWFFWLLSSHPH  366

Query  1003  AAEAILAE-ADRVVGKNQDL--------IASEQRMRELNYLQAAVCESLRLFPPIQFDSK  851
               EAI  E A  +  ++QD+        + S + M+ ++YL A++CES+RL+PP+  DSK
Sbjct  367   VGEAIYKEIAHLIAARSQDIDSSSSSPVLFSYKEMQNMHYLHASICESMRLYPPVLLDSK  426

Query  850   FCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGVFFQENPFK  674
               + +DVLPDGT V +GTRVTYHPYAMGRM  IWG+DCL+FKPERW+ +DG F  ++PFK
Sbjct  427   HALHNDVLPDGTFVGKGTRVTYHPYAMGRMNAIWGADCLQFKPERWVNKDGHFVPQSPFK  486

Query  673   YPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVH--LAQPHHTPRFSPGLTATFRDGLP  500
             + VFQ G+RVCLGKEMA +E+K VA +V+  FR+   +     TP+    LTA    G P
Sbjct  487   FAVFQGGVRVCLGKEMAFIEMKFVAATVISMFRLQPPVDSRQRTPKLVHCLTARMEGGFP  546

Query  499   VFVQQR*CPP  470
             V VQ+R   P
Sbjct  547   VVVQRRTTTP  556



>ref|XP_007037964.1| Cytochrome P450 94A2 [Theobroma cacao]
 gb|EOY22465.1| Cytochrome P450 94A2 [Theobroma cacao]
Length=508

 Score =   427 bits (1099),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 219/459 (48%), Positives = 306/459 (67%), Gaps = 16/459 (3%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y     L DWYT LL  SPS+TI +  L   R  +TANP NVEYMLK+ F NFPKGK 
Sbjct  51    SFYKNRRRLLDWYTDLLSESPSQTIVVRRLGARRTVVTANPANVEYMLKTNFNNFPKGKP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-G  1472
             F+ ILGD LG GIFNVDG+ W  QRK+AS E    S+  +  + +Q E++ RLLP+L   
Sbjct  111   FTEILGDLLGCGIFNVDGELWSTQRKLASHEFSTKSLREFVVKTLQEEVENRLLPLLQEA  170

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              +   V+DLQDV RRF+FD IC+ S G DP CL+   P+     +F +AS++SA R M+ 
Sbjct  171   MESEKVLDLQDVLRRFAFDTICKVSLGHDPCCLDLSKPVPPLVKAFDIASEISAMRGMAP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD----ENHKDLLSRFMG  1124
               VVWKIKR LNIGSEK+L+++I+++    +E+IR +++   ++    ++ +DLLSR + 
Sbjct  231   MFVVWKIKRALNIGSEKKLKEAIKLVQDCVLEIIRNKKRALEAETKCCDDAEDLLSRLL-  289

Query  1123  SIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLI  944
             S G DE  +RD+VISF++AGRDT +SA++  FWL++ H +A   I+ E + ++   +  +
Sbjct  290   SAGHDEEVVRDMVISFIMAGRDTTSSAMSWLFWLLSKHQNAQNMIVKEVESMLCNGEKEL  349

Query  943   ASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGR  764
               E  ++E+N ++A +CES+RL+PP+ +DSK  + DDVLPDGT V++G RVTY PY MGR
Sbjct  350   NFEV-LKEMNCVKACLCESMRLYPPVAWDSKHALNDDVLPDGTFVEKGDRVTYFPYGMGR  408

Query  763   MEGIWGSDCLEFKPERWLRD-----GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             ME +WG D  EFKP+RW ++     G+    +PFK+PVFQAG RVCLGKEMA +++K V 
Sbjct  409   MEELWGKDRFEFKPDRWFQESDAENGLLKSVSPFKFPVFQAGPRVCLGKEMAFIQMKYVV  468

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              S+LRRF +        P F P LTA    GL V V++R
Sbjct  469   ASILRRFEIR-PVCQEQPVFVPLLTAHMAGGLNVLVRRR  506



>ref|XP_009149812.1| PREDICTED: cytochrome P450 94B3 [Brassica rapa]
 emb|CDY08079.1| BnaA06g16470D [Brassica napus]
Length=506

 Score =   426 bits (1094),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 302/453 (67%), Gaps = 19/453 (4%)
 Frame = -2

Query  1801  NNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAFSAILG  1631
             + L  WYT LLR SPS+TI I +L   R  +TANPENVEY+LK+ F NFPKGK F+ +LG
Sbjct  54    HRLLQWYTELLRLSPSQTISIPLLGSRRTIVTANPENVEYILKTNFFNFPKGKPFTDLLG  113

Query  1630  DFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGKKDGG-V  1454
             D LG+GIFNVDG +W  QRK+AS E    S+ S++FEV++ E++ RL+P L+   D G  
Sbjct  114   DLLGKGIFNVDGHAWSSQRKLASHEFSARSLRSFSFEVLKEEVENRLVPGLSAAADAGTT  173

Query  1453  VDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWK  1274
             VDLQDV +RF+FD +C+ S G DP CL+   P++  A +F  A+++SA RA      VWK
Sbjct  174   VDLQDVLKRFAFDVVCKVSLGWDPDCLDLTRPVNPLAEAFDTATEISARRATEPVYAVWK  233

Query  1273  IKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGSIGDDET  1103
             +KR LN+GSE+ LR++I  +++L  E++R ++K   +GT +E  +DLLSRF+ + G D  
Sbjct  234   VKRALNVGSERRLREAIRTVHVLVSEIVRAKKKSLEIGTGEEAKQDLLSRFLAA-GHDGE  292

Query  1102  YLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMR  923
              +RD+VISF++AGRDT ++A+T  FWL++ + +    +L E D ++     L    + ++
Sbjct  293   SVRDMVISFIMAGRDTTSAAMTWLFWLLSENGNVERKLLEEVDPLI----SLGLGFEELK  348

Query  922   ELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGS  743
             E++Y +A +CE++RL+PP+ +DSK    DDVLPDGT VK+G +VTY PY MGRME +WG 
Sbjct  349   EMSYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRVKKGDKVTYFPYGMGRMENLWGK  408

Query  742   DCLEFKPERWLRD------GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRR  581
             D  EFKP RW          V    +PFK+PVFQAG RVC+GKEMA +++K V   VL R
Sbjct  409   DWDEFKPSRWFDSEPGSTRPVLKPVSPFKFPVFQAGPRVCVGKEMAFMQMKYVVGYVLSR  468

Query  580   FRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             F + +      P F P LTA    GL V +++R
Sbjct  469   FEI-VTVNKDKPAFVPLLTAHMAGGLKVKIKRR  500



>ref|XP_010045499.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=528

 Score =   425 bits (1092),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 218/464 (47%), Positives = 309/464 (67%), Gaps = 20/464 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI IH L   R  +TANPENVE++LK+ F N+PKG  
Sbjct  51    SFYRNRSRLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPENVEHVLKNNFHNYPKGVP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F++ILGDFLG GIFNVDG  W  QRK+AS E   +S+  +    ++ E++ RLLP+L   
Sbjct  111   FTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFLVRTLEAEVENRLLPLLQDY  170

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++ A RA S 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENH----KDLLSRF  1130
               +VWKIKR LNIGSEK+L +++++++   +++IR R+K  L  +D+       DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + + G  E  +RD+VISF++AGRDT ++A+T  FWL+A + +A E I++E D ++ ++ +
Sbjct  291   LAA-GHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEIVSEVDSILDRSYN  349

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+PP+ +DSK    DDVLPDGTAV+RG RVTY PY M
Sbjct  350   KCLDFEALKEMKFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGTAVRRGDRVTYFPYGM  409

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GR+E +WG D LEFKP+RWL         +G     +P++YPVFQAG RVCLGKEMA ++
Sbjct  410   GRLEELWGKDRLEFKPDRWLVEPGVEGGAEGELRAVSPYEYPVFQAGPRVCLGKEMAFIQ  469

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K V  S+LRRF +      + P F P LTA    GL V V++R
Sbjct  470   MKYVVASILRRFEIRPVL-ENRPVFVPLLTAHMAGGLKVVVKKR  512



>ref|XP_009415113.1| PREDICTED: cytochrome P450 94B3-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   424 bits (1091),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 214/451 (47%), Positives = 300/451 (67%), Gaps = 12/451 (3%)
 Frame = -2

Query  1816  WYAKYNNLCDWYTHLLRNSPSKTI---HIHVLRNTITANPENVEYMLKSRFENFPKGKAF  1646
             +Y   + L DWYT +L+ SP+ T     +   R  +TANPEN+E+MLK+ F N+PKGK F
Sbjct  77    FYKNRHRLLDWYTEMLKASPNLTFVMWRLGARRIVVTANPENLEHMLKTNFPNYPKGKPF  136

Query  1645  SAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK-  1469
             + ILGDFLG+GI + DGD W  QRK+AS E    S+  +   V++ E+  RLLPIL+   
Sbjct  137   TDILGDFLGRGILSADGDLWHMQRKLASHEFSARSLREFVVNVLEREVGERLLPILSSAC  196

Query  1468  KDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSAS  1289
              D  VVD+QD+ RRF+FD +C+ SFG DP  L+  LP S  A +F +AS +SA+R  +  
Sbjct  197   ADRRVVDMQDLLRRFAFDTVCKISFGTDPGLLDPSLPESALAGAFEVASAISAKRGAAPV  256

Query  1288  PVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDD  1109
              VVWK KR L +GSE++LR ++++++   MEVIR+R+    +   HKDLLSR +   G +
Sbjct  257   FVVWKAKRALGVGSERQLRAAVKLIHASIMEVIRRRKATLENGTQHKDLLSRLITG-GHE  315

Query  1108  ETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQR  929
             E  +RD+VISF++AGRDT ++ALT FFWL++ HP+    ++ EA R  G++ DL A    
Sbjct  316   EEVIRDMVISFVMAGRDTTSAALTWFFWLVSGHPEVEAELVKEAKRAKGRS-DLHA----  370

Query  928   MRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIW  749
             ++++  L+A +CES+RL+PP+ +DSK  V DDVLPDGT ++ G RVTY PY MGRME +W
Sbjct  371   LKDMKTLEACLCESMRLYPPVVWDSKHAVSDDVLPDGTRIRGGDRVTYFPYGMGRMERLW  430

Query  748   GSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRV  572
             G +CL+F   RWL + G   +E+PFK+PVFQAG R+CLGKEMA L++K +A +VLR F +
Sbjct  431   GENCLDFDHRRWLSESGEVVRESPFKFPVFQAGPRICLGKEMAFLKMKYIAAAVLREFAL  490

Query  571   HLAQ-PHHTPRFSPGLTATFRDGLPVFVQQR  482
                +     P   P LTA    GL + V  R
Sbjct  491   RRVEGERQKPTLVPMLTAHMAGGLQMVVDSR  521



>gb|KFK34160.1| hypothetical protein AALP_AA5G108200 [Arabis alpina]
Length=503

 Score =   422 bits (1084),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 301/453 (66%), Gaps = 19/453 (4%)
 Frame = -2

Query  1801  NNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAFSAILG  1631
             + L  WYT LLR SP++TI I +L   R  +T NPENVEY+LK+ F NFPKGK F+ +LG
Sbjct  54    HRLLQWYTELLRLSPTQTISIPLLGNRRTIVTTNPENVEYILKTNFFNFPKGKPFTDLLG  113

Query  1630  DFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGKKD-GGV  1454
             D LG+GIFNVDG SW  QRK+AS E    S+ S+AFEV++ E++ RL+P+L+   D G  
Sbjct  114   DLLGKGIFNVDGHSWSSQRKLASHEFSTRSLRSFAFEVLKDEVETRLVPVLSTAADVGAT  173

Query  1453  VDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWK  1274
             +DLQDV +RF+FD +C+ S G DP CL+   P++    +F  A+++SA RA      VWK
Sbjct  174   MDLQDVLKRFAFDVVCKVSLGWDPDCLDLSRPVNPLLEAFDTAAEISARRATEPVYAVWK  233

Query  1273  IKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGSIGDDET  1103
             +KR LN+GSE+ LR++I+ +++L  E++R ++K   +GT  E  +DLLSRF+ + G D  
Sbjct  234   MKRVLNVGSERRLREAIKTVHVLVSEIVRAKKKSLEIGTGVEAKQDLLSRFLAA-GHDGE  292

Query  1102  YLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMR  923
              +RD+VISF++AGRDT ++A+T  FWL+  + +    IL E D +V     L    + ++
Sbjct  293   AVRDMVISFIMAGRDTTSAAMTWLFWLLTENGEVERKILEEVDPLVS----LGLGFEELK  348

Query  922   ELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGS  743
             +++Y +A +CE++RL+PP+ +DSK    DDVLPDGT VKRG +VTY PY MGRME +WG 
Sbjct  349   DMSYTKACLCETMRLYPPVSWDSKHAANDDVLPDGTRVKRGDKVTYFPYGMGRMETLWGK  408

Query  742   DCLEFKPERWLRD------GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRR  581
             D  +FKP RW          V    +PFK+PVFQAG RVC+GKEMA +++K V  SVL R
Sbjct  409   DWEQFKPNRWFDSEPGSIRPVLKPVSPFKFPVFQAGPRVCVGKEMAFMQMKYVVGSVLSR  468

Query  580   FRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             F + +      P F P LTA    GL V +++R
Sbjct  469   FEI-VPVKKDQPVFVPLLTAHMAGGLMVKIKRR  500



>ref|XP_002322606.2| hypothetical protein POPTR_0016s03160g [Populus trichocarpa]
 gb|EEF04367.2| hypothetical protein POPTR_0016s03160g [Populus trichocarpa]
Length=499

 Score =   420 bits (1079),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 213/444 (48%), Positives = 292/444 (66%), Gaps = 9/444 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             +W T  L + P+ T   H    +   ITANP NVEY+LK+ FEN+PKG  F  +L DFLG
Sbjct  57    EWTTETLSHCPTNTAVFHRPGKVHGIITANPLNVEYILKTNFENYPKGDRFINLLEDFLG  116

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKDGGVVDLQ  1442
             +GIFN DG+ WR QRK AS E    S+ ++  E ++ EI  RL+PILA   K   V+DLQ
Sbjct  117   RGIFNSDGELWRVQRKTASYEFNTKSLRNFVMENVEVEISTRLVPILAKASKTKQVLDLQ  176

Query  1441  DVFRRFSFDCICRFSFGLDPKCLES-LLPMSEFAVSFHLASKLSAERAMSASPVVWKIKR  1265
             D+  RF+FD IC+ +F +DP CL        EF  +F  A+  S+ R M   PV WKI R
Sbjct  177   DILERFAFDNICKVAFNVDPACLGGDGTSGGEFMRAFEDAATFSSGRFMYVLPVFWKINR  236

Query  1264  FLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYLRDIV  1085
             F N+G+EK LR+S+++++  A E+IR R +L T ++N +D LSRF+G   +   +LRDIV
Sbjct  237   FFNVGTEKTLRESVKIVHEFADEMIRSRMELKT-EKNDEDFLSRFIGKDENSTEFLRDIV  295

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV---VGKNQDLIASEQRMRELN  914
             ISF+LAGRDT +SAL+ FFWL++ +PD    IL E + +    GKN     S + +R+++
Sbjct  296   ISFILAGRDTTSSALSWFFWLLSLNPDVEGNILKELETIRSSNGKNLGDTYSFEELRDMH  355

Query  913   YLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCL  734
             YLQAA+ E+LRL+PP+  D+K C  DDVLPDGT V +   VTYH YAMGRME IWG +C 
Sbjct  356   YLQAAISETLRLYPPVPVDTKACQSDDVLPDGTFVGKNWFVTYHAYAMGRMESIWGKNCR  415

Query  733   EFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPH  554
             +F PERWL +G++ QE+PFK+PVF AG R+CLGK+MA +++KS+A SV+ RF + +    
Sbjct  416   DFVPERWLENGIYRQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVIERFEIDVQNKE  475

Query  553   HTPRFSPGLTATFRDGLPVFVQQR  482
               P     LT   + GL V V++R
Sbjct  476   KCPDHLLSLTLRMKGGLQVKVKER  499



>ref|XP_002964775.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ33613.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
Length=490

 Score =   419 bits (1077),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/441 (46%), Positives = 294/441 (67%), Gaps = 9/441 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIHVLRNT--ITANPENVEYMLKSRFENFPKGKAFSAILGDFLGQ  1616
             +W T  + NSPS T       +T  IT NP  VE++LK+ FEN+PKG+     L D LG 
Sbjct  54    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  113

Query  1615  GIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG-KKDGGVVDLQD  1439
             GIFNVDG+ W+ QR++AS E    S+  +  + +  E+  RLLP LA   +DG  +DLQD
Sbjct  114   GIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  173

Query  1438  VFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWKIKRFL  1259
             +F RF+FD IC+ SFG+DP CL+   P  +FA +F  A+ LS  R     P+VWK+ R L
Sbjct  174   LFMRFNFDNICKLSFGVDPACLDPSFPEVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  233

Query  1258  NIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMG--SIGDDETYLRDIV  1085
             N+G E+EL++ ++V+N  A+ V+++RR+       ++DLLSRF+G  S    + +LRDI+
Sbjct  234   NVGPERELKEVLDVVNEFAVSVVQKRRE--EKGRVNQDLLSRFIGLDSTSFSDEFLRDII  291

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMRELNYLQ  905
             ISF+LAG+DT A +L+ FFWL++NHP   + I+ E   +V K  D   + + +R++ YLQ
Sbjct  292   ISFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIREVGSIVAKGSDRPFTYEELRDMVYLQ  351

Query  904   AAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCLEFK  725
             AA+CES+RL+PP+  D+K     DVLPDG +V++G +V+YH YAMGRME +WG DCLEFK
Sbjct  352   AALCESMRLYPPVPIDTKVVKNSDVLPDGNSVEKGMKVSYHVYAMGRMESLWGKDCLEFK  411

Query  724   PERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPHHTP  545
             PERW++DG F   +PFK+PVFQAG RVCLGKEMA+L++K V  +++ +F + + +    P
Sbjct  412   PERWIQDGQFVAVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVGK--EEP  469

Query  544   RFSPGLTATFRDGLPVFVQQR  482
              +   +T   +DGLPV  + R
Sbjct  470   CYGINMTLIMKDGLPVVPKLR  490



>gb|KCW83161.1| hypothetical protein EUGRSUZ_B00116 [Eucalyptus grandis]
Length=511

 Score =   420 bits (1079),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 215/457 (47%), Positives = 304/457 (67%), Gaps = 20/457 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI IH L   R  +TANPENVE++LK+ F N+PKG  
Sbjct  51    SFYRNRSRLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPENVEHVLKNNFHNYPKGVP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F++ILGDFLG GIFNVDG  W  QRK+AS E   +S+  +    ++ E++ RLLP+L   
Sbjct  111   FTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFLVRTLEAEVENRLLPLLQDY  170

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++ A RA S 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENH----KDLLSRF  1130
               +VWKIKR LNIGSEK+L +++++++   +++IR R+K  L  +D+       DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + + G  E  +RD+VISF++AGRDT ++A+T  FWL+A + +A E I++E D ++ ++ +
Sbjct  291   LAA-GHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEIVSEVDSILDRSYN  349

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+PP+ +DSK    DDVLPDGTAV+RG RVTY PY M
Sbjct  350   KCLDFEALKEMKFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGTAVRRGDRVTYFPYGM  409

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GR+E +WG D LEFKP+RWL         +G     +P++YPVFQAG RVCLGKEMA ++
Sbjct  410   GRLEELWGKDRLEFKPDRWLVEPGVEGGAEGELRAVSPYEYPVFQAGPRVCLGKEMAFIQ  469

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGL  503
             +K V  S+LRRF +      + P F P LTA    GL
Sbjct  470   MKYVVASILRRFEIRPVL-ENRPVFVPLLTAHMAGGL  505



>ref|XP_002961706.1| hypothetical protein SELMODRAFT_76541 [Selaginella moellendorffii]
 gb|EFJ36966.1| hypothetical protein SELMODRAFT_76541 [Selaginella moellendorffii]
Length=490

 Score =   419 bits (1076),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/441 (46%), Positives = 293/441 (66%), Gaps = 9/441 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIHVLRNT--ITANPENVEYMLKSRFENFPKGKAFSAILGDFLGQ  1616
             +W T  + NSPS T       +T  IT NP  VE++LK+ FEN+PKG+     L D LG 
Sbjct  54    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  113

Query  1615  GIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG-KKDGGVVDLQD  1439
             GIFNVDG+ W+ QR++AS E    S+  +  + +  E+  RLLP LA   +DG  +DLQD
Sbjct  114   GIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  173

Query  1438  VFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWKIKRFL  1259
             +F RF+FD IC+ SFG+DP CL+   P  +FA +F  A+ LS  R     P+VWK+ R L
Sbjct  174   LFMRFNFDNICKLSFGVDPACLDPSFPEVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  233

Query  1258  NIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMG--SIGDDETYLRDIV  1085
             N+G E+EL++ ++V+N  A+ V+++RR+       ++DLLSRF+G  S    + +LRDI+
Sbjct  234   NVGPERELKEVLDVVNEFAVSVVQKRRE--EKGRVNQDLLSRFIGLDSTSFSDEFLRDII  291

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMRELNYLQ  905
             ISF+LAG+DT A +L+ FFWL++NHP   + I+ E   +V K  D   + + +R++ YLQ
Sbjct  292   ISFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIREVGSIVAKGSDRPFTYEELRDMVYLQ  351

Query  904   AAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCLEFK  725
             AA+CES+RL+PP+  D+K     DVLPDG  V++G +V+YH YAMGRME +WG DCLEFK
Sbjct  352   AALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAMGRMESLWGKDCLEFK  411

Query  724   PERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPHHTP  545
             PERW++DG F   +PFK+PVFQAG RVCLGKEMA+L++K V  +++ +F + + +    P
Sbjct  412   PERWIQDGQFVAVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVGK--EEP  469

Query  544   RFSPGLTATFRDGLPVFVQQR  482
              +   +T   +DGLPV  + R
Sbjct  470   CYGINMTLIMKDGLPVVPKLR  490



>ref|XP_002988642.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ10438.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
Length=491

 Score =   418 bits (1074),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 204/441 (46%), Positives = 293/441 (66%), Gaps = 8/441 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIHVLRNT--ITANPENVEYMLKSRFENFPKGKAFSAILGDFLGQ  1616
             +W T  + NSPS T       +T  IT NP  VE++LK+ FEN+PKG+     L D LG 
Sbjct  54    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  113

Query  1615  GIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG-KKDGGVVDLQD  1439
             GIFNVDG+ W+ QRK+AS E    S+  +  + +  E+  RLLP LA   +DG  +DLQD
Sbjct  114   GIFNVDGELWKIQRKLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  173

Query  1438  VFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWKIKRFL  1259
             +F RF+FD IC+ SFG+DP CL+   P  +FA +F  A+ LS  R     P+VWK+ R L
Sbjct  174   LFMRFNFDNICKLSFGVDPACLDPSFPEVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  233

Query  1258  NIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMG--SIGDDETYLRDIV  1085
             N+G E+EL++ ++V+N  A+ V+++RR+       ++DLLSRF+G  S    + +LRDI+
Sbjct  234   NVGPERELKEVLDVVNEFAVSVVQKRRE--EKGRVNQDLLSRFIGLDSTSFSDEFLRDII  291

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMRELNYLQ  905
             ISF+LAG+DT A +L+ FFWL++NHP   + I+ E   +V K  +   + + +R++ YLQ
Sbjct  292   ISFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIREVGSIVAKGSNRPFTYKELRDMVYLQ  351

Query  904   AAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCLEFK  725
             AA+CES+RL+PP+  D+K     DVLPDG  V++G +V+YH YAMGRME +WG DCLEFK
Sbjct  352   AALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAMGRMESLWGKDCLEFK  411

Query  724   PERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPHHTP  545
             PERW++DG F + +PFK+PVFQAG RVCLGKEMA+L++K V  +++ +F + +      P
Sbjct  412   PERWIQDGQFVEVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVVGKEE-P  470

Query  544   RFSPGLTATFRDGLPVFVQQR  482
              +   +T   +DGLPV  + R
Sbjct  471   CYGINMTLIMKDGLPVVPKLR  491



>ref|XP_007050381.1| Cytochrome P450 94A1 [Theobroma cacao]
 gb|EOX94538.1| Cytochrome P450 94A1 [Theobroma cacao]
Length=504

 Score =   417 bits (1072),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 214/473 (45%), Positives = 304/473 (64%), Gaps = 19/473 (4%)
 Frame = -2

Query  1864  LFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVE  1694
             +F  S  +  +Y++    +  +N   W T +L+ SPS T  +H L   R  +TANP NV+
Sbjct  35    IFPKSYPIIGSYLAVK--SNRSNRMQWMTQILQTSPSATFTLHHLFGHRQILTANPANVQ  92

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             +MLK+ F N+ KG    ++L DFLG GIFNVDG+SW+FQR+++S E    S+  +   V+
Sbjct  93    HMLKTHFNNYQKGPFSISVLFDFLGNGIFNVDGESWKFQRQVSSHEFNTKSLRKFVQTVV  152

Query  1513  QTEIDRRLLPILA-GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
              TE+  RL+P+ +    D  V+DLQ++ +RF+FD +C+ +FG DP CL   LP S FA +
Sbjct  153   DTELHDRLIPMFSEAASDKTVLDLQEILQRFAFDNVCKIAFGFDPACLLPSLPQSRFAEA  212

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTS  1163
             F  A+ LS+ER  +   + WKIKRF NIGSEK L+ ++  +   A +++R++++     S
Sbjct  213   FEDATNLSSERFRTFHNIAWKIKRFFNIGSEKRLKIAVSQVRDFAKKIVREKKQELADKS  272

Query  1162  DENHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILA  983
                  DLLSRF+ S   DE ++ DIVISF+LAGRDT ++ALT FFWL+  HP+  + IL 
Sbjct  273   SLESVDLLSRFLQSGHSDENFVTDIVISFILAGRDTTSAALTWFFWLVYKHPEVEKEILK  332

Query  982   EADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             E      K++  +   + ++E+ Y  A++CE +RL+PP+  DSK  ++DDVLPDGT VK+
Sbjct  333   EI-----KDKSAMPVFEEVKEMVYTHASLCECMRLYPPVPADSKLAMDDDVLPDGTVVKK  387

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWL-RDGV----FFQENPFKYPVFQAGLRVCL  638
             GT +TYHPYAMGRME IWGSD  +FKPERWL RD      F   +P+ YPVFQAG R+C+
Sbjct  388   GTLMTYHPYAMGRMEKIWGSDWEDFKPERWLERDEAGKWSFVGRDPYTYPVFQAGPRICM  447

Query  637   GKEMALLELKSVALSVLRRFRVHLA-QPHHTPRFSPGLTATFRDGLPVFVQQR  482
             GKEMA L++K V   VLRRF+V  A +    P F   LT+  + G PV V+ R
Sbjct  448   GKEMAFLQMKRVVAGVLRRFKVVPAVEDGLQPEFLVYLTSKMKGGFPVRVEDR  500



>ref|XP_010026558.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
 gb|KCW83164.1| hypothetical protein EUGRSUZ_B00119 [Eucalyptus grandis]
Length=514

 Score =   417 bits (1073),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 215/464 (46%), Positives = 306/464 (66%), Gaps = 20/464 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI IH L   R  +TANP+NVE++LK+ F N+PKG  
Sbjct  52    SFYRNRSRLLDWYTDLLSRSPTQTIVIHRLGACRTVVTANPDNVEHVLKANFHNYPKGVP  111

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F++ILGD LG GIFNVDG  W  QRK+AS E    S+  +   +++ E++ RLLP+L   
Sbjct  112   FTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTHSLRDFVLRMLEAEVENRLLPLLQDY  171

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ +RF+FD +C+ S G DP CL+   P+     +F  AS++ A RA S 
Sbjct  172   ADTDRTLDLQDLLKRFTFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  231

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHK---DLLSRF  1130
               +VWKIKR L+IGSEK+L +++++++   +++IR R+K       D+  K   DLLSRF
Sbjct  232   VYLVWKIKRALSIGSEKKLAEAVKLVHGDILDIIRNRKKKLLQENGDQQIKYDGDLLSRF  291

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + + G  E  +RD+VISF++AGRDT ++A+T  FWL+A + +A +AI++E D ++ ++ +
Sbjct  292   LAA-GHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEQAIISEIDSILDQSCN  350

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+PPI +DSK    DDVLPDGT V++G RVTY PY M
Sbjct  351   KFLEFENLKEMKFLKACLCESMRLYPPITWDSKHATVDDVLPDGTPVRKGDRVTYFPYGM  410

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GRME +WG D LEFKP+RWL          G     +PFKYPVFQAG RVCLGK+MA ++
Sbjct  411   GRMEELWGKDRLEFKPDRWLVGPGMEDGAKGELRAVSPFKYPVFQAGPRVCLGKQMAFIQ  470

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K V  S+LRRF +      + P F P LTA    GL V V++R
Sbjct  471   MKYVVASILRRFEIRPVL-ENGPIFVPLLTAHMAGGLKVAVKKR  513



>ref|XP_002511196.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51798.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score =   416 bits (1069),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 210/461 (46%), Positives = 301/461 (65%), Gaps = 19/461 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y     L DWYT LL  SP++TI +  L   R  +TANP NVE+MLKS F NFPKGK 
Sbjct  20    SFYKNRFRLLDWYTDLLSVSPTQTIEVQRLGGRRIVVTANPANVEHMLKSNFSNFPKGKP  79

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ ILGD LG GIFN DG+ W  QRK+AS E    S+  +  + +Q  ++ RL+P+L   
Sbjct  80    FTEILGDLLGCGIFNADGELWSTQRKLASHEFSTKSLREFVVKTLQEVVENRLIPLLEDA  139

Query  1468  KD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D   V+DLQDV RRF+FD +C  S G DP CL+   P+     +F  AS++SA R  + 
Sbjct  140   ADRESVLDLQDVLRRFAFDIVCLVSLGTDPFCLDFSRPIPPLVKAFDTASEISAMRGTAP  199

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGD  1112
                VWK KR LN+G+EK+L++++++++   +E+++ ++K+  +D+   DLLSR + S G 
Sbjct  200   VYAVWKTKRMLNLGTEKKLKEAVKMVHSSVLEIVKNKKKVLENDQGS-DLLSRLL-SGGH  257

Query  1111  DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQ  932
             DE  +RD+VISF++AGRDT ++A+T  FWL++ + ++ E I+ E   ++ + +  I  E 
Sbjct  258   DEEVIRDMVISFIMAGRDTTSAAMTWLFWLLSKNKNSEEMIVKEVTTLLNRGEKAIDFEL  317

Query  931   RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGI  752
              ++E+N+L+A++CES+RL+PP+ +DSK  + DD+LPDGT V +G RVTY PY MGRME +
Sbjct  318   -LKEMNFLKASLCESMRLYPPVAWDSKHALSDDILPDGTFVGKGDRVTYFPYGMGRMEKL  376

Query  751   WGSDCLEFKPERWLRDGVFF-----------QENPFKYPVFQAGLRVCLGKEMALLELKS  605
             WG DC EFKP+RW    V F             +P+K+PVFQAG RVCLGKEMA +++K 
Sbjct  377   WGKDCFEFKPDRWFNKPVGFGFESTGDRVMKSVSPYKFPVFQAGPRVCLGKEMAFIQMKY  436

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             VA S+LRRF +   +    P   P LTA    GL V V++R
Sbjct  437   VAASILRRFEIRPVR-EDQPVLVPLLTAHMAGGLKVTVKRR  476



>ref|XP_010250749.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=488

 Score =   416 bits (1070),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 212/462 (46%), Positives = 300/462 (65%), Gaps = 17/462 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y     L DWYT LL  SP+KTI +  L   R  ITANP+NVEYML++ F NFPKGK 
Sbjct  18    SFYKNRFRLLDWYTELLAQSPAKTIVVQRLGARRTVITANPDNVEYMLRTNFSNFPKGKP  77

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AG  1472
             F+ ILGD LG GIFNVDG+ WR QRK+ S E    S+  +  + +  E++ RLLP+L + 
Sbjct  78    FTEILGDLLGYGIFNVDGELWRTQRKLVSHEFTTKSLREFVVKTLVEEVEERLLPLLESA  137

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
               +  VVD+Q++ RRF+FD +C+ S G+DP CL++ L +S  A +F +AS++SA RA + 
Sbjct  138   SANNKVVDMQELLRRFAFDTVCKVSLGMDPGCLDASLTISPLARAFDVASEISARRAAAP  197

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE-----NHKDLLSRFM  1127
                VWKIKR L +GSE +L+++IE ++    E+IR ++K  ++ E     ++ DLLSR +
Sbjct  198   VFAVWKIKRLLRMGSEWQLKQAIEDVHRSVEEIIRDKKKKISAGESRGEHDNGDLLSRLI  257

Query  1126  GSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDL  947
              S G D+   RD+VISF++AGRDT ++A+T  FW ++ HP+  + ++ E    +G ++  
Sbjct  258   -SAGHDDDVTRDMVISFIMAGRDTTSAAMTWLFWSLSRHPNTEKEVVKEVVTALGNDEPK  316

Query  946   IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
                 + +++L  L+A +CES+RL+PP+ +DSK  V  D LPDGT V  G RVTY PY MG
Sbjct  317   SLDYEALKDLPLLKACLCESMRLYPPVAWDSKHSVRADTLPDGTKVGVGDRVTYFPYGMG  376

Query  766   RMEGIWGSDCLEFKPERWLRD-----GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             RME +WG D LEFKP+RW  +     G   + +P+K+PVFQAG RVCLGKEMA +++K V
Sbjct  377   RMESLWGKDRLEFKPDRWFLEPDKEGGALKEVSPYKFPVFQAGPRVCLGKEMAFIQMKYV  436

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDG--LPVFVQQR  482
               S+LRRF +        P F P LTA    G  + V V+QR
Sbjct  437   VASILRRFELRPVASERKPVFVPLLTAHMAGGFNVNVVVRQR  478



>ref|XP_006351473.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=489

 Score =   416 bits (1070),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 215/451 (48%), Positives = 293/451 (65%), Gaps = 9/451 (2%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL +SP++TI +      R  ITANP+NVEYMLK+ F N+PKGK 
Sbjct  41    SFYKNRHRLLDWYTQLLSDSPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKP  100

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AG  1472
             F+ ILGDFLG+GIFNVDG+ W  QRK+AS E   +S+  +  + ++  ++ RL+P+L   
Sbjct  101   FTDILGDFLGRGIFNVDGELWNAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQA  160

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              K G  +DLQDV RRFSFD IC+ S G DP CL+ L  +     SF  AS+  A R M+ 
Sbjct  161   AKSGKALDLQDVLRRFSFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASRACAMRGMAP  220

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGD  1112
                +WK KR LN+GSEK+L+++++ ++    E+I+++++    +EN  DLLSR + +  +
Sbjct  221   VYAIWKSKRALNLGSEKQLKENVKRVHCCIDEIIQEKKEKIIINENGGDLLSRLLIAGHE  280

Query  1111  DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQ  932
             DE  LRD+VISFL+AGRDT +SALT  FWL  NHP+    ++ E   +   N D      
Sbjct  281   DEV-LRDMVISFLMAGRDTTSSALTWLFWLTTNHPNIKNEMIDEITSI--NNGDKALEFD  337

Query  931   RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGI  752
              ++E+ YL A + ES+RL+PP+ +DSK   +DD+LPDGT V++G RVTY PY MGRME I
Sbjct  338   ELKEMKYLAACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRMEEI  397

Query  751   WGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFR  575
             WG D LEFKP+RW+  +G      P+KYPVFQAG R+CLGKEMA  ++K V  SVLRRF 
Sbjct  398   WGKDRLEFKPDRWIDENGGSKSVCPYKYPVFQAGPRMCLGKEMAFTQMKYVLASVLRRFE  457

Query  574   VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +        P F P LTA    G  V + +R
Sbjct  458   IKPVNVEK-PVFLPLLTAHMVGGFNVRIYER  487



>ref|XP_011041380.1| PREDICTED: cytochrome P450 94A1-like [Populus euphratica]
Length=499

 Score =   416 bits (1070),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 213/444 (48%), Positives = 292/444 (66%), Gaps = 9/444 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             +W T  L + P+ T   H    +   ITANP NVEY+LK+ FEN+PKG  F  +L DFLG
Sbjct  57    EWTTETLSHCPTNTAVFHRPGKVHGIITANPLNVEYILKTNFENYPKGDRFINLLEDFLG  116

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKDGGVVDLQ  1442
             +GIFN DG+ WR QRK AS E    S+ ++  + ++ EI  RL+PILA   K   V+DLQ
Sbjct  117   RGIFNSDGELWRVQRKTASYEFNTKSLRNFVMDNVEVEISTRLVPILAQASKTKQVLDLQ  176

Query  1441  DVFRRFSFDCICRFSFGLDPKCLES-LLPMSEFAVSFHLASKLSAERAMSASPVVWKIKR  1265
             D+  RF+FD IC+ +F +DP CL        EF  +F  AS LS+ R M   PV WKI R
Sbjct  177   DILERFAFDNICKVAFNVDPACLGGDGTSGGEFMRAFEDASTLSSGRFMYVLPVFWKINR  236

Query  1264  FLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYLRDIV  1085
             F N+G+EK LR+S+++++  A E+IR R +  T ++N +DLLSRF+G   +   +LRDIV
Sbjct  237   FFNVGTEKTLRESVKIVHEFADEMIRSRMEQIT-EKNDEDLLSRFIGKDENSTEFLRDIV  295

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV---VGKNQDLIASEQRMRELN  914
             ISF+LAGRDT +SAL+ FFWL++ +P     IL E + +    GKN     S + +R+++
Sbjct  296   ISFILAGRDTTSSALSWFFWLLSLNPAVEGNILKELETIRSSNGKNLGDTYSFEELRDMH  355

Query  913   YLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCL  734
             YLQAA+ E+LRL+PP+  D+K C  DDVLPDGT V +   VTYH YAMGRME IWG +C 
Sbjct  356   YLQAAISETLRLYPPVPVDTKACQSDDVLPDGTFVGKKWFVTYHAYAMGRMESIWGKNCR  415

Query  733   EFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPH  554
             +F PERWL +G++ QE+PFK+PVF AG R+CLGK+MA +++KS+A SV+ RF + +    
Sbjct  416   DFVPERWLENGIYRQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVIERFEIDVQNKE  475

Query  553   HTPRFSPGLTATFRDGLPVFVQQR  482
               P     LT   + GL V V++R
Sbjct  476   KCPEHLLSLTLRMKGGLQVKVKER  499



>ref|XP_010247227.1| PREDICTED: cytochrome P450 94B3 [Nelumbo nucifera]
Length=507

 Score =   416 bits (1070),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 209/444 (47%), Positives = 288/444 (65%), Gaps = 8/444 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             DW T +L  +P+ T   +    +   ITANP NVE+MLK+ FEN+PKG  F A+L DFLG
Sbjct  57    DWTTDVLSRTPTNTATFYRPGKVNGIITANPLNVEHMLKANFENYPKGDRFIALLKDFLG  116

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKDGGVVDLQ  1442
             QGIFN DGD WR QRK AS E    S+ S+  E ++ EI+ RL+P+L    +   ++D+Q
Sbjct  117   QGIFNSDGDLWRVQRKTASFEFNTKSLRSFVMENVKAEIETRLIPLLKRASETNQILDIQ  176

Query  1441  DVFRRFSFDCICRFSFGLDPKCLESLLPMS-EFAVSFHLASKLSAERAMSASPVVWKIKR  1265
             D+  RF+FD +C+ +F +DP CL      S EF  +F  A++LSA R M   P +WK+K+
Sbjct  177   DILERFAFDNVCKLAFDIDPVCLGGDGTTSGEFMQAFEEAARLSAGRFMYLFPFLWKVKK  236

Query  1264  FLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYLRDIV  1085
              LNIGSE+ L+++I  ++  A ++I  R +     +N+ DLLSRFM    +   +LRDIV
Sbjct  237   ALNIGSERRLKQAISTVHDFADKIIWSRMENRRQKQNNDDLLSRFMEDEFNSAEFLRDIV  296

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA---SEQRMRELN  914
             ISF+LAGRDT +S+L  FFW++++ PD    IL E + V  +    I    S   +RE+ 
Sbjct  297   ISFILAGRDTTSSSLAWFFWILSSRPDIERNILDELESVRARKGKCIGDTYSYDELREMQ  356

Query  913   YLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCL  734
             YLQAA+ E LRL+PP+  D+K C EDDVLPDG+ +K+G  +TYH YAMGRME IWG DC 
Sbjct  357   YLQAALSEGLRLYPPVAVDTKACREDDVLPDGSFIKKGWFITYHTYAMGRMEAIWGKDCR  416

Query  733   EFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPH  554
             EFKP+RWL  G   QE+PF+YP+F AG R+CLGK+MA +++KS+A SV+ RF V +    
Sbjct  417   EFKPQRWLESGTCRQESPFRYPIFHAGPRMCLGKDMAYIQMKSIAASVIERFHVDVVDGD  476

Query  553   HTPRFSPGLTATFRDGLPVFVQQR  482
               P     LT   + GL V ++QR
Sbjct  477   KCPEHLLSLTLRIKGGLRVRIKQR  500



>ref|XP_002979339.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ19747.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
Length=461

 Score =   414 bits (1065),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 204/441 (46%), Positives = 292/441 (66%), Gaps = 10/441 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIHVLRNT--ITANPENVEYMLKSRFENFPKGKAFSAILGDFLGQ  1616
             +W T  + NSPS T       +T  IT NP  VE++LK+ FEN+PKG+     L D LG 
Sbjct  26    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  85

Query  1615  GIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG-KKDGGVVDLQD  1439
             GIFNVDG+ W+ QR++AS E    S+  +  + +  E+  RLLP LA   +DG  +DLQD
Sbjct  86    GIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  145

Query  1438  VFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWKIKRFL  1259
             +F RF+FD IC+ SFG+DP CL+   P  +FA +F  A+ LS  R     P+VWK+ R L
Sbjct  146   LFMRFNFDNICKLSFGVDPACLDPSFPEVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  205

Query  1258  NIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMG--SIGDDETYLRDIV  1085
             N+G E+EL++ ++V+N  A+ V+++RR+       ++DLLSRF+G  S    + +LRDI+
Sbjct  206   NVGPERELKEVLDVVNEFAVSVVQKRRE--EKGRVNQDLLSRFIGLDSTSFSDEFLRDII  263

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMRELNYLQ  905
             ISF+LAG+DT+A +L+ FFWL++NHP   + I+ E     G N+     E  +R++ YLQ
Sbjct  264   ISFVLAGKDTIAVSLSWFFWLLSNHPGVQQEIIREVGSTKGSNRPFTYKE--LRDMVYLQ  321

Query  904   AAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCLEFK  725
             AA+CES+RL+PP+  D+K     DVLPDG  V++G +V+YH YAMGRME +WG DCLEFK
Sbjct  322   AALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAMGRMESLWGKDCLEFK  381

Query  724   PERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPHHTP  545
             PERW++DG F + +PFK+PVFQAG RVCLGKEMA+L++K V  +++ +F + +      P
Sbjct  382   PERWIQDGQFVEVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVVG-KEEP  440

Query  544   RFSPGLTATFRDGLPVFVQQR  482
              +   +T   +DGLPV  + R
Sbjct  441   CYGINMTLIMKDGLPVVPKLR  461



>ref|XP_010045498.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=518

 Score =   416 bits (1070),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 213/464 (46%), Positives = 307/464 (66%), Gaps = 20/464 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   ++L DWYT LL  SP++TI IH L   R  +TANP+NVE++L++ F N+PKG  
Sbjct  51    SFYRNRSHLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPDNVEHVLRANFHNYPKGVP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F++ILGD LG GIFNVDG  W  QRK+AS E   +S+  +    ++ E++ RLLP+L   
Sbjct  111   FTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTLEAEVENRLLPLLQDY  170

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++ A RA S 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENH----KDLLSRF  1130
               +VWKIKR LNIGSEK+L +++++++   +++IR R+K  L  +D+       DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + + G  E  +RD+VISF++AGRDT ++A+T  FWL+A + +A E I++E D ++ ++ +
Sbjct  291   LAA-GHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEIVSEVDSILDRSYN  349

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+P + +DSK    DDVLPDGT V++G RVTY PY M
Sbjct  350   KCLDFEALKEMKFLKACLCESMRLYPSVAWDSKHAAVDDVLPDGTPVRKGDRVTYFPYGM  409

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GRME +WG D LEFKP+RWL         +G     +P+K+PVFQAG RVCLGKEMA ++
Sbjct  410   GRMEELWGKDRLEFKPDRWLVGPGMEGGAEGELRAVSPYKFPVFQAGPRVCLGKEMAFIQ  469

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K V  S+LRRF +      + P F P LTA    GL V V++R
Sbjct  470   MKYVVASILRRFEIRPVL-ENRPVFVPLLTAHMAGGLKVVVKKR  512



>ref|XP_004236553.1| PREDICTED: cytochrome P450 94B3-like [Solanum lycopersicum]
Length=492

 Score =   415 bits (1067),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 217/455 (48%), Positives = 293/455 (64%), Gaps = 10/455 (2%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI +      R  ITANP+NVEYMLK+ F N+PKGK 
Sbjct  41    SFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKP  100

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ ILGDFLG+GIFNVDG+ W  QRK+AS E   +S+  +  + ++  ++ RL+P+L   
Sbjct  101   FTDILGDFLGRGIFNVDGELWSAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQV  160

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              + G V+DLQDV RRF+FD IC+ S G DP CL+ L  +     SF  AS   A R M+ 
Sbjct  161   ANSGKVLDLQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASLACAMRGMAP  220

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRR-KLGTSDE-NHKDLLSRFMGSI  1118
                +WK KR LN GSEK+LR++++ ++    E+I +++ K+ T +  N  DLLSR + + 
Sbjct  221   VYAIWKSKRALNFGSEKKLRENVKRVHCCIDEIIEEKKQKIATENGGNQMDLLSRLLLA-  279

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIAS  938
             G D   +RD+VISFL+AGRDT +SALT  FWL  NH D  + ++ E   +   ++ L   
Sbjct  280   GHDNEVVRDMVISFLIAGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSIYNGDKALEFD  339

Query  937   EQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRME  758
             E  ++E+ YL A + ES+RL+PP+ +DSK   +DD+LPDGT V++G RVTY PY MGRME
Sbjct  340   E--LKEMKYLAACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRME  397

Query  757   GIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRR  581
              IWG D LEFKP+RW+  +G     +P+KYPVFQAG RVCLGKEMA  ++K V  SVLRR
Sbjct  398   EIWGKDRLEFKPDRWIDENGALKMVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRR  457

Query  580   FRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR*C  476
             F +        P F P LTA    G  V +  R C
Sbjct  458   FEIKPVVNVEKPVFLPLLTAHMAGGFNVRIYHRDC  492



>gb|EYU43048.1| hypothetical protein MIMGU_mgv1a026913mg, partial [Erythranthe 
guttata]
Length=462

 Score =   414 bits (1064),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 217/455 (48%), Positives = 299/455 (66%), Gaps = 12/455 (3%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y     L  WYT LL  S ++TI +H L   R  +TANP+NVEY+LK+RF NFPKGK 
Sbjct  7     SFYKNRRRLLSWYTDLLSESATQTIVVHRLWAPRTIVTANPDNVEYILKTRFSNFPKGKP  66

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-G  1472
             F+ +LGDFLG GIFNVDG  W  QRK+AS E    S+  +  +V++ E+ +RL+PIL   
Sbjct  67    FTELLGDFLGVGIFNVDGGQWSVQRKLASHEFSAKSLREFVVKVLEDEVSKRLIPILENA  126

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              ++GGV+D+Q+V RRF+FD IC  S G+DP CL+        A +F  AS++SA R  + 
Sbjct  127   AENGGVLDMQEVLRRFAFDTICHVSLGIDPCCLDFSRAPPPLAAAFDAASEISAMRGAAP  186

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK----LGTSDENHKDLLSRFMG  1124
                VW++KR LN+GSE+EL+++++++     E+I +R K     G       DLLSRF+G
Sbjct  187   VSAVWRLKRALNLGSERELKEAVKLVRGCVDEMISERIKNGGGGGGGSGGGGDLLSRFLG  246

Query  1123  SIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLI  944
             +  +DE  +RD+VISFL+AGRDT +SA+T   WL++ H    +  + E   +    Q  +
Sbjct  247   AGLEDE-MVRDMVISFLMAGRDTTSSAVTWLLWLLSGHRGIEKRAVEEIASIGDTTQRQL  305

Query  943   ASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGR  764
               +  ++E+N++QA +CES+RL+PP+ +DSK   EDDVLPDGT V RG RVTY  Y MGR
Sbjct  306   GFDD-LKEMNFIQACLCESMRLYPPVVWDSKHAAEDDVLPDGTPVSRGDRVTYFQYGMGR  364

Query  763   MEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVL  587
             ME +WG D LEF+P+RWL R G   + +P+KYPVFQAG RVCLGKEMA +++K V  SVL
Sbjct  365   MEELWGPDRLEFRPDRWLDRAGSVKKVSPYKYPVFQAGPRVCLGKEMAFIQMKYVVASVL  424

Query  586   RRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              RF +   +P  TP F P LTA    G  V V++R
Sbjct  425   SRFELVPVRP-ETPAFVPLLTAYMAGGFNVRVRRR  458



>gb|KDO52651.1| hypothetical protein CISIN_1g036030mg [Citrus sinensis]
Length=503

 Score =   415 bits (1067),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/462 (47%), Positives = 298/462 (65%), Gaps = 17/462 (4%)
 Frame = -2

Query  1822  TSWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGK  1652
              S+Y   + L +WYT LL  SP++TI +  L   R  +TANP NVEYMLKS F NFPKG+
Sbjct  41    VSFYRNRHQLLNWYTDLLSQSPTQTIIVQRLGARRTIVTANPANVEYMLKSNFTNFPKGR  100

Query  1651  AFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG  1472
              F+ ILGD LG GIFNVDG+ W  QRK+AS E    S+  +  + +Q E+D RL+P+L  
Sbjct  101   PFTEILGDLLGCGIFNVDGELWSMQRKLASHEFSAKSLREFTVKTLQQEVDDRLIPMLEE  160

Query  1471  KKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMS  1295
               +   V+D QD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++SA R M+
Sbjct  161   AAESRRVLDFQDILRRFAFDVVCKVSLGTDPFCLDHSQPLPPLVKAFDAASEISAMRGMA  220

Query  1294  ASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD-ENHKDLLSRFMGSI  1118
                +VWKIKR LNIGSEK+L++S+ +++   ME+IR +++  + + +   DLLSR + S 
Sbjct  221   PVFLVWKIKRLLNIGSEKKLKESVNLVHESVMEIIRNKKENNSVNGDEGGDLLSRLL-SA  279

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIAS  938
             G  E   RD+ ISF++AGRDT ++A+T  FWL++ +      I+ E  +V+ KN    A 
Sbjct  280   GHGEQVARDMAISFIMAGRDTTSAAMTWLFWLLSQNEAVEREIVDEVKQVIDKNNIGRAR  339

Query  937   E---QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
                 + ++E+N+L+A +CES+RL+PP+ +DSK     DVLPDGT V++G RVTY PY MG
Sbjct  340   ALDFEALKEMNFLKACLCESMRLYPPVAWDSKHAAAYDVLPDGTPVRKGDRVTYMPYGMG  399

Query  766   RMEGIWGSDCLEFKPERWLRDGVFFQEN-------PFKYPVFQAGLRVCLGKEMALLELK  608
             RME +WG D LEFKP+RWL D     EN       P+K+PVFQAG RVCLGKEMA +++K
Sbjct  400   RMETLWGKDRLEFKPDRWLDDLGEEWENRVLKPVSPYKFPVFQAGPRVCLGKEMAFIQMK  459

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              V  SVLRRF +     +  P F P LT     GL V V++R
Sbjct  460   YVVGSVLRRFEIKPVSGNQ-PVFVPLLTGHMIGGLKVLVRKR  500



>ref|XP_006477025.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=504

 Score =   414 bits (1065),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/462 (47%), Positives = 298/462 (65%), Gaps = 17/462 (4%)
 Frame = -2

Query  1822  TSWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGK  1652
              S+Y   + L +WYT LL  SP++TI +  L   R  +TANP NVEYMLKS F NFPKG+
Sbjct  42    VSFYRNRHQLLNWYTDLLSQSPTQTIIVQRLGARRTIVTANPANVEYMLKSNFTNFPKGR  101

Query  1651  AFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG  1472
              F+ ILGD LG GIFNVDG+ W  QRK+AS E    S+  +  + +Q E+D RL+P+L  
Sbjct  102   PFTEILGDLLGCGIFNVDGELWSMQRKLASHEFSAKSLREFTVKTLQQEVDDRLIPMLEE  161

Query  1471  KKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMS  1295
               +   V+D QD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++SA R M+
Sbjct  162   AAESRRVLDFQDILRRFAFDVVCKVSLGTDPFCLDLSRPLPPLVKAFDAASEISAMRGMA  221

Query  1294  ASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD-ENHKDLLSRFMGSI  1118
                +VWKIKR LNIGSEK+L++S+ +++   ME+IR +++  + + +   DLLSR + S 
Sbjct  222   PVFLVWKIKRLLNIGSEKKLKESVNLVHESVMEIIRNKKENNSVNGDEGGDLLSRLL-SA  280

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIAS  938
             G  E   RD+ ISF++AGRDT ++A+T  FWL++ +      I+ E  +V+ KN    A 
Sbjct  281   GHGEQVARDMAISFIMAGRDTTSAAMTWLFWLLSQNEAVEREIVDEVKQVIDKNNIGRAR  340

Query  937   E---QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
                 + ++E+N+L+A +CES+RL+PP+ +DSK     DVLPDGT V++G RVTY PY MG
Sbjct  341   ALDFEALKEMNFLKACLCESMRLYPPVAWDSKHAAAYDVLPDGTPVRKGDRVTYMPYGMG  400

Query  766   RMEGIWGSDCLEFKPERWLRDGVFFQEN-------PFKYPVFQAGLRVCLGKEMALLELK  608
             RME +WG D LEFKP+RWL D     EN       P+K+PVFQAG RVCLGKEMA +++K
Sbjct  401   RMETLWGKDRLEFKPDRWLDDVGEEWENRVLKPVSPYKFPVFQAGPRVCLGKEMAFIQMK  460

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              V  SVLRRF +     +  P F P LT     GL V V++R
Sbjct  461   YVVGSVLRRFEIKPVSGNQ-PVFVPLLTGHMIGGLKVLVRKR  501



>ref|XP_006440103.1| hypothetical protein CICLE_v10019793mg [Citrus clementina]
 gb|ESR53343.1| hypothetical protein CICLE_v10019793mg [Citrus clementina]
Length=506

 Score =   414 bits (1064),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 216/462 (47%), Positives = 297/462 (64%), Gaps = 17/462 (4%)
 Frame = -2

Query  1822  TSWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGK  1652
              S+Y   + L +WYT LL  SP++TI +  L   R  +TANP NVEYMLKS F NFPKG+
Sbjct  42    VSFYRNRHQLLNWYTDLLSQSPTQTIIVQRLGARRTIVTANPANVEYMLKSNFTNFPKGR  101

Query  1651  AFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG  1472
              F+ ILGD LG GIFNVDG+ W  QRK+AS E    S+  +  + +Q E+D RL+P+L  
Sbjct  102   PFTEILGDLLGCGIFNVDGELWSMQRKLASHEFSAKSLREFTVKTLQQEVDDRLIPMLEE  161

Query  1471  KKDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMS  1295
               +   V+D QD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++SA R M+
Sbjct  162   AAESRRVLDFQDILRRFAFDVVCKVSLGTDPFCLDHSQPLPPLVKAFDAASEISAMRGMA  221

Query  1294  ASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD-ENHKDLLSRFMGSI  1118
                +VWKIKR LN+GSEK+L++S+ +++   ME+IR +++  + + +   DLLSR + S 
Sbjct  222   PVFLVWKIKRLLNMGSEKKLKESVNLVHESVMEIIRNKKENNSVNGDEGGDLLSRLL-SA  280

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIAS  938
             G  E   RD+ ISF++AGRDT ++A+T  FWL++ +     AI+ E   V  KN    A 
Sbjct  281   GHGEQVARDMAISFIMAGRDTTSAAMTWLFWLLSQNEAVERAIVDEVKLVTDKNNIGRAR  340

Query  937   E---QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
                 + ++E+N+L+A +CES+RL+PP+ +DSK     DVLPDGT V++G RVTY PY MG
Sbjct  341   ALDFETLKEMNFLKACLCESMRLYPPVAWDSKHAAAYDVLPDGTPVRKGDRVTYMPYGMG  400

Query  766   RMEGIWGSDCLEFKPERWLRDGVFFQEN-------PFKYPVFQAGLRVCLGKEMALLELK  608
             RME +WG D LEFKP+RWL D     EN       P+K+PVFQAG RVCLGKEMA +++K
Sbjct  401   RMETLWGKDRLEFKPDRWLDDLGEEWENRVLKPVSPYKFPVFQAGPRVCLGKEMAFIQMK  460

Query  607   SVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              V  SVLRRF +     +  P F P LT     GL V V++R
Sbjct  461   YVVGSVLRRFEIKPVSGNQ-PVFVPLLTGHMIGGLKVLVRKR  501



>ref|XP_010045501.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=513

 Score =   414 bits (1064),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 213/464 (46%), Positives = 306/464 (66%), Gaps = 20/464 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI IH L   R  +TANP+NVE++LK+ F N+PKG  
Sbjct  51    SFYRNRSRLLDWYTDLLSRSPTQTIVIHRLGACRTVVTANPDNVEHVLKNNFHNYPKGAP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F++ILGDFLG GIFNVDG  W  QRK+AS E   +S+  +    ++ E+  RLLP+L   
Sbjct  111   FTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTLEAEVGNRLLPLLQDY  170

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ RRF+FD +C+ S G DP CL+    +     +F  AS++ A RA S 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRTLPPLVTAFENASRICATRANSP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENH----KDLLSRF  1130
               +VWKIKR LNIGSEK+L +++++++   +++IR R+K  L  +D+       DLLSRF
Sbjct  231   VYLVWKIKRGLNIGSEKKLSEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + ++G  E  +RD+VISF++AGRDT ++A+T  FWL+A + +A  AI++E D ++ ++  
Sbjct  291   L-AVGHSEEMVRDMVISFVMAGRDTTSAAITWLFWLLAQNSNAERAIVSEVDSILDRSYK  349

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+PP+ +DSK    DDVLPDGT V++G RVTY PY M
Sbjct  350   NCLDFEALKEMRFLKACLCESMRLYPPVAWDSKHAAADDVLPDGTPVRKGDRVTYFPYGM  409

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GRM+ +WG D LEFKP+RWL         +G     +P+K+PVFQAG RVCLGKEMA ++
Sbjct  410   GRMKELWGKDRLEFKPDRWLVGPGMEGGTEGELRAVSPYKFPVFQAGPRVCLGKEMAFIQ  469

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K V  S+L+RF +      + P F P LTA    GL V V++R
Sbjct  470   MKYVVASILKRFVIRPVL-ENRPVFVPLLTAHMAGGLKVAVKKR  512



>ref|XP_002278009.1| PREDICTED: cytochrome P450 94A1 [Vitis vinifera]
Length=500

 Score =   413 bits (1061),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 205/444 (46%), Positives = 292/444 (66%), Gaps = 9/444 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIHV---LRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             DW T +L   P+ T  I     +   ITANP NVE+MLK+ FEN+PKG  F +IL DFLG
Sbjct  52    DWTTDVLSRCPTNTSTIRRPGGIHGVITANPLNVEHMLKTNFENYPKGPQFISILEDFLG  111

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGKKDGG-VVDLQ  1442
             +GIFN D D W+ QRK AS E    S+ ++ FE +  E   RL+PIL    + G V+D+Q
Sbjct  112   RGIFNSDADLWKVQRKTASYEFNTKSLRNFVFESVTVETQTRLVPILKKAAETGRVLDVQ  171

Query  1441  DVFRRFSFDCICRFSFGLDPKCLES-LLPMSEFAVSFHLASKLSAERAMSASPVVWKIKR  1265
             D+  RF+FD +C+ +F +DP CL        +F  +F  A+ LS+ R M A   +WK+++
Sbjct  172   DILERFAFDNVCKLAFNVDPACLGGDATAGGDFMRAFEDAATLSSGRFMYAFQSIWKMEK  231

Query  1264  FLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYLRDIV  1085
             F N+  EK L+KSI +++  A ++I+ R +    +++ +DLLSRF+G+  +   +LRDIV
Sbjct  232   FFNMRKEKRLKKSIAIVHEFAEKIIQSRLEQKAENKD-QDLLSRFVGNYDNSPEFLRDIV  290

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASE---QRMRELN  914
             ISF+LAGRDT +SALT FFWL++ +P+    IL E + V  +N   I        +REL+
Sbjct  291   ISFILAGRDTTSSALTWFFWLLSLNPEVETNILKELETVRARNGKSIGDTYNFDELRELH  350

Query  913   YLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCL  734
             YL AA+ E++RL+PP+  D+K+C+ DDVLPDGT V +G  +TY PY+MGR+E IWG DCL
Sbjct  351   YLHAAISETMRLYPPVPVDTKYCLNDDVLPDGTFVGKGWFMTYIPYSMGRIESIWGKDCL  410

Query  733   EFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPH  554
             +FKPERWL +GV+ QENPF+YP+F AG R+CLGK+MA +++KS+A SV+ +F V + +  
Sbjct  411   QFKPERWLENGVYRQENPFRYPIFHAGPRMCLGKDMAYIQMKSIAASVMEQFEVKVEEKD  470

Query  553   HTPRFSPGLTATFRDGLPVFVQQR  482
               P     LT     GL V V++R
Sbjct  471   KCPEHYLSLTLRMTGGLEVRVKER  494



>gb|KCW83158.1| hypothetical protein EUGRSUZ_B00113, partial [Eucalyptus grandis]
Length=505

 Score =   413 bits (1062),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 213/464 (46%), Positives = 302/464 (65%), Gaps = 20/464 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI IH L   R  +TANP+NVE++LK+ F N+PKG  
Sbjct  43    SFYRNRSRLLDWYTDLLSQSPTQTIVIHRLGACRTVVTANPDNVEHVLKNNFHNYPKGVP  102

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ ILGDFLG GIFNVDG  W  QRK+AS E    S+  +    ++ E++ RLLP+L   
Sbjct  103   FTCILGDFLGCGIFNVDGPLWSTQRKLASHEFSTHSLRDFVVRTLEAEVENRLLPLLQDY  162

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++ A R  S 
Sbjct  163   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRGTSP  222

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENH----KDLLSRF  1130
               +VWKIKR LNIGSE +L +++ +++   +++IR R+K  L  +D+       DLLSRF
Sbjct  223   VYLVWKIKRVLNIGSENKLAEAVNLVHDDILDIIRSRKKKLLKQNDDQQIKYDGDLLSRF  282

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + + G  E  +RD+ ISF++AGRDT ++A+T  F L+A + +A EAI++E D ++ ++ +
Sbjct  283   LAA-GHSEEMVRDMAISFVMAGRDTTSAAMTWLFLLLAQNSNAEEAIVSEVDSILDRSYN  341

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+PP+ +DSK    DDVLPDGT VK+G RVTY PY M
Sbjct  342   KCLDFKALKEMRFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGTLVKKGDRVTYFPYGM  401

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GRM+ +WG D LEFKP+RWL         +G     +P+KYPVFQAG RVCLGKEMA ++
Sbjct  402   GRMKELWGEDRLEFKPDRWLVEPGMDGGAEGELRAVSPYKYPVFQAGPRVCLGKEMAFIQ  461

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K V  S+L+RF +      + P F P LTA    GL V V++R
Sbjct  462   MKYVVASILQRFEIRPVL-ENRPVFVPLLTAHMAGGLKVVVKKR  504



>ref|XP_010938845.1| PREDICTED: cytochrome P450 94B3-like [Elaeis guineensis]
Length=519

 Score =   414 bits (1063),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 218/467 (47%), Positives = 291/467 (62%), Gaps = 20/467 (4%)
 Frame = -2

Query  1822  TSWYAKYNNLCDWYTHLLRNSPSKTIHIHV---LRNTITANPENVEYMLKSRFENFPKGK  1652
             T +    + + DW    L  SP+ TI  H    +R  ITANP NVE++L+S F+N+ KG 
Sbjct  47    TQFLKNRHRMADWLAEALAASPTNTITFHRPGGVRGVITANPANVEHILRSNFDNYTKGS  106

Query  1651  AFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-  1475
              F++IL DFLG+GIFN DG+ WR QRK AS E    S+ S+    +Q EI  RLLP+LA 
Sbjct  107   RFASILHDFLGRGIFNSDGEVWRLQRKTASFEFNTRSLRSFVVHCVQDEILHRLLPLLAE  166

Query  1474  GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPM-----SEFAVSFHLASKLSA  1310
                 G  +DLQDV  RF+FD +C+ +F  DP CL +  P      SEFA +F  A+ LSA
Sbjct  167   ASLHGRAIDLQDVLERFAFDNVCKVAFNHDPACLAADGPERSSSDSEFAEAFEDAANLSA  226

Query  1309  ERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLL  1139
              R   A P  WKIK+ L IGSE+ LRKSI  ++  A ++IR R+K     +S     DLL
Sbjct  227   GRFRYAVPRFWKIKKLLRIGSERRLRKSIATVHAFANQIIRSRKKENWTSSSSPRADDLL  286

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGK  959
             SRF+ +    E +LRDIVISFLLAGR+T +SAL+ FFWL+++ P+    IL +   V  +
Sbjct  287   SRFVANEDHSEEFLRDIVISFLLAGRETTSSALSWFFWLLSSRPEVERKILDDIRSVRLR  346

Query  958   NQDLIASE--------QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKR  803
             N+              + +RE++YL AA+ E++RL+PP+  +S  C  DDVLPDGTAVK+
Sbjct  347   NRSSSGGGGCETTFDFEELREMHYLHAAITEAMRLYPPVPMNSTECQGDDVLPDGTAVKK  406

Query  802   GTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMA  623
             G  ++Y  YAMGRME IWG DCLE++PERWL +G+F  E+PFK+  F AG R+CLGKEMA
Sbjct  407   GWFMSYSSYAMGRMEAIWGKDCLEYRPERWLEEGLFRPESPFKFAAFHAGPRMCLGKEMA  466

Query  622   LLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              +++KS+A  VL RF + +      P     LT   R GLPV V QR
Sbjct  467   YIQMKSIAACVLERFVIEVVDKDTCPEKMMSLTLRMRGGLPVRVMQR  513



>ref|XP_010026539.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
 gb|KCW83160.1| hypothetical protein EUGRSUZ_B00115 [Eucalyptus grandis]
Length=518

 Score =   413 bits (1062),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 212/464 (46%), Positives = 303/464 (65%), Gaps = 20/464 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP+ TI IH L   R  +TANP+NVE++L++ F N+PKG  
Sbjct  51    SFYQNRSRLLDWYTDLLSRSPTHTIVIHRLGACRTVVTANPDNVEHVLRANFHNYPKGVP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F++ILGD LG GIFNVDG  W  QRK+AS E   +S+  +    ++ E++ RLLP+L   
Sbjct  111   FTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFLVRTLEAEVENRLLPLLQDY  170

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++ A RA S 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQISLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENH----KDLLSRF  1130
               +VWKIKR LNIGSEK+L +++++++   +++IR R+K  L  +D+       DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDILDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + + G  E  +RD+VISF++AGRDT ++A+T  FWL+A + +A  AI++E D ++ ++  
Sbjct  291   LAA-GHSEEMVRDMVISFVMAGRDTTSAAITWLFWLLAQNSNAERAIVSEVDSILDRSYK  349

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+PP+ +DSK    DDVLPDGT V++G RVTY PY M
Sbjct  350   NCLDFEALKEMRFLKACLCESMRLYPPVAWDSKHAAADDVLPDGTPVRKGDRVTYFPYGM  409

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GRM+ +WG D LEFKP+RWL         +G     +P+K+PVFQAG RVCLGKEMA ++
Sbjct  410   GRMKELWGKDRLEFKPDRWLVGPGMEGGAEGELRAVSPYKFPVFQAGPRVCLGKEMAFIQ  469

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K V  S+L RF +      + P F P LTA    GL V V +R
Sbjct  470   MKYVVASILGRFEIRPVL-ENRPAFVPLLTAHMTGGLKVVVNKR  512



>ref|XP_002979336.1| hypothetical protein SELMODRAFT_110688 [Selaginella moellendorffii]
 gb|EFJ19744.1| hypothetical protein SELMODRAFT_110688 [Selaginella moellendorffii]
Length=491

 Score =   412 bits (1059),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 201/441 (46%), Positives = 292/441 (66%), Gaps = 8/441 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIHVLRNT--ITANPENVEYMLKSRFENFPKGKAFSAILGDFLGQ  1616
             +W T  + NSPS T       +T  IT NP  VE++LK+ FEN+PKG+     L D LG 
Sbjct  54    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  113

Query  1615  GIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG-KKDGGVVDLQD  1439
             GIFNVDG+ W+ QR++AS E    S+  +  + +  E+  RLLP LA   +DG  +DLQD
Sbjct  114   GIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  173

Query  1438  VFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWKIKRFL  1259
             +F RF+FD IC+ SFG+DP CL+   P  +FA +F  A+ LS  R     P+VWK+ R L
Sbjct  174   LFMRFNFDNICKLSFGVDPACLDPSFPDVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  233

Query  1258  NIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMG--SIGDDETYLRDIV  1085
             N+G E+EL++ ++V+N  A+ V+++RR+       ++DLLSRF+G  S    + +LRDI+
Sbjct  234   NVGPERELKEVLDVVNEFAVSVVQKRRE--EKGRVNQDLLSRFIGLDSTSFSDEFLRDII  291

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMRELNYLQ  905
             ISF+LAG+DT A +L+ FFWL++NHP   + I+ +   +V K  +   + + +R++ YLQ
Sbjct  292   ISFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIRKVGSIVAKGSNRPFTYKELRDMVYLQ  351

Query  904   AAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCLEFK  725
             AA+CES+RL+PP+  D+K     DVLPDG  V++G +V+YH YA+GRME +WG DCLEFK
Sbjct  352   AALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAIGRMESLWGKDCLEFK  411

Query  724   PERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPHHTP  545
             PERW+ DG F + +PFK+PVFQAG RVCLGKEMA+L++K V  +++ +F + +      P
Sbjct  412   PERWIHDGQFVEVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVVGKEE-P  470

Query  544   RFSPGLTATFRDGLPVFVQQR  482
              +   +T   +DGLPV  + R
Sbjct  471   CYGINMTLIMKDGLPVVPKLR  491



>ref|XP_010111213.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXC30691.1| Cytochrome P450 94A1 [Morus notabilis]
Length=508

 Score =   413 bits (1061),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 209/460 (45%), Positives = 291/460 (63%), Gaps = 12/460 (3%)
 Frame = -2

Query  1828  MSTSWYAKYNNLCDWYTHLLRNSPSKTI---HIHVLRNTITANPENVEYMLKSRFENFPK  1658
             M   + +  + L DW T +L  +P+ T     +  +R   TANP NVEYMLK+ FEN+PK
Sbjct  44    MLPGFLSNRHRLLDWLTEVLSQTPTNTAVARRLGNVRGVTTANPLNVEYMLKTNFENYPK  103

Query  1657  GKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL  1478
             G  F ++LG+FLGQGIFN DG+ W+ QRK AS E    S+ ++  E +  EI  RL+P L
Sbjct  104   GDGFVSVLGNFLGQGIFNSDGEIWKVQRKTASYEFNTKSLRNFVMENVVVEIKTRLVPGL  163

Query  1477  -AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLES----LLPMSEFAVSFHLASKLS  1313
                 + G V+D+QDV  RF+FD IC+ +F +DP CL           EF  +F  A+ LS
Sbjct  164   NKAVETGQVLDIQDVLERFAFDNICKLAFNVDPCCLAGDGFFGNDTGEFMKAFEEAATLS  223

Query  1312  AERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSR  1133
             + R   A P +WKIKRF N+GSEK LR+ I  ++  A E+I  RR     +   +DLLSR
Sbjct  224   SGRFRYAFPYLWKIKRFFNVGSEKRLRECIATVHQFADEII-LRRMENKEENTEEDLLSR  282

Query  1132  FMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQ  953
             FM        +LRDI+ISF+LAGRDT +SALT FFW++++ PD  E IL E + +  +N 
Sbjct  283   FMACHNGSPEFLRDIIISFILAGRDTTSSALTWFFWILSSRPDIEEKILNELETIRTRNG  342

Query  952   DLIASE---QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
               I        +R+++YL AA+ ES+RL+PP+  D+K C  DDV+PDGT V +   VTYH
Sbjct  343   KDIGETYNFNELRDMHYLHAAISESMRLYPPVPADTKVCRNDDVMPDGTFVGKDWFVTYH  402

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
              YAMGRME IWG +CLEF PERWL +G+  QE+PF++P+F AG R+CLGK+MA +++KS+
Sbjct  403   TYAMGRMENIWGKNCLEFVPERWLENGICRQESPFRFPIFHAGPRMCLGKDMAYIQMKSI  462

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             A +V+ +F + +     TP +   LT   R GL + V++R
Sbjct  463   AATVIEKFHIEVQDKGKTPDYVLSLTLRMRGGLLLRVRER  502



>ref|XP_006373690.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP51487.1| cytochrome P450 family protein [Populus trichocarpa]
Length=499

 Score =   412 bits (1059),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 290/444 (65%), Gaps = 10/444 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTI---HIHVLRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             +W T  L + P+ T        +   ITANP NVEY+LK+ FEN+PKG  F  +LGDFLG
Sbjct  58    EWTTETLSHCPTNTAVFPRPGKVHGIITANPLNVEYILKTNFENYPKGNRFIKLLGDFLG  117

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKDGGVVDLQ  1442
             +GIFN DG+ WR QRK AS E    S+ ++  + ++ EI  RL+PILA   K   V+DLQ
Sbjct  118   RGIFNSDGELWRVQRKTASYEFNTKSLRNFVMDNVEVEISTRLVPILAKASKTKQVLDLQ  177

Query  1441  DVFRRFSFDCICRFSFGLDPKCLES-LLPMSEFAVSFHLASKLSAERAMSASPVVWKIKR  1265
             D+  RF+FD IC+ +F +DP CL        EF  +F  A+ L + R MS   V WKI R
Sbjct  178   DILERFAFDNICKVAFNVDPACLGGDGTSGGEFMRAFEDAATLCSGRFMSVHRVFWKINR  237

Query  1264  FLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYLRDIV  1085
             F N+G+EK LR+S+++++  A E+IR R +  T  E ++D LSRF+G   +   +LRDI+
Sbjct  238   FFNVGTEKTLRESVKIVHEFADEMIRSRMEQKT--EKNEDFLSRFIGKDENSTEFLRDII  295

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV---VGKNQDLIASEQRMRELN  914
             ISF+LAGRDT +SAL+ FFWL++ +PD    IL E + +    GKN     S + +R+++
Sbjct  296   ISFILAGRDTTSSALSWFFWLLSLNPDVEGNILKELETIRSSNGKNLGDTYSFEELRDMH  355

Query  913   YLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCL  734
             YLQAA+ E+LRL+PP+  D+K C  DDVLPDGT V +   VTYH YAMGRME IWG +C 
Sbjct  356   YLQAAISETLRLYPPVPVDTKACQSDDVLPDGTFVGKKWFVTYHAYAMGRMESIWGKNCR  415

Query  733   EFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPH  554
             +F PERWL +G++ QE+PFK+PVF AG R+CLGK+MA +++KS+A SV+ RF + +    
Sbjct  416   DFVPERWLENGIYRQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVIERFEIDVQNKE  475

Query  553   HTPRFSPGLTATFRDGLPVFVQQR  482
               P     LT   + GL V V++R
Sbjct  476   KCPDHLLSLTLRMKGGLQVKVKER  499



>gb|KCW83159.1| hypothetical protein EUGRSUZ_B00114, partial [Eucalyptus grandis]
Length=508

 Score =   412 bits (1058),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 211/459 (46%), Positives = 303/459 (66%), Gaps = 20/459 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   ++L DWYT LL  SP++TI IH L   R  +TANP+NVE++L++ F N+PKG  
Sbjct  51    SFYRNRSHLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPDNVEHVLRANFHNYPKGVP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F++ILGD LG GIFNVDG  W  QRK+AS E   +S+  +    ++ E++ RLLP+L   
Sbjct  111   FTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTLEAEVENRLLPLLQDY  170

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++ A RA S 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENH----KDLLSRF  1130
               +VWKIKR LNIGSEK+L +++++++   +++IR R+K  L  +D+       DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + + G  E  +RD+VISF++AGRDT ++A+T  FWL+A + +A E I++E D ++ ++ +
Sbjct  291   LAA-GHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEIVSEVDSILDRSYN  349

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+P + +DSK    DDVLPDGT V++G RVTY PY M
Sbjct  350   KCLDFEALKEMKFLKACLCESMRLYPSVAWDSKHAAVDDVLPDGTPVRKGDRVTYFPYGM  409

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GRME +WG D LEFKP+RWL         +G     +P+K+PVFQAG RVCLGKEMA ++
Sbjct  410   GRMEELWGKDRLEFKPDRWLVGPGMEGGAEGELRAVSPYKFPVFQAGPRVCLGKEMAFIQ  469

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPV  497
             +K V  S+LRRF +      + P F P LTA    GL V
Sbjct  470   MKYVVASILRRFEIRPVL-ENRPVFVPLLTAHMAGGLKV  507



>ref|XP_010247228.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=530

 Score =   412 bits (1060),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 204/455 (45%), Positives = 299/455 (66%), Gaps = 12/455 (3%)
 Frame = -2

Query  1816  WYAKYNNLCDWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKAF  1646
             ++   N   +W T +L ++P+ T   H    +R  +TANP NV++MLK+ F+N+PKG+ F
Sbjct  77    FFKNRNRFVEWVTDILASNPTNTAVYHRPVNIRGIMTANPLNVQHMLKNNFDNYPKGELF  136

Query  1645  SAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGKK  1466
             ++ L DFLG+GIFNVDG  W+ QRK AS E    S+ ++  +++  E   RL+P+L  +K
Sbjct  137   TSHLEDFLGRGIFNVDGHLWKVQRKTASSEFSTKSLRNFVMDIVNEETLSRLVPLL--RK  194

Query  1465  DGG---VVDLQDVFRRFSFDCICRFSFGLDPKCLES-LLPMSEFAVSFHLASKLSAERAM  1298
               G   VVD+QD+  RF+FD +C+ +F +DP CL       +EF  +F+ A+ LSA R +
Sbjct  195   ASGQKIVVDMQDIMERFAFDHVCKLAFNVDPGCLGGDNTAGAEFMKAFNDAATLSAGRFL  254

Query  1297  SASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSI  1118
                P +WK+KR LNIGSE+ LR +I  ++  A ++IR R +     +N +DLLSRF+ + 
Sbjct  255   YFLPYLWKMKRALNIGSEERLRSAISTVHDFADKIIRSRMQEKEEKQNDEDLLSRFIANE  314

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV---VGKNQDL  947
              +   +LRDI+I+F+LAGRDT ++ L+ FFWL++N P+    IL E   +    GK  D 
Sbjct  315   SNSPEFLRDIIINFILAGRDTTSTTLSWFFWLLSNRPEVERKILDELKLIRASNGKKIDD  374

Query  946   IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
               S   +RE+ YLQAA+ E+LRL+PP+  D+K C +DDV+PDGT V +G  VTYH YAMG
Sbjct  375   TYSFNELREMQYLQAALSEALRLYPPVALDTKVCRKDDVMPDGTFVGKGWFVTYHAYAMG  434

Query  766   RMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVL  587
             RME IWG DCLEFKPERWL +GV  +E+PF++P F AG R+CLGK+MA + +KS+  SV+
Sbjct  435   RMESIWGKDCLEFKPERWLENGVCRRESPFRFPAFHAGPRICLGKDMAYILMKSITASVI  494

Query  586   RRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +RF++ +      P     LT   ++GLP+ V++R
Sbjct  495   QRFQMEVVDKDKCPELVVSLTLRMKEGLPMRVKER  529



>ref|XP_006351474.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=492

 Score =   410 bits (1054),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 218/452 (48%), Positives = 292/452 (65%), Gaps = 11/452 (2%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI +      R  ITANP+NVEYMLK+ F N+PKGK 
Sbjct  44    SFYKNRHQLLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKP  103

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AG  1472
             F+ ILGDFLG+GIFNVDG+ W  QRK+AS E   +S+     + ++  ++ RL+P+L   
Sbjct  104   FTDILGDFLGRGIFNVDGELWSAQRKLASHEFSTNSLRELVVKALEEVVENRLIPLLIQA  163

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              K G V+DLQDV RRF+FD IC+ S G DP CL+ L  +     SF  AS   A R M+ 
Sbjct  164   AKSGKVLDLQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVESFDTASLACAMRGMAP  223

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGD  1112
                +WK KR LN+GSEK+L+++++ ++    E+I ++++   S  NH DLLSR + + G 
Sbjct  224   VYAIWKSKRALNLGSEKKLKENVKRVHCCIDEIIVEKKQKIVSG-NHMDLLSRLLLA-GH  281

Query  1111  DETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASE-  935
             +   +RD+VISFL+AGRDT +SALT  FWLI NH D  + ++ E   +   N D  A E 
Sbjct  282   ENEVVRDMVISFLIAGRDTTSSALTWLFWLITNHHDIKDKMIKEITSI--NNGDHKALEF  339

Query  934   QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEG  755
               ++E+ YL A + ES+RL+PP+ +DSK   +DD+LPDGT V++G RVTY  Y MGRME 
Sbjct  340   DELKEMKYLAACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFQYGMGRMEE  399

Query  754   IWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRF  578
             IWG D LEFKPERW+  +G     +P+KYPVFQAG RVCLGKEMA  ++K V  SVLRRF
Sbjct  400   IWGKDRLEFKPERWMDENGELKIVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRF  459

Query  577   RVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              +   +    P F P LTA    G  V +  R
Sbjct  460   EIKPVKV-EKPVFMPLLTAHMVGGFNVRIHHR  490



>ref|XP_004236333.1| PREDICTED: cytochrome P450 94B3-like [Solanum lycopersicum]
Length=494

 Score =   410 bits (1055),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 293/453 (65%), Gaps = 11/453 (2%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI +      R  ITANP+NVEYMLK+ F N+PKGK 
Sbjct  41    SFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKP  100

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ ILGDFLG+GIFNVDG+ W  QRK+AS E   +S+  +  + ++  ++ RL+P+L   
Sbjct  101   FTDILGDFLGRGIFNVDGELWSAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQT  160

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              + G V+DLQDV RRF+FD IC+ S G DP CL+ L  +     SF  AS   A R M+ 
Sbjct  161   ANSGKVLDLQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASLACAMRGMAP  220

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRR-KLGTSDE-NHKDLLSRFMGSI  1118
                +WK KR LN+GSEK+L+++++ ++    ++I +++ K+ T +  NH DLLSR + + 
Sbjct  221   VYAIWKSKRALNLGSEKKLKENVKRVHCCIDKIIEEKKQKIATENGGNHMDLLSRLLLA-  279

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIAS  938
             G +   +RD+VISFL+AGRDT +SALT  FWL  NH D  + ++ E   +   N D    
Sbjct  280   GHENEVVRDMVISFLMAGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSI--NNGDKALE  337

Query  937   EQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRME  758
                ++E+ Y+ A + ES+RL+PP+ +DSK   +DD+LPDGT V++G RVTY PY MGRME
Sbjct  338   FDELKEMKYITACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRME  397

Query  757   GIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRR  581
              IWG D LEFKPERW+  +G     +P+KYPVFQAG RVCLGKEMA  ++K V  SVLRR
Sbjct  398   EIWGKDRLEFKPERWMEENGELKIVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRR  457

Query  580   FRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             F +   +    P F P LTA    G  V +  R
Sbjct  458   FEIKPVK-LEKPVFLPLLTAHMVGGFNVRIHHR  489



>gb|AJD25220.1| cytochrome P450 CYP94B50 [Salvia miltiorrhiza]
Length=505

 Score =   410 bits (1053),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 213/456 (47%), Positives = 292/456 (64%), Gaps = 12/456 (3%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L  WYT LL  S ++TI +H L   R  +TANP+NVEYMLK+ F NFPKGK 
Sbjct  48    SFYKNRHRLLSWYTELLSESENQTIVVHRLGAPRTVVTANPDNVEYMLKTNFANFPKGKP  107

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-G  1472
             F+ +LGDFLG GIFNVDG+ W  QRK+AS E    S+  +  +V++ E+  RL+PIL   
Sbjct  108   FTELLGDFLGLGIFNVDGEMWSVQRKLASHEFSTKSLREFVVQVLRDEVAARLIPILENA  167

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              +D GV+D+Q+V RRF+FD IC+ S G+DP CL+   P    + +F  AS+LSA R  + 
Sbjct  168   AEDNGVLDMQEVLRRFAFDTICKVSLGMDPSCLDMSRPAPPLSSAFDAASELSAMRGAAP  227

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK-----DLLSRFM  1127
                VWK+KR LN+G EK+L+ ++  +     E+IR +++   +          DLLSRF+
Sbjct  228   VFAVWKLKRALNVGPEKDLKDAVRTVRGCVDEMIRCKKETMAAGGGGGGGGGGDLLSRFL  287

Query  1126  GSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDL  947
             G+ G +   +RD+VISFL+AGRDT ++ALT  FWL+  H DA    + E     G +   
Sbjct  288   GA-GMESEMVRDMVISFLMAGRDTTSAALTWLFWLLTWHRDAERRAVEEIGDGYGGSCGR  346

Query  946   IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
                   ++E+N+++A +CE++RL+PP+ +DSK    DDVLPDGT V RG RVTY PY MG
Sbjct  347   ELGFDDLKEMNFVKACLCETMRLYPPVVWDSKHAARDDVLPDGTPVFRGNRVTYFPYGMG  406

Query  766   RMEGIWGSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSV  590
             RME +WG D L F+P+RWL D G     +P+K+PVFQAG RVCLGKEMA +++K V  SV
Sbjct  407   RMEALWGKDRLRFRPDRWLDDAGAVKMVSPYKFPVFQAGPRVCLGKEMAFIQMKYVVASV  466

Query  589   LRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             L RF +   +P   P F P LTA    G  V V++R
Sbjct  467   LARFELVPVRP-EPPVFVPQLTAYMAGGFSVRVRRR  501



>ref|XP_008239459.1| PREDICTED: cytochrome P450 94B3 [Prunus mume]
Length=510

 Score =   409 bits (1051),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 294/459 (64%), Gaps = 15/459 (3%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTI---HIHVLRNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   +NL DWYT LL NSPS+TI    I   R  +TANP NVE++LK+ F NFPKGK 
Sbjct  51    SFYKNQHNLLDWYTSLLSNSPSQTIVVRRIGARRTIVTANPSNVEHVLKTNFTNFPKGKP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AG  1472
              +  LGD LG GIFNVDGD W  QRK+AS E    S+  +  + ++ E++ RL+P+L   
Sbjct  111   LTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSTKSLREFVVKTLEEEVEHRLIPLLEEA  170

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              +   V+DLQ++ RRF+FD +C+ S G DP CL+   P+     +F  AS +SA RA + 
Sbjct  171   AESKSVLDLQEILRRFAFDTVCKVSLGSDPFCLDLTRPVPPLVEAFDCASGISARRATAP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN--HKDLLSRFMGSI  1118
               ++WK+KR LNIGSEK+L++++++++    E+I+ ++K+   DE     D+LSR + + 
Sbjct  231   LYLMWKVKRALNIGSEKKLKEAVKLVHGSVHEIIQNKKKILEKDEGCESHDMLSRLLLA-  289

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA-  941
             G  E  +RD+VISF+LAGRDT ++A+T  FWL++ HP     I+ E + V+G+N      
Sbjct  290   GHGEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPSINHQIVNEVENVLGQNTSTEKL  349

Query  940   SEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRM  761
               + ++++ +L+A +CES+RL+PP+ +DSK    D VLPDGT V +G RVTY PY MGRM
Sbjct  350   GFEDLQKMRFLRACLCESMRLYPPVPWDSKHAEVDTVLPDGTWVGKGDRVTYFPYGMGRM  409

Query  760   EGIWGSDCLEFKPERWL-------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             E +WG D  EF P+RW          GV    +P+K+PVFQAG RVCLGKEMA +++K V
Sbjct  410   EELWGKDWFEFNPDRWFDIEHGCDDGGVLKSISPYKFPVFQAGPRVCLGKEMAFIQMKYV  469

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQ  485
               SVLRRF +        P F P LTA    GL V V++
Sbjct  470   MASVLRRFEIKPVYEKEQPIFVPLLTAHMAGGLKVLVRK  508



>ref|XP_010550730.1| PREDICTED: cytochrome P450 94B3 [Tarenaya hassleriana]
Length=505

 Score =   409 bits (1050),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 219/461 (48%), Positives = 305/461 (66%), Gaps = 17/461 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+YA    L  WYT LL  SPS+TI +  L   R  +TANP+NVEY+LK+ F NFPKGK 
Sbjct  44    SFYANRRRLLQWYTDLLSLSPSQTISLRRLGSRRTVVTANPDNVEYILKTNFINFPKGKP  103

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AG  1472
             F+ +LGD LG GIFN D D W  QRK+AS E    S+  + FEV++ E + RL+P+L + 
Sbjct  104   FTDLLGDLLGGGIFNSDADQWSSQRKVASHEFTTRSIRDFGFEVLRDEAENRLIPVLESA  163

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
                G  +DLQ+V +RF+FD +C+FS G DP CL+   P+S   V+F  A+++SA RAM  
Sbjct  164   AYAGATLDLQEVLKRFAFDVVCKFSLGTDPDCLDLTRPVSPLVVAFDTAAEISARRAMEP  223

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGS  1121
                VWKIKR+LN+GSE+ LR+++  +++   E+IR ++K   +GT DE  +DLLSRF+ S
Sbjct  224   IYAVWKIKRWLNVGSERRLREAVRTVHVSVSEIIRAKKKSLEIGTGDEAKQDLLSRFL-S  282

Query  1120  IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV-GKNQDLI  944
              G     +RD+VISF++AGRDT ++A+T  FWL+  +  A + +L E   ++ GK+ DL 
Sbjct  283   AGHGGDAVRDMVISFIMAGRDTTSAAMTWLFWLLTQNDVAEKKVLEEVGSLMKGKDGDLG  342

Query  943   ASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGR  764
                + ++ ++Y +A +CE++RL+PP+ +DSK    DDVLPDGT V RG +VTY PY MGR
Sbjct  343   LGFEDLKVMSYTKACLCEAMRLYPPVAWDSKHAANDDVLPDGTRVSRGDKVTYFPYGMGR  402

Query  763   MEGIWGSDCLEFKPERWL----RDG---VFFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             ME +WG D  EFKP+RWL     DG   V    +PFK+PVFQAG RVCLGKE A +++K 
Sbjct  403   MEKLWGKDWDEFKPDRWLACEPEDGARPVLRSVSPFKFPVFQAGPRVCLGKETAFMQMKY  462

Query  604   VALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             V  SVLRRF + +   ++ P F P LTA    G  V +++R
Sbjct  463   VIGSVLRRFEI-VPVCNNRPIFVPLLTAHMASGFKVKIKRR  502



>gb|KCW83162.1| hypothetical protein EUGRSUZ_B00117, partial [Eucalyptus grandis]
Length=506

 Score =   409 bits (1050),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 210/457 (46%), Positives = 301/457 (66%), Gaps = 20/457 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI IH L   R  +TANP+NVE++LK+ F N+PKG  
Sbjct  51    SFYRNRSRLLDWYTDLLSRSPTQTIVIHRLGACRTVVTANPDNVEHVLKNNFHNYPKGAP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F++ILGDFLG GIFNVDG  W  QRK+AS E   +S+  +    ++ E+  RLLP+L   
Sbjct  111   FTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTLEAEVGNRLLPLLQDY  170

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ RRF+FD +C+ S G DP CL+    +     +F  AS++ A RA S 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRTLPPLVTAFENASRICATRANSP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENH----KDLLSRF  1130
               +VWKIKR LNIGSEK+L +++++++   +++IR R+K  L  +D+       DLLSRF
Sbjct  231   VYLVWKIKRGLNIGSEKKLSEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + ++G  E  +RD+VISF++AGRDT ++A+T  FWL+A + +A  AI++E D ++ ++  
Sbjct  291   L-AVGHSEEMVRDMVISFVMAGRDTTSAAITWLFWLLAQNSNAERAIVSEVDSILDRSYK  349

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+PP+ +DSK    DDVLPDGT V++G RVTY PY M
Sbjct  350   NCLDFEALKEMRFLKACLCESMRLYPPVAWDSKHAAADDVLPDGTPVRKGDRVTYFPYGM  409

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GRM+ +WG D LEFKP+RWL         +G     +P+K+PVFQAG RVCLGKEMA ++
Sbjct  410   GRMKELWGKDRLEFKPDRWLVGPGMEGGTEGELRAVSPYKFPVFQAGPRVCLGKEMAFIQ  469

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGL  503
             +K V  S+L+RF +      + P F P LTA    GL
Sbjct  470   MKYVVASILKRFVIRPVL-ENRPVFVPLLTAHMAGGL  505



>ref|XP_006447077.1| hypothetical protein CICLE_v10017920mg [Citrus clementina]
 gb|ESR60317.1| hypothetical protein CICLE_v10017920mg [Citrus clementina]
Length=492

 Score =   408 bits (1048),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 208/451 (46%), Positives = 294/451 (65%), Gaps = 12/451 (3%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  S + TI +      R  +TANPENVEY+LK+ F NFPKGK 
Sbjct  45    SFYRNRHRLLDWYTELLAKSATNTIVVSRFGARRTIVTANPENVEYILKTNFNNFPKGKP  104

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG-  1472
             F+ ILGDFLG GIFNVDG+ WR QRK+AS E   +S+  +    ++ E+D RLLP++   
Sbjct  105   FTEILGDFLGYGIFNVDGELWRSQRKMASHEFSTNSLREFVMNTLKDEVDNRLLPLMDSL  164

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              K    VDLQ++  R +F+ IC+ S G+D  CL+   P    A +F +AS++SA R  + 
Sbjct  165   AKSSEEVDLQELLTRLAFNMICKVSMGIDRCCLDPSSPAPPLAKAFDMASEISARRGAAP  224

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN-HKDLLSRFMGSIG  1115
               +VWKIK++L IGSE++L+ ++E++     E+I  ++      EN  +DLLSR + S G
Sbjct  225   LFIVWKIKKWLGIGSERQLKDAVELVREYVEEIIHNKKMTVRQGENDSQDLLSRLIAS-G  283

Query  1114  DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASE  935
              +E  +RD+ IS ++AGRDT ++A+   FWLI+ H D  + ++ E   V   ++D+    
Sbjct  284   QEEEVIRDMAISLIMAGRDTTSAAMVWLFWLISCHQDIEQKLVKETGLV---SEDI--DY  338

Query  934   QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEG  755
             + ++EL  L+A +CES+RL+PP+ +DSK    DD+LPDGTAV+ G RVTY PY MGRME 
Sbjct  339   ESLKELRLLKACICESMRLYPPVAWDSKHAAADDLLPDGTAVQAGDRVTYFPYGMGRMEA  398

Query  754   IWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFR  575
             +WG+D  EFKP+RWL  G   +  P+K+PVFQAG RVCLGKEMA +++K V  SVLRR++
Sbjct  399   LWGNDWFEFKPQRWLSQGEPDKVCPYKFPVFQAGPRVCLGKEMAFIQMKYVVASVLRRYQ  458

Query  574   VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +   +    P F P LTA    GL VFV++R
Sbjct  459   IRPVRSGQ-PVFVPRLTAHMAGGLKVFVRRR  488



>ref|XP_006470124.1| PREDICTED: cytochrome P450 94A2-like [Citrus sinensis]
Length=497

 Score =   408 bits (1048),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 208/451 (46%), Positives = 294/451 (65%), Gaps = 12/451 (3%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  S + TI +      R  +TANPENVEY+LK+ F NFPKGK 
Sbjct  50    SFYRNRHRLLDWYTELLAKSATNTIVVSRFGARRTIVTANPENVEYILKTNFNNFPKGKP  109

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAG-  1472
             F+ ILGDFLG GIFNVDG+ WR QRK+AS E   +S+  +    ++ E+D RLLP++   
Sbjct  110   FTEILGDFLGYGIFNVDGELWRSQRKMASHEFSTNSLREFVMNTLKDEVDNRLLPLMDSL  169

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              K    VDLQ++  R +F+ IC+ S G+D  CL+   P    A +F +AS++SA R  + 
Sbjct  170   AKSSEEVDLQELLTRLAFNMICKVSMGIDRCCLDPSSPAPPLAKAFDMASEISARRGAAP  229

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN-HKDLLSRFMGSIG  1115
               +VWKIK++L IGSE++L+ ++E++     E+I  ++      EN  +DLLSR + S G
Sbjct  230   LFIVWKIKKWLGIGSERQLKDAVELVREYVEEIIHNKKMTVRQGENDSQDLLSRLIAS-G  288

Query  1114  DDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASE  935
              +E  +RD+ IS ++AGRDT ++A+   FWLI+ H D  + ++ E   V   ++D+    
Sbjct  289   QEEEVIRDMAISLIMAGRDTTSAAMVWLFWLISCHQDIEQKLVKETGLV---SEDI--DY  343

Query  934   QRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEG  755
             + ++EL  L+A +CES+RL+PP+ +DSK    DD+LPDGTAV+ G RVTY PY MGRME 
Sbjct  344   ESLKELRLLKACICESMRLYPPVAWDSKHAAADDLLPDGTAVQAGDRVTYFPYGMGRMEA  403

Query  754   IWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFR  575
             +WG+D  EFKP+RWL  G   +  P+K+PVFQAG RVCLGKEMA +++K V  SVLRR++
Sbjct  404   LWGNDWFEFKPQRWLSQGEPDKVCPYKFPVFQAGPRVCLGKEMAFIQMKYVVASVLRRYQ  463

Query  574   VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +   +    P F P LTA    GL VFV++R
Sbjct  464   IRPVRSGQ-PVFVPRLTAHMAGGLKVFVRRR  493



>gb|EMS54048.1| Cytochrome P450 94A1 [Triticum urartu]
Length=410

 Score =   404 bits (1039),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 193/343 (56%), Positives = 258/343 (75%), Gaps = 11/343 (3%)
 Frame = -2

Query  1861  FYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNTITANPENVEYMLK  1682
             ++C+C VC AY++ SW  +++NLCDW+ HLLR  P +T+H+HVL N +TANP  VE+ML+
Sbjct  54    WWCACAVCEAYLTASWTGEFDNLCDWFAHLLRREPGRTVHVHVLGNVLTANPATVEHMLR  113

Query  1681  SRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEI  1502
              RF+N+PKG  FSAIL DFLG+GIFNVDGDSW FQRK+A+ +L   ++ ++   V+ +E+
Sbjct  114   GRFDNYPKGAPFSAILADFLGRGIFNVDGDSWLFQRKLAAAQLASPAIRAFTASVVASEL  173

Query  1501  DRRLLPIL--AGKKDGG---VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
               RL+P+L  A  + GG   ++DLQDVFRRF+FDCIC+ SFGLDP CLE  LPMS FA +
Sbjct  174   RCRLIPLLHSASAEQGGQEKLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPMSAFADA  233

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  AS LSA RA +   VVWK+KR LNIG E+ELR +I +++ LA EVIRQRRKLG++  
Sbjct  234   FDTASMLSARRATAPMHVVWKLKRLLNIGDERELRDAIGLVDDLAAEVIRQRRKLGSATA  293

Query  1156  NHKDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA  977
             +  DLLSRFMGSI DD+ YLRDIV+SFLLAGRDTVASALT+FF L+++HP  A+AI  E 
Sbjct  294   SGDDLLSRFMGSINDDK-YLRDIVVSFLLAGRDTVASALTAFFLLLSDHPHVADAIRDEV  352

Query  976   DRVVGKNQDL-----IASEQRMRELNYLQAAVCESLRLFPPIQ  863
              RV    +D+     IAS + +++++Y+ AA+ E +RL PP+Q
Sbjct  353   SRVTAGGRDVDDHPAIASSENLKDMHYVHAALYECMRLVPPVQ  395



>ref|XP_006338805.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=522

 Score =   408 bits (1049),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 297/459 (65%), Gaps = 19/459 (4%)
 Frame = -2

Query  1816  WYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAF  1646
             +Y     L DWYTHLL +SP+KTI I  L   R  +TANP NVEYMLK+ F+NFPKGK F
Sbjct  59    FYKNRYRLLDWYTHLLSHSPTKTIVIDRLGARRTIVTANPHNVEYMLKTNFDNFPKGKPF  118

Query  1645  SAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AGK  1469
             + ILGDFLG GIFNVDG+ W  QRK+ S E     +  Y    ++ E++ +LLP+L   +
Sbjct  119   NEILGDFLGNGIFNVDGEMWYKQRKMVSHEFTARCLRDYVVNALKEEVENKLLPMLDLME  178

Query  1468  KDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSAS  1289
              +    DLQD+ RR  FD +C+ S G DP CL   LP S    +F  AS++ A R  +  
Sbjct  179   AENRAFDLQDLLRRLGFDVVCKVSLGFDPCCLNHSLPFSPLLHAFERASQICAGRGAAPI  238

Query  1288  PVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENH----KDLLSRFMGS  1121
               +WK+KR+LNIGSE++LR +I+ ++    ++IR+R K+    EN     KDLLS+ + +
Sbjct  239   SAIWKVKRWLNIGSERQLRLAIDQIHSSVADIIRER-KIKIRGENQQEISKDLLSKLILA  297

Query  1120  IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA  941
                DE  +RD+VISF++AGRDT+++A+T  F+L+  HP+    ++++  R +    + + 
Sbjct  298   ENFDEEEVRDMVISFIIAGRDTISAAMTWLFYLLTLHPEIENELVSKELRFI--EAETLT  355

Query  940   SEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRM  761
               + +RE+ +L+A +CE++RL+PP+ +DSK  + DD+LPDGT +K G RVTY PY MGRM
Sbjct  356   KHETLREMKFLKACLCETMRLYPPVAWDSKHAIADDILPDGTRIKAGNRVTYFPYGMGRM  415

Query  760   EGIWGSDCLEFKPERWLRD------GVFFQ-ENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             E +WG D LEFKPERW+++      GV  Q  N +K+PVFQAG RVCLGKE+A +++K V
Sbjct  416   ENLWGKDMLEFKPERWMQNSEEDEGGVAEQASNLYKFPVFQAGPRVCLGKELAFIQMKYV  475

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQ  485
               S+L+RF++  A     P F P LTA    G  +FV +
Sbjct  476   VSSILKRFQIRPAC-SDPPVFLPLLTAHMAGGFKIFVHK  513



>ref|XP_009394066.1| PREDICTED: cytochrome P450 94B3-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   408 bits (1048),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 208/451 (46%), Positives = 291/451 (65%), Gaps = 12/451 (3%)
 Frame = -2

Query  1816  WYAKYNNLCDWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKAF  1646
             +Y   + L DWYT LL +SP++TI I      R  +TANP NVE++L++ F N+PKG+AF
Sbjct  53    FYRNRHRLLDWYTELLASSPTQTIVIGRFGARRTVVTANPNNVEHVLRTNFPNYPKGEAF  112

Query  1645  SAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK-  1469
             + ILGD LG GIFN DG  W  QRK+AS E    S+  +  E +++E + RLLPILA   
Sbjct  113   TDILGDLLGCGIFNADGQLWHTQRKLASHEFTTKSLREFVVETLESEAEERLLPILASAC  172

Query  1468  KDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSAS  1289
              D   VD+QD+ RRF+FD IC+ S G +P  L++ LP SE A +F +AS +SA R  +  
Sbjct  173   ADRRAVDVQDLLRRFAFDTICKVSLGTNPCYLDASLPESELANAFEVASGISARRGAAPM  232

Query  1288  PVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDD  1109
               VWK+KR  ++GSE+ LR ++++++   ME+IR R+        H DLL+R + S G  
Sbjct  233   AAVWKLKRAFDVGSERRLRGAVKLIHESIMELIRTRKTEMEKGTEHNDLLTRLI-SGGHS  291

Query  1108  ETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQR  929
             E  +RD+VISF++AGRDT ++ALT FFWLI+  PD    I+ E  R  G+      S Q 
Sbjct  292   EEVIRDMVISFVMAGRDTTSAALTWFFWLISRRPDVEAEIVDEVKRFKGR-----LSYQE  346

Query  928   MRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIW  749
             ++++  L+A +CES+R++PP+ +DSK     D LPDGT +K+G RVTY PY MGRME +W
Sbjct  347   LKDMKVLEACLCESMRMYPPVAWDSKHAAGSDELPDGTRIKKGDRVTYFPYGMGRMERLW  406

Query  748   GSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRV  572
             G++C EF   RWL + G   + +P+K+PVFQAG RVCLGKEMA  ++K +A +VL RF +
Sbjct  407   GNNCREFDHRRWLSEHGEVVRASPYKFPVFQAGPRVCLGKEMAFAQMKYIAAAVLGRFEL  466

Query  571   HLAQPH-HTPRFSPGLTATFRDGLPVFVQQR  482
                  H   P F P LTA    GL + V++R
Sbjct  467   RRDHRHSRPPVFVPLLTAHMAGGLQMVVEKR  497



>ref|XP_010247156.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=504

 Score =   408 bits (1048),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 204/445 (46%), Positives = 291/445 (65%), Gaps = 11/445 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             DW + +L   P+ T+  H    +   ITANP NVE+MLKS F N+PKG   ++ L DFLG
Sbjct  56    DWSSEVLARLPTNTLDYHHPGKVHGIITANPLNVEHMLKSNFHNYPKGSRVTSYLEDFLG  115

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKDGGVVDLQ  1442
             +GIFN DG+ W+ QRK AS E    S+ ++  + ++ EI  RL+P+L        VVD+Q
Sbjct  116   RGIFNADGEIWKIQRKTASYEFNTKSLRNFFMKSVEEEIQTRLVPVLKRASVLNQVVDMQ  175

Query  1441  DVFRRFSFDCICRFSFGLDPKCLESL-LPMSEFAVSFHLASKLSAERAMSASPVVWKIKR  1265
             D+  RFSFD +CR SF +DP CL S     +EF  +F  AS  SA R   A P +W+IK+
Sbjct  176   DILERFSFDTVCRLSFNMDPGCLGSEGTTGTEFMNAFGEASTYSAGRFFYALPYMWRIKK  235

Query  1264  FLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYLRDIV  1085
              LNIGSEK +RK+I +++  A ++I+ R K     E+  DLLSRF+ +  +   +LRDI+
Sbjct  236   ALNIGSEKRMRKAISIVHDFADDIIKSRMKEKGEKEDTDDLLSRFIANESNSAEFLRDII  295

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASE----QRMREL  917
             ISF+LAGRDT+ S++T FFW++++  D    IL E   +  +N++   SE      M ++
Sbjct  296   ISFMLAGRDTMTSSITWFFWVLSSRSDVEGNILHEMKSI--RNRNGTGSEAFNFDDMGQM  353

Query  916   NYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDC  737
             +YL+AA+ ESLR++PP+  D K C++DD++PDGT V +G  VTYH YAMGRME IWG DC
Sbjct  354   HYLKAALSESLRMYPPVPLDEKQCLQDDIMPDGTFVGKGWCVTYHAYAMGRMESIWGKDC  413

Query  736   LEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQP  557
             L+FKPERWL +G+  QE+PF++P F AG R+CLGK++A +++K V  SVL RF + L   
Sbjct  414   LDFKPERWLENGICRQESPFRFPAFHAGPRICLGKDVAHMQMKMVVASVLSRFHLDLVDK  473

Query  556   HHTPRFSPGLTATFRDGLPVFVQQR  482
             +  P+    LT   +DGLP+ V++R
Sbjct  474   YRAPKQILSLTLRMKDGLPMRVRER  498



>gb|EPS70135.1| hypothetical protein M569_04626, partial [Genlisea aurea]
Length=489

 Score =   407 bits (1046),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 206/459 (45%), Positives = 292/459 (64%), Gaps = 23/459 (5%)
 Frame = -2

Query  1816  WYAKYNNLCDWYTHLLRNSPSKTIHIHVLRNT------ITANPENVEYMLKSRFENFPKG  1655
             ++   +    W   ++ ++P+ T   + LR T      ITA+P NV ++LKS F  + KG
Sbjct  40    FFKNRDRFVQWTAEIVNSTPTNT---YTLRRTMGQRFVITADPRNVHHILKSHFHVYEKG  96

Query  1654  KAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-  1478
               F A+L D LG GIFN DG+ W+FQR+IAS E    S+  +   ++  E+  R LPIL 
Sbjct  97    DHFKAVLRDLLGDGIFNADGEIWKFQRQIASHEFNTKSLRKFFDTIVDAELSDRFLPILR  156

Query  1477  AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAM  1298
                 DG V+D QD+ +RF+FD IC+F+FG DP+CL   LP SEFAV+F  A +LS ER  
Sbjct  157   TAATDGTVLDFQDILQRFAFDNICKFAFGYDPECLTPALPESEFAVAFRNAVRLSRERFA  216

Query  1297  SASPVVWKIKRFLNIG-SEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGS  1121
             +  P+ WK++R LN+G SEKEL+ ++  +  LA E+IR+++      ++  DLLSRF+ S
Sbjct  217   TFLPIFWKLRRALNLGKSEKELKSAVSKVQNLAREIIRRKKNHPGKIDDGSDLLSRFLSS  276

Query  1120  IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA  941
                DE  L DIVISF+LAGRDT ++ LT FFW+++ HP   +AIL E +  V ++    A
Sbjct  277   GHTDEVMLMDIVISFILAGRDTTSAVLTWFFWVLSKHPRVEDAILEEINTKVSES----A  332

Query  940   SEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRM  761
             + + ++E+ Y  A++ ES+RL+PP+  DSK  V DDVLPDGT VK+G R+ YHPYAMGR+
Sbjct  333   AYEEVKEMVYTHASISESMRLYPPVPVDSKSAVADDVLPDGTVVKKGMRIAYHPYAMGRV  392

Query  760   EGIWGSDCLEFKPERWLRDG------VFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             E IWG D  EF+PERWL++        F   +P+ YPVFQAG R+CLGK++A L++KSV 
Sbjct  393   EKIWGKDWPEFRPERWLQNSPDSGRLTFVNRDPYTYPVFQAGPRICLGKDLAFLQMKSVV  452

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
               VLR FR+      + P +   LTA  + G PV ++ R
Sbjct  453   AGVLREFRIIPVV--NEPEYISFLTAKMKGGFPVRIEAR  489



>ref|XP_011083758.1| PREDICTED: cytochrome P450 94B3-like [Sesamum indicum]
Length=545

 Score =   409 bits (1050),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 216/470 (46%), Positives = 304/470 (65%), Gaps = 16/470 (3%)
 Frame = -2

Query  1873  RIKLFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPE  1703
             +  L+ C    C      ++Y     L DWYT LL  S ++TI +H L   R  +TANP+
Sbjct  83    KFALYSCPSIGCL----IAFYKNRRRLLDWYTELLSQSETQTIVVHRLGAPRTIVTANPD  138

Query  1702  NVEYMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAF  1523
             NVEY+LK+ F NFPKGK F+ +LGDFLG GIFNVDG+ W  QRK+AS E    S+  +  
Sbjct  139   NVEYILKTNFANFPKGKPFTELLGDFLGLGIFNVDGEKWSIQRKLASHEFSAKSLREFVV  198

Query  1522  EVIQTEIDRRLLPIL-AGKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEF  1346
             +V++ E++ RL+PIL    ++  ++D+Q+V RRF+FD IC+ S G+DP CL+   P    
Sbjct  199   KVLEDEVESRLIPILDDAAENDRIIDMQEVLRRFAFDTICKVSLGMDPLCLDLARPPPPL  258

Query  1345  AVSFHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGT  1166
             A +F  AS +SA R  +    VWK+KR LN+G EKEL++++++++    E+IR ++  GT
Sbjct  259   ASAFDAASAISAMRGTAPVFAVWKLKRTLNVGLEKELKEAVKLVHGCVDEMIRSKK--GT  316

Query  1165  SDENH-KDLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAI  989
                N   DLLSRF+ S  DDE  +RD+VISFL+AGRDT ++A+T  FWL+  H    + +
Sbjct  317   MGGNSGGDLLSRFLESGLDDEM-VRDMVISFLMAGRDTTSAAVTWLFWLLTGHRGIEKQV  375

Query  988   LAEADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAV  809
             + E   +    + L   +  ++ LN+++A +C+ +RL+PP+ +DSK  V+DDVLPDGT V
Sbjct  376   VDEITSMKNGGEQLGFDD--LKGLNFIKACLCDDMRLYPPVVWDSKHAVKDDVLPDGTPV  433

Query  808   KRGTRVTYHPYAMGRMEGIWGSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGK  632
              RG RVTY  Y MGRME +WG D LEF+PERWL + G+    +P+K+ VFQAG RVCLGK
Sbjct  434   YRGNRVTYFQYGMGRMEEVWGKDRLEFRPERWLDESGMVKMVSPYKFAVFQAGPRVCLGK  493

Query  631   EMALLELKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             EMA +++K V  SVLRRF +H  +    P F P LTA    G  V VQ+R
Sbjct  494   EMAFIQMKYVVASVLRRFELHPVR-SEPPVFVPLLTAYMGGGFNVRVQRR  542



>ref|XP_010250748.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=516

 Score =   407 bits (1047),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 299/464 (64%), Gaps = 22/464 (5%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y     L DWYT LL +SP +TI I      R  +TANP+NVEY+L + F NFPKG+ 
Sbjct  52    SFYKNRRRLLDWYTDLLADSPMQTIVIRRFGARRTVVTANPDNVEYILTTNFNNFPKGQP  111

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ ILGD LG GIFNVDG+ WR QRK+AS E    S+  +  + +   +  RL P+LA  
Sbjct  112   FTDILGDLLGCGIFNVDGELWRAQRKLASHEFSTKSLREFVGKTLNQVVKNRLTPVLASA  171

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              +   +VDLQD+ RRF+FD +C  S G+DP CL+S LP+S  A +F +AS++SA RA + 
Sbjct  172   METDQIVDLQDLLRRFAFDTVCMVSLGIDPGCLDSSLPVSALAGAFDIASEISARRASAP  231

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLG---------TSDENHKDLL  1139
                VWKIKR L +GSE+ L+++I+ ++    E+IR ++KL           ++ ++ DLL
Sbjct  232   VFAVWKIKRALCLGSERRLKEAIQHVHGSVEEIIRDKKKLMLNRVRKEEINNNNSNGDLL  291

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGK  959
             SR + S  DDE  +RD+VISF++AGRDT ++A+T  FWL++ HP     ++ E + +   
Sbjct  292   SRLISSGYDDEV-IRDMVISFIMAGRDTASAAMTWLFWLLSCHPHIENEVVKEVEAINTG  350

Query  958   NQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHP  779
             +  L    + ++EL  L+A +CES+RL+PPI +DSK  VEDD LPDGT V+ G RVTY P
Sbjct  351   DSPL--DYEALKELPLLKACLCESMRLYPPIAWDSKHVVEDDTLPDGTRVRAGDRVTYFP  408

Query  778   YAMGRMEGIWGSDCLEFKPERWLRD-----GVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             Y MGRMEG+WG D  EFKP+RW  +     G   + +PFK+PVFQAG RVCLGKEMA ++
Sbjct  409   YGMGRMEGLWGKDRFEFKPDRWFVEPDKEGGALKEVSPFKFPVFQAGPRVCLGKEMAFVQ  468

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K V  S+L++F+   +     P F P LTA    GL V ++ R
Sbjct  469   MKYVMASLLKQFQFK-SVGLEEPAFVPLLTAHMAGGLNVLIRPR  511



>ref|XP_010045497.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=518

 Score =   407 bits (1047),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 210/457 (46%), Positives = 297/457 (65%), Gaps = 20/457 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI IH L   R  +TANP+NVE++LK+ F N+PKG  
Sbjct  51    SFYRNRSRLLDWYTDLLSQSPTQTIVIHRLGACRTVVTANPDNVEHVLKNNFHNYPKGVP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ ILGDFLG GIFNVDG  W  QRK+AS E    S+  +    ++ E++ RLLP+L   
Sbjct  111   FTCILGDFLGCGIFNVDGPLWSTQRKLASHEFSTHSLRDFVVRTLEAEVENRLLPLLQDY  170

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D    +DLQD+ RRF+FD +C+ S G DP CL+   P+     +F  AS++ A R  S 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRGTSP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENH----KDLLSRF  1130
               +VWKIKR LNIGSE +L +++ +++   +++IR R+K  L  +D+       DLLSRF
Sbjct  231   VYLVWKIKRVLNIGSENKLAEAVNLVHDDILDIIRSRKKKLLKQNDDQQIKYDGDLLSRF  290

Query  1129  MGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQD  950
             + + G  E  +RD+ ISF++AGRDT ++A+T  F L+A + +A EAI++E D ++ ++ +
Sbjct  291   LAA-GHSEEMVRDMAISFVMAGRDTTSAAMTWLFLLLAQNSNAEEAIVSEVDSILDRSYN  349

Query  949   LIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAM  770
                  + ++E+ +L+A +CES+RL+PP+ +DSK    DDVLPDGT VK+G RVTY PY M
Sbjct  350   KCLDFKALKEMRFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGTLVKKGDRVTYFPYGM  409

Query  769   GRMEGIWGSDCLEFKPERWL--------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLE  614
             GRM+ +WG D LEFKP+RWL         +G     +P+KYPVFQAG RVCLGKEMA ++
Sbjct  410   GRMKELWGEDRLEFKPDRWLVEPGMDGGAEGELRAVSPYKYPVFQAGPRVCLGKEMAFIQ  469

Query  613   LKSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGL  503
             +K V  S+L+RF +      + P F P LTA    GL
Sbjct  470   MKYVVASILQRFEIRPVL-ENRPVFVPLLTAHMAGGL  505



>ref|XP_006351475.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=495

 Score =   406 bits (1044),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 212/456 (46%), Positives = 291/456 (64%), Gaps = 13/456 (3%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI +      R  ITANP+NVEYMLK+ F N+PKGK 
Sbjct  41    SFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKP  100

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AG  1472
             F+ ILGDFLG GIFNVDG+ W  QRK+AS E   +S+  +  + ++  ++ RL+P+L   
Sbjct  101   FTDILGDFLGGGIFNVDGELWSAQRKLASHEFSTNSLREFVVKTLEEVVETRLVPLLIQA  160

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              K G V++LQDV RRF+FD IC+ S G DP CL+ L  +     SF  AS+  A R M+ 
Sbjct  161   AKSGKVLNLQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASQACAMRGMAP  220

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN-----HKDLLSRFM  1127
                +WK KR LN+GSEK+L+++++ ++    E+I +++    + EN     + DLLSR +
Sbjct  221   VYAIWKSKRALNLGSEKKLKENVKRVHCCIDEIIEEKKLKNIATENGDHMKNTDLLSRLL  280

Query  1126  GSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDL  947
              + G +   +RD+VISFL+AGRDT +SALT  FWL  NH D  + ++ E   +   ++ L
Sbjct  281   IA-GYENEVVRDMVISFLMAGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSINNGDKSL  339

Query  946   IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
                E  ++E+ YL A + ES+RL+PP+ +DSK   +DD+LPDGT V++G RVTY  Y MG
Sbjct  340   DFDE--LKEMKYLAACLNESMRLYPPVVWDSKHAAKDDILPDGTRVQKGNRVTYFQYGMG  397

Query  766   RMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSV  590
             RME IWG D LEFKP+RW+  +G     +P+KYPVFQAG RVCLGKEMA  ++K V  SV
Sbjct  398   RMEEIWGKDRLEFKPDRWIDENGALKIVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASV  457

Query  589   LRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             LRRF +        P F P LTA    G  V +  R
Sbjct  458   LRRFEIKPVVNVEKPVFVPLLTAHMAGGFNVRIYHR  493



>ref|XP_002300789.2| cytochrome P450 CYP94A1 family protein [Populus trichocarpa]
 gb|EEE80062.2| cytochrome P450 CYP94A1 family protein [Populus trichocarpa]
Length=517

 Score =   407 bits (1046),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 207/465 (45%), Positives = 303/465 (65%), Gaps = 22/465 (5%)
 Frame = -2

Query  1825  STSWYAKYNNLCDWYTHLLRNSPSKTIHIHVLRN---TITANPENVEYMLKSRFENFPKG  1655
             S + YA  N +  W + L++NSP+ TI +H   +     T NP NV+++LK++F N+ KG
Sbjct  46    SVAIYANRNRVIQWTSDLIQNSPTATIVLHRFLDDSRVHTGNPANVQHILKTQFHNYGKG  105

Query  1654  KAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA  1475
               F  IL DFLG GIFN+DGDSW+FQR+++S E    S+  +   ++ TE+ +RL+PIL+
Sbjct  106   SKFRRILFDFLGNGIFNIDGDSWKFQRQVSSNEFNTKSLRKFVETLVDTELSQRLIPILS  165

Query  1474  -GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAM  1298
                 +  V+DLQD+ +RF+FD IC  +FG DP  L   LP +EFA +F  A+K+S+ER  
Sbjct  166   SAAANNTVLDLQDILQRFAFDNICNIAFGYDPAYLLPDLPEAEFAKTFDDAAKISSERLN  225

Query  1297  SASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK--DLLSRFMG  1124
             S  P +WKIKR LNIGSEK L+++   +   A  +I+++++  +   + +  DLLSRF+ 
Sbjct  226   SVFPYLWKIKRVLNIGSEKRLKEASSQLRQFAKNIIKEKKQELSKKPSLESVDLLSRFLS  285

Query  1123  SIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLI  944
             S   DE ++ DIVISF+LAGRDT ++ALT +FWL++ + +  + +L E   +  K++  +
Sbjct  286   SGHSDEDFVTDIVISFILAGRDTTSAALTWYFWLLSQNQEVEKEVLRE---IKEKSESPV  342

Query  943   ASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGR  764
               E  ++++ Y  A++CES+RL+PP+  DSK    DDVLPDGT VK+G RV+YHPYAMGR
Sbjct  343   YEE--VKDMVYTHASLCESMRLYPPVPIDSKVAKHDDVLPDGTVVKKGMRVSYHPYAMGR  400

Query  763   MEGIWGSDCLEFKPERWLR---DGV-------FFQENPFKYPVFQAGLRVCLGKEMALLE  614
             +E +WGSD  +FKPERWL    DG        F   +P+ YPVFQAG R+CLGK+MA L+
Sbjct  401   LEVLWGSDWEKFKPERWLESAADGATKNGKWSFVGRDPYTYPVFQAGPRICLGKDMAFLQ  460

Query  613   LKSVALSVLRRFR-VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             +K V   +LRRF+ V +A+    P F   LT   + G PV  ++R
Sbjct  461   MKKVVAGILRRFKVVPVAEDGFEPEFVAYLTGKMKGGFPVRFEKR  505



>ref|XP_002877615.1| CYP94B3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53874.1| CYP94B3 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   407 bits (1045),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 216/459 (47%), Positives = 300/459 (65%), Gaps = 19/459 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+    + L  WYT LLR SPS+TI + +L   R  +T NPENVEY+LK+ F NFPKGK 
Sbjct  47    SFNKNRHRLLQWYTELLRISPSQTILVPLLGNRRTIVTTNPENVEYILKTNFFNFPKGKP  106

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ +LGD LG GIFNVDG SW  QRK+AS E    S+ S+AFEV+  E++ RL+P+L+  
Sbjct  107   FTDLLGDLLGGGIFNVDGHSWSSQRKLASHEFSTRSLRSFAFEVLIDEVENRLVPVLSAA  166

Query  1468  KD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              D G  VDLQDV +RF+FD +C+ S G DP CL+   P++    +F  A+++SA RA   
Sbjct  167   ADVGTTVDLQDVLKRFAFDVVCKVSLGWDPDCLDLTRPVNPLVEAFDTAAEISARRATEP  226

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGS  1121
                VW +KR LN+GSE+ LR++I  +++L  E++R ++K   +G  +E  +DLLSRF+ +
Sbjct  227   VCAVWMVKRVLNVGSERRLREAIRTVHVLVSEIVRAKKKSLEIGIGEEAKQDLLSRFLAA  286

Query  1120  IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA  941
              G +   +RD+VISF++AGRDT ++A+T  FWL+  + D    IL E D +V     L  
Sbjct  287   -GHNGEAVRDMVISFIMAGRDTTSAAMTWLFWLLTENDDVERKILEEVDPLVS----LGL  341

Query  940   SEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRM  761
               + ++E+NY +A +CE++RL+PP+ +DSK    DDVLPDGT VKRG +VTY PY MGRM
Sbjct  342   GFEDLKEMNYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRVKRGDKVTYFPYGMGRM  401

Query  760   EGIWGSDCLEFKPERWLRD------GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVA  599
             E +WG+D  EFKP RW          V    +P+K+PVFQAG RVC+GKEMA +++K V 
Sbjct  402   ETLWGTDSEEFKPNRWFHSEPGSTRPVLKPISPYKFPVFQAGPRVCVGKEMAFMQMKYVV  461

Query  598   LSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              SVL RF + +      P F P LTA    GL V +++R
Sbjct  462   GSVLSRFEI-IPVNLDRPVFVPLLTAHMAGGLKVKIKRR  499



>ref|XP_011070085.1| PREDICTED: cytochrome P450 94A1 [Sesamum indicum]
Length=504

 Score =   407 bits (1045),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 296/445 (67%), Gaps = 10/445 (2%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             DW T +L   P+ T   H    +   ITANP+ VE+MLKS FEN+PKG  F  +L DFLG
Sbjct  57    DWSTGVLSGCPTNTAVFHRPGKVHGVITANPQIVEHMLKSNFENYPKGPRFRILLTDFLG  116

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AGKKDGGVVDLQ  1442
             +GIFN DG+ WR QRK AS E    S+ ++  E +  E+  RL+PIL +  +   V+D+Q
Sbjct  117   KGIFNTDGELWRIQRKTASYEFNTKSLRNFVMENVYVELQTRLIPILESAARTDRVLDVQ  176

Query  1441  DVFRRFSFDCICRFSFGLDPKCLES-LLPMSEFAVSFHLASKLSAERAMSASPVVWKIKR  1265
             D+  RF+FD IC+ +F +DP CL       +EF  +F  A+ LS+ R M A P ++ IK+
Sbjct  177   DILERFAFDNICKVAFNVDPGCLGGDGTAGAEFMQAFEDAATLSSGRFMYALPSLFAIKK  236

Query  1264  FLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYLRDIV  1085
             FLN+GSEK+LRK I  ++  A ++IR R +   +++  +DLLSRF+ +  +   +LRDIV
Sbjct  237   FLNLGSEKKLRKYIATVHEFADKIIRTRLE-EKAEKKDEDLLSRFIANSENSAEFLRDIV  295

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD---RVVGKNQDLIASEQRMRELN  914
             ISF+LAGRDT +SAL+ FFWL+++ PD  E IL E +   R  GK+   I S   +RE++
Sbjct  296   ISFILAGRDTTSSALSWFFWLLSSRPDVEERILKELENIRRQNGKSIGEIYSFDELREMH  355

Query  913   YLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCL  734
             YL AA+ E++RL+PP+  D+K C E+D+LPDGT + +   ++YH +AMGRME IWG DC 
Sbjct  356   YLHAAISEAMRLYPPVPVDTKACKENDILPDGTVIGKDWFISYHTFAMGRMESIWGEDCC  415

Query  733   EFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVH-LAQP  557
             EFKPERW+ +G+  QE+PFKYPVF AG R+CLGK+MA +++KS+A SVL RF +  L + 
Sbjct  416   EFKPERWIENGICKQESPFKYPVFHAGPRMCLGKDMAYIQMKSIAASVLERFGMDVLLEN  475

Query  556   HHTPRFSPGLTATFRDGLPVFVQQR  482
              + P     LT   + GLPV V++R
Sbjct  476   GNPPEPLLSLTLRMKGGLPVRVKER  500



>ref|XP_008443231.1| PREDICTED: cytochrome P450 94A1-like [Cucumis melo]
Length=511

 Score =   406 bits (1044),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 206/450 (46%), Positives = 292/450 (65%), Gaps = 10/450 (2%)
 Frame = -2

Query  1801  NNLCDWYTHLLRNSPSKTIHIH---VLRNTITANPENVEYMLKSRFENFPKGKAFSAILG  1631
             +   DW T +LRN  + T        +   ITANP  VE++LK++FEN+PKG+ F ++L 
Sbjct  56    HRFLDWSTEVLRNCRTNTAVFKRPGKVHGVITANPLVVEHILKTQFENYPKGERFISLLE  115

Query  1630  DFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK-KDGGV  1454
             DFLG+GIFN DG+ W+ QRK AS E    S+ ++  E ++ EI  RLLPI     +   +
Sbjct  116   DFLGRGIFNSDGEIWKVQRKTASYEFNTKSLRNFVMENVRVEIQSRLLPIFGKACETERI  175

Query  1453  VDLQDVFRRFSFDCICRFSFGLDPKCLES-LLPMSEFAVSFHLASKLSAERAMSASPVVW  1277
             +DLQDV  RF+FD +C+ +F  DP CL       +EF  +F  A+ LS+ R M A P  +
Sbjct  176   LDLQDVLERFAFDNVCKLAFNYDPACLGGDGTAATEFMRAFEHAATLSSGRFMYAFPGSY  235

Query  1276  KIKRFLNIGSEKELRKSIEVMNMLAMEVIRQR--RKLGTSDENHKDLLSRFMGSIGDDET  1103
             K+K+F NIGSEK L++SI V++  A ++I  R   K  T  EN +DLLSRFMG   +   
Sbjct  236   KVKKFFNIGSEKTLKESIAVVHKFAEDIIHSRLEEKKTTQIENDQDLLSRFMGDQNNSPQ  295

Query  1102  YLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA---SEQ  932
             +LRDI+ISF+LAGRDT +SALT FFW++++ PD  + ILAE + +  K    I    S  
Sbjct  296   FLRDIIISFILAGRDTTSSALTWFFWILSSRPDVEQKILAELETIRTKAHKEIGEMYSFD  355

Query  931   RMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGI  752
              +R+++YLQAA+ E+LRL+PP+  D+K C  DDVLPDGT + +   VTYH YAMGRME I
Sbjct  356   ELRDMHYLQAALSETLRLYPPVPVDTKACRNDDVLPDGTFIGKSWFVTYHTYAMGRMESI  415

Query  751   WGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRV  572
             WG D  EF PERWL +GV   E+PF++P+F AG R+CLGK+MA +++KS+A +V+ +F V
Sbjct  416   WGKDYGEFSPERWLENGVCKTESPFRFPIFHAGPRMCLGKDMAYIQMKSIAAAVIEKFEV  475

Query  571   HLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
              + +   +P+    LT    +GL V +++R
Sbjct  476   EMVEKKKSPKHLLSLTLRMENGLQVMIKRR  505



>gb|ADO24345.1| cytochrome P450 A [Capsicum annuum]
Length=497

 Score =   406 bits (1043),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 213/456 (47%), Positives = 293/456 (64%), Gaps = 16/456 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI +      R  ITANP NVE+MLK+ F N+PKG+ 
Sbjct  46    SFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITANPNNVEHMLKTNFTNYPKGQP  105

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-G  1472
             F+ ILGDFLG+GIFNVDG+ W  QRK+AS E    S+  +  + ++  +D RL+P+L   
Sbjct  106   FTEILGDFLGRGIFNVDGEQWSAQRKLASHEFSTKSLREFVVKTLEEVVDTRLIPLLNHA  165

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              K G V+DLQDV RRF+FD IC+ S G DP CL+ L  +     SF  AS+  A R M+ 
Sbjct  166   AKSGKVLDLQDVLRRFAFDTICKVSLGTDPHCLDDLSDVPSLVDSFDTASQAGAMRGMAP  225

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK-----DLLSRFM  1127
                +WK KR LN+ SEK+L+++++ ++    ++I ++++  T +EN K     DLLSR +
Sbjct  226   VYAIWKGKRALNLRSEKKLKENVKRVHCCINDIIEKKKQ--TINENGKNSKNMDLLSRLL  283

Query  1126  GSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDL  947
              +  +DE  +RD+VISFL+AGRDT +SALT  FWL  NHPD    ++ E   +   ++ L
Sbjct  284   IAGHEDEV-VRDMVISFLMAGRDTTSSALTWLFWLTTNHPDVKNEMINEITSINIGDKAL  342

Query  946   IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
                E +  E+ YLQA + ES+RL+PP+ +DSK    DD+LPDGT V++G RVTY  Y MG
Sbjct  343   EFDESK--EMKYLQACLNESMRLYPPVAWDSKHAATDDILPDGTRVQKGNRVTYFQYGMG  400

Query  766   RMEGIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSV  590
             RME IWG D LEFKP+RW+  +G+    + +K+PVFQAG RVCLGKEMA +++K V  SV
Sbjct  401   RMEEIWGKDRLEFKPDRWIDENGLLKSVSAYKFPVFQAGPRVCLGKEMAFMQMKYVLASV  460

Query  589   LRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             LRRF +   +    P F P LTA    G  V +  R
Sbjct  461   LRRFEIKPVKVEK-PVFMPLLTAHMAGGFNVRICHR  495



>ref|XP_007210176.1| hypothetical protein PRUPE_ppa017252mg, partial [Prunus persica]
 gb|EMJ11375.1| hypothetical protein PRUPE_ppa017252mg, partial [Prunus persica]
Length=505

 Score =   406 bits (1043),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 206/456 (45%), Positives = 292/456 (64%), Gaps = 15/456 (3%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   +NL DWYT LL NSPS+TI +H +   R  +TANP NVE++LK+ F NFPKGK 
Sbjct  51    SFYKNQHNLLDWYTSLLSNSPSQTIVVHRIGARRTIVTANPSNVEHVLKTNFTNFPKGKP  110

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
              +  LGD LG GIFNVDGD W  QRK+AS E    S+  +  + ++ E++ RL+P+L   
Sbjct  111   LTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSTKSLREFVVKTLEEEVEHRLIPLLEEA  170

Query  1468  KD-GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              +   V+DLQ++ RRF+FD +C+ S G DP CL+   P+     +F  AS++SA RA + 
Sbjct  171   AECKSVLDLQEILRRFAFDTVCKVSLGSDPFCLDLTRPLPPLVEAFDCASEISARRATAP  230

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN--HKDLLSRFMGSI  1118
               ++WK+KR LNIGSE +L++++++++    E+I+ ++K+   DE     D+LSR + + 
Sbjct  231   LYLMWKVKRALNIGSENKLKEAVKLVHGSVHEIIQNKKKILQKDEGCESHDMLSRLLLA-  289

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA-  941
             G  E  +RD+VISF+LAGRDT ++A+T  FWL++ HP     I+ E + V+G+N      
Sbjct  290   GHGEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPSINHQIVNEVENVLGQNTSTEKL  349

Query  940   SEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRM  761
               + ++++ +L+A +CES+RL+PP+ +DSK    D VLPDGT V +G RVTY PY MGRM
Sbjct  350   GFEDLQKMRFLRACLCESMRLYPPVPWDSKHAEVDTVLPDGTWVGKGDRVTYFPYGMGRM  409

Query  760   EGIWGSDCLEFKPERWL-------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             E +WG D  EF P RW          GV    +P+K+PVFQAG RVCLGKEMA +++K V
Sbjct  410   EELWGKDRFEFNPNRWFDIEPGCDDGGVLKSISPYKFPVFQAGPRVCLGKEMAFIQMKYV  469

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVF  494
               SVLRRF +        P F P LTA    GL V 
Sbjct  470   IASVLRRFEIKQVCEKDHPVFVPLLTAHMAGGLKVL  505



>ref|XP_009620348.1| PREDICTED: cytochrome P450 94B3 [Nicotiana tomentosiformis]
Length=511

 Score =   406 bits (1044),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 204/455 (45%), Positives = 296/455 (65%), Gaps = 14/455 (3%)
 Frame = -2

Query  1816  WYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAF  1646
             +Y     L DWYTHL+  SP++TI I  L   R  +TANP NVEYMLK+ F+NFPKGK F
Sbjct  56    FYKNRYRLLDWYTHLISKSPTQTIVIDRLGARRTIVTANPYNVEYMLKTNFDNFPKGKPF  115

Query  1645  SAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GK  1469
             + ILGDFLG GIFNVDG+ W  QRK+ S E    S+  Y    ++ E++ +LLPIL   +
Sbjct  116   NEILGDFLGNGIFNVDGEMWYKQRKMVSHEFTARSLRDYVVNALKEEVENKLLPILELME  175

Query  1468  KDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSAS  1289
              +    DLQD+ RR  FD +C+ S G DP CL   L  S    +F  AS++ AER  +  
Sbjct  176   AENRAFDLQDLLRRLGFDVVCKVSLGFDPCCLNESLSFSPLLDAFERASQICAERGAAPI  235

Query  1288  PVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRR---KLGTSDENHKDLLSRFMGSI  1118
              VVWK+KR+LNIGSEK+L+ +++ ++    ++IR+R+   +     E +KDLLS+ + + 
Sbjct  236   FVVWKVKRWLNIGSEKQLKLAVDQIHSSIDDIIRERKIKIREENQKETNKDLLSKMILAA  295

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIAS  938
               DE  +RD+VISF++AGRDT ++A+T FF+L++ HP+    ++++  R +    + +  
Sbjct  296   NFDEEEVRDMVISFIMAGRDTTSAAMTWFFYLLSLHPEIEYELVSKELRFI--EAETLTK  353

Query  937   EQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRME  758
              + ++E+N+L++ +CE++RL+PP+ +DSK  + DD+LPDGT +K G RVTY PY MGRME
Sbjct  354   YEILKEMNFLKSCLCETMRLYPPVAWDSKHAISDDILPDGTRIKAGNRVTYFPYGMGRME  413

Query  757   GIWGSDCLEFKPERWLR----DGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSV  590
              +WG D  EFKP RW++    +G     N +K+PVFQAG RVCLGKE+A +++K V  S+
Sbjct  414   NLWGKDRFEFKPRRWMQESEEEGTEQVSNLYKFPVFQAGPRVCLGKELAFIQMKYVVASI  473

Query  589   LRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             L+RF++  A     P F P LTA    G  VFV +
Sbjct  474   LKRFQIRPAC-SDPPVFLPLLTAHMAGGFKVFVHK  507



>ref|XP_002279981.1| PREDICTED: cytochrome P450 94B3-like [Vitis vinifera]
Length=512

 Score =   406 bits (1043),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 206/460 (45%), Positives = 296/460 (64%), Gaps = 19/460 (4%)
 Frame = -2

Query  1822  TSWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGK  1652
              S+Y     L +WYT LL  SPS+TI +H L   R  +TAN  NVEY+LK+ F NFPKGK
Sbjct  53    VSFYQNRRRLLEWYTDLLSESPSQTIVVHRLGARRTVVTANAANVEYVLKTNFSNFPKGK  112

Query  1651  AFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-A  1475
              F+ ILGD LG GIFNVDGD W  QRK+AS E    S+  +   +++ E++ RLLP+L +
Sbjct  113   PFTEILGDLLGFGIFNVDGDLWSSQRKLASHEFSTKSLREFVMRILEEEVEGRLLPLLES  172

Query  1474  GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMS  1295
               +   V+DLQDV RRF+F+ +C+ S G+DP CL+   P+     +F  AS++ A R M+
Sbjct  173   AMEKNEVLDLQDVLRRFAFETVCKVSLGVDPCCLDLSRPVPPLVRAFDRASEICAMRGMA  232

Query  1294  ASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE---NHKDLLSRFMG  1124
                 VWK+KR  N+GSE++L++S+++++    E+I+ +++    D    +  DLL+  + 
Sbjct  233   PVYAVWKMKRAFNVGSERKLKESVQLVHSSVREIIQNKKRKLEEDRAEGDGGDLLTSLL-  291

Query  1123  SIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLI  944
             S G  E  +RD+VISF++AGRDT ++A+T  FWL++ HP    AI+A  D +     D  
Sbjct  292   SAGHGEEVVRDMVISFIMAGRDTTSAAMTWLFWLLSQHPPIESAIVAHVDSLYRNPLDF-  350

Query  943   ASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGR  764
                + ++E+N+++A +CES+RL+PP+ +DSK    DD LPDGTA++ G RVTY PY MGR
Sbjct  351   ---ETLKEMNFVKACLCESMRLYPPVVWDSKHAAADDTLPDGTALREGDRVTYFPYGMGR  407

Query  763   MEGIWGSDCLEFKPERWLRD------GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             ME +WG D  EF+P+RWL +      G     +P+K+PVFQAG RVCLGKEMA +++K V
Sbjct  408   MEHLWGKDRFEFRPDRWLEEPEADGGGPLKAVSPYKFPVFQAGPRVCLGKEMAFIQMKYV  467

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
               S+LRRF +  A  +  P F P LTA    G  V V++R
Sbjct  468   VASILRRFEIRPAGSNR-PVFVPLLTAHMAGGFKVVVRKR  506



>ref|XP_004236332.1| PREDICTED: cytochrome P450 94B3-like [Solanum lycopersicum]
Length=491

 Score =   405 bits (1041),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 291/453 (64%), Gaps = 11/453 (2%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y   + L DWYT LL  SP++TI +      R  ITANP+NVEYMLK+ F N+PKGK 
Sbjct  41    SFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKP  100

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AG  1472
             F+ ILGDFLG+GIFNVDG+ W  QRK+AS E   +S+  +  + ++  ++ RL+P+L   
Sbjct  101   FTDILGDFLGRGIFNVDGELWNAQRKLASHEFSTNSLREFVVKTLEEVVENRLVPLLIQA  160

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
                G V+DLQDV RRF+FD IC+ S G DP CL+ L  +     SF  AS+  A R M+ 
Sbjct  161   ANSGKVLDLQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASRACAMRGMAP  220

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRR-KLGTSDE-NHKDLLSRFMGSI  1118
                +WK KR LN+GSEK+L+++++ ++    E+I +++ K+ T +  +  DLLSR + + 
Sbjct  221   VYAIWKSKRALNLGSEKKLKENVKRVHCCIDEIIEEKKQKIATENGGDQMDLLSRLLLA-  279

Query  1117  GDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIAS  938
             G D   +RD+VISFL+AGRDT +SALT  FWL  NH D  + ++ E   +   N D    
Sbjct  280   GHDNEVVRDMVISFLMAGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSI--NNGDKALE  337

Query  937   EQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRME  758
                ++E+ +L A + ES+RL+PP+ +DSK   +DD+LPDGT V++G RVTY PY MGRME
Sbjct  338   FDELKEMKHLAACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRME  397

Query  757   GIWGSDCLEFKPERWL-RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRR  581
              IWG D LEFKP+RW+  +G     +P++YPVFQAG RVCLGKEMA  ++K V  SVLRR
Sbjct  398   EIWGKDRLEFKPDRWIDENGGLKSVSPYEYPVFQAGPRVCLGKEMAFTQMKYVLASVLRR  457

Query  580   FRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             F +        P F P LTA    G  V +  R
Sbjct  458   FEIKPVNVEK-PVFLPLLTAHMVGGFNVRIYGR  489



>ref|XP_006290939.1| hypothetical protein CARUB_v10017052mg [Capsella rubella]
 gb|EOA23837.1| hypothetical protein CARUB_v10017052mg [Capsella rubella]
Length=506

 Score =   405 bits (1042),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 299/453 (66%), Gaps = 19/453 (4%)
 Frame = -2

Query  1801  NNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAFSAILG  1631
             + L  WYT LLR SPS+TI + +L   R  +T NPENVEY+LK+ F NFPKGK F+ +LG
Sbjct  52    HRLLQWYTELLRLSPSQTILVPLLGNRRTIVTTNPENVEYILKTNFFNFPKGKPFTDLLG  111

Query  1630  DFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGKKD-GGV  1454
             D LG GIFNVDG +W  QRK+AS E    S+ S+AFEV++ E++ RL+P+L+   D G  
Sbjct  112   DLLGGGIFNVDGHTWSSQRKLASHEFSTRSLRSFAFEVLKDEVENRLVPVLSAAADVGTT  171

Query  1453  VDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWK  1274
             +DLQDV +RF+FD +C+ S G DP CL+   P++    +F  A+++SA RA      VWK
Sbjct  172   LDLQDVLKRFAFDVVCKVSLGWDPDCLDLTRPVNPLVEAFDTAAEISARRATEPVYAVWK  231

Query  1273  IKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGSIGDDET  1103
             +KR LN+GSE+ LR++I  ++ML  E++R ++K   +GT +E  +DLLSRF+ + G D  
Sbjct  232   VKRVLNVGSERRLREAISTVHMLVSEIVRAKKKSLEIGTGEEAKQDLLSRFLAA-GHDGK  290

Query  1102  YLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMR  923
              +RD+VISF++AGRDT ++A+T  FW +  + +    IL E D +V     L    + ++
Sbjct  291   AVRDMVISFIMAGRDTTSAAMTWLFWSLTENDNVERKILEEVDPLVS----LGLGFEDLK  346

Query  922   ELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGS  743
             E+NY +A +CE++RL+PP+ +DSK    DDVLPDGT +K+G +VTY PY MGRME +WG 
Sbjct  347   EMNYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRLKKGDKVTYFPYGMGRMETLWGK  406

Query  742   DCLEFKPERWL------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRR  581
             D  EFKP RW          V    +P+K+PVFQAG RVC+GKE+A +++K V  SVL R
Sbjct  407   DAEEFKPNRWFDYEPGSTRPVLKPVSPYKFPVFQAGPRVCVGKELAFMQMKYVVGSVLSR  466

Query  580   FRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             F + +      P F P LTA    GL V +++R
Sbjct  467   FEI-VPVGKDRPVFVPLLTAHMAGGLKVKIKRR  498



>ref|XP_010503490.1| PREDICTED: cytochrome P450 94B3-like [Camelina sativa]
Length=507

 Score =   405 bits (1042),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 213/451 (47%), Positives = 299/451 (66%), Gaps = 19/451 (4%)
 Frame = -2

Query  1795  LCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAFSAILGDF  1625
             L  WYT LLR SPS+TI + +L   R  +TANPENVEY+LK+ F NFPKGK F+ +LGD 
Sbjct  56    LLQWYTELLRISPSQTILVPLLGNRRTIVTANPENVEYILKTNFFNFPKGKPFTDLLGDL  115

Query  1624  LGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGKKD-GGVVD  1448
             LG GIFNVDG SW  QRK+AS E    S+ S+AFEV++ E++ RL+P+L+   D G  VD
Sbjct  116   LGGGIFNVDGHSWSSQRKLASHEFSTRSLRSFAFEVLKDEVENRLVPVLSAAADVGTTVD  175

Query  1447  LQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWKIK  1268
             LQDV +RF+FD +C+ S G DP CL+    ++    +F  A+++SA RA      VWK+K
Sbjct  176   LQDVLKRFAFDVVCKVSLGWDPDCLDLTRAVNPLVEAFDTAAEISARRATEPVYAVWKVK  235

Query  1267  RFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGSIGDDETYL  1097
             R LN+GSE+ L+++I+ +++L  +++R ++K   +GT +E  +DLLSRF+ + G D   +
Sbjct  236   RVLNVGSERRLKEAIKTVHVLVSQIVRAKKKSLEIGTGEEAKQDLLSRFLAA-GHDGEAV  294

Query  1096  RDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMREL  917
             RD+VISF++AGRDT ++A+T  FWL+  + D    IL E D +V     L    + ++E+
Sbjct  295   RDMVISFIMAGRDTTSAAMTWLFWLLTENDDVERKILEEVDPLVS----LGLGFEDLKEM  350

Query  916   NYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDC  737
             NY +A +CE++RL+PP+ +DSK    DDVLPDGT +K+G +VTY PY MGRME +W  D 
Sbjct  351   NYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRLKKGDKVTYFPYGMGRMETLWEKDS  410

Query  736   LEFKPERWL------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFR  575
              EFKP RW          V    +P+K+PVFQAG RVC+GKEMA +++K V  SVL RF 
Sbjct  411   EEFKPNRWFDYEPGSTQPVLKPVSPYKFPVFQAGPRVCVGKEMAFMQMKYVVGSVLSRFE  470

Query  574   VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             + +      P F P LTA    GL V +++R
Sbjct  471   I-VPVNKDRPVFVPLLTAHMAGGLKVKIKRR  500



>ref|XP_010515172.1| PREDICTED: cytochrome P450 94B3-like [Camelina sativa]
Length=507

 Score =   405 bits (1041),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 300/451 (67%), Gaps = 19/451 (4%)
 Frame = -2

Query  1795  LCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAFSAILGDF  1625
             L  WYT LLR SPS+TI + +L   R  +TANPEN+EY+LK+ F NFPKGK F+ +LGD 
Sbjct  56    LLQWYTELLRISPSQTILVPLLGNRRTIVTANPENIEYILKTNFFNFPKGKHFTDLLGDL  115

Query  1624  LGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGKKD-GGVVD  1448
             LG GIFNVDG SW  QRK+AS E    S+ S+AF+V++ E++ RL+ +L+   D G  +D
Sbjct  116   LGGGIFNVDGHSWSSQRKLASHEFSTRSLRSFAFQVLKDEVENRLVAVLSAAADVGTTLD  175

Query  1447  LQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPVVWKIK  1268
             LQDV +RF+FD +C+ S G DP CL+   P++    +F  A+++SA RA      VWK+K
Sbjct  176   LQDVLKRFAFDVVCKVSLGWDPDCLDLTRPVNPLVEAFDTAAEISARRATEPVYAVWKVK  235

Query  1267  RFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGSIGDDETYL  1097
             R LN+GSE+ L+++I+ +++L  +++R ++K   +GT +E  +DLLSRF+ + G D   +
Sbjct  236   RVLNVGSERRLKEAIKTVHVLVSQIVRAKKKSLEIGTGEEAKQDLLSRFLAA-GHDGEAV  294

Query  1096  RDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQRMREL  917
             RD+VISF++AGRDT ++A+T  FWL+  + D    IL E D +V     L    + ++E+
Sbjct  295   RDMVISFIMAGRDTTSAAMTWLFWLLTENDDVERKILKEVDPLVS----LGLGFEDLKEM  350

Query  916   NYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDC  737
             NY +A +CE++RL+PP+ +DSK    DDVLPDGT +K+G +VTY PY MGRME +WG D 
Sbjct  351   NYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRLKKGDKVTYFPYGMGRMETLWGKDS  410

Query  736   LEFKPERWL------RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFR  575
              EFKP RW          V    +P+K+PVFQAG RVC+GKEMA +++K V  SVL RF 
Sbjct  411   EEFKPNRWFDYEPGSTQPVLKPVSPYKFPVFQAGPRVCVGKEMAFMQMKYVVGSVLSRFE  470

Query  574   VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             + +      P F P LTA    GL V +++R
Sbjct  471   I-VPVNKDRPVFVPLLTAHMAGGLKVKIKRR  500



>ref|XP_009386731.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94B3-like [Musa 
acuminata subsp. malaccensis]
Length=507

 Score =   405 bits (1041),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 203/447 (45%), Positives = 290/447 (65%), Gaps = 12/447 (3%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIHV---LRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             DW T +L +SP+ ++       +   ITANP NVE++LKS FEN+PKG+    +L DFLG
Sbjct  57    DWITDVLVHSPTHSMTFRSPGQVGGVITANPSNVEHVLKSNFENYPKGERSFRMLVDFLG  116

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL--AGKKDGGVVDL  1445
              GIFN DG+ W+ QRK AS E  + S+ ++  + +Q+EI  RLLP++  AG+K G  +DL
Sbjct  117   HGIFNSDGEEWKGQRKQASYEFSKRSLRNFMVDTMQSEIAHRLLPLMRRAGEK-GETMDL  175

Query  1444  QDVFRRFSFDCICRFSFGLDPKCLE----SLLPMSEFAVSFHLASKLSAERAMSASPVVW  1277
             Q V  RF+FD IC+ +F  DP CL     +    S F  +F  A  L   R M A  + W
Sbjct  176   QSVLERFAFDSICKVAFDEDPACLAEDAVADATSSSFMRAFEEAQNLIVGRFMDAFEITW  235

Query  1276  KIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYL  1097
             ++K+ L+IGSE+ LR+ + V++  AM +IR R++  +  + H DLLSRF  +  + E +L
Sbjct  236   RVKKLLDIGSERRLRELLAVVHGYAMRIIRARKEKASELDEHHDLLSRFASNKNNSEEFL  295

Query  1096  RDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEAD--RVVGKNQDLIASEQRMR  923
             RDIV +FL+AGR+T +SALT FFW+++  PD  + IL E    R + KN     S   +R
Sbjct  296   RDIVTNFLVAGRETTSSALTWFFWILSTRPDVEKKILDEVTSVRTINKNTSETFSFDELR  355

Query  922   ELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGS  743
             E++YL AAV ES+RL+PP+  D++ C+EDD++PDGT V +G  VTY  YAMGR+E IWG 
Sbjct  356   EMHYLHAAVTESMRLYPPVPIDTQSCLEDDIMPDGTFVGKGWFVTYSAYAMGRLEDIWGR  415

Query  742   DCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLA  563
             DC E+KPERWL +GVF  E+PF++PVF AG R+CLGKEMA +++KS+   V+ RF + + 
Sbjct  416   DCNEYKPERWLENGVFRPESPFRFPVFHAGPRMCLGKEMAYVQMKSIVARVVERFEIDVV  475

Query  562   QPHHTPRFSPGLTATFRDGLPVFVQQR  482
                 TP     LT   + GLP+ V+++
Sbjct  476   GKEKTPEHVLSLTLRMKGGLPIKVKEK  502



>ref|XP_008788557.1| PREDICTED: cytochrome P450 94A1 [Phoenix dactylifera]
Length=503

 Score =   405 bits (1040),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/446 (45%), Positives = 288/446 (65%), Gaps = 12/446 (3%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTIHIHV---LRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             +W T +L  +P+ T+ +     +   ITAN  NVE+MLK+ F N+P+G+   A+L DFLG
Sbjct  57    EWSTEILIKAPTYTVTLQSPGQVSGVITANTLNVEHMLKTNFVNYPRGERSIAMLEDFLG  116

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKDGGVVDLQ  1442
             QGIFN DG+ W++QRK AS E  + S+ ++  + +Q EI +RLLP+L    K   +V+LQ
Sbjct  117   QGIFNSDGEHWKWQRKAASYEFNKKSLRNFVVDTVQYEIVKRLLPLLKKASKKNEIVNLQ  176

Query  1441  DVFRRFSFDCICRFSFGLDPKCL----ESLLPMSEFAVSFHLASKLSAERAMSASPVVWK  1274
             DV  RF+FD IC+ +F  DP CL     S +  S+F  +F  A  +   R + A  V W+
Sbjct  177   DVLERFAFDNICKVAFNEDPACLAEERSSDMVSSDFMKAFEEAQNIVVGRFLDALKVTWR  236

Query  1273  IKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYLR  1094
             IK+ LNIGSE+ L++ I +++  +M +IR RR+      N  DLLSRF  +  + E +LR
Sbjct  237   IKKLLNIGSERRLKQLISIVHNYSMNIIRSRRERPLDQYN--DLLSRFASNKDNTEEFLR  294

Query  1093  DIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRV--VGKNQDLIASEQRMRE  920
             D+V +FL+AGR+T +SALT FFWL++  PD  + IL E   V  + +N +   S   +RE
Sbjct  295   DVVTNFLIAGRETTSSALTWFFWLLSTRPDVEKKILEEVRSVQALNQNSNETFSFDELRE  354

Query  919   LNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSD  740
             ++YL AA+ ES+RL+PP+  D++ C EDD +PD T V +G  VTY  YAMGRME IWG D
Sbjct  355   MHYLHAAISESMRLYPPVPIDTQSCKEDDTMPDRTFVGKGWSVTYSAYAMGRMEHIWGKD  414

Query  739   CLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQ  560
             C ++KPERWL +GVF  ENPFKYPVF AG R+CLGKEMA +++KS+   VL RF +++  
Sbjct  415   CNDYKPERWLENGVFQPENPFKYPVFHAGPRMCLGKEMAYIQMKSIVACVLERFEINVVG  474

Query  559   PHHTPRFSPGLTATFRDGLPVFVQQR  482
                +P     +T   + GLP+ V++R
Sbjct  475   KDKSPEHILSVTLRMKGGLPIQVKER  500



>ref|XP_011084785.1| PREDICTED: cytochrome P450 94B3-like [Sesamum indicum]
Length=468

 Score =   403 bits (1036),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 210/435 (48%), Positives = 292/435 (67%), Gaps = 14/435 (3%)
 Frame = -2

Query  1864  LFYCSCDVCSAYMSTSWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVE  1694
             +FYC C      M+  +Y     L DWYT LL  S ++TI +H L   R  +TANP+NVE
Sbjct  37    VFYC-CPSIGCLMA--FYKNRRRLLDWYTELLSQSETQTIVVHRLGAPRTIVTANPDNVE  93

Query  1693  YMLKSRFENFPKGKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVI  1514
             Y+LK+ F NFPKGK F+ +LGDFLG GIFNVDG+ W  QRK+AS E    S+  +  +V+
Sbjct  94    YILKTNFANFPKGKPFTELLGDFLGLGIFNVDGEKWSIQRKLASHEFTAKSLREFVVKVL  153

Query  1513  QTEIDRRLLPILA-GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVS  1337
             + E++ RL+PIL    ++  ++D+Q+V RRF+FD IC+ S G+DP CL+   P    A +
Sbjct  154   EDEVESRLIPILDDAAENDRIIDMQEVLRRFAFDTICKVSLGMDPLCLDLSRPPPPLAAA  213

Query  1336  FHLASKLSAERAMSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDE  1157
             F  AS++SA R  +    VWK+KR LN+G EKEL++++++++    E+IR ++  GT   
Sbjct  214   FDAASEISAMRGTAPVFAVWKLKRALNVGLEKELKEAVKLVHGCVDEMIRSKK--GTMGG  271

Query  1156  NHK-DLLSRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAE  980
             N   DLLSRF+ S  DDE  +RD+VISFL+AGRDT +SALT  FWL+  H    + ++ E
Sbjct  272   NSGGDLLSRFLESGLDDEM-VRDMVISFLMAGRDTTSSALTWLFWLLTGHRGIEKQVVDE  330

Query  979   ADRVVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRG  800
                +    + L   +  ++ LN+++A +CES+RL+PP+ +DSK  V+DDVLPDGT V RG
Sbjct  331   ITSMKNGGEQLGFDD--LKGLNFIKACLCESMRLYPPVVWDSKHAVKDDVLPDGTPVYRG  388

Query  799   TRVTYHPYAMGRMEGIWGSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGKEMA  623
              RVTY  Y MGRME +WG D LEF+PERWL + G+    +P+K+ VFQAG RVCLGKEMA
Sbjct  389   NRVTYFQYGMGRMEEVWGKDRLEFRPERWLDESGMVKMVSPYKFAVFQAGPRVCLGKEMA  448

Query  622   LLELKSVALSVLRRF  578
              +++K V  SVLRRF
Sbjct  449   FIQMKYVVASVLRRF  463



>gb|KGN63489.1| hypothetical protein Csa_1G002090 [Cucumis sativus]
Length=515

 Score =   405 bits (1040),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/463 (43%), Positives = 295/463 (64%), Gaps = 19/463 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y     L  WYT LL +SP++TI +H L   R  +TANP NVE+MLK+ F N+PKGK 
Sbjct  52    SFYKNRRRLLTWYTDLLSDSPTQTIVMHRLGSRRTILTANPANVEHMLKTNFLNYPKGKP  111

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AG  1472
             F+ ILGD LG GIFNVDGD W  QRK+AS      S+  +  + ++ E+  RL+P+L   
Sbjct  112   FTDILGDLLGCGIFNVDGDLWSTQRKLASHAFSAKSLREFVVKTLEDEVHFRLIPLLHNA  171

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              +   V+DLQDV  R +FD +C+ + G D +CL+   P+ E   +F +A+ +SA RA++ 
Sbjct  172   ARTNAVLDLQDVLGRLAFDTVCKVTLGTDEQCLDMSRPIPEIVKAFDVATAISARRAVTP  231

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSD---------ENHKDLL  1139
               + WK+KR LN+GSEK+L++ ++ ++     +I   + L  +D         +N+ DLL
Sbjct  232   LYLTWKVKRMLNLGSEKKLKQVVQTVHEWISNII-HNKVLNNNDNKDRNHNQTQNNSDLL  290

Query  1138  SRFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEA----DR  971
             SR + S G +E  +RD+++SF++AGRDT ++A+T  FWL+ NH +  + I+ EA    D 
Sbjct  291   SRLL-SAGLNEEVIRDMIVSFIMAGRDTTSAAMTWLFWLLTNHRNIEQTIINEATSLSDH  349

Query  970   VVGKNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRV  791
                K   L    + ++++ YL+A +CES+RL+PP+ +DSK     D+LPDGT V++G RV
Sbjct  350   DYSKTTSLGYGYEELKDMKYLKACLCESMRLYPPVAWDSKHAAAADILPDGTQVRKGDRV  409

Query  790   TYHPYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLEL  611
             TY PY MGRME +WG D LEFKPERW ++G     + FK+PVFQAG R+CLG EMA +++
Sbjct  410   TYFPYGMGRMEELWGKDRLEFKPERWFQNGELKTVSAFKFPVFQAGPRMCLGTEMAFIQM  469

Query  610   KSVALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             K V  +VL+RF       ++ P F P LTA    GL V+V++R
Sbjct  470   KYVMATVLKRFEFRRVSENNEPVFVPLLTAHMAGGLKVYVRER  512



>ref|XP_009763713.1| PREDICTED: cytochrome P450 94A1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009763715.1| PREDICTED: cytochrome P450 94A1-like isoform X2 [Nicotiana sylvestris]
 gb|AAL54887.1|AF092916_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum]
Length=511

 Score =   404 bits (1039),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 207/456 (45%), Positives = 293/456 (64%), Gaps = 17/456 (4%)
 Frame = -2

Query  1810  AKYNNLCDWYTHLLRNSPSKT---IHIHVLRNTITANPENVEYMLKSRFENFPKGKAFSA  1640
             A ++    W + ++  +P+ T   I     R   TANP NV+++LK+ F+ + KG    +
Sbjct  59    ANHDRRIKWISDIILTTPNLTFTLIRPLNFRTIFTANPSNVQHVLKTNFQVYQKGHGSYS  118

Query  1639  ILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKD  1463
              L DFL  GIFNVDGD W++QR++AS E    S+  +   V+ TE+  RL+PILA    +
Sbjct  119   TLKDFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVETVVDTELSERLIPILATAAAN  178

Query  1462  GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPV  1283
               V+D QD+ +RF+FD IC+ +FG DP  L   LP +EFAV+F  A +LS ER +    +
Sbjct  179   KTVLDFQDILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAVAFEDAVRLSTERFIVPFSL  238

Query  1282  VWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKL--GTSDENHKDLLSRFMGSIGDD  1109
             +WKIKR LNIGSEK+LR ++E +   A E++R+++K     S  +  DLLSRF+ +   D
Sbjct  239   IWKIKRALNIGSEKKLRVAVEQVREFAKEIVREKQKELNDKSSLDSADLLSRFLSTGHSD  298

Query  1108  ETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQR  929
             E ++ DIVISF+LAGRDT ++ALT FFWLI+ HP+    I+ E    VG+  + +     
Sbjct  299   EDFVTDIVISFILAGRDTTSAALTWFFWLISKHPEVESQIMKE----VGEKSESLLLYDE  354

Query  928   MRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIW  749
             ++ + Y  A++CES+R +PP+  DSK   +DD+LPDGT VK+GTRVTYHPYAMGR+E +W
Sbjct  355   VKNMMYTHASLCESMRFYPPVPMDSKEATKDDILPDGTFVKKGTRVTYHPYAMGRVEKVW  414

Query  748   GSDCLEFKPERWL-RDGV-----FFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVL  587
             G D  EFKPERWL +D V     F  ++ + YPVFQAG R+CLGKEMA L++K V   VL
Sbjct  415   GEDWAEFKPERWLDKDEVTGNWTFVPKDAYTYPVFQAGPRICLGKEMAFLQMKRVVAGVL  474

Query  586   RRFR-VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             RRF+ V + +    P F   LTA  + G PV +++R
Sbjct  475   RRFKVVPVVEQGVEPVFISYLTAKMKGGFPVTIEER  510



>ref|XP_007162039.1| hypothetical protein PHAVU_001G118600g [Phaseolus vulgaris]
 gb|ESW34033.1| hypothetical protein PHAVU_001G118600g [Phaseolus vulgaris]
Length=529

 Score =   405 bits (1040),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/442 (45%), Positives = 286/442 (65%), Gaps = 6/442 (1%)
 Frame = -2

Query  1789  DWYTHLLRNSPSKTI---HIHVLRNTITANPENVEYMLKSRFENFPKGKAFSAILGDFLG  1619
             DW T +LR+ P+ T      +     ITANP+NVE+MLK+RFEN+PKG+ F   L DFLG
Sbjct  77    DWTTQVLRDCPTNTAVFSRPYSSHGVITANPDNVEHMLKTRFENYPKGERFINHLQDFLG  136

Query  1618  QGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKDGGVVDLQ  1442
              GIFN D + W+ QRKIAS E    S+ ++    + TE+  RLLPIL+   +  G++DLQ
Sbjct  137   NGIFNSDSELWKLQRKIASHEFSTKSLRNFIVNTVTTELQTRLLPILSKASQTNGLLDLQ  196

Query  1441  DVFRRFSFDCICRFSFGLDPKCLES-LLPMSEFAVSFHLASKLSAERAMSASPVVWKIKR  1265
             ++F RF+FD +C+ +F +DP CL       +EF  +F  A+ LS+ R MS  P +WKIK+
Sbjct  197   NLFERFAFDNVCKLAFNVDPACLGGDGTAGAEFMSAFEDAAVLSSGRFMSVLPFMWKIKQ  256

Query  1264  FLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHKDLLSRFMGSIGDDETYLRDIV  1085
              LNIG+E+ LRKSI  +++ A  +IR R +      + +DLLSRF+ +      +LRD+V
Sbjct  257   LLNIGTERRLRKSITTVHVFADSIIRSRLESREHTSDDEDLLSRFIRTQESSPEFLRDVV  316

Query  1084  ISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA-SEQRMRELNYL  908
             ISF+LAGRDT +SALT FFW++++ PD    I  E  RV      + A   + ++E++YL
Sbjct  317   ISFILAGRDTTSSALTWFFWILSSRPDVRRKIHDEIARVRFATGGVGAFGYEELKEMHYL  376

Query  907   QAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIWGSDCLEF  728
              AA+ E++RL+PP+  DSK C +DDVLPDGT + +G  ++YH YAMGRME +WG DC ++
Sbjct  377   HAALTETMRLYPPVPVDSKKCADDDVLPDGTRIGKGWFLSYHTYAMGRMESVWGKDCAQY  436

Query  727   KPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVLRRFRVHLAQPHHT  548
              PERWL +G F  E+PF++PVF AG R+CLGKEMA +++KS+A SV+  F +        
Sbjct  437   NPERWLENGAFRTESPFRFPVFHAGPRMCLGKEMAYIQMKSIAASVMESFEIEAVDKDTC  496

Query  547   PRFSPGLTATFRDGLPVFVQQR  482
             P     LT   + GL V ++ R
Sbjct  497   PEHVLSLTLRIKGGLAVRLRTR  518



>ref|XP_008464443.1| PREDICTED: cytochrome P450 94B3 [Cucumis melo]
Length=513

 Score =   404 bits (1038),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 292/460 (63%), Gaps = 15/460 (3%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y     L  WYT LL +SP++TI +H L   R  +TANP NVE+MLK+ F N+PKGK 
Sbjct  52    SFYKNRRRLLAWYTDLLSDSPTRTIVLHRLGSRRTILTANPANVEHMLKTNFLNYPKGKP  111

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL-AG  1472
             F+ ILGD LG GIFNVDGD W  QRK+AS      S+  +  + ++ E+  RL+P+L   
Sbjct  112   FTDILGDLLGCGIFNVDGDLWSTQRKLASHAFSAKSLREFVVKTLEDEVHFRLIPLLHNA  171

Query  1471  KKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              +   VVDLQDV  R +FD +C+ + G D +CL+   P+ E   +F +A+ +SA RA++ 
Sbjct  172   ARTNAVVDLQDVLGRLAFDTVCKVTLGTDEQCLDMSRPIPEIVNAFDVATAISARRAVAP  231

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQR--------RKLGTSDENHKDLLS  1136
               + WK KR LN+GSEK+L++ ++ ++     +I  +             +  ++ DLLS
Sbjct  232   LYLTWKAKRMLNLGSEKKLKEVVQTVHEWISNIIHSKLLNNNNNNTVHNHNQTHNNDLLS  291

Query  1135  RFMGSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVV--G  962
             R + S G DE  +RD+++SF++AGRDT ++A+T  FWL+ NH +  + I+ EA  +    
Sbjct  292   RLL-SAGLDEEVVRDMIVSFIMAGRDTTSAAMTWLFWLLTNHRNIEQTIINEATSLSDDS  350

Query  961   KNQDLIASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYH  782
             K   L    + ++++ YL+A +CES+RL+PP+ +DSK     D+LPDGT V++G RVTY 
Sbjct  351   KTTSLGYGYEELKDMKYLKACLCESMRLYPPVAWDSKHAAAADILPDGTQVRKGDRVTYF  410

Query  781   PYAMGRMEGIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSV  602
             PY MGRME +WG D LEFKPERW ++G     +PFK+PVFQAG R+CLG EMA +++K V
Sbjct  411   PYGMGRMEELWGKDRLEFKPERWFQNGELKTVSPFKFPVFQAGPRMCLGMEMAFIQMKYV  470

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
               +VL+RF       ++ P F P LTA    GL VFV++R
Sbjct  471   MATVLKRFEFRPVSENNVPVFVPLLTAHMAGGLQVFVRER  510



>ref|XP_002282477.2| PREDICTED: cytochrome P450 94A1-like [Vitis vinifera]
 emb|CBI17962.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   405 bits (1042),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 205/456 (45%), Positives = 296/456 (65%), Gaps = 18/456 (4%)
 Frame = -2

Query  1810  AKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAFSA  1640
             A  N    W + L+R SPS T+ IH     R  +T NP NV+++LK+ F N+ KG+ F+ 
Sbjct  109   ANLNRRIQWTSDLIRASPSATVVIHRFLGTRVVLTGNPSNVQHILKTHFHNYHKGQTFAI  168

Query  1639  ILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKD  1463
              L DFLG GIFN DGD+W+FQR+++S E    S+  +   V+  E+  RL+PIL+    +
Sbjct  169   NLSDFLGGGIFNADGDNWKFQRQVSSHEFNTKSLRKFIETVVDAELSDRLIPILSMAAAN  228

Query  1462  GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPV  1283
               ++D QD+ +RF+FD IC+ +FG DP  L   LP ++FAV+F  A+++S+ER  S  P 
Sbjct  229   NSILDFQDILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAVAFEDAARISSERFSSIRPT  288

Query  1282  VWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENHKDLLSRFMGSIGDD  1109
             VW++KR + +GSEK L+ ++  +   A  +IR++++     S  +  DLLSRF+ S   D
Sbjct  289   VWRLKRLMGVGSEKRLKLAVGEVREFAKNIIREKKEELKHKSSLDSTDLLSRFLSSGHSD  348

Query  1108  ETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQR  929
             E ++ DIVISF+LAGRDT ++ALT FFWL+  +PD  + IL E    + +  +L   ++ 
Sbjct  349   EDFVTDIVISFILAGRDTTSAALTWFFWLLFKNPDVEDQILNE----INEKSELPVFDE-  403

Query  928   MRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIW  749
             ++++ Y  A++CES+R +PP+  DSK  V DDVLPDGT V++G RVTYHPYAMGR+E +W
Sbjct  404   VKDMIYTHASLCESMRFYPPVPADSKEAVSDDVLPDGTVVRKGMRVTYHPYAMGRLEELW  463

Query  748   GSDCLEFKPERWL-RDG-----VFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVL  587
             GSD  EF+PERWL RD       F   +P+ YPVFQAG R+CLGKEMA L++K V   VL
Sbjct  464   GSDWPEFRPERWLQRDPDTGKWSFVARDPYTYPVFQAGPRICLGKEMAFLQMKRVVAGVL  523

Query  586   RRFR-VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             RRF+ V + +    P F+  LTA  + G PV + +R
Sbjct  524   RRFQVVPVVEDGGEPVFTADLTAKMKGGFPVRIVER  559



>ref|XP_009784521.1| PREDICTED: cytochrome P450 94B3-like [Nicotiana sylvestris]
Length=511

 Score =   404 bits (1037),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 206/456 (45%), Positives = 296/456 (65%), Gaps = 16/456 (4%)
 Frame = -2

Query  1816  WYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKAF  1646
             +Y     L DWYTHLL  SP++TI I  L   R  +TANP NVEYMLK+ F+NFPKGK F
Sbjct  56    FYKNRYRLLDWYTHLLSKSPTQTIVIDRLGARRTIVTANPYNVEYMLKTNFDNFPKGKPF  115

Query  1645  SAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GK  1469
             + ILGDFLG GIF+VDG+ W  QRK+ S E    S+  Y    ++ E++ +LLPIL   +
Sbjct  116   NEILGDFLGNGIFDVDGEMWYKQRKMVSHEFTARSLRDYVVNALKEEVENKLLPILELME  175

Query  1468  KDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSAS  1289
              +    D QD+ RR +FD +C+ S G DP C+   L  S    +F  AS++SAER  +  
Sbjct  176   AENRAFDFQDLLRRLAFDVVCKVSLGFDPCCINESLSFSPLLDAFERASQISAERGAAPI  235

Query  1288  PVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDEN----HKDLLSRFMGS  1121
               VWK+KR+LNIGSEK+L+ +I+ ++    ++IR+R K+   DEN    +KDLLSR + +
Sbjct  236   FFVWKVKRWLNIGSEKQLKLAIDQIHSSINDIIRER-KIKIKDENQKETNKDLLSRMILA  294

Query  1120  IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA  941
                DE  +RD+VISF++AGRDT ++A+T FF+L++ HP+    ++++  R +    + + 
Sbjct  295   ENFDEEEVRDMVISFIMAGRDTTSAAMTWFFYLLSLHPEIENELVSKELRFI--ETETLT  352

Query  940   SEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRM  761
               + ++E+N+L++ +CE++RL+PP+ +DSK  + DD+LPDGT +K G RVTY PY MGRM
Sbjct  353   KYEILKEMNFLKSCLCETMRLYPPVAWDSKHAISDDILPDGTRIKAGNRVTYFPYGMGRM  412

Query  760   EGIWGSDCLEFKPERWL----RDGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALS  593
             E +WG D  EFKP RW+     +G       +K+PVFQAG RVCLGKE+A +++K V  S
Sbjct  413   ENLWGKDRFEFKPRRWMEESGEEGTEQISILYKFPVFQAGPRVCLGKELAFIQMKYVVAS  472

Query  592   VLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQ  485
             +L+RF++  A     P F P LTA    G  VFV +
Sbjct  473   ILKRFQIRPAC-SDPPVFLPLLTAHMAGGFKVFVHK  507



>ref|XP_009610819.1| PREDICTED: cytochrome P450 94A1-like [Nicotiana tomentosiformis]
Length=510

 Score =   403 bits (1036),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 207/462 (45%), Positives = 295/462 (64%), Gaps = 23/462 (5%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKT------IHIHVLRNTITANPENVEYMLKSRFENFPK  1658
             S  A ++    W + ++ ++P+ T      ++ H +    TANP NV++MLK+ F+ + K
Sbjct  55    SILANHDQRIKWISDIILSTPNLTFTLIRPLNFHTI---FTANPSNVQHMLKTNFQVYQK  111

Query  1657  GKAFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPIL  1478
             G   +  L DFL  GIFNVDGD W++QR++AS E    S+  +   V+ TE+  RL+PIL
Sbjct  112   GHNSNTTLKDFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVETVVDTELSERLIPIL  171

Query  1477  A-GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERA  1301
             A    +  V+D QD+ +RF+FD IC+ +FG DP  L   LP +EFAV+F  A +LS ER 
Sbjct  172   ATAAANKTVLDFQDILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAVAFEDAVRLSTERF  231

Query  1300  MSASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIR--QRRKLGTSDENHKDLLSRFM  1127
             +   P++WK+KR LNIGSEK+LR ++E +   A E++R  QR     S  +  DLLSRF+
Sbjct  232   ILPFPLIWKMKRALNIGSEKKLRFAVEQVREFAKEIVREKQRELKDKSSLDSADLLSRFL  291

Query  1126  GSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDL  947
              +   DE ++ DIVISF+LAGRDT ++ALT FFWLI+ HP+    IL E    +G+  + 
Sbjct  292   STGHSDENFVTDIVISFILAGRDTTSAALTWFFWLISKHPEVESQILKE----IGEKSES  347

Query  946   IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
             +     ++ + Y  A++CES+R +PP+  D+K   +DD+LPDGT VK+G RVTYHPYAMG
Sbjct  348   LLLYDEVKNMIYTHASLCESMRFYPPVPMDTKEATKDDILPDGTFVKKGNRVTYHPYAMG  407

Query  766   RMEGIWGSDCLEFKPERWL-RDGV-----FFQENPFKYPVFQAGLRVCLGKEMALLELKS  605
             R+E +WG D  EF+PERWL +D V     F  ++ + YPVFQAG RVCLGKEMA L++K 
Sbjct  408   RVEKVWGKDWAEFRPERWLDKDEVTGNWTFVSKDAYTYPVFQAGPRVCLGKEMAFLQMKR  467

Query  604   VALSVLRRFR-VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             V   VLRRF+ V + +    P F   LTA  + G PV +++R
Sbjct  468   VVAGVLRRFKVVPVVEQGAEPVFISYLTAKMKGGFPVTIEER  509



>ref|XP_002318721.2| hypothetical protein POPTR_0012s09880g [Populus trichocarpa]
 gb|EEE96941.2| hypothetical protein POPTR_0012s09880g [Populus trichocarpa]
Length=631

 Score =   407 bits (1047),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 305/459 (66%), Gaps = 18/459 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+Y     L DWYT+LL  SP++TI +  L   R  +TANPENVEY+LK+ F NFPKGK+
Sbjct  50    SFYKNRRCLLDWYTNLLSVSPTQTIVVKRLGARRIIVTANPENVEYVLKTNFINFPKGKS  109

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ ILGD LG GIFN DG+ W  QRK+AS E    S+  +    +Q E++ RL+P+L   
Sbjct  110   FTEILGDLLGCGIFNADGELWSTQRKLASHEFSTKSLREFVVMTLQEEVENRLIPLLEEA  169

Query  1468  KDG-GVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              +   V+DLQD+ RRFSFD +CR S G DP CL+   P+     +F  AS++SA R M+ 
Sbjct  170   VEAKSVLDLQDLLRRFSFDIVCRVSLGTDPSCLDLSRPIPPLVKAFDAASEISAMRGMAP  229

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRKLGTSDENHK---DLLSRFMGS  1121
                VWK K+  N+G+EK+L+++I++++    E+++ ++++  +D   K   DLLSR + +
Sbjct  230   VYAVWKAKKLFNLGAEKKLKEAIKLVHDSVSEIVKTKKRVLENDREGKLESDLLSRLLLA  289

Query  1120  IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA  941
              G  E  +RD+VISF++AGRDT ++A+T  FWL++ H ++ + I+ E   ++   +  I 
Sbjct  290   -GHGEEVVRDMVISFIMAGRDTTSAAMTWLFWLLSKHRNSEKMIVKEVKSLLDDREKAID  348

Query  940   SEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRM  761
              E  ++ +N+L+A++CES+RL+PP+ +DSK  + DDVLPDGT+V++G RVTY PY MGRM
Sbjct  349   YEV-LKGMNFLKASLCESMRLYPPVPWDSKHAIIDDVLPDGTSVRKGDRVTYFPYGMGRM  407

Query  760   EGIWGSDCLEFKPERWLR----DGVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALS  593
             E +WG D  EF+P+RW +    D      +P+ +PVFQAG RVCLGKEMA++++K V  S
Sbjct  408   EKLWGKDRFEFRPDRWFQEIGNDQTLKSVSPYTFPVFQAGPRVCLGKEMAMIQMKYVMAS  467

Query  592   VLRRFRVHLAQP--HHTPRFSPGLTATFRDGLPVFVQQR  482
             VLRRF +   +P   + P F+P LTA    GL V V++R
Sbjct  468   VLRRFEI---KPVFDNEPVFAPLLTAHMVGGLKVMVKRR  503



>gb|KFK28056.1| hypothetical protein AALP_AA8G465900 [Arabis alpina]
Length=499

 Score =   402 bits (1034),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 213/460 (46%), Positives = 302/460 (66%), Gaps = 18/460 (4%)
 Frame = -2

Query  1819  SWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGKA  1649
             S+    + L  WYT LLR SPS+TI + +L   R  ITANPENVE++LK+ F NFPKGK 
Sbjct  44    SFNKNRHRLLQWYTDLLRQSPSQTITVDLLLRRRTIITANPENVEHILKTNFYNFPKGKP  103

Query  1648  FSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILAGK  1469
             F+ +LGD LG GIFN DG+ W  QRK+AS E    S+  + FE+++ E++ RL+P+L+  
Sbjct  104   FTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEVENRLIPVLSSA  163

Query  1468  KDGG-VVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSA  1292
              DGG  VD Q+V +RF+FD +C+ S G DP CL+   P+ +   +F +A+ +SA RA   
Sbjct  164   GDGGRTVDFQEVLKRFAFDVVCKVSLGWDPDCLDLTRPVPDLFKAFDVAAMISARRATEP  223

Query  1291  SPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK---LGTSDENHKDLLSRFMGS  1121
                VWK+KR LN+G+E+ LR++I+ +++   E+IR ++K   +G    + KDLLSRF+ +
Sbjct  224   VQAVWKLKRMLNVGTERRLREAIKTVHVSVSEIIRAKKKILEIGGDVSDKKDLLSRFLAA  283

Query  1120  IGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIA  941
              GDDE  +RD VISF++AGRDT ++A+T  FWL++ + D  + IL E      ++  L  
Sbjct  284   -GDDEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSENNDVEKKILEEVSN--KESLGLGL  340

Query  940   SEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRM  761
               + +RE++Y++A +CE++RL+PP+ +DSK    DDVLPDGT VKRG +VTY PY MGRM
Sbjct  341   GFEDLREMSYIKACLCEAMRLYPPVAWDSKHAANDDVLPDGTRVKRGDKVTYFPYGMGRM  400

Query  760   EGIWGSDCLEFKPERWLRDGVFFQENP-------FKYPVFQAGLRVCLGKEMALLELKSV  602
             E +WG D  EFKP RW  +   +   P       FK+PVFQAG RVC+GKEMA L++K V
Sbjct  401   ERVWGQDWDEFKPNRWFEEEPNYGTKPVLKSVSSFKFPVFQAGPRVCIGKEMAFLQMKYV  460

Query  601   ALSVLRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
               SVL RF + +    + P F P LTA    GL V +++R
Sbjct  461   VGSVLSRFEI-IPVCDNRPVFVPLLTAHMAGGLKVKIKRR  499



>emb|CAN75729.1| hypothetical protein VITISV_031409 [Vitis vinifera]
Length=506

 Score =   402 bits (1034),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 205/456 (45%), Positives = 294/456 (64%), Gaps = 18/456 (4%)
 Frame = -2

Query  1810  AKYNNLCDWYTHLLRNSPSKTIHIHV---LRNTITANPENVEYMLKSRFENFPKGKAFSA  1640
             A  N    W + L+R SPS T+ IH     R  +T NP NV+++LK+ F N+ KG+ F  
Sbjct  52    ANLNRRVQWTSDLIRASPSATVVIHRCLGTRVVLTGNPSNVQHILKTHFHNYHKGQFFRI  111

Query  1639  ILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-GKKD  1463
             IL DFLG GIFN DGD+W+FQR+++S E    S+  +   V+  E+  RL+PIL+    +
Sbjct  112   ILSDFLGGGIFNADGDNWKFQRQVSSHEFNTKSLRKFIETVVDAELSDRLIPILSTAAAN  171

Query  1462  GGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMSASPV  1283
               V+D QD+ +RF+FD IC+ +FG DP  L   LP ++FAV+F  A+++S+ER     P+
Sbjct  172   NSVLDFQDILQRFAFDNICKIAFGYDPDXLLPSLPQAKFAVAFEDAARISSERFTLILPI  231

Query  1282  VWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRRK--LGTSDENHKDLLSRFMGSIGDD  1109
             VWK+KR + +GSEK L+ ++  +   A  ++R++++     S  +  DLLSRF+ S   D
Sbjct  232   VWKLKRLMGVGSEKRLKLAVAEVREFAKNIVREKKEELKHKSSLDSTDLLSRFLSSGHSD  291

Query  1108  ETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDLIASEQR  929
             E ++ DIVISF+LAGRDT ++ALT FFWL+  HPD  + IL E    + +  +L   ++ 
Sbjct  292   EDFITDIVISFILAGRDTTSAALTWFFWLLFKHPDVEDQILNE----INEKSELPVFDE-  346

Query  928   MRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMGRMEGIW  749
             ++++ Y  A++CES+R +PP+  DSK  V DDVLPDGT VK+G RVTYHPYAMGR+E +W
Sbjct  347   VKDMVYTHASLCESMRFYPPVPVDSKEVVSDDVLPDGTVVKKGMRVTYHPYAMGRLEELW  406

Query  748   GSDCLEFKPERWL-RDG-----VFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSVL  587
             GSD  EF+PERWL RD       F   +P+ YPVFQAG R+CLGKEMA L++K V   VL
Sbjct  407   GSDWPEFRPERWLQRDPDTXKWSFVARDPYTYPVFQAGPRICLGKEMAFLQMKRVVAGVL  466

Query  586   RRFR-VHLAQPHHTPRFSPGLTATFRDGLPVFVQQR  482
             RRF+ V + +    P ++  L A  + G  V + +R
Sbjct  467   RRFQVVPVVEDGGEPVYTADLAAKMKGGFLVRIVER  502



>emb|CDP15011.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   402 bits (1034),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/463 (44%), Positives = 305/463 (66%), Gaps = 13/463 (3%)
 Frame = -2

Query  1822  TSWYAKYNNLCDWYTHLLRNSPSKTIHIHVL---RNTITANPENVEYMLKSRFENFPKGK  1652
              ++Y   + L DWYT +L  SPS+T+ I      R  +TANP+NVEY+LK+ F N+PKGK
Sbjct  50    VAFYQNRHRLLDWYTEILSQSPSQTMVIKRFGAPRTIVTANPQNVEYILKTNFNNYPKGK  109

Query  1651  AFSAILGDFLGQGIFNVDGDSWRFQRKIASMELGRSSVLSYAFEVIQTEIDRRLLPILA-  1475
              F+ ILGDFLG+GIFN DG  W+ QRK+AS E    S+  +  + ++ ++  +L P+L  
Sbjct  110   PFTEILGDFLGRGIFNADGHLWQVQRKLASHEFSAKSLREFVVKTLEEQVQNKLFPVLEM  169

Query  1474  GKKDGGVVDLQDVFRRFSFDCICRFSFGLDPKCLESLLPMSEFAVSFHLASKLSAERAMS  1295
               +   V+DLQDV RRF+FD IC+ S G+DP+CL+   P+   A++F  AS++ A R ++
Sbjct  170   AVEKNMVLDLQDVLRRFAFDTICKVSLGMDPRCLDISQPVPPLAIAFDKASEICARRGVA  229

Query  1294  ASPVVWKIKRFLNIGSEKELRKSIEVMNMLAMEVIRQRR----KLGTSDENHKDLLSRFM  1127
               P VWK++R LN+GSEKEL++++++++    ++I+ ++    ++     ++ DLLSR +
Sbjct  230   PIPAVWKMRRALNLGSEKELKEAVDLVHGCVDDIIQTKKTKLNEIADKKTSNNDLLSRLL  289

Query  1126  GSIGDDETYLRDIVISFLLAGRDTVASALTSFFWLIANHPDAAEAILAEADRVVGKNQDL  947
              +  DDE  +RD+VISFL+AGRDT +SALT  FWL++NH    + ++ E + +  K + L
Sbjct  290   LAGLDDEM-VRDMVISFLMAGRDTTSSALTWLFWLLSNHHAVKKNVMNELEILNLKEKPL  348

Query  946   IASEQRMRELNYLQAAVCESLRLFPPIQFDSKFCVEDDVLPDGTAVKRGTRVTYHPYAMG  767
                +  ++E+ Y++A +CES+RL+PP+ +DSK    DD+LPDGT V +G RVTY  Y MG
Sbjct  349   DVED--LKEMKYIKACLCESMRLYPPVVWDSKHAENDDILPDGTIVYKGNRVTYFQYGMG  406

Query  766   RMEGIWGSDCLEFKPERWLRD-GVFFQENPFKYPVFQAGLRVCLGKEMALLELKSVALSV  590
             R+E +WG DC EF+P+RW  D G+    +P+K+PVFQAG RVCLGKEMA +++K V  S+
Sbjct  407   RIEELWGKDCFEFRPDRWFDDNGMLKMVDPYKFPVFQAGPRVCLGKEMAFIQMKHVVASI  466

Query  589   LRRFRVHLAQPHHTPRFSPGLTATFRDGLPVFVQQR*CPPCLI  461
             LRR+ +     +  P F P LTA    GL V + +   P  +I
Sbjct  467   LRRYEIKKVDDNQ-PIFVPLLTAFMAGGLKVRIHRLSQPGVVI  508



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6209079152520