BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18684_g1_i2 len=1219 path=[1:0-482 484:483-1163 1165:1164-1218]

Length=1219
                                                                      Score     E

dbj|BAA89480.1|  pectin methylesterase                                  308   6e-95   Salix gilgiana
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                306   2e-94   
ref|XP_002324181.2|  pectinesterase family protein                      303   5e-93   Populus trichocarpa [western balsam poplar]
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             301   2e-92   
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    300   5e-92   
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    296   2e-90   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    293   3e-89   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     289   1e-87   
gb|EPS66234.1|  hypothetical protein M569_08543                         281   9e-85   
ref|XP_011093900.1|  PREDICTED: pectinesterase-like                     280   2e-84   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               280   4e-84   Ricinus communis
emb|CDP19930.1|  unnamed protein product                                275   3e-82   
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             271   6e-81   
ref|XP_007154534.1|  hypothetical protein PHAVU_003G126700g             268   2e-79   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    265   1e-78   
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     265   1e-78   
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         265   1e-78   
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    265   2e-78   
ref|XP_010526136.1|  PREDICTED: probable pectinesterase/pectinest...    263   9e-78   
ref|XP_010526019.1|  PREDICTED: putative pectinesterase/pectinest...    263   1e-77   
ref|XP_007012506.1|  Pectinesterase                                     263   1e-77   
gb|KFK29934.1|  hypothetical protein AALP_AA7G197300                    261   7e-77   
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    261   7e-77   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    261   7e-77   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    258   8e-76   
emb|CDX83235.1|  BnaA03g22710D                                          258   1e-75   
emb|CDY38523.1|  BnaC03g26740D                                          257   2e-75   
ref|XP_009133943.1|  PREDICTED: probable pectinesterase/pectinest...    256   5e-75   
ref|XP_006452912.1|  hypothetical protein CICLE_v10007819mg             254   1e-74   
ref|XP_010437784.1|  PREDICTED: putative pectinesterase/pectinest...    255   2e-74   
ref|XP_002867193.1|  pectinesterase family protein                      254   2e-74   
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    254   4e-74   
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    253   7e-74   
ref|NP_195049.1|  putative pectinesterase/pectinesterase inhibito...    253   9e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447267.1|  PREDICTED: putative pectinesterase/pectinest...    253   1e-73   
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    252   1e-73   
ref|XP_010432595.1|  PREDICTED: putative pectinesterase/pectinest...    251   3e-73   
ref|XP_006474558.1|  PREDICTED: probable pectinesterase/pectinest...    251   3e-73   
emb|CDX72395.1|  BnaC07g44170D                                          251   4e-73   
ref|XP_003609936.1|  Pectinesterase                                     251   4e-73   
gb|KFK32509.1|  hypothetical protein AALP_AA6G251800                    251   5e-73   
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                     249   3e-72   
ref|XP_006285466.1|  hypothetical protein CARUB_v10006885mg             249   5e-72   
ref|XP_006412376.1|  hypothetical protein EUTSA_v10024699mg             248   6e-72   
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                     247   1e-71   
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    245   5e-71   
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    245   6e-71   
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                     240   5e-69   
ref|XP_009138175.1|  PREDICTED: putative pectinesterase/pectinest...    240   7e-69   
emb|CDY46125.1|  BnaA03g52430D                                          240   8e-69   
ref|XP_002878962.1|  pectinesterase family protein                      239   1e-68   
ref|XP_006408782.1|  hypothetical protein EUTSA_v10001934mg             239   1e-68   
gb|AAP40488.1|  putative pectin methylesterase                          239   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    238   2e-68   
ref|XP_010472674.1|  PREDICTED: probable pectinesterase/pectinest...    237   6e-68   
ref|XP_010417438.1|  PREDICTED: probable pectinesterase/pectinest...    237   1e-67   
ref|NP_850077.1|  probable pectinesterase/pectinesterase inhibito...    236   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...    236   3e-67   
ref|XP_006295415.1|  hypothetical protein CARUB_v10024513mg             232   7e-66   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    231   1e-65   
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                     225   2e-63   
ref|XP_004289016.1|  PREDICTED: probable pectinesterase/pectinest...    224   6e-63   
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                     223   7e-63   
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                     221   5e-62   
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...    221   5e-62   
ref|XP_009386320.1|  PREDICTED: pectinesterase-like                     221   9e-62   
ref|XP_010431632.1|  PREDICTED: probable pectinesterase/pectinest...    223   1e-61   
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                     218   5e-61   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     217   2e-60   
ref|XP_006474679.1|  PREDICTED: putative pectinesterase/pectinest...    211   1e-59   
gb|AAC14494.1|  putative pectinesterase                                 212   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009611625.1|  PREDICTED: probable pectinesterase/pectinest...    213   1e-58   
ref|XP_006661265.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    212   1e-58   
ref|NP_001063246.1|  Os09g0433700                                       211   4e-58   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ44838.1|  hypothetical protein OsJ_29475                          211   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     208   2e-57   
ref|XP_009798263.1|  PREDICTED: probable pectinesterase/pectinest...    209   3e-57   
ref|XP_010687597.1|  PREDICTED: pectinesterase                          207   1e-56   
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          205   7e-56   Sorghum bicolor [broomcorn]
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     203   1e-55   
gb|EMT24232.1|  Putative pectinesterase/pectinesterase inhibitor 13     204   1e-55   
ref|XP_008646066.1|  PREDICTED: uncharacterized protein LOC100384...    204   2e-55   
gb|AES65624.2|  pectinesterase/pectinesterase inhibitor                 204   2e-55   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          202   4e-55   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     202   4e-55   
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     201   1e-54   
ref|NP_001169525.1|  pectinesterase                                     201   2e-54   Zea mays [maize]
ref|XP_010248006.1|  PREDICTED: probable pectinesterase/pectinest...    197   3e-54   
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     198   2e-53   
ref|XP_002275000.1|  PREDICTED: pectinesterase                          197   2e-53   Vitis vinifera
emb|CBI26012.3|  unnamed protein product                                197   2e-53   
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          197   3e-53   Sorghum bicolor [broomcorn]
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    197   3e-53   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          197   5e-53   
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              196   6e-53   
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                     196   6e-53   Vitis vinifera
gb|EAY94388.1|  hypothetical protein OsI_16156                          196   7e-53   Oryza sativa Indica Group [Indian rice]
dbj|BAK05856.1|  predicted protein                                      196   8e-53   
ref|NP_001132793.1|  pectinesterase                                     197   9e-53   Zea mays [maize]
gb|EMS59431.1|  Putative pectinesterase/pectinesterase inhibitor 28     196   1e-52   
ref|NP_001052981.1|  Os04g0458900                                       195   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    195   1e-52   
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    195   2e-52   
gb|EPS69324.1|  hypothetical protein M569_05439                         195   2e-52   
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative               194   4e-52   Ricinus communis
gb|EAY94391.1|  hypothetical protein OsI_16158                          194   5e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_010276571.1|  PREDICTED: uncharacterized protein LOC104611288    196   5e-52   
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                     194   5e-52   
gb|ACF79975.1|  unknown                                                 193   7e-52   Zea mays [maize]
gb|EAZ42935.1|  hypothetical protein OsJ_27525                          194   9e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                     193   1e-51   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     192   1e-51   
emb|CAH67075.1|  OSIGBa0097P08.5                                        192   2e-51   Oryza sativa [red rice]
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     192   2e-51   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    194   2e-51   
emb|CAN67129.1|  hypothetical protein VITISV_040170                     197   2e-51   Vitis vinifera
ref|XP_004956918.1|  PREDICTED: putative pectinesterase/pectinest...    193   2e-51   
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     192   2e-51   
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    192   2e-51   
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     191   4e-51   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    191   5e-51   
ref|XP_003632385.1|  PREDICTED: pectinesterase-like                     191   5e-51   
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     190   7e-51   
ref|XP_010247944.1|  PREDICTED: probable pectinesterase/pectinest...    188   8e-51   
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     189   2e-50   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    189   2e-50   
gb|AEK07905.1|  pectin methylesterase                                   190   4e-50   
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    191   6e-50   
ref|XP_010038523.1|  PREDICTED: pectinesterase-like                     187   7e-50   
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g             187   8e-50   Populus trichocarpa [western balsam poplar]
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     187   1e-49   
ref|XP_011008693.1|  PREDICTED: pectinesterase-like                     187   2e-49   
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             187   2e-49   
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     186   2e-49   
ref|XP_004149499.1|  PREDICTED: putative pectinesterase/pectinest...    186   3e-49   
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                186   4e-49   
ref|XP_002462429.1|  hypothetical protein SORBIDRAFT_02g025460          186   4e-49   Sorghum bicolor [broomcorn]
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                185   5e-49   
ref|XP_004986923.1|  PREDICTED: putative pectinesterase/pectinest...    185   1e-48   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    184   1e-48   
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    183   2e-48   
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                     183   4e-48   
ref|XP_006344580.1|  PREDICTED: probable pectinesterase/pectinest...    184   4e-48   
ref|XP_002298186.1|  hypothetical protein POPTR_0001s21630g             182   5e-48   Populus trichocarpa [western balsam poplar]
gb|EAZ09211.1|  hypothetical protein OsI_31486                          179   5e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g             182   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2          182   6e-48   
ref|XP_008660035.1|  PREDICTED: pectinesterase-like                     182   7e-48   
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3          182   1e-47   
ref|XP_004242900.1|  PREDICTED: probable pectinesterase/pectinest...    182   2e-47   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    181   2e-47   
ref|NP_001049858.1|  Os03g0300500                                       181   3e-47   Oryza sativa Japonica Group [Japonica rice]
emb|CBI39537.3|  unnamed protein product                                182   3e-47   
ref|XP_011046142.1|  PREDICTED: pectinesterase-like                     180   4e-47   
gb|KGN49779.1|  hypothetical protein Csa_5G119700                       180   5e-47   
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...    179   6e-47   
gb|AFW88066.1|  hypothetical protein ZEAMMB73_934481                    182   7e-47   
emb|CDP21547.1|  unnamed protein product                                180   9e-47   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                179   1e-46   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    179   1e-46   
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1          178   2e-46   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                178   2e-46   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 178   2e-46   Ricinus communis
ref|XP_008466403.1|  PREDICTED: pectinesterase-like                     178   3e-46   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    179   3e-46   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    179   3e-46   
ref|NP_001050306.1|  Os03g0399000                                       178   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    177   4e-46   
ref|XP_007219746.1|  hypothetical protein PRUPE_ppa024156mg             177   4e-46   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    177   5e-46   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    177   5e-46   
ref|XP_008656646.1|  PREDICTED: pectinesterase-like                     177   5e-46   
ref|XP_011007987.1|  PREDICTED: pectinesterase-like                     177   6e-46   
ref|XP_002304074.1|  hypothetical protein POPTR_0003s01550g             176   7e-46   Populus trichocarpa [western balsam poplar]
tpg|DAA45708.1|  TPA: hypothetical protein ZEAMMB73_512323              177   7e-46   
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          177   7e-46   Sorghum bicolor [broomcorn]
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    176   8e-46   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               176   9e-46   Ricinus communis
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...    176   1e-45   
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    176   1e-45   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    176   1e-45   
emb|CDP17031.1|  unnamed protein product                                176   1e-45   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                176   1e-45   
gb|EAY90351.1|  hypothetical protein OsI_11933                          176   1e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    177   1e-45   
ref|XP_008375414.1|  PREDICTED: putative pectinesterase/pectinest...    176   2e-45   
ref|XP_008356804.1|  PREDICTED: putative pectinesterase/pectinest...    176   2e-45   
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    176   2e-45   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          176   2e-45   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    175   2e-45   
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...    175   3e-45   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    176   3e-45   
emb|CDX99968.1|  BnaC09g03330D                                          176   3e-45   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    175   3e-45   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                174   3e-45   
ref|NP_001105487.1|  pectin methylesterase1                             174   3e-45   Zea mays [maize]
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...    175   4e-45   
ref|XP_002273396.2|  PREDICTED: probable pectinesterase/pectinest...    174   4e-45   Vitis vinifera
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     174   6e-45   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    174   6e-45   
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     174   7e-45   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     174   7e-45   
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    174   7e-45   
ref|XP_009355064.1|  PREDICTED: putative pectinesterase/pectinest...    174   8e-45   
ref|XP_002467727.1|  hypothetical protein SORBIDRAFT_01g033140          174   9e-45   Sorghum bicolor [broomcorn]
ref|XP_006382447.1|  pectin methylesterase family protein               174   1e-44   
ref|XP_010939548.1|  PREDICTED: pectinesterase-like                     173   1e-44   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    174   1e-44   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             174   1e-44   
ref|XP_009339254.1|  PREDICTED: putative pectinesterase/pectinest...    173   2e-44   
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              172   2e-44   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             174   2e-44   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         172   2e-44   
ref|XP_003559753.1|  PREDICTED: pectinesterase-like                     172   3e-44   
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative               172   3e-44   Ricinus communis
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    172   3e-44   
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    172   3e-44   
ref|XP_002872255.1|  pectinesterase family protein                      172   3e-44   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    173   3e-44   
gb|KDP28007.1|  hypothetical protein JCGZ_19087                         172   3e-44   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    172   3e-44   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    173   3e-44   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    172   4e-44   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    172   4e-44   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             172   4e-44   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     171   5e-44   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                171   5e-44   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             172   6e-44   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             171   6e-44   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    172   7e-44   
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    171   7e-44   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    171   7e-44   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     171   8e-44   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          171   8e-44   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     172   9e-44   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     171   9e-44   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          171   1e-43   
ref|XP_010067062.1|  PREDICTED: probable pectinesterase/pectinest...    170   2e-43   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     170   2e-43   
gb|KDP43631.1|  hypothetical protein JCGZ_16918                         170   2e-43   
gb|EAZ07185.1|  hypothetical protein OsI_29431                          171   2e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    170   2e-43   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    170   2e-43   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    170   3e-43   
ref|XP_010067063.1|  PREDICTED: probable pectinesterase/pectinest...    169   3e-43   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    170   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003535291.1|  PREDICTED: probable pectinesterase/pectinest...    169   3e-43   
ref|XP_002884519.1|  pectinesterase family protein                      170   3e-43   
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    167   3e-43   Medicago sativa [alfalfa]
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    169   4e-43   
emb|CDY27751.1|  BnaA05g31600D                                          169   5e-43   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    169   5e-43   
ref|XP_002515781.1|  Pectinesterase-3 precursor, putative               169   5e-43   Ricinus communis
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 168   6e-43   
ref|XP_003591317.1|  Pectinesterase                                     168   6e-43   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    168   6e-43   
ref|XP_003535290.1|  PREDICTED: probable pectinesterase/pectinest...    168   8e-43   
ref|XP_007133558.1|  hypothetical protein PHAVU_011G1890000g            166   8e-43   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    168   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    168   1e-42   
ref|XP_007011069.1|  Root hair specific 12                              168   1e-42   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    168   1e-42   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     167   1e-42   
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     167   1e-42   
emb|CAB65291.1|  pectin methyl-esterase PEF1                            167   1e-42   Medicago truncatula
gb|KHG23523.1|  putative pectinesterase/pectinesterase inhibitor ...    167   1e-42   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             167   2e-42   
ref|NP_001061941.1|  Os08g0450200                                       167   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             167   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006352821.1|  PREDICTED: pectinesterase 4-like                   167   2e-42   
emb|CDO98832.1|  unnamed protein product                                167   2e-42   
ref|XP_008804471.1|  PREDICTED: pectinesterase-like                     167   2e-42   
ref|XP_003591319.1|  Pectinesterase                                     167   2e-42   
emb|CDX74137.1|  BnaA03g29100D                                          167   3e-42   
dbj|BAK06954.1|  predicted protein                                      166   4e-42   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    166   4e-42   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    166   4e-42   
ref|XP_007145105.1|  hypothetical protein PHAVU_007G210200g             166   4e-42   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             166   4e-42   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    166   4e-42   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     165   6e-42   
dbj|BAC42986.1|  putative pectinesterase                                166   6e-42   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     166   6e-42   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    166   7e-42   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     166   7e-42   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    165   7e-42   
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    165   8e-42   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    165   9e-42   
emb|CDY68790.1|  BnaAnng28400D                                          166   9e-42   
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    165   9e-42   
gb|EMS65303.1|  putative pectinesterase/pectinesterase inhibitor 21     161   1e-41   
ref|XP_007163235.1|  hypothetical protein PHAVU_001G217300g             165   1e-41   
ref|XP_003518613.1|  PREDICTED: probable pectinesterase/pectinest...    165   1e-41   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     164   1e-41   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    166   1e-41   
ref|XP_002516960.1|  Pectinesterase precursor, putative                 165   1e-41   
ref|XP_007163236.1|  hypothetical protein PHAVU_001G217400g             164   1e-41   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    166   2e-41   
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...    164   2e-41   
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    164   2e-41   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    165   2e-41   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     164   2e-41   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    164   2e-41   
gb|EYU45917.1|  hypothetical protein MIMGU_mgv1a003666mg                164   2e-41   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     164   2e-41   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             164   3e-41   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     164   3e-41   
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    164   3e-41   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             164   3e-41   
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    163   3e-41   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    164   4e-41   
ref|XP_004510571.1|  PREDICTED: pectinesterase 3-like                   163   4e-41   
gb|EPS59322.1|  pectinesterase                                          163   4e-41   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    163   4e-41   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    163   5e-41   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    163   5e-41   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     162   6e-41   
emb|CDX80613.1|  BnaC07g28310D                                          163   6e-41   
gb|ACR34431.1|  unknown                                                 160   6e-41   
ref|XP_002316458.2|  pectinesterase family protein                      162   6e-41   
ref|XP_011046484.1|  PREDICTED: putative pectinesterase/pectinest...    162   7e-41   
ref|XP_004495868.1|  PREDICTED: probable pectinesterase/pectinest...    162   8e-41   
ref|XP_006299080.1|  hypothetical protein CARUB_v10015221mg             162   8e-41   
gb|EYU25005.1|  hypothetical protein MIMGU_mgv1a003670mg                162   9e-41   
ref|XP_003591168.1|  Pectinesterase                                     162   9e-41   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    162   1e-40   
emb|CDY05188.1|  BnaC05g46150D                                          162   1e-40   
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                162   1e-40   
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    162   2e-40   
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    161   2e-40   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    161   2e-40   
ref|XP_003591164.1|  Pectinesterase                                     161   2e-40   
ref|XP_011094021.1|  PREDICTED: pectinesterase 3-like                   161   2e-40   
emb|CDO98833.1|  unnamed protein product                                160   2e-40   
ref|XP_006349952.1|  PREDICTED: probable pectinesterase/pectinest...    159   3e-40   
gb|EMT00224.1|  Putative pectinesterase/pectinesterase inhibitor 21     160   3e-40   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    163   4e-40   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    160   4e-40   
gb|EAZ41174.1|  hypothetical protein OsJ_25671                          160   4e-40   
ref|NP_001060715.1|  Os07g0691100                                       160   4e-40   
ref|XP_003598363.1|  Pectinesterase                                     160   4e-40   
ref|XP_008346146.1|  PREDICTED: putative pectinesterase/pectinest...    160   4e-40   
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 160   4e-40   
ref|XP_010029515.1|  PREDICTED: pectinesterase 3-like                   160   4e-40   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 160   5e-40   
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    160   5e-40   
emb|CDY36269.1|  BnaA01g31490D                                          160   5e-40   
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    160   6e-40   
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     160   6e-40   
gb|KHN43418.1|  Putative pectinesterase/pectinesterase inhibitor 13     158   6e-40   
gb|EYU46877.1|  hypothetical protein MIMGU_mgv1a027033mg                159   7e-40   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    160   8e-40   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    159   8e-40   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    159   8e-40   
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    159   9e-40   
ref|XP_009122673.1|  PREDICTED: putative pectinesterase/pectinest...    159   9e-40   
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g             159   1e-39   
gb|EAZ05229.1|  hypothetical protein OsI_27427                          159   1e-39   
ref|XP_009130851.1|  PREDICTED: probable pectinesterase/pectinest...    159   1e-39   
ref|XP_009762125.1|  PREDICTED: pectinesterase-like                     159   2e-39   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     159   2e-39   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    159   2e-39   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    159   2e-39   
gb|EPS70728.1|  pectinesterase                                          158   2e-39   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     158   2e-39   
gb|EPS72184.1|  pectinesterase family protein                           158   2e-39   
gb|EYU19492.1|  hypothetical protein MIMGU_mgv1a025514mg                158   2e-39   
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     158   2e-39   
ref|XP_003528738.1|  PREDICTED: pectinesterase 3                        158   2e-39   
gb|KHN14164.1|  Putative pectinesterase/pectinesterase inhibitor 28     158   3e-39   
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    158   3e-39   
ref|NP_001151322.1|  pectinesterase-1 precursor                         158   3e-39   
ref|XP_006658993.1|  PREDICTED: probable pectinesterase/pectinest...    158   3e-39   
ref|XP_003521616.1|  PREDICTED: pectinesterase 4-like                   158   3e-39   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    158   3e-39   
ref|XP_009627394.1|  PREDICTED: pectinesterase-like                     158   3e-39   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             157   3e-39   
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    158   3e-39   
tpg|DAA64233.1|  TPA: pectinesterase                                    157   4e-39   
gb|ABK24761.1|  unknown                                                 157   4e-39   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     157   4e-39   
ref|XP_010106130.1|  putative pectinesterase/pectinesterase inhib...    157   4e-39   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          158   4e-39   
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                157   5e-39   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                160   5e-39   
ref|XP_010940182.1|  PREDICTED: pectinesterase 3-like                   159   5e-39   
ref|XP_003557034.1|  PREDICTED: putative pectinesterase/pectinest...    155   5e-39   
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    157   5e-39   
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...    157   5e-39   
ref|XP_010273808.1|  PREDICTED: pectinesterase 3                        157   6e-39   
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    156   1e-38   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    156   1e-38   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    156   1e-38   
ref|XP_010558236.1|  PREDICTED: probable pectinesterase/pectinest...    155   2e-38   
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor                 156   2e-38   
ref|XP_010543643.1|  PREDICTED: probable pectinesterase/pectinest...    155   2e-38   
ref|XP_007145106.1|  hypothetical protein PHAVU_007G210300g             155   2e-38   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             155   2e-38   
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    155   2e-38   
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    155   2e-38   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    155   3e-38   
ref|XP_007031044.1|  Pectinesterase, putative                           155   3e-38   
emb|CDY11322.1|  BnaA03g01580D                                          155   3e-38   
ref|XP_002265217.1|  PREDICTED: pectinesterase 3                        155   3e-38   
emb|CAN80988.1|  hypothetical protein VITISV_008223                     155   3e-38   
ref|XP_009135127.1|  PREDICTED: putative pectinesterase/pectinest...    155   3e-38   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    155   4e-38   
gb|KHN10154.1|  Putative pectinesterase/pectinesterase inhibitor 24     155   4e-38   
ref|XP_003546684.1|  PREDICTED: putative pectinesterase/pectinest...    154   4e-38   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         154   4e-38   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    155   4e-38   
ref|XP_010098737.1|  Putative pectinesterase/pectinesterase inhib...    153   4e-38   
ref|XP_002314364.1|  putative pectinesterase family protein             154   4e-38   
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     154   5e-38   
ref|XP_011072690.1|  PREDICTED: pectinesterase 3-like                   154   5e-38   
ref|XP_009589773.1|  PREDICTED: pectinesterase-like                     154   5e-38   
ref|XP_002311918.1|  pectinesterase family protein                      154   5e-38   
ref|XP_011032980.1|  PREDICTED: putative pectinesterase/pectinest...    154   5e-38   
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 154   6e-38   
emb|CBI22967.3|  unnamed protein product                                157   6e-38   
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             154   6e-38   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    154   7e-38   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    154   7e-38   
gb|ABO80928.1|  Pectinesterase; Pectinesterase inhibitor                154   8e-38   
ref|XP_008797350.1|  PREDICTED: pectinesterase 3                        154   8e-38   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    154   8e-38   
ref|XP_004494467.1|  PREDICTED: pectinesterase 4-like                   154   8e-38   
ref|XP_006432535.1|  hypothetical protein CICLE_v10003818mg             154   9e-38   
ref|XP_004242306.1|  PREDICTED: pectinesterase 4-like                   153   1e-37   
emb|CDX80932.1|  BnaC03g01860D                                          153   1e-37   
emb|CAB65290.2|  pectin methyl-esterase PER                             154   1e-37   
ref|XP_003626047.1|  Pectinesterase                                     153   1e-37   
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor                 154   1e-37   
ref|XP_010418644.1|  PREDICTED: putative pectinesterase/pectinest...    152   1e-37   
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    153   1e-37   
emb|CDP16868.1|  unnamed protein product                                153   2e-37   
ref|XP_009391197.1|  PREDICTED: pectinesterase 3                        153   2e-37   
sp|Q43111.1|PME3_PHAVU  RecName: Full=Pectinesterase 3; Short=PE ...    152   2e-37   
ref|XP_009135128.1|  PREDICTED: putative pectinesterase/pectinest...    152   2e-37   
ref|XP_006828611.1|  hypothetical protein AMTR_s00129p00070300          153   2e-37   
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g             152   2e-37   
ref|XP_009606551.1|  PREDICTED: pectinesterase 3                        152   2e-37   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          152   2e-37   
ref|NP_187682.1|  root hair specific 12                                 152   3e-37   
ref|XP_007012507.1|  Pectinesterase, putative                           152   3e-37   
gb|KHN10316.1|  Putative pectinesterase/pectinesterase inhibitor 24     152   3e-37   
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     152   3e-37   
ref|XP_003541560.1|  PREDICTED: putative pectinesterase/pectinest...    152   3e-37   
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    152   3e-37   
gb|KDP34079.1|  hypothetical protein JCGZ_07650                         152   3e-37   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     152   3e-37   
gb|KDO53809.1|  hypothetical protein CISIN_1g036226mg                   152   4e-37   
ref|XP_010917367.1|  PREDICTED: pectinesterase 3 isoform X1             152   4e-37   
ref|XP_002882691.1|  pectinesterase family protein                      152   4e-37   
ref|XP_010917368.1|  PREDICTED: pectinesterase 3 isoform X2             152   4e-37   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         151   4e-37   
ref|XP_003547912.1|  PREDICTED: pectinesterase 3                        152   4e-37   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     151   5e-37   
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...    151   5e-37   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          151   5e-37   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     151   5e-37   
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     151   6e-37   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    151   6e-37   
ref|XP_002461260.1|  hypothetical protein SORBIDRAFT_02g043780          151   7e-37   
ref|XP_009773400.1|  PREDICTED: pectinesterase 1                        151   8e-37   
ref|XP_006407517.1|  hypothetical protein EUTSA_v10020407mg             150   8e-37   
ref|XP_010486686.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    150   9e-37   
ref|XP_004308181.1|  PREDICTED: probable pectinesterase/pectinest...    150   9e-37   
ref|XP_003591166.1|  Pectinesterase                                     150   1e-36   
gb|AFI23414.1|  pectin methylesterase                                   150   1e-36   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     150   1e-36   
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...    150   1e-36   
gb|EPS58111.1|  pectinesterase                                          147   1e-36   
gb|KDP40628.1|  hypothetical protein JCGZ_24627                         150   1e-36   
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g             153   1e-36   
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     149   2e-36   
gb|EYU38316.1|  hypothetical protein MIMGU_mgv1a023297mg                149   2e-36   
emb|CDO97788.1|  unnamed protein product                                150   2e-36   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             149   2e-36   
ref|XP_008460354.1|  PREDICTED: pectinesterase 3                        149   2e-36   
gb|KDO37799.1|  hypothetical protein CISIN_1g046024mg                   149   2e-36   
ref|XP_008227793.1|  PREDICTED: pectinesterase                          149   2e-36   
ref|XP_003604119.1|  Pectinesterase                                     149   3e-36   
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                   149   3e-36   
ref|XP_003627449.1|  Pectinesterase                                     149   3e-36   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    149   4e-36   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             149   4e-36   
ref|XP_007221469.1|  hypothetical protein PRUPE_ppa003369mg             149   4e-36   
ref|XP_004144445.1|  PREDICTED: pectinesterase 3-like                   149   4e-36   
gb|KFK38796.1|  hypothetical protein AALP_AA3G161400                    149   5e-36   
gb|KFK38463.1|  hypothetical protein AALP_AA3G116200                    148   5e-36   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    148   6e-36   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    148   7e-36   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    148   7e-36   
gb|ABO80931.1|  Pectinesterase; Pectinesterase inhibitor                146   7e-36   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    147   1e-35   
ref|XP_004252915.1|  PREDICTED: pectinesterase                          147   1e-35   
ref|XP_010029513.1|  PREDICTED: pectinesterase 3-like                   147   1e-35   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    147   1e-35   
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             146   1e-35   



>dbj|BAA89480.1| pectin methylesterase [Salix gilgiana]
Length=596

 Score =   308 bits (789),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 201/388 (52%), Positives = 263/388 (68%), Gaps = 17/388 (4%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             M FQDFD +SERR+ ER++KL+ KI IA V  +   V + A VF  V   +        G
Sbjct  1     MVFQDFDQLSERRRLERQQKLRKKIIIASVSSIAFFVIVGAGVFSLVSNHDISSPGNNGG  60

Query  280   TKSKTT-PLDSGK---SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRIS  447
             + S  T P +  K    V   +K +C+ T ++DTC+ TL       D +  +PK+LL+I+
Sbjct  61    SPSAATRPAEKAKPISHVARVIKTVCNATTYQDTCQNTLEKGVLGKDPSSVQPKDLLKIA  120

Query  448   MVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSS  627
             + AA +E+DK +KK+   K D P +KAA  DC EL++DAK++L  ++  I G+ IG  +S
Sbjct  121   IKAADEEIDKVIKKASSFKFDKPREKAAFDDCLELIEDAKEELKNSVDCI-GNDIGKLAS  179

Query  628   HAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF  807
             +A DL NWLSAVM+YQ TCIDGFP+G+ K+ MEK+ K  +EL SN+LA+VS L S L  F
Sbjct  180   NAPDLSNWLSAVMSYQQTCIDGFPEGKLKSDMEKTFKATRELTSNSLAMVSSLVSFLKNF  239

Query  808   EPSESHAKRRLLA----------DGVPEWMNDEQRRMLK-ADIPKQPPNATVAKDGSGKF  954
               S +   RRLLA          DGVP WM+ E RR+LK AD  K  PN +VAKDGSG F
Sbjct  240   SFSGT-LNRRLLAEEQNSPSLDKDGVPGWMSHEDRRILKGADKDKPKPNVSVAKDGSGDF  298

Query  955   STINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
              TI+ AL AMPAKY+GRYVIFVK G+YDE+V VTKKM N+TMYGDGSQKTIVTG K+ AD
Sbjct  299   KTISEALAAMPAKYEGRYVIFVKQGVYDETVTVTKKMANITMYGDGSQKTIVTGNKNFAD  358

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G+ T++TATFAV+G+GF+ +F+GFRNTA
Sbjct  359   GVQTFRTATFAVLGDGFLCKFMGFRNTA  386



>gb|EYU28291.1| hypothetical protein MIMGU_mgv1a003232mg [Erythranthe guttata]
Length=598

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 200/391 (51%), Positives = 275/391 (70%), Gaps = 24/391 (6%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFDLIS+RR+ E+++KL+ ++ IA V ++ LL+  AA +   V+V +K++ H  + 
Sbjct  1     MAFQDFDLISQRRQQEKKQKLRRRLTIAAVSVVTLLLIAAATIC--VLVYQKNE-HVTTE  57

Query  280   TKSKT----------------TPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDS  411
               +K                 T + S     ++VK +C  TD++ TCE +L  A +D+ +
Sbjct  58    QNTKASPATPSSSSASATTKPTTVASVNVAEKAVKTVCASTDYKQTCEDSLLKAVKDNHT  117

Query  412   APKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIA  591
             A  +P+++LR S   A  E+D  +KK+  +K D P KKAA  DC  LLKDAK++L+T+I+
Sbjct  118   A--QPQDILRASFAVAAAEIDDVIKKAAALKFDDPFKKAAFNDCMVLLKDAKEELNTSIS  175

Query  592   SIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALA  771
             S+ G  +   S+   +++NWLSAV++YQ TCIDGFP+GEEKT+M+K LKT +ELGSNALA
Sbjct  176   SVTGKDLTKISTLKPEINNWLSAVLSYQQTCIDGFPEGEEKTSMQKMLKTFRELGSNALA  235

Query  772   IVSQLASVLSTFEPSESHAKRRLLADG-VPEWMNDEQRRMLKADIP-KQPPNATVAKDGS  945
             IVSQ++S+ S F   E+H K   + DG  P W+N++ RR+LKA  P K  PN TVAKDGS
Sbjct  236   IVSQVSSIFSAF-GDEAHRKLVSVDDGEFPTWVNNDLRRLLKAGGPNKFTPNVTVAKDGS  294

Query  946   GKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKS  1125
             G F+TI+ AL AMP KY GRYVI+VK G+YDESV VTK+M NVTMYGDGSQK+I+TGKK+
Sbjct  295   GDFTTISKALGAMPKKYSGRYVIYVKEGVYDESVTVTKEMENVTMYGDGSQKSIITGKKN  354

Query  1126  LADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
               DG+ T+QTATFA +G+GFMAQ +GFRNTA
Sbjct  355   YVDGVPTFQTATFAALGDGFMAQSLGFRNTA  385



>ref|XP_002324181.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEF02746.2| pectinesterase family protein [Populus trichocarpa]
Length=593

 Score =   303 bits (776),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 197/395 (50%), Positives = 269/395 (68%), Gaps = 35/395 (9%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMV----MEKDDGH  267
             M FQDFDL+SERR+ ER++KL+ KIAIA V  +           +FV+V    +     H
Sbjct  1     MVFQDFDLLSERRRLERQQKLRKKIAIAAVSGIA----------FFVIVGAGVLALVSNH  50

Query  268   KRS----GTKSKTTPLDSGKS---VGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKP  426
             K S    G  +   P++S K    V   +K +C+ T +++TC++TL    E D S  + P
Sbjct  51    KSSPGNNGGSAVPQPVESAKPISRVSRVIKTVCNATTYQETCQKTLEKEVEKDPSLAQ-P  109

Query  427   KELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGD  606
             K LL+I++ AA +E+ K +KK+   K D P +KAA +DC EL+++AK++L  ++A + GD
Sbjct  110   KNLLKIAIKAADEEIKKVLKKASSFKFDDPREKAAFEDCLELVENAKEELKDSVAHV-GD  168

Query  607   KIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQL  786
              +G  + +A DL+NWLSAVM+YQ TCIDGFP+G+ K+ MEK+ K +KEL SN+LA+VS L
Sbjct  169   DLGKLAKNAPDLNNWLSAVMSYQQTCIDGFPEGKLKSDMEKTFKASKELTSNSLAMVSSL  228

Query  787   ASVLSTFEPSESHAKRRLLA----------DGVPEWMNDEQRRMLKADIPKQP-PNATVA  933
              S + +F P  +   RRLLA          D +P WM++E RR+LK     +P PN TVA
Sbjct  229   TSFMKSF-PFPAALNRRLLAKEDNSPALNKDDLPGWMSNEDRRILKGASKDKPKPNVTVA  287

Query  934   KDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVT  1113
             KDGSG F TI+ AL AMPAKY+GRYVIFVK GIYDE+V VTKKM N+T+YGDGSQKTIVT
Sbjct  288   KDGSGDFKTISEALAAMPAKYEGRYVIFVKQGIYDETVTVTKKMSNITIYGDGSQKTIVT  347

Query  1114  GKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G K+ ADG+ T++TATFAV+G+GF+ + +GFRNTA
Sbjct  348   GNKNFADGVQTFRTATFAVLGDGFLCKAMGFRNTA  382



>ref|XP_006381543.1| hypothetical protein POPTR_0006s13690g [Populus trichocarpa]
 gb|ERP59340.1| hypothetical protein POPTR_0006s13690g [Populus trichocarpa]
Length=595

 Score =   301 bits (772),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 264/388 (68%), Gaps = 18/388 (5%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             M FQDFD +SERRK ER++KL+ KI I  V  +   V + A VF  V            G
Sbjct  1     MVFQDFDQLSERRKLERQQKLRKKIIIGSVSSIAFFVIVGAGVFALVSNHNISSPGSNGG  60

Query  280   TKSKTT-PLDSGK---SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRIS  447
             + S  + P++S K    V   +K +C+ T ++DTC+ TL   G   D +  +PK+LL+I+
Sbjct  61    SPSTVSQPVESAKPTSHVARVIKTVCNATTYQDTCQNTLE-KGMRKDPSSVQPKDLLKIA  119

Query  448   MVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSS  627
             + AA KE++K +KK+   K D P +KAA  DC EL++DAK++L   I  + G+ IG  + 
Sbjct  120   IKAADKEIEKVLKKASSFKFDKPREKAAFDDCLELIEDAKEELKHCIDRV-GNDIGKLTK  178

Query  628   HAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF  807
             +A DL+NWLSAVM+YQ TCIDGFP+G+ K+ MEK+ K A+EL SN+LA+VS LAS L  F
Sbjct  179   NAPDLNNWLSAVMSYQQTCIDGFPEGKLKSDMEKTFKAARELTSNSLAMVSSLASFLKNF  238

Query  808   EPSESHAKRRLLA----------DGVPEWMNDEQRRMLK-ADIPKQPPNATVAKDGSGKF  954
               S +   RRLLA          DG+P W + E RR+LK A+  K  P+ TVAKDGSG F
Sbjct  239   SFSGT-LNRRLLAEEYNSPSLDKDGLPGWTSHEDRRILKGANQDKPKPHVTVAKDGSGDF  297

Query  955   STINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
              TI+ AL AMPAKY+GRYVIFVK GIYDE+V VTKKMVN+TMYGDGSQKTIVTG K+ AD
Sbjct  298   KTISEALAAMPAKYEGRYVIFVKQGIYDETVTVTKKMVNITMYGDGSQKTIVTGNKNFAD  357

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G+ T++TATFAV+GEGF+ + +GFRNTA
Sbjct  358   GVQTFRTATFAVLGEGFLCKAMGFRNTA  385



>ref|XP_011015792.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 45 [Populus euphratica]
Length=593

 Score =   300 bits (769),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 195/387 (50%), Positives = 266/387 (69%), Gaps = 19/387 (5%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             M FQDFDL+SERR++ER++KL+ KIAIA V  +   V + A VF  V   +   G+  +G
Sbjct  1     MVFQDFDLLSERRRSERQQKLRKKIAIAAVSGIAFFVIVGAGVFALVSSHKSSPGN--NG  58

Query  280   TKSKTTPLDSGKSVGES---VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISM  450
               +   P +S K +      +K +C+ T +++TC++TL    E D S+ + PK LL+I++
Sbjct  59    GSAVPQPEESAKPISRVTRVIKTVCNATTYQETCQKTLEKEVEKDPSSAQ-PKNLLKIAI  117

Query  451   VAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSH  630
              AA +E+ K +KK+   K D P +KAA +DC EL+++AK++L  ++A + GD +G    +
Sbjct  118   KAADEEIKKVLKKASSFKFDDPREKAAFEDCLELVENAKEELKDSVAHV-GDDLGKLVKN  176

Query  631   AADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE  810
             A DL+NWLSAVM+YQ TCIDGFP+G+ K+ MEK+ K +KE  SN+LA+VS L S +  F 
Sbjct  177   APDLNNWLSAVMSYQQTCIDGFPEGKLKSDMEKTFKASKEFTSNSLAMVSSLTSFMKNF-  235

Query  811   PSESHAKRRLLA----------DGVPEWMNDEQRRMLKADIPKQP-PNATVAKDGSGKFS  957
             P      RRLLA          D +P WM++E RR+LK     +P PN TVAKDGSG F 
Sbjct  236   PFPGALNRRLLAKEDNSPALNKDDLPGWMSNEDRRILKGASKDKPKPNVTVAKDGSGDFK  295

Query  958   TINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADG  1137
             TI+ AL AMPAKY+GRYVIFVK GIYDE+V VTKKM N+T+YGDGSQKTIVTG K+ ADG
Sbjct  296   TISEALAAMPAKYQGRYVIFVKQGIYDETVTVTKKMANITIYGDGSQKTIVTGNKNFADG  355

Query  1138  LSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             + T++TATFAV G+GF+ + +GFRNTA
Sbjct  356   VQTFRTATFAVXGDGFLCKTMGFRNTA  382



>ref|XP_011005056.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Populus euphratica]
Length=595

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 201/388 (52%), Positives = 264/388 (68%), Gaps = 18/388 (5%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVME-KDDGHKRS  276
             M FQDFD +SERR+ ER++KL+ KI I  V  +   V + A VF  V        G    
Sbjct  1     MVFQDFDQLSERRRLERQQKLRKKIIIGSVSSIAFFVIVGAGVFALVSNQNISSPGSNGG  60

Query  277   GTKSKTTPLDSGK---SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRIS  447
              + + + P++S K    V   +K +C+ T ++DTC+ TL   G   D +  +PK+LL+I+
Sbjct  61    SSSTVSQPVESAKPTSHVARVIKTVCNATTYQDTCQNTLE-KGVGKDPSSVQPKDLLKIA  119

Query  448   MVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSS  627
             + AA KE++K +KK+   K D P +KAA  DC EL+KDAK++L   I  + G+ IG  + 
Sbjct  120   IKAADKEIEKVLKKASSFKFDKPREKAAFDDCLELIKDAKEELKHCIDRV-GNDIGKLTK  178

Query  628   HAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF  807
             +A DL+NWLSAVM+YQ TCIDGFP+G+ K+ MEK+ K A+EL SN+LA+VS LAS L  F
Sbjct  179   NAPDLNNWLSAVMSYQQTCIDGFPEGKLKSDMEKTFKPARELTSNSLAMVSSLASFLKNF  238

Query  808   EPSESHAKRRLLAD----------GVPEWMNDEQRRMLK-ADIPKQPPNATVAKDGSGKF  954
               S +   RRLLAD          G+P W + E RR+LK A+  K  P+ TVAKDGSG F
Sbjct  239   SFSGT-LNRRLLADEYNSPSLDKDGLPGWTSHEDRRILKGANQDKPKPHVTVAKDGSGDF  297

Query  955   STINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
              TI+ AL AMPAKY+GRYVIFVK GIYDE+V VTKKMVN+TMYGDGSQKTIVTG K+ AD
Sbjct  298   KTISEALAAMPAKYEGRYVIFVKQGIYDETVTVTKKMVNITMYGDGSQKTIVTGNKNFAD  357

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G+ T++TATFAV+GEGF+ + +GFRNTA
Sbjct  358   GVQTFRTATFAVLGEGFLCKAMGFRNTA  385



>ref|XP_010047427.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Eucalyptus grandis]
Length=590

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 188/385 (49%), Positives = 268/385 (70%), Gaps = 19/385 (5%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFDL+SERR+AER++K++ ++AIAVV  L +   +A  +   + V+++  G   + 
Sbjct  1     MAFQDFDLLSERRQAERKQKMRKRVAIAVVSSLAIAGVVAGVI---IAVVQRSGGSSSAA  57

Query  280   TKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAA  459
               ++  P        + +K +C  TD+ DTC+ T   A + + +  + PK+LL++++ A 
Sbjct  58    NATQAEPTSQISHSQKMIKMICSSTDYRDTCKSTFDKAVKSEKNLTQ-PKDLLKVAIGAT  116

Query  460   GKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD  639
               E+ +A  K+ + K ++P +KAA +DC +LL+DA ++L ++++++ GD IG FSS   D
Sbjct  117   FDEVKEAFDKTKKFKFNSPQEKAAFEDCKQLLEDAVEELHSSVSNL-GDSIGKFSSKTPD  175

Query  640   LDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE  819
             L+NWLSA ++YQ +C+DGFPDG+ KT M+K+LK AKEL SN+LAI+S+++S L+TF+   
Sbjct  176   LNNWLSAAISYQHSCVDGFPDGKLKTEMQKTLKIAKELTSNSLAIISEVSSFLTTFQIP-  234

Query  820   SHAKRRLLA-----------DGVPEWMNDEQRRMLKADI-PKQPPNATVAKDGSGKFSTI  963
               A R LL            DG+P WMN E+RR+LK     K  PN  VAKDGSGKF TI
Sbjct  235   -GATRHLLEKEASGLPAVGEDGLPSWMNQEERRILKGKRGVKLTPNVVVAKDGSGKFKTI  293

Query  964   NAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLS  1143
             + AL A+P KY GRYVI++KAGIYDE + VTKKMVNVTMYGDGSQKTIVTG K+  DG+ 
Sbjct  294   SEALAALPEKYTGRYVIYIKAGIYDEYITVTKKMVNVTMYGDGSQKTIVTGNKNFVDGVR  353

Query  1144  TYQTATFAVVGEGFMAQFIGFRNTA  1218
             T+QTA+FA +G+GFMAQ +GFRNTA
Sbjct  354   TFQTASFAALGDGFMAQAMGFRNTA  378



>ref|XP_011078157.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=590

 Score =   289 bits (739),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 270/383 (70%), Gaps = 16/383 (4%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFDLIS+RR+ ERR+K + KI IAV L +++L+  AAAV   +    +D   K S 
Sbjct  1     MAFQDFDLISQRRQEERRQK-KKKIIIAVTLSVLILLIAAAAVAVVLHQNNQDVNTKESH  59

Query  280   T---KSKTTPLD--SGKSVGESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKPKELLR  441
                 K K    D  S +   + VK +C  TD++ TCE +L  +    + S+    + +LR
Sbjct  60    KDPPKPKAVASDEKSDEKNEKVVKTVCATTDYQKTCEESLLKSIKSVNPSSTSLHENILR  119

Query  442   ISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNF  621
              +  AA  E+DKAVKK+ ++K + PLKK A +DC ELL+DAK++L+++ A IKG  +G  
Sbjct  120   AAFSAASDEIDKAVKKASDLKFNGPLKKKAFEDCLELLEDAKEELNSSSAFIKGKDMGKL  179

Query  622   SSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLS  801
             SS   +++NWLSAV+TYQ TCIDGFPDGEEKT+M+K L T+KE GSNALAIV++L++ L 
Sbjct  180   SSITPEINNWLSAVLTYQQTCIDGFPDGEEKTSMQKLLNTSKEHGSNALAIVAELSTTLK  239

Query  802   TFEPSESHAKRRLLA---DGVPEWM-NDEQRRMLKADIPKQPPNATVAKDGSGKFSTINA  969
             T +     ++R+LL     G P WM + E RR LKAD  K  PN TVAKDGSG F+TI A
Sbjct  240   TVQ-----SQRKLLGMDEAGFPAWMGHHEYRRALKADATKFTPNVTVAKDGSGNFTTIAA  294

Query  970   ALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTY  1149
             ALKAMP KY GRYVI++K G+YDE+V++TKKMVNVTMYG GSQK+I+TG K+  DG+ TY
Sbjct  295   ALKAMPEKYTGRYVIYIKEGVYDENVIITKKMVNVTMYGVGSQKSIITGSKNYVDGVPTY  354

Query  1150  QTATFAVVGEGFMAQFIGFRNTA  1218
             QTA+FA +G+GFMAQ +GFRNTA
Sbjct  355   QTASFAAIGDGFMAQSLGFRNTA  377



>gb|EPS66234.1| hypothetical protein M569_08543 [Genlisea aurea]
Length=598

 Score =   281 bits (720),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 195/400 (49%), Positives = 270/400 (68%), Gaps = 42/400 (11%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFDLIS+RR+ +RR+KL+ +I  AVV  +++L+ + AA+   V+         +S 
Sbjct  1     MAFQDFDLISQRREQQRREKLRRRITTAVVSSVVVLLVVGAAMGAAVI---------KSN  51

Query  280   TKSKTTPLDSGK----------------------SVGESV-KALCHGTDFEDTCERTLST  390
              +S  +  ++ K                      +V E+V K +C   D++ TCE +L  
Sbjct  52    NESDVSLSENNKSHHPSSPSSSSHSPSSSSSPSPNVAEAVAKRVCSVVDYKKTCEGSLLK  111

Query  391   AGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakd  570
               +  D A  KP+ +++ S+  A KE+  A+ +S E++ DTP KKAA  DC  LL DA +
Sbjct  112   QVKGKDEA--KPEAIVKASLSVALKEVGGAMNRSREIEFDTPFKKAAFNDCLVLLNDAVE  169

Query  571   dldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKE  750
             +L+ +I+SI+G   G  SS   ++ NWLSAV++YQ TCIDGFPDG EK  M+K L T+KE
Sbjct  170   ELNASISSIEG---GGLSSATPEIKNWLSAVLSYQQTCIDGFPDGAEKDKMQKLLNTSKE  226

Query  751   LGSNALAIVSQLASVLSTFEPSESHAKRRLLA--DG--VPEWMNDEQRRMLKADIPKQPP  918
             LGSNALA+V+Q +++      S+S ++RRLLA  DG  VP+W++ E RR+LK+   K  P
Sbjct  227   LGSNALAVVTQASAIFKALRGSKS-SERRLLASDDGFVVPDWVDPESRRVLKSKESKFTP  285

Query  919   NATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQ  1098
             NATVAKDG+G F+TI AAL A+P K+KGRYVI++K GIYDESVVV+KKM N+TMYGDGSQ
Sbjct  286   NATVAKDGTGNFTTIAAALDAIPEKFKGRYVIYIKEGIYDESVVVSKKMQNITMYGDGSQ  345

Query  1099  KTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             K+I+TG K+  DG+ TYQTATFAVVG+GF+ Q +GFRNTA
Sbjct  346   KSIITGNKNYVDGVPTYQTATFAVVGDGFLGQSLGFRNTA  385



>ref|XP_011093900.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=586

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 183/377 (49%), Positives = 251/377 (67%), Gaps = 9/377 (2%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD IS+RRK ER+++L+ K     V  ++ ++ +AAA F  V      D   R  
Sbjct  1     MAFQDFDQISQRRKLERQQRLK-KRLSIAVSSIVFVLLVAAAAFCVVKYKNNQDTAARKD  59

Query  280   TKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAA  459
             + S++       +  E VKA+C GTD++ TCE ++  A   + S   +PK++++ S   A
Sbjct  60    SDSQSPGPSKPSAAEEEVKAVCAGTDYKQTCEDSILKAVAKNSSP--QPKDIVKASFAVA  117

Query  460   GKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD  639
               E+++  K++  +K     K+AA +DC  LL DA D+L+ +I+SI+G      SS   D
Sbjct  118   SDEINRVSKEASALKYSDKFKQAALEDCLVLLNDAVDELNRSISSIQGTDKAALSSKTPD  177

Query  640   LDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS-  816
             ++NWLSAV++Y+ TCIDGFPDG+EK AM+K L  +KE GSNALAIVS + S+ +  + S 
Sbjct  178   INNWLSAVLSYEQTCIDGFPDGDEKAAMKKLLTNSKEHGSNALAIVSNVFSIFAKLKGSG  237

Query  817   ESHAKRRLL---ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMP  987
              SH  R+LL    DG P WM+ E RR L AD  K  PN TVAKDGSG ++TI+ AL AMP
Sbjct  238   PSH--RKLLGLDVDGYPTWMSLENRRNLGADPSKFTPNVTVAKDGSGNYTTISEALDAMP  295

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFA  1167
               YKGRYVI+VK G+YDE+VVV K MVN+T++GDGSQK++VTG K+  DG  T++TAT A
Sbjct  296   KTYKGRYVIYVKVGVYDETVVVKKTMVNLTIFGDGSQKSVVTGSKNYVDGAPTFRTATCA  355

Query  1168  VVGEGFMAQFIGFRNTA  1218
             V+GEGF AQ IGF+NTA
Sbjct  356   VLGEGFFAQSIGFKNTA  372



>ref|XP_002516193.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF46195.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=593

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 194/390 (50%), Positives = 272/390 (70%), Gaps = 25/390 (6%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             M FQDFD ISERR+ ER++K + ++ IA V +  LLV +AA VF  +     ++ HK+S 
Sbjct  1     MVFQDFDQISERRRLERQQKFRKRVTIAAVAVFALLVVVAAGVFAII----SNNNHKQSQ  56

Query  280   TK-SKTT----PLDSGKS-VGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLR  441
              + SK+T    P +S  S +G+ +  +C+ T +++TC  +L  A E D S+   PK++L+
Sbjct  57    QQHSKSTQSQKPDNSEVSHLGKVIDNVCNATTYKETCHTSLKKAVEKDPSSAH-PKDVLK  115

Query  442   ISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNF  621
             +++ +   E  + ++K    K ++P +KAA +DC EL+ DAK++L+ +I+S  GD  G  
Sbjct  116   LAIGSTEDEFARILEKVKSFKFESPREKAAFEDCKELIDDAKEELNKSISSAGGD-TGKL  174

Query  622   SSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLS  801
               + ADL+NWLSAVM+YQ TCIDGFP+G+ K+ MEK+ K AKEL SN+LA+VS+L + L+
Sbjct  175   LKNEADLNNWLSAVMSYQQTCIDGFPEGKLKSDMEKTFKEAKELTSNSLAMVSELTAFLT  234

Query  802   TFEPSESHAKRRLLA----------DGVPEWMNDEQRRMLK-ADIPKQPPNATVAKDGSG  948
              F  S     RRLLA          DG+P W++ E RR+LK +D  K  PN TVAKDGSG
Sbjct  235   AF--SVPKPSRRLLAKESNTSSFGEDGIPSWISPEDRRILKGSDGDKPTPNVTVAKDGSG  292

Query  949   KFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSL  1128
             +F TI+ AL AMP KY+GRYVI+VKAGIYDE+V VTK MVNVT+YGDGSQK+IVTG K+ 
Sbjct  293   QFKTISDALAAMPEKYQGRYVIYVKAGIYDETVTVTKNMVNVTIYGDGSQKSIVTGSKNF  352

Query  1129  ADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             ADG+ T++TATFA +G+GF+A+ +GFRNTA
Sbjct  353   ADGVQTFRTATFAALGDGFIAKAMGFRNTA  382



>emb|CDP19930.1| unnamed protein product [Coffea canephora]
Length=592

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 195/392 (50%), Positives = 261/392 (67%), Gaps = 33/392 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFY------FVMVMEKDD  261
             MAFQDFDLIS+RR+ ER++KL+ +I IAVV   +L +  AAAV              ++ 
Sbjct  1     MAFQDFDLISQRRENERKRKLKRRITIAVVATTVLALVAAAAVCAVVYKDRLYPNSSQNH  60

Query  262   GHKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLR  441
             G+        T P  S     ++VK +C  TD++ TCE  L  A + + SA  +PK+LL+
Sbjct  61    GNAHPAHHPPTQPAQS--PAQKAVKTICASTDYKQTCEDNLFKAVKANASA-LQPKDLLK  117

Query  442   ISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNF  621
              SM A  + +D A+K    V  D P  K A   C  LL DAK++L+++I+SI  DK    
Sbjct  118   ASMTAISRGIDLAMKIGSSVHFDDPKTKIAFDFCMTLLGDAKEELNSSISSID-DK----  172

Query  622   SSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVS--QLASV  795
             +S+A DL+NWLSAVM+YQ +CIDG+P+G  K+ +E +LK++KEL SN+LA+VS  QLAS 
Sbjct  173   TSNAGDLNNWLSAVMSYQQSCIDGYPNGTIKSQLESTLKSSKELTSNSLAMVSLSQLASF  232

Query  796   LSTFEPSESHAKRRLLA----------DGVPEWMND-EQRRMLKADIPKQPPNATVAKDG  942
               T        KRRLL           +G+P W+ND E+RR+LK +   Q PNATVAKDG
Sbjct  233   HGT------SIKRRLLTKGSGIPSLDEEGLPRWLNDQERRRILKDNTTFQHPNATVAKDG  286

Query  943   SGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKK  1122
             SG ++TINAAL A+P+ Y GRYVI+VKAG+Y+E+V VTKKMVNVT+YGDGSQK+IVTG K
Sbjct  287   SGNYTTINAALAAIPSNYTGRYVIYVKAGVYEETVTVTKKMVNVTIYGDGSQKSIVTGSK  346

Query  1123  SLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +  DG+ T+ TATF+ +G+GFMAQ IGFRNTA
Sbjct  347   NYVDGVPTFLTATFSALGDGFMAQSIGFRNTA  378



>ref|XP_007203102.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
 gb|EMJ04301.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
Length=596

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 253/388 (65%), Gaps = 21/388 (5%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD ISERRKAER +K++ +I IAVV++++L++    A      +  K    K+  
Sbjct  1     MAFQDFDQISERRKAERARKMRKRIIIAVVVVVLLILIAVGAYLLLNKLNSKKGNAKQDK  60

Query  280   T-KSKTTPL------DSGK----SVGESV-KALCHGTDFEDTCERTLSTAGEDDDSAPKK  423
             T  SK  P       D  K    + GE + K +C  TD+ED CE  +  A         K
Sbjct  61    TANSKPAPAKAQPKNDQAKKKEPTKGEKIMKQMCGATDYEDKCESIIGKA-----KGASK  115

Query  424   PKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKG  603
             PKE ++ ++ AA  E   A  KS E+  ++P +K A +DC  L +DA D+L  AI+ I G
Sbjct  116   PKEFIKTAISAASDEARIAYSKSSELTFNSPEEKGAFEDCKVLFEDAMDELGDAISQI-G  174

Query  604   DKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQ  783
             +   +       L+ WLSAV++YQ TC+DGFPDG+ K+ +EK L+ +KE  SN+LA++S 
Sbjct  175   NTTASGKIRTGLLNTWLSAVISYQQTCVDGFPDGKLKSDLEKMLQASKEFTSNSLAMLSL  234

Query  784   LASVLSTFEPSESHAKRRLLA---DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKF  954
             L+        + S AKRRLLA   DG P WM+ E+RR+LK +  K  PN TVAKDGSG F
Sbjct  235   LSQFQLPVTAAVSGAKRRLLAQNKDGFPTWMSHEERRVLKKNDEKPTPNVTVAKDGSGNF  294

Query  955   STINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
              TI+ AL AMPAKY+GRY+I+VK G+YDE+V+VTKKM NVT+YGDGSQK+I+TG K+ AD
Sbjct  295   KTISEALAAMPAKYEGRYIIYVKGGVYDETVIVTKKMPNVTIYGDGSQKSIITGNKNFAD  354

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G+ T+QTA+FA +GEGFMA+ +GFRNTA
Sbjct  355   GVRTFQTASFAALGEGFMAKSMGFRNTA  382



>ref|XP_007154534.1| hypothetical protein PHAVU_003G126700g [Phaseolus vulgaris]
 gb|ESW26528.1| hypothetical protein PHAVU_003G126700g [Phaseolus vulgaris]
Length=605

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 181/399 (45%), Positives = 251/399 (63%), Gaps = 32/399 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRS-  276
             MAFQDFDLISERR+ E+++K  M+  I + ++  +++        FV+V   D G+ +S 
Sbjct  1     MAFQDFDLISERRRNEKKQK--MRKRIMIGVVSSIVLVGMIGAVLFVVVKNDDAGNNKST  58

Query  277   GTKSKTT---PLDSGKSVGESV-------KALCHGTDFEDTCERTLSTAGEDDDSAPK--  420
               KS+T+   P   G S  E V       + +C   DF+D CE  L+ A +DD   PK  
Sbjct  59    NNKSRTSHSPPHSEGGSPKEHVAHSEKIVQVVCSSADFKDRCEAPLNKAMQDD---PKLS  115

Query  421   KPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIK  600
             +PK+LL+I +  A +E+ KA   +  VK D+  +K A +DC +L +DAKDD+ T+I+ + 
Sbjct  116   EPKDLLKIYVKLAEEELSKAFNSTKSVKFDSEEEKGAFEDCQKLFEDAKDDIATSISELS  175

Query  601   GDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVS  780
               ++ N S    DL++WLSAV+++Q TC+DGFP+G  KT +   +  +KE  SN+LAI+S
Sbjct  176   KTELKNISDKTPDLNSWLSAVISFQQTCMDGFPEGNIKTELHNLMNDSKEFVSNSLAILS  235

Query  781   QLASVLSTFEP--SESHAKRRLLA-----------DGVPEWMNDEQRRMLKADIPKQPPN  921
             Q+AS LST +   + SH  R LL+           DG P W+N E RR+LKA   K  PN
Sbjct  236   QVASALSTLQNIDAPSHG-RSLLSSNSPAATLDKTDGFPSWINQEDRRILKAVDNKPAPN  294

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
              TVAKDGSG F TI+  L A+P  Y+GRYVI+VK GIYDE V++TK M N+TMYGDGSQK
Sbjct  295   VTVAKDGSGNFKTISECLNAVPQNYEGRYVIYVKEGIYDEPVMITKNMQNITMYGDGSQK  354

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TIVTG K+  DG+  + TA+F V G+GF    +GFRNTA
Sbjct  355   TIVTGNKNFRDGVRVFLTASFVVEGDGFTGMAMGFRNTA  393



>ref|XP_008460558.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Cucumis melo]
Length=595

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 224/327 (69%), Gaps = 8/327 (2%)
 Frame = +1

Query  259   DGHKRSGTKSKTTPLDSGK--SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKE  432
             D    +G   K  P ++ +   V + +  +C+ TD++  CE TL   G   D     PK+
Sbjct  59    DSGSSTGNSKKPLPPETKQVSRVEKMITMICNSTDYKGKCESTLKD-GLHTDPNSSDPKD  117

Query  433   LLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKI  612
             L+++++ AA  E+  AVKK+      TP +K A +DC  LL+DA ++L+ +++ +    +
Sbjct  118   LIKLAISAAAHEVKSAVKKASGFNFATPEEKGAFEDCKVLLEDAVEELEMSMSEVSKKNM  177

Query  613   GNFSSHAA-DLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             G  ++    DL+NWLSAVM+Y +TC+DGFP+G+ K+ MEK +K  KEL SN+LA++SQ+A
Sbjct  178   GKLTAKTTPDLNNWLSAVMSYHETCVDGFPEGKMKSEMEKVVKAGKELTSNSLAMISQVA  237

Query  790   SVLSTFE-PSESHAKRRLLA-DGVPEWMNDEQRRMLK--ADIPKQPPNATVAKDGSGKFS  957
             S  STFE P  + ++RRL+A  GVP WMN  +RRMLK  A   K  PN  VAKDGSG+F 
Sbjct  238   SFFSTFEMPEGAASRRRLMATKGVPTWMNSNERRMLKGAAAGEKPKPNVVVAKDGSGEFK  297

Query  958   TINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADG  1137
             TIN AL AMPAKY GRYVI+VK GIYDE+VV+TKKMVNVTMYGDGSQK++++G K+  DG
Sbjct  298   TINEALAAMPAKYDGRYVIYVKEGIYDETVVITKKMVNVTMYGDGSQKSMISGSKNFVDG  357

Query  1138  LSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             + T+QTATF  +GEGF+ Q IGFRN A
Sbjct  358   VRTFQTATFVALGEGFLGQAIGFRNIA  384



>ref|XP_008242146.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=596

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 186/388 (48%), Positives = 255/388 (66%), Gaps = 21/388 (5%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD ISERRKAER +K++ +I IAVV++++L++    A      +  K    K+  
Sbjct  1     MAFQDFDQISERRKAERARKMRKRIIIAVVVVVLLILIAVGAYLLLNKLNSKKGNAKQDK  60

Query  280   T-KSKTTPL------DSGK----SVGESV-KALCHGTDFEDTCERTLSTAGEDDDSAPKK  423
             T  SK  P       D  K    + GE + K +C  TD++D CE   S  G+  D++  K
Sbjct  61    TANSKPAPAKAQPKNDQAKKKVPAKGEKIMKQMCGATDYKDKCE---SIIGKAKDAS--K  115

Query  424   PKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKG  603
             PKE ++ ++  A  E   A  KS E+  ++P +K A +DC  L +DA D+L  AI+ I G
Sbjct  116   PKEFIKTAISVASDEARIAYSKSSELTFNSPEEKGAFEDCKVLFEDAMDELGDAISQI-G  174

Query  604   DKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQ  783
             +   +       L+ WLSAV++YQ TC+DGFPDG+ K+ +EK L+ +KE  SN+LA++S 
Sbjct  175   NTTASGKIRTGLLNTWLSAVISYQQTCVDGFPDGKLKSDLEKMLQASKEFTSNSLAMLSL  234

Query  784   LASVLSTFEPSESHAKRRLLA---DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKF  954
             L+        + S AKRRLLA   D  P WM+ E+RR+LK +  K  PN TVAKDGSG F
Sbjct  235   LSQFQLPVTAAVSGAKRRLLAQNKDRFPTWMSHEERRVLKKNDEKPTPNVTVAKDGSGNF  294

Query  955   STINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
              TI+ AL AMPAKY+GRY+I+VK G+YDE+V+VTKKM NVT+YGDGSQK+I+TG K+ AD
Sbjct  295   KTISEALAAMPAKYEGRYIIYVKGGVYDETVIVTKKMPNVTIYGDGSQKSIITGNKNFAD  354

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G+ T+QTA+FA +GEGFMA+ +GFRNTA
Sbjct  355   GVRTFQTASFAALGEGFMAKSMGFRNTA  382



>gb|KDP33981.1| hypothetical protein JCGZ_07552 [Jatropha curcas]
Length=590

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 185/384 (48%), Positives = 256/384 (67%), Gaps = 16/384 (4%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             M FQDFD ISERR+ ER +K + +I IA + I++LLV +   VF  +   +     K S 
Sbjct  1     MVFQDFDQISERRRLEREQKFRKRITIAAITIVLLLVIIGCGVFAIISENKNTKRSKESS  60

Query  280   TKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAA  459
              +SK +  D  + V   ++ +C+GTD++DTC  +L +  + D S+   PK +LR+++ A 
Sbjct  61    QESKGSAKDVAQ-VDRVIRRICNGTDYKDTCVSSLESEVKKDPSSAN-PKAILRLAIEAT  118

Query  460   GKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD  639
               EM   +KK+   K ++P +KAA +DC  L+KDAK++L  ++    G  I   + +  +
Sbjct  119   DDEMGVVLKKASSFKFESPQEKAAFEDCKVLIKDAKEELKESLTH-AGVDIKKLAENEPE  177

Query  640   LDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE  819
             L+N LSAVM+YQ TCIDGFPDG+ K+ MEK+   +KEL SN+LA+VS L S LS+    E
Sbjct  178   LNNLLSAVMSYQQTCIDGFPDGKLKSDMEKTFNASKELTSNSLAMVSSLTSFLSS--FGE  235

Query  820   SHAKRRLLA----------DGVPEWMNDEQRRMLKADIPKQP-PNATVAKDGSGKFSTIN  966
              +  RRLLA          D +P W+++E RR+LKAD   +P PN  VAKDGSGKF TI+
Sbjct  236   INHSRRLLATKPNLSSMDKDELPSWISNEDRRILKADDSDKPTPNVIVAKDGSGKFKTIS  295

Query  967   AALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLST  1146
              ALKAMP KYKGRY+I+VKAG+YDE V V KKM N+TMYGDGSQK+I+TG K+  DG+ T
Sbjct  296   EALKAMPKKYKGRYIIYVKAGVYDEVVTVEKKMENITMYGDGSQKSIITGNKNFKDGVQT  355

Query  1147  YQTATFAVVGEGFMAQFIGFRNTA  1218
             ++TA+F  +G GFMA+ IGFRNTA
Sbjct  356   FRTASFVALGNGFMAKAIGFRNTA  379



>ref|XP_010273980.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Nelumbo nucifera]
Length=599

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 256/391 (65%), Gaps = 22/391 (6%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQ+F  +S RR+AER++KL+ ++ IA V+I++LL+ +AA VF  V + E+        
Sbjct  1     MAFQEFSQVSARRRAERQEKLRKRLTIAAVVIVVLLIIIAAGVFAIVYISERS--GSSKS  58

Query  280   TKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAA  459
             ++ +  P        + +K +C+ TD++  CE +L    +++ S+   PK+ LR S+V  
Sbjct  59    SQQEVKPKKDKSQRADRIKMICNPTDYQSVCESSLKKVLKNNASSTN-PKDALRASIVVT  117

Query  460   GKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD  639
               E++  + ++ + + +   ++ A +DC  LL+DAK++L  +I+++    +    S A D
Sbjct  118   LDEVENVLNQTSKFRFENKEEQGAYEDCKLLLQDAKEELQDSISTVSDKDVEMLPSKADD  177

Query  640   LDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE  819
             L+NWLSAV++YQ TCIDGFP+G+ KT M+K+L   K L SNALAIV++++S+LST + S 
Sbjct  178   LNNWLSAVISYQQTCIDGFPEGKSKTKMQKTLGNTKILTSNALAIVAEVSSILSTLQLSG  237

Query  820   SHAKRRLLA------------------DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGS  945
              + KRRLL                   DG+P WM+ E RRMLKA      PNA VAKDGS
Sbjct  238   GN-KRRLLQATSTSTSSSTSTSTSLGEDGLPNWMSHEDRRMLKARSVNLKPNAVVAKDGS  296

Query  946   GKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKS  1125
             G F TI+ AL  +P KY GRYVI+VKAG+YDE+V+VTK MVNVTMYGDGS K+IVTG K+
Sbjct  297   GDFKTISDALAKIPKKYTGRYVIYVKAGVYDETVIVTKDMVNVTMYGDGSMKSIVTGSKN  356

Query  1126  LADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
               DG+ T+QTATFA +GEGF A  +GFRNTA
Sbjct  357   FVDGIRTFQTATFAALGEGFTAMAMGFRNTA  387



>ref|XP_010526136.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Tarenaya hassleriana]
Length=597

 Score =   263 bits (672),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 170/388 (44%), Positives = 244/388 (63%), Gaps = 20/388 (5%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD I ER  AER++K + ++    V  L+++ A+    F +V   + ++      
Sbjct  1     MAFQDFDKIQERVNAERKRKFRKRVIAGSVSFLVVVAAIIGGAFAYVSYQKGNNISNNGN  60

Query  280   TKSKTTPLDSGKSVGESVK---------ALCHGTDFEDTCERTLSTAGEDDDSAPKKPKE  432
             T+SK T   S  S  +S+K          LC+ T ++  CE+TL    ++D S    PK 
Sbjct  61    TESKNTNQKSPVSATQSIKHVTFDKIVETLCNSTLYKQNCEKTLKDKAKNDTSLSN-PKA  119

Query  433   LLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKI  612
             L++ ++ A   ++D+ ++K   +K +    K A + C  L++DAK++L  + + +    +
Sbjct  120   LVKSAIEAVNVDLDRVLEKFPSLKIENEDDKHAIEQCKLLVEDAKEELAESASKMNDTNV  179

Query  613   GNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLAS  792
             GNF     DL+NWLSAVMTYQ+TC+DGF DGE K+ ++KS  +++ L SN+LA++  L +
Sbjct  180   GNFERIVPDLNNWLSAVMTYQETCLDGFEDGELKSDIQKSFNSSQILTSNSLAMIKSLEA  239

Query  793   VLSTFEPSESHAK-RRLL----ADGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKF  954
              LS    S S A  RRLL    +D +P W++ E+RRML+  D+    PNATVAKDGSG F
Sbjct  240   YLS----SGSKAPIRRLLESKSSDRIPSWVSHEERRMLRVVDVNLLKPNATVAKDGSGNF  295

Query  955   STINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
             +TIN AL AMP KY+GRY+I++K G+YDE+V + KK  N+TM GDGSQKTIVTG KS A 
Sbjct  296   TTINDALNAMPEKYEGRYIIYIKQGVYDETVTIDKKKANLTMVGDGSQKTIVTGNKSNAK  355

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  356   KIRTFLTATFVAQGEGFMAQSMGFRNTA  383



>ref|XP_010526019.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Tarenaya hassleriana]
Length=597

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 165/384 (43%), Positives = 245/384 (64%), Gaps = 12/384 (3%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMV---MEKDDGHK  270
             MAFQDFD I ER  AER++K + KI I  V +L+++ A+    F +V        ++GH 
Sbjct  1     MAFQDFDKIQERVNAERKRKFRKKIIIGSVSLLVVVAAVIGGAFAYVSYEKGKNNNNGHS  60

Query  271   RSGTKSKTTPLDSGKSVGES-----VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKEL  435
             ++   S+  P+ + +SV  +     V+ LC+ T +   CE+TL    ++D +    P+ L
Sbjct  61    QTANASQKPPVSAAQSVKHASLDQIVETLCNATLYRQNCEQTLHENAKNDTTL-SNPRAL  119

Query  436   LRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIG  615
             +R ++     ++DK ++K    +  +   K A   C  L+ +AK++L  +++ +    + 
Sbjct  120   VRSTIEEVKVDLDKVIEKVLGFETKSQEDKDAIAQCQLLVDEAKEELAESVSKVNETDVK  179

Query  616   NFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASV  795
             NF+    DL+NWLSAVM+YQ+TC+DGF DG+ K+ ++KS  +++ L SN+LA++  L S 
Sbjct  180   NFAKIVPDLNNWLSAVMSYQETCLDGFEDGKLKSNIQKSFNSSQILTSNSLAMIKSLDSY  239

Query  796   LSTFE--PSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTIN  966
             LS+    P+  H      +D +P W++ E RRML+A D+    PNA VAKDGSG F+TIN
Sbjct  240   LSSISNAPTTRHLLESKPSDQIPSWVSKEDRRMLRAVDVNVLKPNAIVAKDGSGNFTTIN  299

Query  967   AALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLST  1146
             AAL AMP KY+GRY+I++K GIYDE+V+V KK VN+TM GDGSQKTIVTG KS+A  + T
Sbjct  300   AALIAMPEKYEGRYIIYIKQGIYDETVIVDKKKVNLTMVGDGSQKTIVTGNKSVAKKIRT  359

Query  1147  YQTATFAVVGEGFMAQFIGFRNTA  1218
             + TATF   GEGFMAQ +GF+NTA
Sbjct  360   FLTATFVAQGEGFMAQSMGFKNTA  383



>ref|XP_007012506.1| Pectinesterase [Theobroma cacao]
 gb|EOY30125.1| Pectinesterase [Theobroma cacao]
Length=592

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 258/385 (67%), Gaps = 17/385 (4%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             M FQDFDLI ERR+ ER++K + ++ IAVV   +++  +AA +F  V    K+     + 
Sbjct  1     MVFQDFDLIQERRRLERQRKFRKRVGIAVVTTCVVIGLVAAGIFVIVSTKNKEQQGTSAN  60

Query  280   TKSKTTPLDSGKSVGES---VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISM  450
              K+   P  S K V  S   +  +C+GT ++++CE TL  A ++  +  + PK+LL+ S+
Sbjct  61    NKAHQAP--STKQVSRSEKLINTICNGTSYKESCESTLKKAVKEHPNTAQ-PKDLLKSSI  117

Query  451   VAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSH  630
              A   E+DKA  K+   + ++P +K A   C E++ +AK++L TAI  + GDK       
Sbjct  118   SATADELDKAFTKASSFQFNSPGEKQAFNVCKEVMANAKEELATAIGKV-GDKDTGKLLS  176

Query  631   AADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE  810
             + +L+NWLSAVM+YQ+TCID F DG+ KT ++ +L +++EL SN+LA+  QL+S +S+  
Sbjct  177   SGELNNWLSAVMSYQETCIDSFADGKLKTDIKSTLNSSQELTSNSLAMARQLSSHVSSVM  236

Query  811   PSESHAKRRLLA--------DGVPEWMNDEQRRMLK-ADIPKQPPNATVAKDGSGKFSTI  963
                + A R LL         DG+P W+N ++RR+LK AD+ K  PN TVAKDGSG FSTI
Sbjct  237   EMPA-ASRHLLESTSPSVDKDGLPNWLNHDERRLLKGADVEKPTPNVTVAKDGSGNFSTI  295

Query  964   NAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLS  1143
             + AL AMP KY GRYVI+VKAGIY+E+V+VTKKMVN+T+YGDGSQKTIVTG K+  DG+ 
Sbjct  296   SEALAAMPQKYDGRYVIYVKAGIYEETVLVTKKMVNLTIYGDGSQKTIVTGNKNYVDGVP  355

Query  1144  TYQTATFAVVGEGFMAQFIGFRNTA  1218
             TY TATF   G+GF+A+ +GFRNTA
Sbjct  356   TYLTATFVASGDGFLAKAMGFRNTA  380



>gb|KFK29934.1| hypothetical protein AALP_AA7G197300 [Arabis alpina]
Length=612

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 248/399 (62%), Gaps = 27/399 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEK--------  255
             MAFQDFD I ER  AER++K + +I I VV  L+++ A+    F +V    K        
Sbjct  1     MAFQDFDKIQERVNAERKRKFRKRIIIGVVSTLVVVAAITGGAFAYVTYGNKTQEQGKTT  60

Query  256   -----DDGHKRSGTKSKTTPLDSGKSV--GES---VKALCHGTDFEDTCERTLSTAGEDD  405
                  D+  ++S + S+  P  + ++V  GE    ++ LC+ T ++ TCE+TL T G   
Sbjct  61    NKNTKDNNSEKSESPSQKPPTSAAQTVKPGEVDKIIQTLCNSTLYKPTCEKTLKT-GTKT  119

Query  406   DSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTA  585
             D     P+ LL+ S++A  +++ K  +K   +K D    K A   C  L+ +AK++LD++
Sbjct  120   DIPSSDPRSLLKSSIIAVNEDLSKVFEKVLALKTDNKDDKDAIAQCKLLVDEAKEELDSS  179

Query  586   IASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNA  765
             +  I   ++ NF+    DLD+WLSAVM+YQ+TC+DGF +G+ KT + K+  +++ L SN+
Sbjct  180   VKRINDTEVNNFAKTVPDLDSWLSAVMSYQETCVDGFEEGKLKTEIRKNFNSSQMLTSNS  239

Query  766   LAIVSQLASVLSTFEPS-------ESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPN  921
             LA++  L + LS+  P        ES     +  D V  W++++ RRMLKA D+    PN
Sbjct  240   LAMIKSLDAYLSSSVPKVKARHLLESTRSSVMDTDHVTSWLSNKDRRMLKAVDVKALKPN  299

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
             ATVAKDGSG F+TIN ALKAMPAKY+GRY I++K G+YDESV+V KK  NVTM GDGSQK
Sbjct  300   ATVAKDGSGNFTTINDALKAMPAKYQGRYTIYIKQGVYDESVIVDKKKANVTMVGDGSQK  359

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TIVTG KS A  L T+ TATF   GEGFMA  +GFRNTA
Sbjct  360   TIVTGNKSNAKKLRTFLTATFVAQGEGFMAHSMGFRNTA  398



>ref|XP_010656076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Vitis vinifera]
Length=597

 Score =   261 bits (666),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 214/308 (69%), Gaps = 15/308 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +++K +C  TD++ TCE +LS     + S   +PK+LL++++ AA   + KA  K+   K
Sbjct  80    KAIKTICSATDYKQTCENSLSKLSRSN-STLSQPKDLLKVAISAASDGLQKAFGKTVTFK  138

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTC  684
              DTP +K A +DC  L+++AK++L+ +I+ +        SS   +L+NWLSAVM+YQ TC
Sbjct  139   FDTPEEKDAYEDCKVLMQNAKEELEASISQVSASN--KLSSVTQELNNWLSAVMSYQATC  196

Query  685   IDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA------  846
             IDGFP+G  KT MEK+ K+AKEL SNALAIVS++ S+LS+F+   + A R LLA      
Sbjct  197   IDGFPEGPLKTNMEKTFKSAKELTSNALAIVSKVTSILSSFD--LTGANRHLLAQESSGP  254

Query  847   ----DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
                 +G+P WM  E RR+LK       PNA VAKDGSG F+TI+AAL AMP KY GRYVI
Sbjct  255   SLANNGLPIWMTREDRRVLKPKESNLTPNAVVAKDGSGNFTTISAALAAMPPKYPGRYVI  314

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQ  1194
             +VK G+YDE+V V +KM NVTMYG+GS+KTIVTG K+  DG+ T+QTA+F  +G+GF+A 
Sbjct  315   YVKEGVYDETVTVERKMQNVTMYGEGSRKTIVTGNKNFVDGVRTFQTASFVALGDGFVAV  374

Query  1195  FIGFRNTA  1218
              +GFRNTA
Sbjct  375   SMGFRNTA  382



>ref|XP_004142361.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 ref|XP_004159078.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 gb|KGN52371.1| hypothetical protein Csa_5G630740 [Cucumis sativus]
Length=594

 Score =   261 bits (666),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 213/305 (70%), Gaps = 6/305 (2%)
 Frame = +1

Query  319   VGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGE  498
             V + +  +C+ TD++  CE TL   G   D     PK+L+++++ AA  E+  AVKK+  
Sbjct  80    VEKMITMICNSTDYKGKCESTLKD-GVHTDPNSSDPKDLIKLAISAAAHEVKSAVKKASG  138

Query  499   VKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAA-DLDNWLSAVMTYQ  675
                 TP +K A +DC  LL+DA ++L+ +++ +    +G  ++    +L+NWLSAVM+Y 
Sbjct  139   FNFATPEEKGAFEDCKVLLEDAIEELEMSMSEVNKKNMGKLTAKTTPNLNNWLSAVMSYH  198

Query  676   DTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLL--AD  849
             +TC+DGFP+G+ K+ +EK +K  KEL SN+LA++SQ+AS  STFE  E  A RR L   +
Sbjct  199   ETCVDGFPEGKMKSDIEKVVKAGKELTSNSLAMISQVASFFSTFEMPEGAASRRRLMTTN  258

Query  850   GVPEWMNDEQRRMLK--ADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVK  1023
             GVP WM+  QRRMLK  A   K  PN  VAKDGSG+F TIN AL AMPAKY GRYVI+VK
Sbjct  259   GVPTWMDRNQRRMLKGAAAGEKPKPNVVVAKDGSGEFKTINEALAAMPAKYDGRYVIYVK  318

Query  1024  AGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIG  1203
              GIYDE+VV+TKKMVNVTMYGDGSQK++++G K+  DG+ T+QTATF  +GEGF+ Q IG
Sbjct  319   EGIYDETVVITKKMVNVTMYGDGSQKSMISGSKNFVDGVRTFQTATFVALGEGFLGQAIG  378

Query  1204  FRNTA  1218
             FRN A
Sbjct  379   FRNIA  383



>ref|XP_003550590.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Glycine max]
 gb|KHN17766.1| Putative pectinesterase/pectinesterase inhibitor 13 [Glycine 
soja]
Length=603

 Score =   258 bits (659),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 177/396 (45%), Positives = 255/396 (64%), Gaps = 28/396 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFDLISERR+ E+R+K + K  +  V+  ++LVA+  AV + V+  + + G+K+S 
Sbjct  1     MAFQDFDLISERRRNEKRQKAR-KRIMIGVVSSVVLVAMIGAVLFVVVRNDNEAGNKKSN  59

Query  280   -------TKSKTTP-LDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPK--KPK  429
                    ++  TTP  D   +  + VK +C   D+++ CE  L+ A EDD   PK  +PK
Sbjct  60    ENKSHGHSQQSTTPGKDHVVAHSKMVKLVCSSADYKEKCEDPLNKAMEDD---PKLTQPK  116

Query  430   ELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
             +LL+  +  A  E+ KA  K+  +K +   +K A +DC +L +DAKDD+ T+I+ ++  +
Sbjct  117   DLLKAYVKFAEDEVSKAFNKTISMKFENEQEKGAFEDCKKLFEDAKDDIATSISELEKIE  176

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             + N S    D ++WLSAV+++Q  C+DGFP+G  KT ++     +KE  SN+LAI+SQ+A
Sbjct  177   MKNLSQRTPDFNSWLSAVISFQQNCVDGFPEGNTKTELQTLFNDSKEFVSNSLAILSQVA  236

Query  790   SVLSTFEPSESHAKRRLL-------------ADGVPEWMNDEQRRMLKADIPKQPPNATV  930
             S LST + + +   R LL             ADG+P WMN E RR+LKA   K  PN TV
Sbjct  237   SALSTIQ-TLARGSRSLLSENSNSPVASLDKADGLPSWMNHEDRRVLKAMDNKPAPNVTV  295

Query  931   AKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIV  1110
             AKDGSG F TI+  L A+P  ++GRYVIFVK G+YDE+V +TKKM N+TMYGDGSQK+I+
Sbjct  296   AKDGSGDFKTISECLNAVPQNFEGRYVIFVKEGVYDETVTITKKMQNITMYGDGSQKSII  355

Query  1111  TGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TG K+  DG+ T+ TA+F V G+GF+   +GFRNTA
Sbjct  356   TGNKNFRDGVRTFLTASFVVEGDGFIGLAMGFRNTA  391



>emb|CDX83235.1| BnaA03g22710D [Brassica napus]
Length=603

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 172/394 (44%), Positives = 247/394 (63%), Gaps = 26/394 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKD-------  258
             MAFQDFD I ER  A R++K + +I +  V +L+++ A+    F +V   +++       
Sbjct  1     MAFQDFDKIQERVNANRKRKFRKRIIVGTVSLLVVVAAIIGGAFAYVAFEKQNEQEPKNN  60

Query  259   ------DGHKRSGTKSKT--TPLDSGKSV--GES---VKALCHGTDFEDTCERTLSTAGE  399
                   D  K+S + S T   P+ + +SV  G++   ++ LC  T ++ +CE TL    E
Sbjct  61    HKNDAKDSQKKSQSASPTPKAPVAAAQSVKPGQADKIIETLCSTTLYKVSCENTLKNRTE  120

Query  400   DDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddld  579
                 A + P   L+ ++ A  +++D+ ++K   +K +    K A   C  L++DAK+++ 
Sbjct  121   KG-LALESPTTFLKAAIEAVNEDLDRVLEKVLSLKTENQDDKDAIAQCKLLVEDAKEEIV  179

Query  580   TAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGS  759
              ++  + G +I NF     DLDNWLSAVM+YQ+TCIDGF +G  K+ ++KS+ +++ L S
Sbjct  180   ASLDKVNGTEINNFVKIVPDLDNWLSAVMSYQETCIDGFEEGSLKSEVKKSVNSSQVLTS  239

Query  760   NALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATVAK  936
             N+LA++    + +S   P E  A R LL D VP W+ +E RRML+A D+    PNATVAK
Sbjct  240   NSLALIKSFDANIS---PVEKLATRHLL-DQVPSWVTNEDRRMLRAVDVETLNPNATVAK  295

Query  937   DGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTG  1116
             DGSG F+TIN ALKAMP KY+GRY+I+VK G+YDESV V KK  N+TM GDGSQKTIVTG
Sbjct  296   DGSGNFTTINDALKAMPEKYEGRYIIYVKQGVYDESVTVDKKKANLTMVGDGSQKTIVTG  355

Query  1117  KKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  356   NKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  389



>emb|CDY38523.1| BnaC03g26740D [Brassica napus]
Length=603

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 170/394 (43%), Positives = 247/394 (63%), Gaps = 26/394 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKD-------  258
             MAFQDFD I ER  A R++K + +I +  V +L+++ A+    F +V   +++       
Sbjct  1     MAFQDFDKIQERVNANRKRKFRKRIIVGTVSLLVVVAAIIGGAFAYVAFEKQNEQEPKNN  60

Query  259   ------DGHKRSGTKSKT--TPLDSGKSV--GES---VKALCHGTDFEDTCERTLSTAGE  399
                   D  K+S + S T   P+ + +SV  G++   ++ LC  T ++ +CE TL    E
Sbjct  61    HKNDAKDSQKKSQSASPTPKAPVAAAQSVKPGQADKIIETLCSTTLYKVSCENTLKNRTE  120

Query  400   DDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddld  579
                 A + P   L+ ++ A  +++D+ ++K   +K +    K A   C  L++DAK+++ 
Sbjct  121   KG-FAVESPTTFLKAAIEAVNEDLDRVLEKVLSLKTENQDDKDAIAQCKLLVEDAKEEIV  179

Query  580   TAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGS  759
              ++  + G +I NF     DLDNWLSAVM+YQ+TCIDGF +G  K+ ++K++ +++ L S
Sbjct  180   ASLNKVNGTEINNFVKIVPDLDNWLSAVMSYQETCIDGFEEGNLKSEVKKTVNSSQVLTS  239

Query  760   NALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATVAK  936
             N+LA++    + +S   P E  A R LL D +P W+ +E RRML+A D+    PNATVAK
Sbjct  240   NSLALIKSFDANIS---PVEKVATRHLL-DQIPSWVTNEDRRMLRAVDVETLNPNATVAK  295

Query  937   DGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTG  1116
             DGSG F+TIN ALKAMP KY+GRY+I+VK G+YDESV V KK  N+TM GDGSQKTIVTG
Sbjct  296   DGSGNFTTINDALKAMPEKYEGRYIIYVKQGVYDESVTVDKKKANLTMVGDGSQKTIVTG  355

Query  1117  KKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  356   NKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  389



>ref|XP_009133943.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Brassica rapa]
Length=603

 Score =   256 bits (654),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 247/394 (63%), Gaps = 26/394 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKD-------  258
             MAFQDFD I ER  A R++K + +I +  V +L+++ A+    F +V   +++       
Sbjct  1     MAFQDFDKIQERVNANRKRKFRKRIIVGTVSLLVVVAAIIGGAFAYVAFEKQNEQEPKNN  60

Query  259   ------DGHKRSGTKSKT--TPLDSGKSV--GES---VKALCHGTDFEDTCERTLSTAGE  399
                   D  K+S + S T   P+ + +SV  G++   ++ LC  T ++ +CE TL  + E
Sbjct  61    HKNDAKDSQKKSQSASPTPKAPVAAAQSVKPGQADKIIETLCSTTLYKVSCENTLKNSTE  120

Query  400   DDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddld  579
                 A + P   L+ ++ A  +++D+ ++K   +K +    K A   C  L++DAK+++ 
Sbjct  121   KG-FALESPTTFLKAAIEAVNEDLDRVLEKVLSLKTENQDDKDAIAQCKLLVEDAKEEIV  179

Query  580   TAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGS  759
              ++  + G +I N      DLDNWLSAVM+YQ+TCIDGF +G  K+ ++KS+ +++ L S
Sbjct  180   ASLDKVNGTEINNVVKIVPDLDNWLSAVMSYQETCIDGFEEGNLKSEVKKSVNSSQVLTS  239

Query  760   NALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATVAK  936
             N+LA++    + +S   P E  A R LL D VP W+ +E RRML+A D+    PNATVAK
Sbjct  240   NSLALIKSFDANIS---PVEKLATRHLL-DQVPSWVTNEDRRMLRAVDVETLNPNATVAK  295

Query  937   DGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTG  1116
             DGSG F+TIN ALKAMP KY+GRY+I+VK G+YDESV V KK  N+TM GDGSQKTIVTG
Sbjct  296   DGSGNFTTINDALKAMPEKYEGRYIIYVKQGVYDESVTVDKKKANLTMVGDGSQKTIVTG  355

Query  1117  KKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  356   NKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  389



>ref|XP_006452912.1| hypothetical protein CICLE_v10007819mg [Citrus clementina]
 gb|ESR66152.1| hypothetical protein CICLE_v10007819mg [Citrus clementina]
Length=589

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 173/386 (45%), Positives = 255/386 (66%), Gaps = 22/386 (6%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             M FQDFD +SERRKAER++K + ++ I+ +   +L++ +AA VF    V+ +D+G     
Sbjct  1     MVFQDFDHLSERRKAERQRKFRKRVTISAISAFVLIILIAAGVF---GVVSQDNGED---  54

Query  280   TKSKTTPLDSGKSVGES-----VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
               SKT+P  SG   G S     +  +C  T ++++C  TLS A E D S   +P+E L+ 
Sbjct  55    -SSKTSP-SSGAPKGISRAQKMISTICGSTAYKNSCNDTLSAAAEKDPSI-DEPREFLKA  111

Query  445   SMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK--IGN  618
             S+ A   E+DKA+KK      + P  +AA K C +++ DAK++L+  ++ + G K  +G 
Sbjct  112   SIAATVVELDKAIKKVESNDFNAPETEAAFKVCKKVIDDAKEELNRCVSQVGGKKRDLGM  171

Query  619   FSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVL  798
                 A +L+NWLSAVMTYQ TCIDGFP+G+ K+ M+K+L   ++L SN+LA++SQ +  L
Sbjct  172   LVERAGELNNWLSAVMTYQQTCIDGFPEGKMKSDMDKTLNETQQLTSNSLAMISQFSKYL  231

Query  799   STFE--PSESHAKRRLL--ADGV-PEWMNDEQRRMLK-ADIPKQPPNATVAKDGSGKFST  960
             S+      E    R LL   DGV P WM+ ++R+ML+  +  K  P+  VAKDGSG F+T
Sbjct  232   SSIMNLTPEGTDHRGLLDSKDGVLPSWMSHQERKMLQNEENNKIEPHLIVAKDGSGNFTT  291

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             I+ AL A+P KY+GR+VI+V AGIY+ESV V+K+MVN+T+ G+GSQK+I+ G+KS+ADG+
Sbjct  292   ISEALAAVPQKYEGRFVIYVAAGIYEESVTVSKRMVNLTIIGEGSQKSIIVGRKSVADGI  351

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
             + Y TATF  +GEG  A+ +GFRN A
Sbjct  352   NIYDTATFVAIGEGLFAKSMGFRNIA  377



>ref|XP_010437784.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Camelina sativa]
Length=609

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 172/399 (43%), Positives = 242/399 (61%), Gaps = 30/399 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEK-DDGHKRS  276
             MAFQDFD I ER  AER++K + +I +  V  L+++ A+    F +V    K  +  K +
Sbjct  1     MAFQDFDKIQERVNAERKRKFRKRIILGFVSALVVVAAIIGGAFAYVTYGNKTHEQAKTT  60

Query  277   GTKSKTTPLDSGK----------------SVGESVKALCHGTDFEDTCERTLSTAGEDDD  408
               K+K TP  S                   V + ++ LCH T ++  CE+TL   G   D
Sbjct  61    NNKTKDTPKKSESPSQKPPSSAAQTVKPGQVDKIIQTLCHSTLYKPVCEKTLKN-GTKKD  119

Query  409   SAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAI  588
             +    P+ LL  ++VA  +++D+  KK   +K +    K A   C  L+ +AK++L T+ 
Sbjct  120   TPLSDPRRLLESAIVAVNEDLDRVFKKVLSLKTENKDDKDAIAQCKLLVDEAKEELGTSA  179

Query  589   ASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNAL  768
               I   ++ NF+  A  LD+WLSAVM+YQ++C+DGF +G+ KT + K+  +++ L SN+L
Sbjct  180   KRINDTEVNNFAKVAPYLDSWLSAVMSYQESCVDGFEEGKLKTEIRKNFNSSQVLTSNSL  239

Query  769   AIVSQLASVLSTFEPSESHAKRRLL--------ADGVPEWMNDEQRRMLKA-DIPKQPPN  921
             A++  L   L++    ++   R LL         D    W++ ++RRMLKA D+    PN
Sbjct  240   AMIKSLDGYLTSVPKVKT---RHLLESRSLAVQTDHTTSWLSKKERRMLKAVDVKALKPN  296

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
             ATVAKDGSGKF+TIN ALKAMPAKY+GRY+I+VK G+YDESV+V KK  NVTM GDGSQK
Sbjct  297   ATVAKDGSGKFTTINDALKAMPAKYQGRYIIYVKHGVYDESVIVDKKKANVTMIGDGSQK  356

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  357   TIVTGNKSHAKKIQTFLTATFVAQGEGFMAQSMGFRNTA  395



>ref|XP_002867193.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43452.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=609

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 172/399 (43%), Positives = 243/399 (61%), Gaps = 30/399 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEK-DDGHKRS  276
             MAFQDFD I ER  AER++K + +I   +V  L+++ A+    F +V    K  +  K +
Sbjct  1     MAFQDFDKIQERVNAERKRKFRKRIIFGIVSALVVVAAIIGGAFAYVTYENKTQEQGKTT  60

Query  277   GTKSKTTPLDSGK-------SVGESVKA---------LCHGTDFEDTCERTLSTAGEDDD  408
               KSK +P  S         S  ++VKA         LC+ T ++ TCE TL   G   D
Sbjct  61    NNKSKDSPTKSESPSRKPPSSAAQTVKAGQVDKIIQTLCNSTLYKPTCENTLKN-GTKTD  119

Query  409   SAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAI  588
             +    P+ LL  ++VA   ++D+  KK   +K +    K A   C  L+ +AK++L T++
Sbjct  120   TPLSDPRSLLTSAIVAVNDDLDRVFKKVLSLKTENKDDKDAIAQCKLLVDEAKEELGTSM  179

Query  589   ASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNAL  768
               I   ++ NF+    DLD+WLSAVM+YQ+TC+DGF +G+ KT + K+  +++ L SN+L
Sbjct  180   KRINDTEVNNFAKIVPDLDSWLSAVMSYQETCVDGFEEGKLKTEIRKNFNSSQVLTSNSL  239

Query  769   AIVSQLASVLSTFEPSESHAKRRLL--------ADGVPEWMNDEQRRMLKA-DIPKQPPN  921
             A++  L   +S+    ++   R LL         D +  W+++++RRMLKA D+    PN
Sbjct  240   AMIKSLDGYISSVPKVKT---RHLLEARSSAKETDHITSWLSNKERRMLKAVDVNALKPN  296

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
             ATVAKDGSG F+TIN ALKAMPAKY+GRY I++K G+YDESV++ KK  NVTM GDGSQK
Sbjct  297   ATVAKDGSGNFTTINDALKAMPAKYQGRYTIYIKHGVYDESVIIDKKKPNVTMIGDGSQK  356

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TIVTG KS A  + T+ TATF   GEGFMA  +GFRNTA
Sbjct  357   TIVTGNKSHAKKIRTFVTATFVAQGEGFMAHSMGFRNTA  395



>ref|XP_010107091.1| putative pectinesterase/pectinesterase inhibitor 13 [Morus notabilis]
 gb|EXC13612.1| putative pectinesterase/pectinesterase inhibitor 13 [Morus notabilis]
Length=607

 Score =   254 bits (648),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 165/400 (41%), Positives = 254/400 (64%), Gaps = 33/400 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGH--KR  273
             MAFQDFD I+ERR+A + +K + ++    ++  + L+AL  A F+ ++   +  G     
Sbjct  1     MAFQDFDEITERRRAAKEQKFKRRVLTISIVSGVALLALIGAGFFALVSHAERHGQLDAA  60

Query  274   SGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMV  453
             + T +   P ++     + VK +C+ TD+ + CE  L       +     P++LL+ ++V
Sbjct  61    TATAAAVPPGNTDSQAHKIVKVICNATDYREKCEVALR------NQTAASPRDLLKAAIV  114

Query  454   AAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHA  633
             AA  E+ +   K+  +K ++P +KAA +DC  L++DA D+LD +++++  +  G  S+  
Sbjct  115   AAKDELRRDFNKTSSLKFNSPQEKAAYEDCEGLVEDALDELDASVSTVGNNSPGTLSTKT  174

Query  634   ADLDNWLSAVMTYQDTCIDGFPDGEE-KTAMEKSLKTAKELGSNALAIVSQLASVLSTFE  810
              DL++WLSAV++YQ TC+DGFP+G + K  + +  K +KE  SN+LA+V++++S+LS F+
Sbjct  175   PDLNSWLSAVISYQQTCVDGFPEGSKLKADLARLFKASKEFTSNSLALVTEISSLLSAFQ  234

Query  811   PS-ESHAKRRLLAD-----------------------GVPEWMNDEQRRMLKADIPKQPP  918
              S  +    R LA+                       G P+WM ++ RRMLK D  K  P
Sbjct  235   LSGATELTARHLAEIAAAPSPAREPTPVSNGPSLDDYGFPDWMEEDDRRMLKVDYDKLTP  294

Query  919   NATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQ  1098
             N TVAKDGSG+F+TIN A+ A+PAKY GRYVI+VK GIY+E+V+VTKKM+NVTMYGDGSQ
Sbjct  295   NVTVAKDGSGQFTTINEAIVAIPAKYDGRYVIYVKEGIYEETVIVTKKMLNVTMYGDGSQ  354

Query  1099  KTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             K+I+TG K+  DG+ T+QTATF   G+GF+ + +GFRNTA
Sbjct  355   KSIITGSKNFVDGVRTFQTATFVAQGDGFIGRAMGFRNTA  394



>ref|XP_004508050.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cicer arietinum]
Length=593

 Score =   253 bits (646),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 167/389 (43%), Positives = 246/389 (63%), Gaps = 24/389 (6%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFDLISERRK E  KK Q+K  I + ++  +++       +FV   +   G  +  
Sbjct  1     MAFQDFDLISERRKNE--KKQQLKKRILIGVLSSVVLVGLIGCAFFVATSKYGGGSNKDN  58

Query  280   TKSKTTPLDSGKSVGES---VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISM  450
               S+T+   S K V  S   VK +C   D+++ CE  L+ A E D    + PK+LL++ +
Sbjct  59    EPSQTS--SSNKHVAHSEKIVKLVCSSADYKEKCEDPLNKAVEKDPKL-QHPKDLLKVYV  115

Query  451   VAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSH  630
                  E++KA  K+   K ++  +K A +DC +L +DAK+DL  +I+ +   +    SS 
Sbjct  116   KIVEDEVNKAFNKTNTFKFESEEEKGAFEDCKQLFEDAKEDLQASISQLSEIEFKKLSSK  175

Query  631   AADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE  810
               DL++WLSAV+++Q TCIDGFP+G+ KT ++     +KE  SN+LAIVSQ+++ LST +
Sbjct  176   TPDLNSWLSAVISFQQTCIDGFPEGKLKTDLQNLFVDSKEFVSNSLAIVSQVSTFLSTMQ  235

Query  811   PSESHAKRRLL-------------ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGK  951
                +  + R+L             +DG P W++ E+RR+LKA   +  PN TVA+DG+G 
Sbjct  236   ---TFGRGRMLLSDNSNSPVASLDSDGFPSWVHSEERRVLKASSIRPTPNVTVAQDGTGD  292

Query  952   FSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA  1131
             F TI+ AL A+PA Y GRYV++VK G+YDE+V +TKKM N+TMYGDGSQK+I+TG K+  
Sbjct  293   FKTISEALAAIPAIYPGRYVVYVKEGVYDETVTITKKMQNLTMYGDGSQKSIITGSKNFR  352

Query  1132  DGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             DG+ T+ TA+F V+GEGF+   +GFRNTA
Sbjct  353   DGVRTFLTASFVVLGEGFLGLAMGFRNTA  381



>ref|NP_195049.1| putative pectinesterase/pectinesterase inhibitor 45 [Arabidopsis 
thaliana]
 sp|Q9SMY6.1|PME45_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
45; Includes: RecName: Full=Pectinesterase inhibitor 45; AltName: 
Full=Pectin methylesterase inhibitor 45; Includes: RecName: 
Full=Pectinesterase 45; Short=PE 45; AltName: Full=Pectin 
methylesterase 45; Short=AtPME45 [Arabidopsis thaliana]
 emb|CAB36797.1| pectinesterase-like protein [Arabidopsis thaliana]
 emb|CAB80040.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AEE86193.1| putative pectinesterase/pectinesterase inhibitor 45 [Arabidopsis 
thaliana]
Length=609

 Score =   253 bits (646),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 173/401 (43%), Positives = 247/401 (62%), Gaps = 34/401 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEK-DDGHKRS  276
             MAFQDFD I ER  AER++K + +I + VV +L++  A+    F +V    K  +  K +
Sbjct  1     MAFQDFDKIQERVNAERKRKFRKRIILGVVSVLVVAAAIIGGAFAYVTYENKTQEQGKTT  60

Query  277   GTKSKTTP-----------------LDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDD  405
               KSK +P                 + +G+ V + ++ LC+ T ++ TC+ TL    + D
Sbjct  61    NNKSKDSPTKSESPSPKPPSSAAQTVKAGQ-VDKIIQTLCNSTLYKPTCQNTLKNETKKD  119

Query  406   DSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTA  585
              +    P+ LL+ ++VA   ++D+  K+   +K +    K A   C  L+ +AK++L T+
Sbjct  120   -TPQTDPRSLLKSAIVAVNDDLDQVFKRVLSLKTENKDDKDAIAQCKLLVDEAKEELGTS  178

Query  586   IASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNA  765
             +  I   ++ NF+    DLD+WLSAVM+YQ+TC+DGF +G+ KT + K+  +++ L SN+
Sbjct  179   MKRINDSEVNNFAKIVPDLDSWLSAVMSYQETCVDGFEEGKLKTEIRKNFNSSQVLTSNS  238

Query  766   LAIVSQLASVLSTFEPSESHAKRRLL---------ADGVPEWMNDEQRRMLKA-DIPKQP  915
             LA++  L   LS    S    K RLL          D +  W+++++RRMLKA D+    
Sbjct  239   LAMIKSLDGYLS----SVPKVKTRLLLEARSSAKETDHITSWLSNKERRMLKAVDVKALK  294

Query  916   PNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGS  1095
             PNATVAKDGSG F+TINAALKAMPAKY+GRY I++K GIYDESV++ KK  NVTM GDGS
Sbjct  295   PNATVAKDGSGNFTTINAALKAMPAKYQGRYTIYIKHGIYDESVIIDKKKPNVTMVGDGS  354

Query  1096  QKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             QKTIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  355   QKTIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  395



>ref|XP_010447267.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Camelina sativa]
Length=609

 Score =   253 bits (645),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 169/399 (42%), Positives = 241/399 (60%), Gaps = 30/399 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEK-DDGHKRS  276
             MAFQDFD I +R  AER++K + +I +  V  L+++ A+    F +V    K  +  K +
Sbjct  1     MAFQDFDQIQQRVNAERKRKFRKRIILGFVSALVVVAAIIGGAFAYVTYGNKTHEQAKTT  60

Query  277   GTKSKTTPLDSGK----------------SVGESVKALCHGTDFEDTCERTLSTAGEDDD  408
               K+K TP  S                   V + ++ LCH T ++  CE+TL   G   D
Sbjct  61    NNKTKDTPKKSESPSQKPPSSAAQTVKPGQVDKIIQTLCHSTLYKPVCEKTLKN-GTKKD  119

Query  409   SAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAI  588
             +    P+ LL+ ++VA  +++D+  KK   +K +    K A   C  L+ +AK++L T+ 
Sbjct  120   TPLSDPRSLLKSAIVAVNEDLDRVFKKVLSLKTENKDDKDAIAQCKLLVDEAKEELGTSA  179

Query  589   ASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNAL  768
               +   ++ NF+    +LD+WLSAVM+YQ++C+DGF +G+ KT + K+  +++ L SN+L
Sbjct  180   KRVNDTEVNNFAKAVPNLDSWLSAVMSYQESCVDGFEEGKLKTEIRKNFNSSQVLTSNSL  239

Query  769   AIVSQLASVLSTFEPSESHAKRRLL--------ADGVPEWMNDEQRRMLKA-DIPKQPPN  921
             A++  L   L++    ++   R LL         D    W+++ +RRMLKA D+    PN
Sbjct  240   AMIKSLDGYLTSVPKVKA---RHLLESRSTAVKTDHTTYWLSNTERRMLKAVDVKALKPN  296

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
             ATVAKDGSG F+TINAALKAMPAKY+GRY I+VK G+YDESV+V KK  NVTM GDGSQK
Sbjct  297   ATVAKDGSGNFTTINAALKAMPAKYQGRYTIYVKHGVYDESVIVDKKKANVTMIGDGSQK  356

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TIVTG KS A  + T  TATF   GEGFMAQ +GFRNTA
Sbjct  357   TIVTGNKSHAKKIRTLLTATFVAQGEGFMAQSMGFRNTA  395



>ref|XP_009369731.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Pyrus x bretschneideri]
Length=594

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 243/387 (63%), Gaps = 21/387 (5%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD ISERRKAE+ +K++ K  I  V++++LLV +A   ++ V  +    G+ + G
Sbjct  1     MAFQDFDQISERRKAEKARKVK-KRIIIAVVVILLLVLIAVGAYFIVNRLNNKKGNAKQG  59

Query  280   TKSKTTPLDSGKSVGES-----------VKALCHGTDFEDTCERTLSTAGEDDDSAPKKP  426
                K  P+   +    S           +K +C  TD++D CE  +  A     +   KP
Sbjct  60    KVGKPAPMAPKQKNAPSKNKTPSNSKKILKEMCSVTDYKDKCEGIIEKA-----NGETKP  114

Query  427   KELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGD  606
                ++ ++ A   E      K+ E+  ++P +K A +DC EL +DA ++L  AI+ + G 
Sbjct  115   MAFIKTAISATSDEAKSVYSKTAELTFNSPEEKGAFEDCKELFEDAMEELGDAISQV-GS  173

Query  607   KIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQL  786
                +       L++WLSAV++YQ TCIDGFPDG+ K+ +EK L+T+KE  SN+LA++S L
Sbjct  174   NTESGKVRIGVLNSWLSAVISYQQTCIDGFPDGKLKSDLEKMLQTSKEFTSNSLAMLSLL  233

Query  787   ASVLSTFEPSESHAKRRLLADG---VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFS  957
               +      + + + RRLL+      P WM+ E RRMLK +  K  PN TVAKDGSG + 
Sbjct  234   NQLQLPGTGAAAGSNRRLLSQDKGEFPTWMSHEDRRMLKKNDKKLTPNVTVAKDGSGNYK  293

Query  958   TINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADG  1137
             TIN AL+ MP KY+GRYVI+VK G+YDE+V VTKKM NVTMYGDGSQK+I+TG K+ ADG
Sbjct  294   TINEALEKMPQKYEGRYVIYVKEGVYDETVTVTKKMPNVTMYGDGSQKSIITGNKNFADG  353

Query  1138  LSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             + T+QTA FA +GEGFMA+ +GFRNTA
Sbjct  354   VRTFQTAPFAALGEGFMAKSMGFRNTA  380



>ref|XP_010432595.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Camelina sativa]
Length=609

 Score =   251 bits (642),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 172/399 (43%), Positives = 241/399 (60%), Gaps = 30/399 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEK-DDGHKRS  276
             MAFQDFD I ER  AER++K + +I + VV  L+++ A+    F +V    K  +  K +
Sbjct  1     MAFQDFDKIQERVNAERKRKFRKRIILGVVSALVVVAAIIGGAFAYVTYGNKTHEQAKTT  60

Query  277   GTKSKTTPLDSGK----------------SVGESVKALCHGTDFEDTCERTLSTAGEDDD  408
               K+K TP  S                   V + ++ LCH T ++  CE+TL   G   D
Sbjct  61    NNKTKDTPKKSESPSQKPPSSAAQTVKPGQVDKIIQTLCHSTLYKPVCEKTLKN-GTKKD  119

Query  409   SAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAI  588
                  P+ LL  ++VA  +++D+  KK   +K +    K A   C  L+ +AK++L T+ 
Sbjct  120   PPLSDPRRLLESAIVAVNEDLDRVFKKVLSLKTENKDDKDAIAQCKLLVDEAKEELGTSA  179

Query  589   ASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNAL  768
               I   ++ NF+  A  LD+WLSAVM+YQ++C+DGF +G+ KT + K+  +++ L SN+L
Sbjct  180   KRINDTEVNNFAKVAPYLDSWLSAVMSYQESCVDGFEEGKLKTEIRKNFNSSQVLTSNSL  239

Query  769   AIVSQLASVLSTFEPSESHAKRRLL--------ADGVPEWMNDEQRRMLKA-DIPKQPPN  921
             A++  L   L++    ++   R LL         D    W++ ++RRMLKA D+    PN
Sbjct  240   AMIKSLDGYLTSVPKVKT---RHLLESRSSAVKTDHTTSWLSKKERRMLKAVDVKALKPN  296

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
             ATVAKDGSG F+TIN ALKAMPAKY+GRY+I+VK G+YDESV+V KK  NVTM GDGSQK
Sbjct  297   ATVAKDGSGNFTTINDALKAMPAKYQGRYIIYVKHGVYDESVIVDKKKANVTMIGDGSQK  356

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  357   TIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSLGFRNTA  395



>ref|XP_006474558.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13-like 
[Citrus sinensis]
Length=589

 Score =   251 bits (641),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 171/386 (44%), Positives = 255/386 (66%), Gaps = 22/386 (6%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             M FQDFD +SERRKAER++K + ++ I+ +   +L++ +AA VF    V+ +D+G     
Sbjct  1     MVFQDFDHLSERRKAERQRKFRKRVTISAISAFVLIILIAAGVF---GVVSQDNGED---  54

Query  280   TKSKTTPLDSGKSVGES-----VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
               SKT+P  SG   G S     +  +C  T ++++C  TLS A E D S   +P+E L+ 
Sbjct  55    -SSKTSP-SSGDPKGISRAQKMISTICGSTAYKNSCSDTLSAAAEKDPSI-DEPREFLKA  111

Query  445   SMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK--IGN  618
             S+ A   E+DKA+KK      + P  +AA K C +++ DAK++L+  ++ + G K  +G 
Sbjct  112   SIAATVVELDKAIKKVESNDFNAPETEAAFKVCKKVIDDAKEELNRCVSQVGGKKRDLGM  171

Query  619   FSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVL  798
                 A +L+NWLSAVMTYQ TCIDGFP+G+ K+ M+K+L   ++L SN+LA++SQ +  L
Sbjct  172   LVERAGELNNWLSAVMTYQQTCIDGFPEGKMKSDMDKTLNETQQLTSNSLAMLSQFSKYL  231

Query  799   STFE--PSESHAKRRLL--ADGV-PEWMNDEQRRMLK-ADIPKQPPNATVAKDGSGKFST  960
             S+      E    R LL   DGV P WM+ ++R+ML+  +  K  P+  VAKDGSG F+T
Sbjct  232   SSIMNLTPEGTDHRGLLDSKDGVLPSWMSHQERKMLQDEENNKIEPHLIVAKDGSGNFTT  291

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             I+ AL A+P KY+GR+VI+V AGIY+ESV V+K++VN+T+ G+GSQK+I+ G+KS+ADG+
Sbjct  292   ISEALAAVPQKYEGRFVIYVAAGIYEESVTVSKRIVNLTILGEGSQKSIIVGRKSVADGV  351

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
             + Y TATF  +G+G  A+ +GFRN A
Sbjct  352   NIYDTATFVAIGDGLFAKSMGFRNIA  377



>emb|CDX72395.1| BnaC07g44170D [Brassica napus]
Length=608

 Score =   251 bits (642),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 172/398 (43%), Positives = 243/398 (61%), Gaps = 30/398 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD------  261
             MAFQDFDLI ER  A+R++K + KI I VV  L+++  +    F +V   +K        
Sbjct  1     MAFQDFDLIQERVNADRKRKFRKKITIGVVSTLVVVAVITGGAFAYVTFGKKSQEPVKAT  60

Query  262   -------GHKRSGTKSKTTPLDSGKS-----------VGESVKALCHGTDFEDTCERTLS  387
                    G  +S  KS  TP +   S           V + +KALC+ T ++ +CE+TL 
Sbjct  61    NTNSKAKGSDKSSEKSTATPSNKPPSSAAAHSDKPGQVDKIIKALCNSTLYKPSCEKTLK  120

Query  388   TAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdak  567
               G    S    P+ LL+ S+ A  +++ K  +K  ++K     +K A   C  L+ +AK
Sbjct  121   N-GAKTASPLSDPRSLLKSSIKATNEDLVKGFEKVLKLKTGNKDEKDALAQCKLLVDEAK  179

Query  568   ddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAK  747
             ++L+T++  I   K+ +F+  A DLD WLSAVM++Q+TC+DGF +G+ +T + K+  +++
Sbjct  180   EELNTSMKRINDTKVNSFAKIAPDLDTWLSAVMSHQETCLDGFEEGKLRTEIRKNFNSSQ  239

Query  748   ELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNA  924
              + SN+LA++  L + LS      +  K R L +    W+ +++RRMLKA D+    PNA
Sbjct  240   MMTSNSLAMIKSLDAYLS----KATKVKTRHLLESRSSWLGNKERRMLKAVDVKALKPNA  295

Query  925   TVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKT  1104
              VAKDGSG F+TINAALKAMPAKYKGRY I++K G+YDESV+V KK  NVTM GDGSQKT
Sbjct  296   IVAKDGSGNFTTINAALKAMPAKYKGRYTIYIKHGVYDESVIVDKKKANVTMVGDGSQKT  355

Query  1105  IVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             IVTG KS A  + T+ TATF   GEGFMA  +GFRNTA
Sbjct  356   IVTGNKSHAKKVRTFLTATFVAQGEGFMAHSMGFRNTA  393



>ref|XP_003609936.1| Pectinesterase [Medicago truncatula]
 gb|AES92133.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=595

 Score =   251 bits (640),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 164/386 (42%), Positives = 244/386 (63%), Gaps = 16/386 (4%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFDLI+ERRK+E+R +++ +I I V+  ++ +  +  A F          G     
Sbjct  1     MAFQDFDLINERRKSEKRAQMRKRIIIGVISSVVFVGLIGCAFFVATTKYNPFGGGGGGS  60

Query  280   TKSKTTPLDSGKSVGES---VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISM  450
                 ++  +  K V  S   VK +C   D+++ CE  L+ A E D    + PK+LL++ +
Sbjct  61    HPEDSSTANGSKHVAHSEKVVKLVCSSADYKEKCEGPLNKAVEKDPKL-QHPKDLLKVYL  119

Query  451   VAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSH  630
                  E++KA  K+   K +T  +KAA +DC E+++ AKDDL T+I  +    +   +S 
Sbjct  120   KTVEDEVNKAFNKTNSFKFNTKEEKAAFEDCKEMIQYAKDDLATSIDQLSEADMKKLASK  179

Query  631   AADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE  810
               DL++WLSAV+T+Q+TC+DGFPDG+ KT ++K  + ++E  SN+LAIVSQ+++ LS+ +
Sbjct  180   TPDLNSWLSAVITFQETCVDGFPDGKLKTDLQKLFQGSREFVSNSLAIVSQVSTFLSSLQ  239

Query  811   PSESHAKRRLLAD----------GVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFST  960
                  A R LL+D          G+P W+  E+RR+LKA   +  PN  VAKDGSG F T
Sbjct  240   --TMGAPRMLLSDNSPVASMDSEGIPSWIQSEERRVLKAADIRPKPNVVVAKDGSGNFRT  297

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             I+AAL A+P  + GRYVI+VK G+YDE V +T KM ++T+YGDGSQK+I+TG K+  DG+
Sbjct  298   ISAALAAIPPNFLGRYVIYVKEGVYDEVVTITDKMKDITIYGDGSQKSIITGSKNFRDGV  357

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
             +T  TA+F V+GEGF+   +GFRNTA
Sbjct  358   TTINTASFVVLGEGFLGLAMGFRNTA  383



>gb|KFK32509.1| hypothetical protein AALP_AA6G251800 [Arabis alpina]
Length=604

 Score =   251 bits (640),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 172/396 (43%), Positives = 241/396 (61%), Gaps = 29/396 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD I ER  AER++K + +I +  V +L+++ A+    F +V   +K +   ++ 
Sbjct  1     MAFQDFDKIQERVTAERKRKFRKRIIVGTVSVLVVVAAIVGGAFAYVSYEKKHEQVAKNN  60

Query  280   TKSKTTPLDSGK-------------SVGESVK---------ALCHGTDFEDTCERTLSTA  393
              KS     DS K             S  +SVK         +LC  T ++ TCE+T    
Sbjct  61    NKSNDITKDSQKTSQNPSPNQKAPVSAAQSVKPGQANKIIQSLCSSTLYKLTCEKTFKNR  120

Query  394   GEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakdd  573
              E    A + P  LL+ ++ A  K++D  ++K   +K +    K A   C  L++DAK++
Sbjct  121   TEKS-IALENPTTLLKSAIEAINKDLDIVLEKLLSLKTENQDDKDAIAQCKLLVEDAKEE  179

Query  574   ldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKEL  753
                ++  + G ++ NF+    DLD+WLSAVMTYQ+TC+DGF +G  K+ ++KS+ +++ L
Sbjct  180   TLASMNKVNGTEVNNFAEIVPDLDSWLSAVMTYQETCLDGFEEGSLKSEVKKSVNSSQVL  239

Query  754   GSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATV  930
              SN+LA++    + LS    S      RLL D +P W+++E RR+L+A DI    PNATV
Sbjct  240   TSNSLAMIKSFNANLS----SVIKVTPRLL-DEIPSWVSNEDRRILRAVDIKALKPNATV  294

Query  931   AKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIV  1110
             AKDGSG F+TIN ALKAMP KY+GRY+I+VK G+YDE V V KK  NVTM GDGSQKTIV
Sbjct  295   AKDGSGNFTTINDALKAMPEKYEGRYIIYVKQGVYDEYVTVDKKKANVTMVGDGSQKTIV  354

Query  1111  TGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  355   TGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  390



>ref|XP_010932334.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=602

 Score =   249 bits (635),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 173/392 (44%), Positives = 243/392 (62%), Gaps = 29/392 (7%)
 Frame = +1

Query  103   AFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSGT  282
             AFQDF  +SERR+AER++K + +I IA   + ++L+  A  V   +   +   GH +S +
Sbjct  3     AFQDFGPLSERRRAERQQKKRKRIMIAGASVSVILILAAVGVAAVMYQSKHHTGHNKSSS  62

Query  283   KSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAG  462
              S    L   +S   ++K +C   D+++ CE  ++ A          PK L+R S+    
Sbjct  63    TSNNKDL---QSTTRAIKLVCGAVDYKEACESRMAKA-----VNTTSPKALIRASISIVV  114

Query  463   KEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADL  642
              E+ KA  KS  +K D P+ + A +DC EL +D+ D+L TA+ +I    +      +++L
Sbjct  115   DEVAKAFNKSDLIKSDDPMVQGAIEDCKELFRDSADELATALGNIDAHTLEQVPKQSSEL  174

Query  643   DNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSES  822
              NWLSAVM+YQ TCIDGFP+GE K  M++++K+AKEL SNALAI+ + +  LS+ +    
Sbjct  175   RNWLSAVMSYQQTCIDGFPNGEWKDKMKEAMKSAKELTSNALAIIEEASHFLSSVKIPAG  234

Query  823   HAKRRLLADG----------VPEWMNDEQRRMLK------ADIPKQP----PNATVAKDG  942
             +  RRLLA+G           P W++ E+RR L+       D P+      PN TVAKDG
Sbjct  235   NG-RRLLAEGQEAAPHKDAGFPSWLSKEERRHLEEEGQDGQDGPRATKNLKPNVTVAKDG  293

Query  943   SGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKK  1122
             SG F TI+ AL  MP KY+GRY I+VK G+Y+E+VVV KKMVNVTM+GDGS+KTIVTG K
Sbjct  294   SGDFKTISEALARMPKKYEGRYFIYVKEGVYEETVVVDKKMVNVTMFGDGSRKTIVTGSK  353

Query  1123  SLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +  DG  TYQTATFA +G+GFM   +GFRNTA
Sbjct  354   NYVDGTRTYQTATFAALGDGFMGIAMGFRNTA  385



>ref|XP_006285466.1| hypothetical protein CARUB_v10006885mg [Capsella rubella]
 gb|EOA18364.1| hypothetical protein CARUB_v10006885mg [Capsella rubella]
Length=623

 Score =   249 bits (635),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 172/409 (42%), Positives = 241/409 (59%), Gaps = 37/409 (9%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEK--DDGHKR  273
             MAFQDFD I ER  AER++K + +I   +V  L+++ A+    + +V    K  D G   
Sbjct  1     MAFQDFDKIQERVNAERKRKFRKRIIFGIVSALVVVAAIIGGGYAYVTYENKSQDQGKTT  60

Query  274   SG----------------------TKSKTTPLDSGKSVGES-----VKALCHGTDFEDTC  372
             +                       T S+  P  + ++V  +     ++ LC+ T ++  C
Sbjct  61    NNKTKESPSKSESPSQKPPTSAAQTASQKPPTSAAQTVKPNQVDKIIQTLCNSTLYKPVC  120

Query  373   ERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcael  552
             E+TL   G   D+    P+ LL+ ++VA  +++D+  KK   +K +    K A   C  L
Sbjct  121   EKTLKN-GTKTDTPLSDPRGLLKSAIVAVNEDLDRVFKKVVSLKTEKKDDKDAIAQCKLL  179

Query  553   lkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKS  732
             + +AK++L T++  I   +  NF     DLD+WLSAVM+YQ+TC+DGF DG+ KT + KS
Sbjct  180   VDEAKEELGTSVKRINDTEANNFGKVVPDLDSWLSAVMSYQETCVDGFEDGKLKTEIRKS  239

Query  733   LKTAKELGSNALAIVSQLASVLS------TFEPSESHAKRRLLADGVPEWMNDEQRRMLK  894
               +++ L SN+LA++  +   LS      T    ES     +  D    W+++++RRMLK
Sbjct  240   FNSSQVLTSNSLAMIKSIDGYLSPVPKLKTRHLLESRRSSAVEKDHSTSWLSNKERRMLK  299

Query  895   A-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvn  1071
             A D+    PNATVAKDGSG F+TIN ALKAMPAKYKGRY+I+VK G+YDESV+V KK  N
Sbjct  300   AVDVKALKPNATVAKDGSGNFTTINDALKAMPAKYKGRYIIYVKHGVYDESVIVDKKKAN  359

Query  1072  vtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             VTM GDGSQKTIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  360   VTMIGDGSQKTIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  408



>ref|XP_006412376.1| hypothetical protein EUTSA_v10024699mg [Eutrema salsugineum]
 gb|ESQ53829.1| hypothetical protein EUTSA_v10024699mg [Eutrema salsugineum]
Length=611

 Score =   248 bits (633),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 170/398 (43%), Positives = 243/398 (61%), Gaps = 26/398 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEK--------  255
             MAFQDFD I ER   ER++K + +I I VV  L+++ A+    F ++    K        
Sbjct  1     MAFQDFDQIQERVNQERKRKFRKRIIIGVVSTLVVVAAIIGGAFAYITYENKTQEQVKNT  60

Query  256   -----DDGHKRSGTKSKTTPLDSGKSV-----GESVKALCHGTDFEDTCERTLSTAGEDD  405
                  D    +S   S+  P  + +SV      + ++ LC+ T ++ +CE+TL   G   
Sbjct  61    KNNSKDKSSDKSENPSQKPPSSAAQSVKPGQVDKIIQTLCNSTLYKPSCEKTLKN-GTKT  119

Query  406   DSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTA  585
             D++   P+ LL+ S+ A   ++ K  +K  ++K +   +K A   C  L+ +AK +LDT+
Sbjct  120   DTSLSDPRSLLKSSIEAVNDDLRKVFEKVLKLKTENKDEKDAIAQCKLLVDEAKKELDTS  179

Query  586   IASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNA  765
             +  I   ++ NF+     LD+WLSAVMTYQ+TC+DGF +G+ KT + K+  +++ L SN+
Sbjct  180   VKRINDTEVDNFAKIVPYLDSWLSAVMTYQETCVDGFEEGKVKTDIRKNFNSSQVLTSNS  239

Query  766   LAIVSQLASVLS------TFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNA  924
             LA+V  L + LS      T    ES +   +  D +  W+++++RRMLKA D+    PNA
Sbjct  240   LAVVKSLGAYLSSAPKLKTRHLLESRSSSAIETDHITSWLSNKERRMLKAVDVNALKPNA  299

Query  925   TVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKT  1104
             TVAKDGSG F+TIN ALKAMP+KY+GRY I++K G+Y+ESVVV KK  NVTM GDGSQKT
Sbjct  300   TVAKDGSGNFTTINDALKAMPSKYQGRYTIYIKHGVYEESVVVDKKKANVTMIGDGSQKT  359

Query  1105  IVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             IVTG KS A  +ST  TATF   GEGFMA  +GFRNTA
Sbjct  360   IVTGNKSQAKKVSTLLTATFVAQGEGFMAHSMGFRNTA  397



>ref|XP_008812392.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=602

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 168/391 (43%), Positives = 238/391 (61%), Gaps = 27/391 (7%)
 Frame = +1

Query  103   AFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSGT  282
             AFQDF  +SERR+AER++K + K  +     + +++ LAA     ++   K  G    G 
Sbjct  3     AFQDFGPLSERRRAERQQK-RRKHLMIAGASVSVILILAAVGVAAIIYQSKHHGEHSKG-  60

Query  283   KSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAG  462
              S T+     +S   ++K +C   D+++ CE  ++            PK L+R S+    
Sbjct  61    -SSTSKNKDVQSTTRAIKLICGAADYKEACESRMAKV-----VNTTSPKALIRASISVVV  114

Query  463   KEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADL  642
              E+ +A  +S   K D P+ + A +DC EL + + D+L TA+ SI    +      +++L
Sbjct  115   DEVTEAFNQSELFKSDDPMVQGAVEDCKELFRFSDDELATALGSIDALALDQIPKQSSEL  174

Query  643   DNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSES  822
              NWLSAVM+YQ TCIDGFPDGE K  ME+++K+AKEL +NALAI+ + +  LS+ +    
Sbjct  175   RNWLSAVMSYQQTCIDGFPDGELKDKMEEAMKSAKELTTNALAIIEEASDFLSSVKIPAG  234

Query  823   HAKRRLLA---------DGVPEWMNDEQRRMLK---ADIPKQP-------PNATVAKDGS  945
               +RRLLA         DG+P W++ E+RR L+    D    P       PN TVAKDGS
Sbjct  235   SRRRRLLAEGQEAALHKDGLPSWLSKEERRHLEEGEQDGQGGPRATRNLQPNVTVAKDGS  294

Query  946   GKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKS  1125
             G F TI+ AL  MP K++GRY I+VK G+Y+E+VVV KKM+NVT+YGDGS+KTIV+G K+
Sbjct  295   GDFKTISEALAQMPKKFEGRYFIYVKEGVYEETVVVDKKMINVTIYGDGSRKTIVSGSKN  354

Query  1126  LADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
               DG  TYQTATFA +G+GFMA  +GFRNTA
Sbjct  355   YVDGTRTYQTATFAALGDGFMAIAMGFRNTA  385



>ref|XP_008391931.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Malus domestica]
Length=599

 Score =   245 bits (626),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 168/392 (43%), Positives = 243/392 (62%), Gaps = 26/392 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD ISERRKAE+ +K++ K  I  V++++LLV +A   ++ V       G+ + G
Sbjct  1     MAFQDFDQISERRKAEKARKVK-KRIIIAVVVILLLVLIAVXAYFIVNKXSNKKGNAKQG  59

Query  280   TKSK---------------TTPLDSGKSVGESV-KALCHGTDFEDTCERTLSTAGEDDDS  411
               ++               T P +   S  + + K +C  TD++D CE  +     +  +
Sbjct  60    NXTQGKAGKPAPAAPKQKNTPPKNKAPSNSKKILKEMCSATDYKDKCEGII-----EKXN  114

Query  412   APKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIA  591
                KP   ++ ++ A   E      K+ E+   +P +K A +DC  L +DA ++L  AI+
Sbjct  115   GETKPMAFIKTAISATSDEAKSVYXKTAELTFSSPEEKGAFEDCKGLFEDAMEELGDAIS  174

Query  592   SIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALA  771
              + G+   +       L++WLSAV++YQ TC+DGFPDG+ K+ +EK L+T+KE  SN+LA
Sbjct  175   QV-GNNTESGKVRIGVLNSWLSAVISYQQTCVDGFPDGKLKSDLEKMLQTSKEFTSNSLA  233

Query  772   IVSQLASVLSTFEPSESHAKRRLLAD---GVPEWMNDEQRRMLKADIPKQPPNATVAKDG  942
             ++S L  +      + + + RRLL+    G P WM+ E RRMLK +  K  PN TVAKDG
Sbjct  234   MLSLLNQLQLPSTGAAAGSNRRLLSQDKSGFPNWMSHEDRRMLKKNDKKLTPNVTVAKDG  293

Query  943   SGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKK  1122
             SG + TI+ AL+ MP KY+GRYVI+VK G+Y E+V VTKKM NVTMYGDGSQK+I+TG K
Sbjct  294   SGNYKTISEALEKMPQKYEGRYVIYVKEGVYXETVTVTKKMPNVTMYGDGSQKSIITGNK  353

Query  1123  SLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             + ADG+ T+QTA FA +GEGFMA+ +GFRNTA
Sbjct  354   NXADGVRTFQTAPFAALGEGFMAKSMGFRNTA  385



>ref|XP_009359677.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Pyrus x bretschneideri]
Length=599

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 170/393 (43%), Positives = 245/393 (62%), Gaps = 28/393 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD ++ERRK E  +K + +I IAVV+IL+L++    A  YF++    + G K+  
Sbjct  1     MAFQDFDQLTERRKTENARKFKKRIIIAVVVILLLVLIAVGA--YFIVNKLNNKGTKKGN  58

Query  280   TKS----------------KTTPLDSGKSVGESV-KALCHGTDFEDTCERTLSTAGEDDD  408
              K                    P +   S G+ + K +C   D++D CE  +  A ++  
Sbjct  59    AKEGNAKQGKVAPKAPQPKNAPPKNKVPSNGQKILKEMCSVADYKDKCEGIIEKAKDET-  117

Query  409   SAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAI  588
                 KPK  ++  + AA  E   A  K+ E+  ++P +K A +DC  L  DAK++L  A+
Sbjct  118   ----KPKAFIKTVISAASDEAKSAYSKTAELTFNSPEEKGAFEDCKVLFDDAKEELGDAV  173

Query  589   ASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNAL  768
             + + G+ I +   H   L++WLSAV++YQ TC+DGFPDG+ K+ +EK L+ +KE  SN+L
Sbjct  174   SQL-GNNIESGKVHTGVLNSWLSAVISYQQTCVDGFPDGKLKSELEKMLQASKEFTSNSL  232

Query  769   AIVSQLASVLSTFEPSESHAKRRLLAD---GVPEWMNDEQRRMLKADIPKQPPNATVAKD  939
             A++S L  +      + + + RRLL+    G P WM+ E RRMLK +  K  PN TVAKD
Sbjct  233   AMLSLLNQLQPLGAEAAAGSNRRLLSQDKSGFPTWMSHEDRRMLKKNDEKLTPNVTVAKD  292

Query  940   GSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGK  1119
             GSG + TI+ AL+ +P KY+GRYVI+VK G+YDE+V VTKKM N+TMYGDGSQK+I+TG 
Sbjct  293   GSGNYKTISEALEKIPEKYEGRYVIYVKEGVYDETVTVTKKMPNITMYGDGSQKSIITGN  352

Query  1120  KSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             K+ AD +  +QTA F V+GEGFMA+ +GFRNTA
Sbjct  353   KNFADKVRIFQTAPFVVLGEGFMAKSMGFRNTA  385



>ref|XP_009417804.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=594

 Score =   240 bits (612),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 146/307 (48%), Positives = 193/307 (63%), Gaps = 17/307 (6%)
 Frame = +1

Query  328   SVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQ  507
             +V+ +C  TD+   CE +L+T      S    PK+L+R ++ +   E+ KA  +   ++ 
Sbjct  81    AVQVICSPTDYRSACESSLTTYANSSSS----PKDLVRAAVSSLVDEVGKAFNRVDSIES  136

Query  508   DTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCI  687
             D P  K+A   C E+ + A D+L   + +I    +        +L NWLSAV  YQ TCI
Sbjct  137   DDPEVKSAVDSCKEMHQYAVDELARTLGTIDAHNLNQLPKQVHELKNWLSAVSAYQQTCI  196

Query  688   DGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA-------  846
             DGFPDGE K+ M+ ++ TAK+L SNALA+V  L S LS   P      RRLLA       
Sbjct  197   DGFPDGEMKSKMQTAMNTAKQLTSNALAVVGSLHSFLSLHIPG---LNRRLLAAKPEPAF  253

Query  847   --DGVPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIF  1017
               DGVP W++D   R+L     KQ  PN TVAKDGSG F+TI+ AL  +P KY+GRYVI+
Sbjct  254   REDGVPSWVSDGDHRILLGRAAKQLTPNVTVAKDGSGDFTTISDALAKIPMKYEGRYVIY  313

Query  1018  VKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQF  1197
             VKAG+Y+E VVV K M+NVTMYGDGS+KTIVTG K+  DG  T+Q+ATFA +G+GFMA  
Sbjct  314   VKAGVYEEQVVVDKNMINVTMYGDGSRKTIVTGSKNFVDGTKTFQSATFAAIGDGFMAVA  373

Query  1198  IGFRNTA  1218
             IGF+NTA
Sbjct  374   IGFQNTA  380



>ref|XP_009138175.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Brassica rapa]
Length=608

 Score =   240 bits (612),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 168/398 (42%), Positives = 235/398 (59%), Gaps = 30/398 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD------  261
             MAFQDFDLI ER  A+R++K + KI I VV  L+++  +    F +V   +         
Sbjct  1     MAFQDFDLIQERVNADRQRKFRKKIIIGVVSTLVVVAVITGGAFAYVTYGKNSQEPVKTT  60

Query  262   ------------GHKRSGTKSKTTPL------DSGKSVGESVKALCHGTDFEDTCERTLS  387
                           K + T S   P       D    V + +KALC+ T ++ +CE+TL 
Sbjct  61    NTNSKSKSSDKSSEKSTATPSNKPPSSAAAHSDKPGQVDKIIKALCNSTLYKPSCEKTLK  120

Query  388   TAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdak  567
               G    S    P+ LL+ S+ A   ++ K  +K  ++K     +K A   C  L+ +AK
Sbjct  121   N-GTKTASPLSDPRSLLKSSIKATNDDLVKGFEKVLKLKTGNKDEKDAIAQCKLLVDEAK  179

Query  568   ddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAK  747
             ++L+T++  I   K+ +F+    DLD WLSAVM++Q+TC+DGF +G+ KT + K+  +++
Sbjct  180   EELNTSMKRINDTKVNSFAKITPDLDTWLSAVMSHQETCLDGFEEGKLKTEIRKNFNSSQ  239

Query  748   ELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNA  924
              + SN+LA++  L + LS         K R L +    W+ +++RRMLKA D+    PNA
Sbjct  240   MMTSNSLAMIKSLDTYLS----KAKKVKTRHLLESRSSWLGNKERRMLKAVDVKALKPNA  295

Query  925   TVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKT  1104
              VAKDGSG F+TINAALKAMPAKYKGRY I++K G+YDESV+V K   NVTM GDGSQKT
Sbjct  296   IVAKDGSGNFTTINAALKAMPAKYKGRYTIYIKHGVYDESVIVDKNKANVTMVGDGSQKT  355

Query  1105  IVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             IVTG KS A  + T+ TATF   GEGFMA  +GFRNTA
Sbjct  356   IVTGNKSHAKKVRTFLTATFVAQGEGFMAHSMGFRNTA  393



>emb|CDY46125.1| BnaA03g52430D [Brassica napus]
Length=608

 Score =   240 bits (612),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 169/398 (42%), Positives = 236/398 (59%), Gaps = 30/398 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD------  261
             MAFQDFDLI ER  A+R++K + KI I VV  L+++  +    F +V   +         
Sbjct  1     MAFQDFDLIQERVNADRQRKFRKKIIIGVVSTLVVVAVITGGAFAYVTYGKNSQEPVKTT  60

Query  262   ------------GHKRSGTKSKTTPL------DSGKSVGESVKALCHGTDFEDTCERTLS  387
                           K + T S   P       D    V + +KALC+ T ++ +CE+TL 
Sbjct  61    NTNSKSKSSDKSSEKSTATPSNKPPSSAAAHSDKPGQVDKIIKALCNSTLYKPSCEKTLK  120

Query  388   TAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdak  567
               G    S    P+ LL+ S+ A   ++ K  +K  ++K     +K A   C  L+ +AK
Sbjct  121   N-GTKTASPLSDPRSLLKSSIKATNDDLVKGFEKVLKLKTGNKDEKDAIAQCKLLVDEAK  179

Query  568   ddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAK  747
             ++L+T++  I   K+ +F+    DLD WLSAVM++Q+TC+DGF +G+ KT + K+  +++
Sbjct  180   EELNTSMKRINDTKVNSFAKITPDLDTWLSAVMSHQETCLDGFEEGKLKTEIRKNFNSSQ  239

Query  748   ELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNA  924
              + SN+LA++  L + LS         K R L +    W+ +++RRMLKA D+    PNA
Sbjct  240   MMTSNSLAMIKSLDTYLS----KAKKVKTRHLLESRSSWLGNKERRMLKAVDVKALKPNA  295

Query  925   TVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKT  1104
              VAKDGSG F+TINAALKAMPAKYKGRY I++K G+YDESV+V KK  NVTM GDGSQKT
Sbjct  296   IVAKDGSGNFTTINAALKAMPAKYKGRYTIYIKHGVYDESVIVDKKKANVTMVGDGSQKT  355

Query  1105  IVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             IVTG KS A  + T+ TATF   GEGFMA  +GFRNTA
Sbjct  356   IVTGNKSHAKKVRTFLTATFVAQGEGFMAHSMGFRNTA  393



>ref|XP_002878962.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55221.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=619

 Score =   239 bits (611),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 162/410 (40%), Positives = 243/410 (59%), Gaps = 42/410 (10%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD-----G  264
             MAFQDFD I ER  A R++K + +I +  V +L+++ A+    F +V   ++++      
Sbjct  1     MAFQDFDKIQERVNANRKRKFRKRIIVGTVSLLVVVAAIVGGAFAYVAYEKRNEQQQAKS  60

Query  265   HKRSGTKSKT--------------------------TPLDSGKSV--GES---VKALCHG  351
             H +SG+ +                             P+ + +S   G+    ++ +C  
Sbjct  61    HNKSGSGNNVKDSDKKSQSPPSQSPSSKSPPSTSQKAPVSAAQSAKPGQGDKIIQTICGS  120

Query  352   TDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaa  531
             T ++  CE TL    E    A   P   L+ ++ A  +++D+ ++K   +K +    + A
Sbjct  121   TLYKRACEETLKNRTEKG-FALANPTSFLKSAIEAVNEDLDRVLEKVLSLKTENQDDRDA  179

Query  532   akdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEE  711
                C  L++DAK++   ++  I G ++ +F+    DL++WLSAVM+YQ+TC+DGF +G  
Sbjct  180   IAQCKLLVEDAKEETAASLNKINGTEVNSFAKVVPDLESWLSAVMSYQETCLDGFEEGTL  239

Query  712   KTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRML  891
             K+ ++KS+ +++ L SN+LA+++     LS   P    A R LL D +P W+++E RRML
Sbjct  240   KSEVKKSVNSSQVLTSNSLAMITSFDVNLS---PVMKVATRHLL-DDIPSWVSNEDRRML  295

Query  892   KA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmv  1068
             +A D+    PNATVAKDGSG F+TIN AL+AMP KY+GRY+I+VK GIYDESV V KK  
Sbjct  296   RAVDVKALKPNATVAKDGSGNFTTINDALRAMPEKYEGRYIIYVKQGIYDESVTVDKKKA  355

Query  1069  nvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             N+TM GDGSQKTIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  356   NLTMVGDGSQKTIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  405



>ref|XP_006408782.1| hypothetical protein EUTSA_v10001934mg [Eutrema salsugineum]
 gb|ESQ50235.1| hypothetical protein EUTSA_v10001934mg [Eutrema salsugineum]
Length=606

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 161/397 (41%), Positives = 243/397 (61%), Gaps = 29/397 (7%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD------  261
             MAFQDFD I ER  A R++K++ ++ +  V +L+++ A+    F +V   +K++      
Sbjct  1     MAFQDFDKIQERVNANRKRKIRKRMIVGTVSLLVVVAAIIGGAFAYVAYEKKNEQQAKNN  60

Query  262   ----------GHKRSGTKSKT--TPLDSGKSV--GES---VKALCHGTDFEDTCERTLST  390
                         K+S + S T   P+   +SV  G++   ++ LC  T ++ +CE+T   
Sbjct  61    NKNNDNNAKYSQKKSQSPSPTPKVPVSVAQSVKPGQTDIIIQNLCSSTLYKLSCEKTFKN  120

Query  391   AGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakd  570
               E   S  +KP  +L+ ++ A  +++D+ ++K   +K D    K A   C  L++DAK+
Sbjct  121   RTEKSFSL-EKPTIILQSAIKAVNEDLDRVLEKVLSLKTDNQFDKDAISQCKLLVEDAKE  179

Query  571   dldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKE  750
             ++  ++  +   +I NFS     LD+WLSAVM+YQ+TC+DGF +G  K+ ++KS+ +++ 
Sbjct  180   EIVASLNIVNNTEINNFSKIVPSLDSWLSAVMSYQETCLDGFEEGSLKSEVKKSVNSSQV  239

Query  751   LGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNAT  927
             L SN+LA++      LS   P    A R LL D +P W+++E RRML+A D+    PNAT
Sbjct  240   LTSNSLAMIQSFGEKLS---PVTKVATRNLL-DKIPNWVSNEDRRMLRAVDVKALNPNAT  295

Query  928   VAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTI  1107
             VAKDGSG F++IN ALKAMP KY+GRY+I+VK G+Y+E V V KK  N+T+ GDGSQKTI
Sbjct  296   VAKDGSGNFTSINDALKAMPEKYEGRYIIYVKQGVYEEYVTVDKKKANLTLVGDGSQKTI  355

Query  1108  VTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             V G KS    + T+ TATF   GEGFMAQ +GF NTA
Sbjct  356   VAGNKSHTKKVHTFITATFVAQGEGFMAQSMGFWNTA  392



>gb|AAP40488.1| putative pectin methylesterase [Arabidopsis thaliana]
 dbj|BAF01447.1| putative pectinesterase [Arabidopsis thaliana]
Length=614

 Score =   239 bits (610),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 163/405 (40%), Positives = 241/405 (60%), Gaps = 37/405 (9%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD------  261
             MAFQDFD I ER  A R++K + +I +  V +L+++ A+    F +V   ++++      
Sbjct  1     MAFQDFDKIQERVNANRKRKFRKRIIVGTVSLLVVVAAIVGGAFAYVAYEKRNEQQQQQQ  60

Query  262   ---GHKRSG-----------------TKSKTTPLDSGKSV--GES---VKALCHGTDFED  366
                 H +SG                 T S+  P+ + +SV  G+    ++ LC  T +  
Sbjct  61    QAKNHNKSGSGNNVVKDSDKKSPSPPTPSQKAPVSAAQSVKPGQGDKIIQTLCSSTLYMQ  120

Query  367   TCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdca  546
              CE+TL     D   A   P   L+ ++ A  +++D  ++K   +K +    K A + C 
Sbjct  121   ICEKTLKNR-TDKGFALDNPTTFLKSAIEAVNEDLDLVLEKVLSLKTENQDDKDAIEQCK  179

Query  547   ellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAME  726
              L++DAK++   ++  I   ++ +F     DL++WLSAVM+YQ+TC+DGF +G  K+ ++
Sbjct  180   LLVEDAKEETVASLNKINVTEVNSFEKVVPDLESWLSAVMSYQETCLDGFEEGNLKSEVK  239

Query  727   KSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DI  903
              S+ +++ L SN+LA++      LS   P     +R LL DG+P W++++ RRML+A D+
Sbjct  240   TSVNSSQVLTSNSLALIKTFTENLS---PVMKVVERHLL-DGIPSWVSNDDRRMLRAVDV  295

Query  904   PKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmY  1083
                 PNATVAKDGSG F+TIN AL+AMP KY+GRY+I+VK GIYDE V V KK  N+TM 
Sbjct  296   KALKPNATVAKDGSGDFTTINDALRAMPEKYEGRYIIYVKQGIYDEYVTVDKKKANLTMV  355

Query  1084  GDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             GDGSQKTIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  356   GDGSQKTIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  400



>ref|XP_008337792.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Malus domestica]
Length=603

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 169/397 (43%), Positives = 243/397 (61%), Gaps = 32/397 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD ++ERRK E  +K + +I IAVV+IL+L++    A  YF++    + G K+  
Sbjct  1     MAFQDFDQLTERRKTENARKFKKRIIIAVVVILLLVLIAVGA--YFIVNKLNNKGTKKGN  58

Query  280   TKSKTT--------------------PLDSGKSVGESV-KALCHGTDFEDTCERTLSTAG  396
              K                        P     S G+ + K +C   D+++ CE  +  A 
Sbjct  59    AKEGNAKQGKAAGKPAPKAPQPKNGPPKSKTPSNGQKILKEMCSAADYKEKCEGIIEKAR  118

Query  397   EDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddl  576
             ++      KPK  ++ ++ AA  E   A  K+ E+  ++P +K A +DC  L  DAK +L
Sbjct  119   DET-----KPKAFIKTAISAASDEAKSAYSKTAELTFNSPEEKGAFEDCKVLFDDAKGEL  173

Query  577   dTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELG  756
               A++ + G+ I +       L++WLSAV++YQ TC+DGFPDG+ K+ +EK L+ +KE  
Sbjct  174   GDAVSQL-GNSIESGKVRTGVLNSWLSAVISYQQTCVDGFPDGKLKSDLEKMLQASKEFT  232

Query  757   SNALAIVSQLASVLSTFEPSESHAKRRLLAD---GVPEWMNDEQRRMLKADIPKQPPNAT  927
             SN+LA++S    +      + + + RRLL+    G P WM+ E RRMLK +  K  PN T
Sbjct  233   SNSLAMLSLFNQLQLPGAEAATGSNRRLLSQDKSGFPTWMSHEDRRMLKKNDEKLTPNVT  292

Query  928   VAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTI  1107
             VAKDGSG + TI+ AL+ +P KY+GRYVI+VK G+YDE+V VTKKM NVTMYGDGSQK++
Sbjct  293   VAKDGSGNYKTISEALEKIPEKYEGRYVIYVKEGVYDETVTVTKKMPNVTMYGDGSQKSV  352

Query  1108  VTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             VTG K+ AD +  +QTA FAV+GEGFMA+ +GFRNTA
Sbjct  353   VTGNKNFADKVRIFQTAPFAVLGEGFMAKSMGFRNTA  389



>ref|XP_010472674.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Camelina sativa]
Length=608

 Score =   237 bits (605),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 166/399 (42%), Positives = 245/399 (61%), Gaps = 31/399 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD----GH  267
             MAFQDFD I ER  A R++K++ +I +  V +++ + A+    F FV   ++++     H
Sbjct  1     MAFQDFDKIQERVNANRKRKIRKRIIVGTVSLIVAVAAIVGGTFAFVAYEKRNEQQAKNH  60

Query  268   KRSGT---------KSKTTPLDSGK---SVGESVK---------ALCHGTDFEDTCERTL  384
              +SG+         KS++ P  + K   S  +SVK          LC  T ++ TCE+TL
Sbjct  61    NKSGSGNNVKDGEKKSQSPPSPTQKAPVSAEQSVKPGQGDNIIETLCSSTLYKQTCEKTL  120

Query  385   STAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkda  564
                 E    A   P   L+ ++ A  +++D  ++K   +K +    K A   C  L+++A
Sbjct  121   KNRTEKG-FALANPTTFLKSAIEAVNEDLDLVLEKVLSLKTENQDDKDAIAQCKLLVEEA  179

Query  565   kddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTA  744
             K++   ++  I   ++ +F+    DLD+WLSAV++YQ+TC+DGF +G  K+ ++KS+ ++
Sbjct  180   KEETAASLEKINITEVNSFAKVVPDLDSWLSAVISYQETCLDGFEEGSLKSEVKKSVNSS  239

Query  745   KELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPN  921
             + L SN+LA++    + LS   P    A R LL D +P W+++E RRML+A D+    PN
Sbjct  240   QILASNSLAMIKSFDASLS---PVMKLATRHLL-DEIPSWVSNEDRRMLRAVDVKALKPN  295

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
             ATVAKDGSG F+TIN AL AMP KY+GRY+I++K G+YDESV+V KK  N+TM GDGSQK
Sbjct  296   ATVAKDGSGNFTTINDALSAMPEKYEGRYIIYIKQGVYDESVIVDKKKANLTMVGDGSQK  355

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  356   TIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  394



>ref|XP_010417438.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Camelina sativa]
Length=608

 Score =   237 bits (604),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 166/399 (42%), Positives = 246/399 (62%), Gaps = 31/399 (8%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD----GH  267
             MAFQDFD I ER  A R++K++ +I +  V +++ + A+    F FV   ++++     H
Sbjct  1     MAFQDFDKIQERVNANRKRKIRKRIIVGTVSLIVAVAAIVGGTFAFVAYEKRNEQQAKNH  60

Query  268   KRSGT---------KSKTTPLDSGK---SVGESVK---------ALCHGTDFEDTCERTL  384
              +SG+         KS++ P  + K   S  +SVK          LC  T ++ TCE+TL
Sbjct  61    NKSGSGNNVKDGEKKSQSPPSPTQKAPVSAEQSVKPGQGDKIIETLCSSTIYKQTCEQTL  120

Query  385   STAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkda  564
                 E    A   P   L+ ++ A  +++D  ++K   +K +    K A   C  L+++A
Sbjct  121   KNRTEKG-FALANPTTFLKSAIEAVNEDLDLVLEKVLSLKTENQDDKDAIAQCKLLVEEA  179

Query  565   kddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTA  744
             K++   ++  I   ++ +F+    DLD+WLSAV++YQ+TC+DGF +G  K+ ++KS+ ++
Sbjct  180   KEETAASLEKINITEVNSFAKVVPDLDSWLSAVISYQETCLDGFEEGSLKSEVKKSVNSS  239

Query  745   KELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPN  921
             + L SN+LA++  + + LS   P    A R LL D +P W+++E RRML+A D+    PN
Sbjct  240   QILTSNSLAMIKSIDANLS---PVMKLATRHLL-DEIPSWVSNEDRRMLRAVDVKALKPN  295

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
             ATVAKDGSG F+TIN AL AMP KY+GRY+I++K G+YDESV+V KK  N+TM GDGSQK
Sbjct  296   ATVAKDGSGNFTTINDALSAMPEKYEGRYIIYIKQGVYDESVIVDKKKANLTMVGDGSQK  355

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  356   TIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  394



>ref|NP_850077.1| probable pectinesterase/pectinesterase inhibitor 13 [Arabidopsis 
thaliana]
 sp|Q7Y201.2|PME13_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
13; Includes: RecName: Full=Pectinesterase inhibitor 13; AltName: 
Full=Pectin methylesterase inhibitor 13; Includes: RecName: 
Full=Pectinesterase 13; Short=PE 13; AltName: Full=Pectin 
methylesterase 13; Short=AtPME13 [Arabidopsis thaliana]
 gb|AEC07840.1| probable pectinesterase/pectinesterase inhibitor 13 [Arabidopsis 
thaliana]
Length=614

 Score =   236 bits (602),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 162/405 (40%), Positives = 240/405 (59%), Gaps = 37/405 (9%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD------  261
             MAFQDFD I ER  A R++K + +I +  V +L+++ A+    F +V   ++++      
Sbjct  1     MAFQDFDKIQERVNANRKRKFRKRIIVGTVSLLVVVAAIVGGAFAYVAYEKRNEQQQQQQ  60

Query  262   ---GHKRSG-----------------TKSKTTPLDSGKSV--GES---VKALCHGTDFED  366
                 H +SG                 T S+  P+ + +SV  G+    ++ LC  T +  
Sbjct  61    QAKNHNKSGSGNNVVKDSDKKSPSPPTPSQKAPVSAAQSVKPGQGDKIIQTLCSSTLYMQ  120

Query  367   TCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdca  546
              CE+TL     D   A   P   L+ ++ A  +++D  ++K   +K +    K A + C 
Sbjct  121   ICEKTLKNR-TDKGFALDNPTTFLKSAIEAVNEDLDLVLEKVLSLKTENQDDKDAIEQCK  179

Query  547   ellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAME  726
              L++DAK++   ++  I   ++ +F     DL++WLSAVM+YQ+TC+DGF +G  K+ ++
Sbjct  180   LLVEDAKEETVASLNKINVTEVNSFEKVVPDLESWLSAVMSYQETCLDGFEEGNLKSEVK  239

Query  727   KSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DI  903
              S+ +++ L SN+LA++      LS   P     +R LL D +P W++++ RRML+A D+
Sbjct  240   TSVNSSQVLTSNSLALIKTFTENLS---PVMKVVERHLL-DDIPSWVSNDDRRMLRAVDV  295

Query  904   PKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmY  1083
                 PNATVAKDGSG F+TIN AL+AMP KY+GRY+I+VK GIYDE V V KK  N+TM 
Sbjct  296   KALKPNATVAKDGSGDFTTINDALRAMPEKYEGRYIIYVKQGIYDEYVTVDKKKANLTMV  355

Query  1084  GDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             GDGSQKTIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  356   GDGSQKTIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  400



>ref|XP_009405157.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Musa acuminata subsp. malaccensis]
Length=639

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 203/316 (64%), Gaps = 20/316 (6%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG  495
             S  +SVK +C  TD++  CE ++S     D S    PK LL+ ++     E+ KA   S 
Sbjct  115   SSSKSVKMICSSTDYQRACESSMSKVVTSDTS---DPKVLLKAAVTVVLDEVSKAFAHSK  171

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
              +K +    + A +DC +L +++K +++  + SI    I +  S + D+  WLSAVMTYQ
Sbjct  172   LLKSNDSRVRGAVEDCQQLYENSKAEINATLQSIVASGIDHLPSRSHDMRTWLSAVMTYQ  231

Query  676   DTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA---  846
              TCIDGFP+GE KT M +++K++KEL SNALA++ Q +S LS      S+  RRLL+   
Sbjct  232   QTCIDGFPEGEVKTKMHEAMKSSKELTSNALAMIGQASSFLSLINLPGSN--RRLLSASE  289

Query  847   -----------DGVPEWMNDEQRRMLKADI-PKQPPNATVAKDGSGKFSTINAALKAMPA  990
                        +G P W+ ++ RRMLK  +  K  PN TVAKDGSGK+ TI+ AL AMP 
Sbjct  290   EHEAVTSGLKKNGYPSWVGEDDRRMLKEHLRVKLTPNVTVAKDGSGKYKTISEALAAMPK  349

Query  991   KYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAV  1170
             K+KGRYVI++KAG+Y+E+V VTKKM NVTMYGDGS +TIVTG ++  DG  T+QTATF  
Sbjct  350   KHKGRYVIYIKAGVYEETVNVTKKMANVTMYGDGSTRTIVTGSRNYIDGTRTFQTATFVA  409

Query  1171  VGEGFMAQFIGFRNTA  1218
             +G+ F+A  +GFRNTA
Sbjct  410   MGDRFVAMAMGFRNTA  425



>ref|XP_006295415.1| hypothetical protein CARUB_v10024513mg [Capsella rubella]
 gb|EOA28313.1| hypothetical protein CARUB_v10024513mg [Capsella rubella]
Length=609

 Score =   232 bits (591),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 155/404 (38%), Positives = 236/404 (58%), Gaps = 40/404 (10%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD-----G  264
             MAFQDFD I ER  A R++K + +I +  V +L+++ A+    F +V   ++++      
Sbjct  1     MAFQDFDKIQERVNANRKRKFRKRIIVGSVSLLVVVAAIVGGAFAYVAYEKRNEQQEAKN  60

Query  265   HKRSGTKSKTT-------------------------PLDSGKSVGESVKALCHGTDFEDT  369
             H +SG+ +                            P+   K +    + LC  + +   
Sbjct  61    HNKSGSGNNVKDGEKKSQSPPSPSQKPPVSPEQLLKPVQDDKII----ETLCSSSLYTQE  116

Query  370   CERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcae  549
             CE+TL  + E    A   P   L  ++ A   ++D+ +++   +K +      A   C  
Sbjct  117   CEKTLKNSTEKG-FALANPTTFLTSAIEAINGDLDRVLEQFLSLKTENQDDIDAIAQCKL  175

Query  550   llkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEK  729
             L+++AK++   ++  I   ++ +F++   DLD+WLSAVM+YQ+TC+DGF +G  K+ ++K
Sbjct  176   LVEEAKEETVASLKKINSTEVSSFANVVPDLDSWLSAVMSYQETCLDGFEEGTLKSEVKK  235

Query  730   SLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIP  906
             S+ +++ L SN+LA++      LS    + S    RLL D +P W++++ RRML+A D+ 
Sbjct  236   SVNSSQVLTSNSLAMIKSFDEHLSPVIKAAS----RLLLDEIPSWVSNDDRRMLRAVDVK  291

Query  907   KQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYG  1086
                PNATVAKDGSG F+TIN AL AMP KY+GRY+I+VK G+YDE+V+V KK  N+TM G
Sbjct  292   ALKPNATVAKDGSGNFTTINDALNAMPEKYEGRYIIYVKQGVYDETVIVDKKKANLTMVG  351

Query  1087  DGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             DGSQKTIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  352   DGSQKTIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  395



>ref|XP_006659464.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13-like 
[Oryza brachyantha]
Length=602

 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 204/313 (65%), Gaps = 14/313 (4%)
 Frame = +1

Query  319   VGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGE  498
             V + +KA+C  TD+ DTCE++L+     + SA   P++++R S+ A G  ++KA  KSGE
Sbjct  76    VSKIIKAMCAQTDYRDTCEKSLAKV-ASNASASSSPRDIVRASVAAIGDAVEKAFDKSGE  134

Query  499   VKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
             +  D P  KAA  DC E+ ++A+DDL+  +  I    +   +     L  WLSAV+  Q+
Sbjct  135   IVSDDPRVKAAIADCKEIYENARDDLERTLGGIDAGGVDGLTKGGYQLRVWLSAVIADQE  194

Query  679   TCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHA-KRRLLADG  852
             TCIDGFPDG+ K  M  ++++ KEL SNALAI+ + +S L+    P+ S A  RRLL+  
Sbjct  195   TCIDGFPDGDLKDKMRDAMESGKELTSNALAIIGKASSFLAALNLPASSAASHRRLLSFA  254

Query  853   ----------VPEWMNDEQRRMLKADIP-KQPPNATVAKDGSGKFSTINAALKAMPAKYK  999
                       VP W++ +QRR+LK     K  PN  VAKDGSGKF TIN AL AMP KY 
Sbjct  255   FDEDTPRQPDVPLWVSRQQRRLLKGKFQNKLTPNVVVAKDGSGKFKTINDALAAMPKKYT  314

Query  1000  GRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGE  1179
             GRYVI+VK G+YDE V +TKKM NVTMYGDG++KTI+TG ++  DG +TY+TATF+  G+
Sbjct  315   GRYVIYVKEGVYDEYVTITKKMANVTMYGDGAKKTIITGNRNFVDGRTTYKTATFSAQGD  374

Query  1180  GFMAQFIGFRNTA  1218
             GFM   +GFRNTA
Sbjct  375   GFMGIALGFRNTA  387



>ref|XP_003578154.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=614

 Score =   225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 209/318 (66%), Gaps = 20/318 (6%)
 Frame = +1

Query  298   PLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDK  477
             P+D  K+V +++  LC  TDF+ TC+ +LS A    +++   PK+++R ++   G+ + +
Sbjct  91    PMDL-KAVSKTITILCKQTDFQVTCQESLSKAA---NASTTSPKDVVRTAVQVIGEAISQ  146

Query  478   AVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLS  657
             A  ++  +  + P  KAA  DC E  + AKD+L+  ++ +  D   + +     L  WLS
Sbjct  147   AFDRADLIMSNDPRVKAAVADCKEFFEYAKDELNRTLSGM--DAKDSLTKQGYQLRVWLS  204

Query  658   AVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRR  837
             AV+ +Q+TCIDGFPDGE +T ++ S    KEL SNALA++ Q ++ L+  +  E   KRR
Sbjct  205   AVIAHQETCIDGFPDGEFRTKVKDSFVKGKELTSNALALIEQASTFLAGIKIPE---KRR  261

Query  838   LLA---------DGVPEWMNDEQRRMLKADIPKQP--PNATVAKDGSGKFSTINAALKAM  984
             LLA         DG+PEW+ D +RR+LK    K    PN  VAKDGSGKF TIN AL AM
Sbjct  262   LLAEEGEPVLGDDGIPEWVPDSERRVLKGGGFKNTMTPNVVVAKDGSGKFKTINEALAAM  321

Query  985   PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF  1164
             P  Y GRYVI+VK G+Y+E VV+T++M NVT+YGDG++K+IVTGKK+  DGL+T++TATF
Sbjct  322   PKTYAGRYVIYVKEGVYEEYVVITRQMANVTVYGDGAKKSIVTGKKNFVDGLTTFKTATF  381

Query  1165  AVVGEGFMAQFIGFRNTA  1218
             A +G+GFMA  + F+NTA
Sbjct  382   AALGDGFMAIGMAFQNTA  399



>ref|XP_004289016.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13-like 
[Fragaria vesca subsp. vesca]
Length=593

 Score =   224 bits (570),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 158/386 (41%), Positives = 236/386 (61%), Gaps = 21/386 (5%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAFQDFD I+ERRK E  +K + K  +  V+ +ILL+ +     + V  ++  +  K+  
Sbjct  1     MAFQDFDQITERRKTENARKFK-KRILIAVVAVILLIGIIVGAIFIVNKLKTHEATKKDS  59

Query  280   TKSKTTPL----------DSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPK  429
               +   P           D   +  + V+ +C  TD++D C+   S   +       KP+
Sbjct  60    KPASPPPKRPDSDNNSTDDKPSTSSKLVEQMCGSTDYKDKCKEVFSKKKD----PISKPR  115

Query  430   ELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
             E+++  +  A  E   A  K+ EV  D   +K A +DC  L  DAK++L+ ++  + G+ 
Sbjct  116   EVIKAIISGASDEAKSAFSKASEVSFDKEEEKKAFEDCKTLFDDAKEELEQSVYQV-GNT  174

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
               +       L++WLSAV++Y  TCIDGFPDG+ K+ + K+L+  KEL SN+LA++S L+
Sbjct  175   TSSGKMRIGLLNSWLSAVISYGQTCIDGFPDGDGKSKITKTLEATKELTSNSLAMISLLS  234

Query  790   SVLSTFEPSESHAKRRLLA---DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFST  960
              V  +   S S + RRLLA   +G P W+  ++RR+LK +     PN TVAKDGSG + +
Sbjct  235   EVPGS--KSSSGSSRRLLAQDKNGFPSWLTYDERRVLKKNDEMPTPNVTVAKDGSGNYQS  292

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             I+ AL AMP KY+GRY+I+VK G+Y+ESV VTKKM NVT+YGDGSQK+I+TG K+ ADG+
Sbjct  293   ISQALSAMPEKYEGRYIIYVKEGVYNESVTVTKKMPNVTIYGDGSQKSIITGNKNSADGV  352

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
               +QTA+F  +GEG +A+ +GFRNTA
Sbjct  353   KMFQTASFVALGEGLIAKSMGFRNTA  378



>ref|XP_010939847.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=570

 Score =   223 bits (568),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 195/311 (63%), Gaps = 13/311 (4%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             ++   SVK +C  TD+++TCE +L+  G  + +    PK++LR ++VA   E+ K+  +S
Sbjct  50    RTTTRSVKLMCATTDYKETCETSLT--GIVNTTGISSPKDVLRAAVVAVIDEISKSFSQS  107

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
                K +    + A  DC E+ +D+++DL   ++ I    + +       L +WLSAV  Y
Sbjct  108   RLFKTNDSRVQDAIDDCREMYQDSEEDLKKTLSKIIDTSLESLPEQTLSLKSWLSAVFFY  167

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA--  846
             Q+TC+DGFPDGE K  M  ++KT+KEL SNALA++ Q++ +L  F   ES   RRLL+  
Sbjct  168   QETCVDGFPDGELKDKMRSAMKTSKELTSNALAMMGQVSDLLMMFTVPES--GRRLLSVD  225

Query  847   ------DGVPEWMNDEQRRMLKADIP-KQPPNATVAKDGSGKFSTINAALKAMPAKYKGR  1005
                    G P W++   RR+L+  +  K  PN TVA+DGSG F TIN A+  +P KY GR
Sbjct  226   ESPVMKRGCPSWVSQGDRRLLREHLNVKLLPNVTVAQDGSGDFRTINEAIHKIPPKYDGR  285

Query  1006  YVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGF  1185
             YVI+VK GIYDE+V +T K VN+TMYGDG +KTIVTG K+  DG  T  TATF   GEGF
Sbjct  286   YVIYVKEGIYDEAVNLTSKYVNITMYGDGPKKTIVTGNKNFVDGTKTSHTATFVASGEGF  345

Query  1186  MAQFIGFRNTA  1218
             MA  +GFRNTA
Sbjct  346   MAVDMGFRNTA  356



>ref|XP_010937248.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=570

 Score =   221 bits (562),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 193/312 (62%), Gaps = 16/312 (5%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             +S  ++VK LC GTD++ TCE +L+   +  ++    PKELL+ ++VA   E  ++  +S
Sbjct  50    RSTTKAVKMLCAGTDYKQTCETSLT---KFSNTTTSDPKELLKAAVVALIDEASRSFSQS  106

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
                K +    + A  DC E+  D+K+DL   +  I    + +      +L NWLSAV  Y
Sbjct  107   SVFKSNDSRVQDAINDCWEMYYDSKEDLVKTLNRIIDTGLEHLPDQTLNLKNWLSAVHFY  166

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF-EPSESHAKRRLLA-  846
             Q+TC+DGFP+GE K  M  ++K  KEL SNALA++ Q++ +L+    PS S   RRLL+ 
Sbjct  167   QETCVDGFPEGELKNKMRSAMKATKELTSNALAMIGQVSDLLTMLGVPSWS---RRLLSV  223

Query  847   -------DGVPEWMNDEQRRMLKADIP-KQPPNATVAKDGSGKFSTINAALKAMPAKYKG  1002
                     G P W+++  RR+LK  +  K  PN TVAKDGSG F TIN A++ MP KY G
Sbjct  224   EHRPVMKRGYPSWVSEGDRRLLKEHLNFKLKPNVTVAKDGSGDFGTINEAIRNMPLKYSG  283

Query  1003  RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEG  1182
             RYVI+VK GIY E+V +T K VN+TMYGDG +KTIVTG K+  DG  T  TATF   GEG
Sbjct  284   RYVIYVKEGIYKEAVNLTSKYVNITMYGDGPKKTIVTGSKNFKDGTKTSHTATFVASGEG  343

Query  1183  FMAQFIGFRNTA  1218
             FMA  +GF NTA
Sbjct  344   FMAIDMGFHNTA  355



>ref|XP_008800480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Phoenix dactylifera]
Length=570

 Score =   221 bits (562),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 139/312 (45%), Positives = 195/312 (63%), Gaps = 16/312 (5%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             +S  +SVK LC  TD+++TCE +L+      + +   PK++L+ S+VA   E+ K+  +S
Sbjct  51    RSTTKSVKMLCATTDYKETCETSLTKIV---NGSTSNPKDVLKASVVAVIDEISKSFSQS  107

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
                K +    + A  DC E+ +D+K+DL   ++ I    + +    A  L NWLSAV  Y
Sbjct  108   RVFKTNNSRVQDAIDDCWEMYQDSKEDLKKTLSKIIDTGLEDLPEQALSLKNWLSAVFFY  167

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKRRLLA-  846
             Q+TC+DGFP+GE K  M  ++KT+KEL SNALA++ Q++  L+    P  S   RRLL+ 
Sbjct  168   QETCVDGFPEGELKNKMRSAMKTSKELTSNALAMIGQVSDFLTMLNIPGSS---RRLLSV  224

Query  847   -------DGVPEWMNDEQRRMLKADIP-KQPPNATVAKDGSGKFSTINAALKAMPAKYKG  1002
                     G P W+++  RR+L+  +  K  PN TVA+DGSG F TIN A+  +P KY G
Sbjct  225   DEKPVMKRGYPSWVSEGDRRLLREYLNVKLRPNVTVAQDGSGDFRTINEAIDKVPLKYDG  284

Query  1003  RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEG  1182
             RYVI+VK GIY+E+V +T + V +TMYGDG +KTIVTG K+  DG  T  TATF   GEG
Sbjct  285   RYVIYVKEGIYNEAVNLTSRYVGITMYGDGPKKTIVTGNKNFVDGTKTSHTATFVASGEG  344

Query  1183  FMAQFIGFRNTA  1218
             FMA  +GFRNTA
Sbjct  345   FMAVDMGFRNTA  356



>ref|XP_009386320.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=594

 Score =   221 bits (562),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 157/392 (40%), Positives = 224/392 (57%), Gaps = 34/392 (9%)
 Frame = +1

Query  103   AFQDFDLISERRKAER----RKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHK  270
             AFQDF  +SERR+AER    RK+L +  A   V++++ +V +            K +G  
Sbjct  3     AFQDFGPLSERRRAERQQIKRKRLMIAGATTSVVLVLAVVGVVVQY--------KANGPS  54

Query  271   RSGTKSKTTPLDSGK-----SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKEL  435
              SG    ++               +++ +C  TD+E  C+ +L     +      KPK+L
Sbjct  55    DSGDSDGSSASGGSASKRAFHTSSAIQVMCSSTDYESACQSSLKKFVNES----SKPKDL  110

Query  436   LRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIG  615
             +R ++ A   E+  A  KS  +K D P  K A   C E+ + A +DL   +++I    + 
Sbjct  111   VRAAVSALVDEVGMAFNKSDSIKSDDPSVKDAVGICKEMHRYAVNDLAKVLSTIDAHHLD  170

Query  616   NFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASV  795
                    +L NWLSAV   Q TCI+GFP+G+ KT M+ ++ +AK++ SNALAIV +++S 
Sbjct  171   KLPEQVHELKNWLSAVAASQQTCIEGFPEGDLKTKMQTAMTSAKQITSNALAIVGKMSSF  230

Query  796   LSTFEPSESHAKRRLLA----------DGVPEWMNDEQRRMLKADIPKQ-PPNATVAKDG  942
             LS    S  H  RRLL           DG P W++D  RR+L +   KQ  PN TVAKDG
Sbjct  231   LSLLHVSGFH--RRLLEAEPVEPAYHEDGAPSWVSDSDRRILLSKATKQLTPNVTVAKDG  288

Query  943   SGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKK  1122
             SG F+TI+ AL  +P  Y GRYVI VK G+Y+E+V+V   MVNVTMYGDGS+KT+V G K
Sbjct  289   SGDFTTISDALAKIPKNYDGRYVIHVKEGVYEETVLVDNYMVNVTMYGDGSRKTVVAGSK  348

Query  1123  SLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +  DG+ T+ TATFA V +GF+A  +GF+NTA
Sbjct  349   NFIDGVKTFNTATFAAVADGFVAIAMGFQNTA  380



>ref|XP_010431632.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Camelina sativa]
Length=744

 Score =   223 bits (567),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 194/297 (65%), Gaps = 6/297 (2%)
 Frame = +1

Query  331   VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQD  510
             ++ LC  T ++ TCE+TL    E    A   P   L  ++ A  +++D  ++K   +K +
Sbjct  239   IETLCSSTLYKQTCEKTLKNRTEKG-FALDNPTTFLTSAIEAVSEDLDLVLEKVLSLKTE  297

Query  511   TPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCID  690
                 K A   C  L+++AK++   ++  I   ++ +F+    DLD+WLSAV++YQ+TC+D
Sbjct  298   NQDDKDAIAQCKLLVEEAKEETAASLKKINITEVDSFAKVVPDLDSWLSAVISYQETCLD  357

Query  691   GFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMN  870
             GF +G  K+ ++ S+ +++ L SN+LA++    + LS   P    A R LL D +P W++
Sbjct  358   GFEEGSLKSEVKNSVNSSQILTSNSLAMIKSFDASLS---PVMKLATRHLL-DEIPSWVS  413

Query  871   DEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESv  1047
             +E RRML+A D+    PNATVAKDGSG F+TIN AL AMP KY+GRY+I++K G+YDESV
Sbjct  414   NEDRRMLRAVDVKALKPNATVAKDGSGNFTTINDALSAMPEKYEGRYIIYIKQGVYDESV  473

Query  1048  vvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +V KK  N+TM GDGSQKTIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  474   IVDKKKANLTMVGDGSQKTIVTGNKSNAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  530


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 120/227 (53%), Gaps = 27/227 (12%)
 Frame = +1

Query  100  MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDD-----G  264
            MAFQDFD I ER  A R++K++ +I +  V +++ + A+    F FV   ++++      
Sbjct  1    MAFQDFDQIQERVNANRKRKIRKRIIVGTVSLIVAVAAIVGGTFAFVAYEKRNEQQQAKN  60

Query  265  HKRSGT---------KSKTTPLDSGK---SVGESVK---------ALCHGTDFEDTCERT  381
            H +SG+         KS++ P  + K   S  +SVK          LC  T ++ TCE+T
Sbjct  61   HNKSGSGNNVKDGEKKSQSPPSPTQKAPVSAEQSVKPGQGDKIIETLCSSTIYKQTCEQT  120

Query  382  LSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkd  561
            L    E    A   P   L+ ++ A  +++D  ++K   +K +    K A   C  L+++
Sbjct  121  LKNRTEKG-FALANPTTFLKSAIEAVNEDLDLVLEKVLSLKTENQDDKDAIAQCKLLVEE  179

Query  562  akddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPD  702
            AK++   ++  I   ++ +F+    DLD+WLSAV++YQ+TC+DGF +
Sbjct  180  AKEETAASLKKINITEVNSFAKVVPDLDSWLSAVISYQETCLDGFEE  226



>ref|XP_008783344.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=570

 Score =   218 bits (555),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 193/311 (62%), Gaps = 16/311 (5%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG  495
             S  ++VK LC  TD++ TCE +L+      +++   PKELL+ S+ A   E+ ++   S 
Sbjct  51    STSKAVKMLCASTDYKQTCETSLTKLV---NTSTPDPKELLKASVTAVINEISESFSHSR  107

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
              +K +    + A  DC E+ +D+K+DL   +  I    + +      +L NWLSAV  YQ
Sbjct  108   LIKSNDSRVQDAINDCWEMYQDSKEDLVKTLDKIIDTGLEHLPDQTLNLKNWLSAVFFYQ  167

Query  676   DTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKRRLLA--  846
             +TC+DGFP+GE K  M  ++KT KEL SNALA+V Q++ +L+    PS S   RRLL+  
Sbjct  168   ETCVDGFPEGELKNKMRSAMKTTKELTSNALAMVGQVSDILTMLGIPSFS---RRLLSVE  224

Query  847   ------DGVPEWMNDEQRRMLKADIP-KQPPNATVAKDGSGKFSTINAALKAMPAKYKGR  1005
                    G P W++   RR+LK  +  K  PN TVAKDGSG FSTIN A++ +P K+ GR
Sbjct  225   DRPVMKRGYPSWVSKRDRRLLKEYLKVKLNPNVTVAKDGSGNFSTINDAIRNIPLKHDGR  284

Query  1006  YVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGF  1185
             YVI++K GIY+E+V +T    N+T+YGDG +KTIVTG K++ DG  T  TATF   G+GF
Sbjct  285   YVIYIKEGIYNEAVNLTSAYANITVYGDGPKKTIVTGNKNVKDGTKTSHTATFVASGDGF  344

Query  1186  MAQFIGFRNTA  1218
             MA  +GF NTA
Sbjct  345   MAIDMGFHNTA  355



>ref|XP_009414337.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=592

 Score =   217 bits (552),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 198/328 (60%), Gaps = 20/328 (6%)
 Frame = +1

Query  283   KSKTTPLDSGKS------VGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
             +S T+P D G           +++ +C  TD++ +CE +LS    D      KPK+L+R 
Sbjct  55    ESSTSPSDGGLESTSHFRTTSAIEVICSPTDYKSSCESSLSKYVNDS----SKPKDLVRA  110

Query  445   SMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFS  624
             +++A    + KA  +S  +K D P  KAA  DC E+ + A D+L   ++ I    +    
Sbjct  111   AVLAVVDGVAKAFNRSDSIKSDDPEVKAAIADCKEMHQYAVDELAKTLSHIDEHHLKQLP  170

Query  625   SHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLST  804
                 +L NWLSAV+ YQ TCIDGFP+G+ K+ M+ ++K+AKE+ SNALAIV +++S L+ 
Sbjct  171   KQIPELKNWLSAVVAYQQTCIDGFPEGKLKSKMQAAMKSAKEITSNALAIVGKISSFLTL  230

Query  805   FEPS--------ESHAKRRLLADGVPEWMNDEQRRMLKAD-IPKQPPNATVAKDGSGKFS  957
              + +        E  A+     DG P W++   RR+L+    P+  PN TVAKDGSG F+
Sbjct  231   IQVAGFSRRLLEEEPAEPEWYVDGNPSWVSHGDRRLLQTPATPELTPNVTVAKDGSGDFT  290

Query  958   TINAALKAMPAKY-KGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
             TI+ AL   P K   GRYVI+VK G+Y+E+V V K   N+TMYGDG QKTIVTG K+  D
Sbjct  291   TISGALAKAPKKLLNGRYVIYVKEGVYEETVAVDKNTWNITMYGDGEQKTIVTGSKNFID  350

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G+ TY TATFA +G+GFMA  + F NTA
Sbjct  351   GVKTYHTATFAAIGDGFMAVDMAFLNTA  378



>ref|XP_006474679.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Citrus sinensis]
Length=412

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 150/381 (39%), Positives = 224/381 (59%), Gaps = 59/381 (15%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             M FQDFD +SERRKAER++  + ++ I+ +               FV+++          
Sbjct  1     MVFQDFDHLSERRKAERQRTFRKRVTISAISA-------------FVLII----------  37

Query  280   TKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAA  459
                              + A   G   +D  E          DS+   P   L+ S+ A 
Sbjct  38    ----------------LIAAGVFGVVSQDNGE----------DSSKTSPH--LKASIAAT  69

Query  460   GKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK--IGNFSSHA  633
               E+DKA+KK      + P  +AA K C +++ DAK++L+  ++ + G K  +G     A
Sbjct  70    VVELDKAIKKVESNDFNAPETEAAFKVCKKVIDDAKEELNRCVSQVGGKKRDLGMLVERA  129

Query  634   ADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-  810
              +L+NWLSAVMTYQ TCIDGFP+G+ K+ M+K+L   ++L SN+LA++SQ +  LS+   
Sbjct  130   GELNNWLSAVMTYQQTCIDGFPEGKMKSDMDKTLNETQQLTSNSLAMLSQFSKYLSSIMN  189

Query  811   -PSESHAKRRLL--ADGV-PEWMNDEQRRMLK-ADIPKQPPNATVAKDGSGKFSTINAAL  975
                E    R LL   DGV P WM+ ++R+ML+  +  K  P+  VAKDGSG F+TI+ AL
Sbjct  190   LTPEGTDHRGLLDSKDGVLPSWMSHQERKMLQDEENNKIEPHLIVAKDGSGNFTTISEAL  249

Query  976   KAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQT  1155
              A P KY+GR+VI+V AGIY+ESV ++K+MVN+T+ G+GSQK+I+ G+KS+ADG++ Y +
Sbjct  250   AAAPQKYEGRFVIYVAAGIYEESVTLSKRMVNLTIIGEGSQKSIIVGRKSVADGVNIYDS  309

Query  1156  ATFAVVGEGFMAQFIGFRNTA  1218
             ATF  +G+G  A+ +GFRN A
Sbjct  310   ATFVAIGDGLFAKSMGFRNIA  330



>gb|AAC14494.1| putative pectinesterase [Arabidopsis thaliana]
Length=496

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 185/284 (65%), Gaps = 6/284 (2%)
 Frame = +1

Query  370   CERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcae  549
             CE+TL     D   A   P   L+ ++ A  +++D  ++K   +K +    K A + C  
Sbjct  4     CEKTLKNR-TDKGFALDNPTTFLKSAIEAVNEDLDLVLEKVLSLKTENQDDKDAIEQCKL  62

Query  550   llkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEK  729
             L++DAK++   ++  I   ++ +F     DL++WLSAVM+YQ+TC+DGF +G  K+ ++ 
Sbjct  63    LVEDAKEETVASLNKINVTEVNSFEKVVPDLESWLSAVMSYQETCLDGFEEGNLKSEVKT  122

Query  730   SLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLADGVPEWMNDEQRRMLKA-DIP  906
             S+ +++ L SN+LA++      LS   P     +R LL D +P W++++ RRML+A D+ 
Sbjct  123   SVNSSQVLTSNSLALIKTFTENLS---PVMKVVERHLL-DDIPSWVSNDDRRMLRAVDVK  178

Query  907   KQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYG  1086
                PNATVAKDGSG F+TIN AL+AMP KY+GRY+I+VK GIYDE V V KK  N+TM G
Sbjct  179   ALKPNATVAKDGSGDFTTINDALRAMPEKYEGRYIIYVKQGIYDEYVTVDKKKANLTMVG  238

Query  1087  DGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             DGSQKTIVTG KS A  + T+ TATF   GEGFMAQ +GFRNTA
Sbjct  239   DGSQKTIVTGNKSHAKKIRTFLTATFVAQGEGFMAQSMGFRNTA  282



>ref|XP_009611625.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Nicotiana tomentosiformis]
Length=645

 Score =   213 bits (542),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 199/303 (66%), Gaps = 16/303 (5%)
 Frame = +1

Query  328   SVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQ  507
             ++ A+C  TDF  TC   LS   + + S   +P +LL+ +M AA  E+ K + + G++ +
Sbjct  139   AIGAICAATDFNQTCGDILSKVLQTNASG-AQPADLLKATMSAAIDEIAKGIDELGKINK  197

Query  508   DTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCI  687
             D+P K  A  DC  LL DAK DL+++I  + G  I + +S  A+L+N LSA +TYQD C+
Sbjct  198   DSPEKSTAYDDCMSLLADAKKDLNSSIYILDG-GINDVASATAELNNKLSAALTYQDMCV  256

Query  688   DGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS-ESHAKRRLLAD--GVP  858
             DG+P+ ++ T ++ +LK   E   N+LA+ S+L    ST  P   ++AKRRLL    GVP
Sbjct  257   DGYPEADQST-VQTALKIIGEHTINSLAVASEL----STTSPKPNNNAKRRLLTTRLGVP  311

Query  859   EWMNDEQRRMLK---ADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAG  1029
              WMN   RRML+   A  PK   N TVAKDGSG F+TIN ALKA+P+ ++GRY I+VK G
Sbjct  312   TWMNQGDRRMLEEEEAKDPKGTANVTVAKDGSGNFTTINDALKAVPS-FEGRYFIYVKEG  370

Query  1030  IYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFR  1209
             +Y+E+VVV++  +    +GDGSQK+I+TG K++ D LSTYQ+AT  + G GF+A  IGFR
Sbjct  371   VYEENVVVSQTNLTF--FGDGSQKSIITGSKNIVDDLSTYQSATVVISGNGFIAYKIGFR  428

Query  1210  NTA  1218
             NTA
Sbjct  429   NTA  431



>ref|XP_006661265.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 45-like [Oryza brachyantha]
Length=613

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 159/403 (39%), Positives = 236/403 (59%), Gaps = 39/403 (10%)
 Frame = +1

Query  103   AFQDFDLISERRKAER----RKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHK  270
             AF DF  ++ERR+AE+    R+++ +      ++I+++++  AA  +      +++ G K
Sbjct  4     AFGDFGPLTERRRAEKARQQRRRIMIAAGTVSIVIILIVMGAAAITYSGKNSEKEESGSK  63

Query  271   RSGTK---SKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLR  441
              S  K      +P D  ++V +S+K +C  TDF+D CE+++   G+  +++   PK+++R
Sbjct  64    GSKAKPGGGSGSPADL-RAVSKSIKVMCAQTDFQDACEKSI---GKAANASASSPKDIIR  119

Query  442   ISMVAA-GKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGN  618
                V   G  + +A  ++  +    P  KAA  DC EL  DA DDL+  +  I G     
Sbjct  120   PPAVGVIGDAVSQAFDRADLIMSTDPRVKAAVADCKELFDDAMDDLNRTLKGIDGAGKDG  179

Query  619   FSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVL  798
              +     L  WLSAV+ +Q+TCIDGFP+ E K  ++ S    KEL SNALA++ + ++ L
Sbjct  180   LAKQGFQLRVWLSAVIAHQETCIDGFPEDEFKAKVKDSFINGKELTSNALALIEKASTFL  239

Query  799   STFEPSESHAKRRLLA---------------------DGVPEWMNDEQRRMLKADIPKQ-  912
             S+ + S    KRRLLA                     DG+PEW+ D  RR+LK    K  
Sbjct  240   SSLKLS----KRRLLAGEDEDDGAAAAEPQREPPLAKDGIPEWVPDGDRRVLKGGGFKNN  295

Query  913   -PPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGD  1089
               PN  VAKDGSGKF TIN AL AMP  Y GRYVI+VK G+Y E V +TKKM NVT+YGD
Sbjct  296   LTPNVVVAKDGSGKFKTINEALAAMPKTYTGRYVIYVKEGVYAEYVTITKKMANVTVYGD  355

Query  1090  GSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G++K++VTG K+  DG++T+++ATF   G+GFMA  +GF+NTA
Sbjct  356   GARKSVVTGNKNFIDGITTFKSATFTAQGDGFMAIGMGFQNTA  398



>ref|NP_001063246.1| Os09g0433700 [Oryza sativa Japonica Group]
 dbj|BAD33558.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF25160.1| Os09g0433700 [Oryza sativa Japonica Group]
 dbj|BAG92940.1| unnamed protein product [Oryza sativa Japonica Group]
Length=617

 Score =   211 bits (537),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 144/322 (45%), Positives = 199/322 (62%), Gaps = 30/322 (9%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             ++V +S+K +C  TDF D+C  ++   G+  +++   PK+++R ++   G  +D+A  ++
Sbjct  91    RAVSKSIKMMCAQTDFADSCATSI---GKAANASVSSPKDIIRTAVDVIGGAVDQAFDRA  147

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
               +  + P  KAA  DC EL  DAKDDL+  +  I G    +       L  WLSAV+  
Sbjct  148   DLIMSNDPRVKAAVADCKELFDDAKDDLNCTLKGIDGK---DGLKQGFQLRVWLSAVIAN  204

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA--  846
              +TCIDGFPDGE +  +++S    +E  SNALA++ + +S LS  + S+    RRLLA  
Sbjct  205   METCIDGFPDGEFRDKVKESFNNGREFTSNALALIEKASSFLSALKGSQ----RRLLAGE  260

Query  847   ----------------DGVPEWMNDEQRRMLKADIPKQ--PPNATVAKDGSGKFSTINAA  972
                             DG+PEW+ D  RR+LK    K    PN  VAKDGSGKF TIN A
Sbjct  261   EDNGGGAADPHLALAEDGIPEWVPDGDRRVLKGGGFKNNLTPNVIVAKDGSGKFKTINEA  320

Query  973   LKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQ  1152
             L AMP  Y GRYVI+VK G+Y E V +TKKM +VTMYGDGS+K+IVTG K+ ADGL+T++
Sbjct  321   LAAMPKTYSGRYVIYVKEGVYAEYVTITKKMASVTMYGDGSRKSIVTGSKNFADGLTTFK  380

Query  1153  TATFAVVGEGFMAQFIGFRNTA  1218
             TATFA  G+GFMA  +GF+NTA
Sbjct  381   TATFAAQGDGFMAIGMGFQNTA  402



>gb|EAZ44838.1| hypothetical protein OsJ_29475 [Oryza sativa Japonica Group]
Length=690

 Score =   211 bits (536),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/322 (45%), Positives = 199/322 (62%), Gaps = 30/322 (9%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             ++V +S+K +C  TDF D+C  ++   G+  +++   PK+++R ++   G  +D+A  ++
Sbjct  164   RAVSKSIKMMCAQTDFADSCATSI---GKAANASVSSPKDIIRTAVDVIGGAVDQAFDRA  220

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
               +  + P  KAA  DC EL  DAKDDL+  +  I G    +       L  WLSAV+  
Sbjct  221   DLIMSNDPRVKAAVADCKELFDDAKDDLNCTLKGIDGK---DGLKQGFQLRVWLSAVIAN  277

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA--  846
              +TCIDGFPDGE +  +++S    +E  SNALA++ + +S LS  + S+    RRLLA  
Sbjct  278   METCIDGFPDGEFRDKVKESFNNGREFTSNALALIEKASSFLSALKGSQ----RRLLAGE  333

Query  847   ----------------DGVPEWMNDEQRRMLKADIPKQ--PPNATVAKDGSGKFSTINAA  972
                             DG+PEW+ D  RR+LK    K    PN  VAKDGSGKF TIN A
Sbjct  334   EDNGGGAADPHLALAEDGIPEWVPDGDRRVLKGGGFKNNLTPNVIVAKDGSGKFKTINEA  393

Query  973   LKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQ  1152
             L AMP  Y GRYVI+VK G+Y E V +TKKM +VTMYGDGS+K+IVTG K+ ADGL+T++
Sbjct  394   LAAMPKTYSGRYVIYVKEGVYAEYVTITKKMASVTMYGDGSRKSIVTGSKNFADGLTTFK  453

Query  1153  TATFAVVGEGFMAQFIGFRNTA  1218
             TATFA  G+GFMA  +GF+NTA
Sbjct  454   TATFAAQGDGFMAIGMGFQNTA  475



>ref|XP_009419138.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=557

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 193/305 (63%), Gaps = 13/305 (4%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEV-  501
             +SV A C  TD++  CERT+ +A     S    PKE+++ S  AA  E+  A   S  V 
Sbjct  46    KSVSAFCAKTDYQADCERTIGSAINGSSS----PKEVIQASFQAAIDEIQAAFHLSNNVS  101

Query  502   -KQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
              K + P+ KAA   C +LL+DA ++L+ A +  +   +   +    D+  WLSAV++YQ 
Sbjct  102   LKANDPMNKAAFNICRQLLEDADEELNAAFS--ETHDLQGLARRTDDIKTWLSAVISYQQ  159

Query  679   TCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEP--SESHAKRRLLAD-  849
             TC+DG  + E ++ M+  L TA ++ SNA+AIV +L+S+L +F+   + +   RRLL D 
Sbjct  160   TCLDGITEPELQSTMKDGLSTATKVTSNAIAIVDELSSLLKSFKIPINITMGSRRLLVDE  219

Query  850   -GVPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVK  1023
              G P W +   R++L A    Q  PN  VAKDGSGKF TIN A+ AMP  Y GRYVI+VK
Sbjct  220   QGYPSWFSGHDRKLLAAQARGQLTPNVVVAKDGSGKFKTINDAVNAMPKDYSGRYVIYVK  279

Query  1024  AGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIG  1203
             AG+Y E+V+V K  VNV MYGDGS+KT+VTG K+  DG+ T  TATFA +G+GF+A+ +G
Sbjct  280   AGVYKENVIVGKDKVNVLMYGDGSRKTVVTGSKNYVDGVQTVDTATFAALGQGFIAKSMG  339

Query  1204  FRNTA  1218
             F NTA
Sbjct  340   FSNTA  344



>ref|XP_009798263.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Nicotiana sylvestris]
Length=660

 Score =   209 bits (533),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 200/302 (66%), Gaps = 14/302 (5%)
 Frame = +1

Query  328   SVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQ  507
             ++ A+C  T+F  TC   LS   + + S   +P +LL+ ++ AA  E+ K + + G++ +
Sbjct  154   AIGAICAATEFNQTCGDILSKVLQTNASG-AQPADLLKATISAAIDEIAKGIDELGKINK  212

Query  508   DTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCI  687
             D+P K  A  DC  LL DAK DL+++I  + G  I + +S  A+L+N LSA +TYQD C+
Sbjct  213   DSPEKSTAYDDCMSLLADAKKDLNSSIYILDGG-INDVASATAELNNKLSAALTYQDMCV  271

Query  688   DGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLAD--GVPE  861
             DG+P+ ++ T ++ +LK   E   N+LA+ S+L++   T   + ++AKRRLL    GVP 
Sbjct  272   DGYPEADQST-VQTALKKIGEHTINSLAVASELST---TSPKTNNNAKRRLLTTRLGVPT  327

Query  862   WMNDEQRRMLKADIPKQP---PNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGI  1032
             WMN   RRML+ +  K P    NATVAKDGSG F+TIN ALKA+P+ ++GRY I+VK G+
Sbjct  328   WMNQGDRRMLEEEEGKDPKGIANATVAKDGSGDFTTINDALKAVPS-FEGRYFIYVKGGV  386

Query  1033  YDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRN  1212
             Y+E+VVV++  +    +GDGSQK+I+TG K++ D LSTYQ+AT  + G GF A  IGFRN
Sbjct  387   YEENVVVSQANLTF--FGDGSQKSIITGSKNIVDDLSTYQSATVVISGNGFFAYKIGFRN  444

Query  1213  TA  1218
             TA
Sbjct  445   TA  446



>ref|XP_010687597.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=602

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 149/388 (38%), Positives = 228/388 (59%), Gaps = 16/388 (4%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDG--HKR  273
             MAF++F  +S+RR+ ER +K + KI IAV+  L+ L+ +A  VF F     K +    K 
Sbjct  1     MAFEEFGQLSKRRREERAQKYKKKILIAVLCTLLFLLCIAGGVFAFFHFTSKKNSASSKN  60

Query  274   SGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPK-KPKELLRISM  450
              G  S     +  K+  + ++ LC  TD++  C  TL      D S P   P+ +++ ++
Sbjct  61    VGASSSPPQGEQTKTSSKIIELLCDPTDYKKKCADTLVKVVHTDTSNPSIAPRLIVKAAI  120

Query  451   VAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSH  630
              AA  E+ KA+ K+ + K D    KAA + C ++ +D+ D+L  ++    G +  N+   
Sbjct  121   SAAADEVVKAINKTEKFKFDKSHDKAAYEVCKKVFQDSVDELAESLNH-AGQEAKNYHDK  179

Query  631   AADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE  810
              +DL  WLSAV +YQ+TCID F DG+ K  ++ ++  +KE  SN+LA+V+Q++++L  F 
Sbjct  180   ISDLKTWLSAVYSYQETCIDAFDDGDMKKKIKDAVNASKEYVSNSLALVAQISTILEKFA  239

Query  811   PSESHAK---RRLLA---------DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKF  954
              +E   K   R LL           G PEW+  E+R++          N TVAKDGSG F
Sbjct  240   AAEESIKPPARHLLEHGSSPPVDNQGFPEWVGHEERKLAVKATTNLVANITVAKDGSGNF  299

Query  955   STINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
             +TIN  LK++P     R  I++K G Y+E V VTKKM N+TM+G+GSQK+++TG K+  D
Sbjct  300   TTINDCLKSLPENRTERIYIYIKGGFYEEYVTVTKKMKNITMFGEGSQKSVITGNKNFVD  359

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G+ TY+TATFAV+G+GF+   +GF NTA
Sbjct  360   GVRTYETATFAVMGDGFVGIALGFNNTA  387



>ref|XP_002445591.1| hypothetical protein SORBIDRAFT_07g022100 [Sorghum bicolor]
 gb|EES15086.1| hypothetical protein SORBIDRAFT_07g022100 [Sorghum bicolor]
Length=626

 Score =   205 bits (522),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 142/326 (44%), Positives = 197/326 (60%), Gaps = 25/326 (8%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG  495
             S  +SVK +C  TD++D CE++LS A    +++   PK+++R ++   G  +  A  +S 
Sbjct  86    SASKSVKMMCSQTDYKDACEKSLSKAAAAANASASSPKDMVRAAVAVIGDALADAFNRSE  145

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
              +K D P  KAA  DC E+ ++AKDDL   +  I    +   + H  +L   LSAV+ + 
Sbjct  146   VIKSDDPRVKAAVADCKEIYQNAKDDLGRTLHGIDAGGMNGVAKHNYELRVLLSAVIAHM  205

Query  676   DTCIDGFPDGEE-KTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLAD-  849
             +TCIDGFPDG   K  M  ++++ KEL SNALAI+ + +SVL         A RRLL D 
Sbjct  206   ETCIDGFPDGGHLKKQMTATMESGKELTSNALAIIEKASSVLVALHIPGFTAHRRLLGDN  265

Query  850   ---------------GVP------EWMNDEQRRMLKAD--IPKQPPNATVAKDGSGKFST  960
                            G+       E M  ++RR+LK +    K  PN  VAKDGSGKF T
Sbjct  266   DEAENMENQPEVKHSGMSLGELEDEAMAADKRRLLKGNNFQAKLRPNVVVAKDGSGKFKT  325

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             IN AL AMP +Y GRY+I+VK G+Y E V +T+ M NVTMYGDG+ KT++TG ++ ADGL
Sbjct  326   INDALNAMPKQYTGRYLIYVKQGVYQEYVTITRAMENVTMYGDGAMKTVITGSRNFADGL  385

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
             +TY+TATF V G+GF+A  +GFRNTA
Sbjct  386   TTYKTATFNVQGDGFIAIALGFRNTA  411



>ref|XP_010271093.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 187/302 (62%), Gaps = 9/302 (3%)
 Frame = +1

Query  331   VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQD  510
             V +LC  T ++D C  +LS      ++A  +P + LR ++ A   E+ KA++ SG +   
Sbjct  50    VNSLCDSTSYKDNCLNSLSPVA---NNASAEPNDYLRAAIKATTIEVKKALEMSGVIGMA  106

Query  511   TPlkkaaakdc--aellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTC  684
             T             +LL+ A D+LD + + +   ++       A+L NWLSAV++YQ+TC
Sbjct  107   TTSSYDRMSIEDCQDLLQFAVDELDASFSMVGNPEMHPVDDRVAELKNWLSAVVSYQETC  166

Query  685   IDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAK--RRLL-ADGV  855
             +DG  + E KTAM   L  A +L SNALAIVS++A +L   +      K  RRLL  +G 
Sbjct  167   LDGIENPELKTAMNNGLLNATQLTSNALAIVSEVAKILKALDVHLDGTKTNRRLLNVNGY  226

Query  856   PEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGI  1032
             P W +   R++L + D  +  PNA VAKDGSG+F TI AAL A P K  GRYVI+VKAG+
Sbjct  227   PTWFSSADRKLLASQDNGRLTPNAVVAKDGSGQFKTIAAALAAYPKKNNGRYVIYVKAGV  286

Query  1033  YDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRN  1212
             Y+E + VTK+ VNV MYGDG  KTI+TG+K+   G+ T+QTA+F  +G+GF+A+ IGF+N
Sbjct  287   YEEYITVTKEQVNVFMYGDGPTKTIITGRKNNRQGVPTFQTASFTAIGKGFIAKSIGFQN  346

Query  1213  TA  1218
             TA
Sbjct  347   TA  348



>gb|EMT24232.1| Putative pectinesterase/pectinesterase inhibitor 13 [Aegilops 
tauschii]
Length=609

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 231/399 (58%), Gaps = 37/399 (9%)
 Frame = +1

Query  103   AFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVM------EKDDG  264
             AF DF  ++ERRKAE+ ++++ +I IAV  I I+L+         V+ +      EKD  
Sbjct  6     AFGDFGPLTERRKAEKARQVKKRIMIAVGTIAIILIVCG-----IVVTLNGKQKEEKDGS  60

Query  265   HKRSGTKSKTTPLDSG-------KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKK  423
                 G+  K+             K+V +++  +C   D++  CE +L+   + ++S+P  
Sbjct  61    SSEKGSSRKSGGGGGDDDGGGDLKAVKKTITMMCKQVDYQGVCEESLTRCAKANESSPLG  120

Query  424   PKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKG  603
                +LR+++   G+ + +A  ++  +  +  L K A  DC E    AK++L+  +A +  
Sbjct  121   ---VLRLAVRVIGEALTEAFDRAELILTNDLLVKGAIADCKEFFGYAKEELNRTLAGM--  175

Query  604   DKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQ  783
             D   + +     L  WLSAV+T+Q+TCIDGFPDGE K  ++ S    KEL SNALA + +
Sbjct  176   DASDSITKQGYQLSIWLSAVITHQETCIDGFPDGEFKDKVKLSFLKGKELTSNALAFIEK  235

Query  784   LASVLSTFE--------PSESHAKRR----LLADGVPEWMNDEQRRMLKADIPKQP--PN  921
              A+ L+  +          E  A RR    L  DG+PEW+ + +RR+LK    K    PN
Sbjct  236   AATFLAGLKLPQRRLLVEEEGAAPRRAEPALGEDGIPEWVPESERRVLKGGGFKAEVKPN  295

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
               VAKDGSG+F TIN AL AMP KY GRYVI +KAG+YDE V +T +M NVT+ GDGS+ 
Sbjct  296   VVVAKDGSGQFKTINEALIAMPKKYDGRYVIQLKAGVYDEYVTITSQMPNVTLTGDGSKT  355

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TI+TGKK+  DG++T+++ATF   G+GFMA  +GF NTA
Sbjct  356   TIITGKKNFVDGITTFKSATFTAQGDGFMAIGVGFENTA  394



>ref|XP_008646066.1| PREDICTED: uncharacterized protein LOC100384243 isoform X1 [Zea 
mays]
 tpg|DAA48840.1| TPA: hypothetical protein ZEAMMB73_037702 [Zea mays]
Length=630

 Score =   204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 138/340 (41%), Positives = 196/340 (58%), Gaps = 41/340 (12%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG  495
             S  +SVK +C  TD+ D CE++LS A    +++   P++++R ++   G  +  A  +S 
Sbjct  78    SASKSVKMMCAQTDYRDACEKSLSKA--AANASASSPEDIVRAAVAVIGDALGNAFNRSE  135

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
              +K D P  K A  DC E+  +AKDDL   +  I    +   +     L   LSAV+T+ 
Sbjct  136   VIKSDDPRVKGAVADCREIYHNAKDDLARTLHGIDAGGMAGVTKRGYQLRILLSAVITHM  195

Query  676   DTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF----------------  807
             +TCIDGFPDG  K  M  ++++ KEL SNALAI+ + +SVL                   
Sbjct  196   ETCIDGFPDGHLKKQMTGTMESGKELTSNALAIIEKASSVLVALQIPGFTHRRLLGNDEE  255

Query  808   -----EPSESHA---------------KRRLLA--DGVPEWMNDEQRRMLKADI-PKQPP  918
                  EP   H+                RRLL+  +G P+W+N  +RR+LK +   K  P
Sbjct  256   GNKENEPKVQHSGTLLGERDDDVPAADSRRLLSIEEGTPQWVNGPERRLLKGNFQAKLKP  315

Query  919   NATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQ  1098
             N  VAKDGSGKF TIN AL AMP +Y GRY+I+VK G+Y+E V +T+ M NVTMYGDG+ 
Sbjct  316   NVVVAKDGSGKFKTINDALGAMPKQYTGRYLIYVKQGVYEEYVTITRAMENVTMYGDGAM  375

Query  1099  KTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             KT+++G ++  DGL+TY+TATF   G+GF+   +GFRNTA
Sbjct  376   KTVISGSRNFVDGLTTYKTATFNAQGDGFIGIALGFRNTA  415



>gb|AES65624.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=634

 Score =   204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 163/434 (38%), Positives = 237/434 (55%), Gaps = 70/434 (16%)
 Frame = +1

Query  100   MAFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSG  279
             MAF+DFDL+SERRKA  ++ L+ KI I V  ++++   +AA  F  V+V      H  + 
Sbjct  1     MAFEDFDLVSERRKANAKQHLKKKILIGVTSVVLIACVIAAVTF--VIVKRSGPDHNNND  58

Query  280   TKS-KTTPLDSGK--SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISM  450
              K  +  P +  +       V  LC  +++++ C  TL  A + D    K+PK LL + M
Sbjct  59    KKPVQNAPPEPERVDKYSRLVTMLCSHSEYKEKCVTTLKEALKKDPKL-KEPKGLLMVFM  117

Query  451   VAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSH  630
             + A  E++ A  K+  +K  +  +K A +DC +L +DAK+++  +I  +    I   +S 
Sbjct  118   LVAKNEINNAFNKTANLKFASKEEKGAYEDCKQLFEDAKEEMGFSITEVGQLDISKLASK  177

Query  631   AADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASV-----  795
              A+L+NWLSAV++YQDTC DGFP+GE K  ME     +++L SN+LA+VSQ++ +     
Sbjct  178   EAELNNWLSAVISYQDTCSDGFPEGELKKKMEMIFAESRQLLSNSLAVVSQVSQIVNAFQ  237

Query  796   --LSTFE----PSESHAKRRLL--------------------------------------  843
               LS F+     S++HA                                           
Sbjct  238   GGLSGFKLPWGKSDAHAPAPDADTDAVADDDEDLADAPDGAPDADQPIFEAPIGAPGAAP  297

Query  844   -----ADGVPEWMNDEQRRMLKADIP----KQPPNATVAKDGSGKFSTINAALKAMPAKY  996
                   D  P W           D+P    K  PN TVAKDGSG F TI+ AL A+P  Y
Sbjct  298   IGAPRVDAPPSWAAP------AVDLPGSTEKPTPNVTVAKDGSGDFKTISEALAAIPQTY  351

Query  997   KGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVG  1176
             KGRYV++VK G+YDE+V VTKKMVN+TMYGDG  K+I+TG K+  DG+ T+QTA+F V+G
Sbjct  352   KGRYVVYVKEGVYDETVTVTKKMVNLTMYGDGGLKSIITGNKNFVDGVRTFQTASFVVLG  411

Query  1177  EGFMAQFIGFRNTA  1218
             +GF+ + +GFRNTA
Sbjct  412   DGFVGRDMGFRNTA  425



>ref|XP_006828574.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
 gb|ERM95990.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
Length=592

 Score =   202 bits (515),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 150/385 (39%), Positives = 237/385 (62%), Gaps = 26/385 (7%)
 Frame = +1

Query  106   FQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSGTK  285
             FQD+  ++ER + ER+K+ + K  I  +      +AL     + V+ + K   H     +
Sbjct  4     FQDYGHLTERGRVERQKRNKQKRVIVALTSAFAALALIIIAAFAVVSLNK---HPEKAQE  60

Query  286   SKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGK  465
              +  P+    S+ +++K++C  TD+++ C  +LS+A + + S    P++L++ ++  A K
Sbjct  61    HQ--PVKISTSM-KAIKSICSPTDYQEACVSSLSSAIKSNSSLTG-PEDLIKAAIKVAKK  116

Query  466   EMDKAVKKSGEVKQD--TPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD  639
             E+ KA   + +++++  + ++K A  +C ELL  A D+LD   + +    + + ++ + D
Sbjct  117   EVIKAFDHASKLRKNARSQMEKEALSNCKELLSYAMDELDETFSGVSVAGLKDLATVSQD  176

Query  640   LDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PS  816
             L NWLSAV+TYQ+TC++G  D   K+ M +++K A +L SN+LAI+++ +SVLS  + P 
Sbjct  177   LKNWLSAVLTYQETCLNGLEDSNAKSDMAEAMKMATQLTSNSLAIITEASSVLSILKVPG  236

Query  817   ESHAKRRLLAD---------GVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINA  969
              S   RRLL+          G P W    +RR+L   + +  PN  VAKDGSG F TI  
Sbjct  237   FS---RRLLSKENHFSEGKGGFPSWFPAGERRLLA--MQEMTPNVAVAKDGSGDFRTITE  291

Query  970   ALKAMP--AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLS  1143
             AL  +P   +  GRYVI++KAG+YDE V VTK+MVNVTMYGDGS+KTI+TG K+  DG  
Sbjct  292   ALSKLPPAKERNGRYVIYIKAGVYDEQVTVTKEMVNVTMYGDGSRKTIITGSKNFIDGTP  351

Query  1144  TYQTATFAVVGEGFMAQFIGFRNTA  1218
             T++TATFA +G+ FMA+ IGFRNTA
Sbjct  352   TFKTATFAAIGDDFMAKAIGFRNTA  376



>ref|XP_010027125.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=567

 Score =   202 bits (513),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 194/319 (61%), Gaps = 17/319 (5%)
 Frame = +1

Query  304   DSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAV  483
             D   S  +SV A+C   D++  C  +LS   +++ ++PK   EL++ ++ A  +E+  A+
Sbjct  37    DQVSSTSKSVAAICAPADYKQACVSSLSAVAKNESASPK---ELIQAAIAATLEEVKAAL  93

Query  484   KKSGEV-KQDTPlkkaaakdcaellkdakddldTAIASIKGDK-IGNFSSHAADLDNWLS  657
              KSG + K  T   +  A +  + L     D   +  S+ GD  +   +   ++L NWLS
Sbjct  94    NKSGSIGKSATNSSQKMAVEDCQDLLKFAVDELQSSFSMVGDSDLHTVNDRVSELQNWLS  153

Query  658   AVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEP--SESHAK  831
             AV++YQ TC+DG    + +  M   +  A EL SNALAIVS ++ +L++F+   + + + 
Sbjct  154   AVISYQQTCLDGVTQPDLQKQMSNGMLNATELTSNALAIVSAISGILTSFKIPFNNTASS  213

Query  832   RRLL-------ADGVPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFSTINAALKAMP  987
             RRLL       ADG P W + E R+++      Q  PNA VAKDGSG +STI AAL A P
Sbjct  214   RRLLEEADAEDADGHPSWWSREDRKLMARQAKGQVTPNAVVAKDGSGHYSTIAAALAAYP  273

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF-  1164
                KGRYVI+VKAG+Y+E + VTK  VN+ MYGDG +KT++TGKK   DG+ST+++A+F 
Sbjct  274   KNNKGRYVIYVKAGVYNEYITVTKDQVNILMYGDGPRKTMITGKKCNRDGVSTFRSASFF  333

Query  1165  -AVVGEGFMAQFIGFRNTA  1218
              AV+G GF+ + +GF+NTA
Sbjct  334   AAVIGNGFIGKSMGFQNTA  352



>ref|XP_009800039.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=586

 Score =   201 bits (512),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 195/329 (59%), Gaps = 31/329 (9%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKEL---LRISMVAAGKEMDKAVK  486
             +  +S+ ++C  TD++  C  +LS+   +  + PK   E    + I  V AG E   ++ 
Sbjct  47    TTSKSIASVCSQTDYKKACVNSLSSMANNQSATPKDFIEKAIEVAIQEVRAGMERSASI-  105

Query  487   KSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVM  666
               G+ +    L+K A +DC +LL  A D+L  + +S+  +++ N +    +L NWLSAV+
Sbjct  106   --GKAEAHDSLQKMATEDCKDLLHFAIDELQASFSSVGDNELHNIADREIELKNWLSAVI  163

Query  667   TYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE----------PS  816
             +YQ TC+DGF   E K A+  SL  A +L  N LAIV+ ++ +LS F            +
Sbjct  164   SYQQTCMDGFTQPELKNAISTSLLNATQLTDNVLAIVATISEILSAFNIPIGNSSNTSSA  223

Query  817   ESHAKRRLLA-------------DGVPEWMNDEQRRMLKA--DIPKQPPNATVAKDGSGK  951
              +   RRLL              +G P W+    R++L A  + P+ PPNA VAKDGSG+
Sbjct  224   TTATSRRLLEANNDDEEAVHNTENGFPAWLPSGDRKLLAARNNNPQSPPNAVVAKDGSGQ  283

Query  952   FSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA  1131
             ++TI AAL A P   KGRYVI+VKAGIYDE + +TK  VN+ MYGDG +KTIVTGKK   
Sbjct  284   YNTIAAALAAYPKNLKGRYVIYVKAGIYDEYITITKDQVNIFMYGDGPRKTIVTGKKCNR  343

Query  1132  DGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             DG++TYQ+A+F+ VG GF+A+ +GF+N A
Sbjct  344   DGVTTYQSASFSAVGNGFIAKSMGFQNIA  372



>ref|NP_001169525.1| pectinesterase [Zea mays]
 gb|ACN34013.1| unknown [Zea mays]
 tpg|DAA40126.1| TPA: pectinesterase [Zea mays]
Length=630

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 170/424 (40%), Positives = 239/424 (56%), Gaps = 65/424 (15%)
 Frame = +1

Query  103   AFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEK------DDG  264
             AF DF  ++ERR+AE+ ++ Q +  +  V  + ++  L    +Y VM   K      D  
Sbjct  5     AFGDFGPLTERRRAEKARQ-QRRRIMIAVGTVSIIAILIVIGWYAVMYSGKKSSSDGDHN  63

Query  265   HKRS--------------------------GTKSKTTPLDSGKSVGESVKALCHGTDFED  366
             HK S                          G+ SKT      K+V +S+KA+C  TD+ D
Sbjct  64    HKSSSSPAKGKSSGGSDSESEAETETETESGSDSKTDL----KAVSKSIKAMCSQTDYTD  119

Query  367   TCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdca  546
              CE++L  A    +++   PK+++R ++   G  + +A  ++  +  + PL K A  DC 
Sbjct  120   ACEKSLGKAA---NASSSSPKDIIRSAVEVIGDAIGQAFDRADLILSNDPLVKGAVADCK  176

Query  547   ellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAME  726
             E+  DAKDDL++ +  +  DK G  +     L  WLSAV+   +TCIDGFPD E KT ++
Sbjct  177   EVFADAKDDLNSTLMGVD-DKDG-IAKQGYQLRIWLSAVIANMETCIDGFPDEEFKTKVK  234

Query  727   KSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA------------------DG  852
             +S    KEL SNALA++ + +S+LS  +     +KRRLL                   DG
Sbjct  235   ESFTEGKELTSNALALIEKGSSLLSALK---GVSKRRLLEEEQGAAAAASQAGPALDKDG  291

Query  853   VPEWMNDEQRRMLKADIPKQP--PNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKA  1026
             +PEW+ D +RR+LK    K    PN  VAKDGSGKF TIN AL AMP  Y GRYVI VK 
Sbjct  292   IPEWVPDGERRVLKGGGFKNTLTPNVVVAKDGSGKFKTINEALSAMPKTYDGRYVIQVKE  351

Query  1027  GIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGF  1206
             G+Y+E V +TK M NVT+ GDGS+K+IVTGKKS ADG++T++TATF   G+GFMA  +GF
Sbjct  352   GVYEEYVTITKTMKNVTLLGDGSKKSIVTGKKSFADGITTFKTATFTAQGDGFMAIGMGF  411

Query  1207  RNTA  1218
             +NTA
Sbjct  412   QNTA  415



>ref|XP_010248006.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Nelumbo nucifera]
Length=438

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 129/325 (40%), Positives = 192/325 (59%), Gaps = 10/325 (3%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
             H +    SK     S  +  +SV A+C    +ED+C RTL+   +++ + P    + L+ 
Sbjct  30    HPKDDLSSKDIASGSTSTTMKSVSAICASAYYEDSCIRTLTPVAKNESATPH---DYLKA  86

Query  445   SMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdc--aellkdakddldTAIASIKGDKIGN  618
             S  A  +E+  A++K G + +D              EL++ A  +L +AI+ +   K   
Sbjct  87    SFEAIVEEVQAALEKFGVIGKDANSSIDKMAVGDCKELMQYAISELQSAISMVNDPKRHP  146

Query  619   FSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVL  798
              S   A+L NWLSAV++Y++TC +GF   + K++ME  L  A +L  NALAIV++L+++L
Sbjct  147   ASDXVAELKNWLSAVVSYEETCTEGFEHPKLKSSMENGLLNATQLTGNALAIVTELSAIL  206

Query  799   STFE---PSESHAKRRLL-ADGVPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFSTI  963
                     +  +++RRLL A G P W   + R++L      Q  PNA VAKDGSG++ TI
Sbjct  207   RALNIRLDTNINSRRRLLDAQGYPTWFTLKDRKLLALQGNGQLTPNAVVAKDGSGQYKTI  266

Query  964   NAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLS  1143
               A+ A P     RYVI+VKAG YDE ++VTK   N+ MYGDG   TIVTGKKS A G S
Sbjct  267   AEAIAACPKNSVSRYVIYVKAGTYDEYIIVTKGQNNIFMYGDGPTSTIVTGKKSYATGTS  326

Query  1144  TYQTATFAVVGEGFMAQFIGFRNTA  1218
             T++TA+F+V+G+GF+A+ +GF NTA
Sbjct  327   TFRTASFSVIGDGFIAKSMGFENTA  351



>ref|XP_010694101.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=569

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 130/332 (39%), Positives = 203/332 (61%), Gaps = 19/332 (6%)
 Frame = +1

Query  271   RSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISM  450
             R    S     D   S  ++++A+C  TD++D C  +L++   +  +  K   + +++++
Sbjct  27    RRANTSNHPNHDPLSSKSKAIQAICGPTDYKDACVTSLNSVANNQSATLK---DYIQVAI  83

Query  451   VAAGKEMDKAVKKSGEVKQDT--PlkkaaakdcaellkdakddldTAIASIKGDKIGNFS  624
              +    + ++++KS  + ++   PL K A  DC ELL+ A D+L + +         + +
Sbjct  84    SSTIDAVKQSIEKSDSIGKEANDPLNKMAFADCKELLQLATDELQSLLRDTNDTNFSSLT  143

Query  625   SHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLST  804
             +   DL NWLSA ++YQ +C+DG  + + K  M K LK   +L SN LAIVS+ + +LS+
Sbjct  144   NRENDLKNWLSATISYQQSCLDGVENSDLKEKMTKGLKITSQLTSNMLAIVSEFSPILSS  203

Query  805   F--EPSESHAKRRLLA----------DGVPEWMNDEQRRML-KADIPKQPPNATVAKDGS  945
             F    + S   RRLL           DG P W++ E R++L + +I    PNA VA+DGS
Sbjct  204   FGINSNASINSRRLLNINENVSKFGKDGYPNWISTEDRKLLSRININNPFPNAIVAQDGS  263

Query  946   GKFSTINAALKAM-PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKK  1122
             G+F TI+ A+ A  P  +KGRYVI+VKAG+Y+E V++TK  VN+ MYGDG +KTIVTG+K
Sbjct  264   GQFRTISQAIAAYNPKNFKGRYVIYVKAGLYNEQVLITKDQVNIFMYGDGPRKTIVTGRK  323

Query  1123  SLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +  DG+STYQ+ATFAV+G GF+ + +GF+NTA
Sbjct  324   NNRDGVSTYQSATFAVIGNGFIGKSMGFQNTA  355



>ref|XP_002275000.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=570

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 131/333 (39%), Positives = 199/333 (60%), Gaps = 20/333 (6%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVG---ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKEL  435
             H R G KS  T  D  K +    ++V A+C  TD++  C  +  T   +  + PK   + 
Sbjct  28    HGRGGHKS--TDGDDEKVLSTTTKAVAAICSPTDYKQQCISSFQTLANNHSATPK---DF  82

Query  436   LRISMVAAGKEMDKAVKKSGEV--KQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
             L  ++    KE+ +A+ KS  +    ++  ++  A +  + L         A  S+ GD 
Sbjct  83    LMAAIDITMKEVKEAIGKSESIGLAGNSSGRQKMATEDCQDLLQLAIGELQASFSMVGDA  142

Query  610   -IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEE-KTAMEKSLKTAKELGSNALAIVSQ  783
              +   +  A DL NWLSAV++YQ +C+DGF +  E K+A++  L  A +L SNALAIVS+
Sbjct  143   AMHTINDRAQDLKNWLSAVISYQQSCMDGFDETPEVKSAIQNGLLNATQLTSNALAIVSE  202

Query  784   LASVLSTFEP--SESHAKRRLL-----ADGVPEWMNDEQRRML-KADIPKQPPNATVAKD  939
             ++++L++F    + + + RRL      +D  P W +   R++L + D  K  PNA VA D
Sbjct  203   ISAILTSFNIPLNFTSSFRRLQEATEESDQYPSWFSAADRKLLGRVDNGKVTPNAVVALD  262

Query  940   GSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGK  1119
             GSG++ +I AAL A P    GRYVI+VKAGIYDE + + K +VN+ MYGDG +KT+VTGK
Sbjct  263   GSGQYKSIGAALAAYPKNLNGRYVIYVKAGIYDEYITIEKNLVNIFMYGDGPRKTMVTGK  322

Query  1120  KSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             KS  DG++TY+T+TF+V+G GF+ + +GFRNTA
Sbjct  323   KSFLDGITTYKTSTFSVIGNGFICKSMGFRNTA  355



>emb|CBI26012.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 131/333 (39%), Positives = 199/333 (60%), Gaps = 20/333 (6%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVG---ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKEL  435
             H R G KS  T  D  K +    ++V A+C  TD++  C  +  T   +  + PK   + 
Sbjct  28    HGRGGHKS--TDGDDEKVLSTTTKAVAAICSPTDYKQQCISSFQTLANNHSATPK---DF  82

Query  436   LRISMVAAGKEMDKAVKKSGEV--KQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
             L  ++    KE+ +A+ KS  +    ++  ++  A +  + L         A  S+ GD 
Sbjct  83    LMAAIDITMKEVKEAIGKSESIGLAGNSSGRQKMATEDCQDLLQLAIGELQASFSMVGDA  142

Query  610   -IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEE-KTAMEKSLKTAKELGSNALAIVSQ  783
              +   +  A DL NWLSAV++YQ +C+DGF +  E K+A++  L  A +L SNALAIVS+
Sbjct  143   AMHTINDRAQDLKNWLSAVISYQQSCMDGFDETPEVKSAIQNGLLNATQLTSNALAIVSE  202

Query  784   LASVLSTFEP--SESHAKRRLL-----ADGVPEWMNDEQRRML-KADIPKQPPNATVAKD  939
             ++++L++F    + + + RRL      +D  P W +   R++L + D  K  PNA VA D
Sbjct  203   ISAILTSFNIPLNFTSSFRRLQEATEESDQYPSWFSAADRKLLGRVDNGKVTPNAVVALD  262

Query  940   GSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGK  1119
             GSG++ +I AAL A P    GRYVI+VKAGIYDE + + K +VN+ MYGDG +KT+VTGK
Sbjct  263   GSGQYKSIGAALAAYPKNLNGRYVIYVKAGIYDEYITIEKNLVNIFMYGDGPRKTMVTGK  322

Query  1120  KSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             KS  DG++TY+T+TF+V+G GF+ + +GFRNTA
Sbjct  323   KSFLDGITTYKTSTFSVIGNGFICKSMGFRNTA  355



>ref|XP_002447958.1| hypothetical protein SORBIDRAFT_06g018850 [Sorghum bicolor]
 gb|EES12286.1| hypothetical protein SORBIDRAFT_06g018850 [Sorghum bicolor]
Length=563

 Score =   197 bits (500),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 135/331 (41%), Positives = 195/331 (59%), Gaps = 22/331 (7%)
 Frame = +1

Query  271   RSGTKSK---TTPLDSGKSV-GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             RSG K+      P D+  +  G+SVK+LC  T ++D+CE+TLS A     +  + PKE+ 
Sbjct  27    RSGKKAGDNFNVPGDASLATSGKSVKSLCAPTLYKDSCEKTLSQA----TNGTENPKEIF  82

Query  439   RISMVAAGKEMDKAVKKS---GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
                   A + +  AV++S   GE K  +     +A++  + L +   D    +  + G  
Sbjct  83    HSVAKVALESVKTAVEQSKNIGEAKA-SDKMTESAREDCKKLLEDAVDDLRGMLDMAGGD  141

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             I    S + DL+ WL+ VMT+ DTCIDGF D + +  M   L+ A EL SNALAI + L 
Sbjct  142   IKVLFSRSDDLETWLTGVMTFMDTCIDGFVDEKLRADMHSVLRNATELSSNALAITNSLG  201

Query  790   SVLSTFEPS--ESHAKRRLLAD-----GVPEWMNDEQRRMLKADIPKQP-PNATVAKDGS  945
              +L   +    +  ++RRLL+      G P WM   +R++L A    QP PNA VAKDGS
Sbjct  202   GILKKLDLDMFKKDSRRRLLSSEQDEKGWPVWMRSPERKLLAAG--NQPKPNAVVAKDGS  259

Query  946   GKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKS  1125
             G+F +I  A+ AMP   +GRYVI+VKAG+YDE V++ K  VN+ MYGDG + T VTG+KS
Sbjct  260   GQFKSIQQAVDAMPKGQQGRYVIYVKAGVYDEIVMIAKDKVNIFMYGDGPKNTRVTGQKS  319

Query  1126  LADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              ADG++T +TATF++   GF+ + +GF NTA
Sbjct  320   FADGITTMKTATFSIEAAGFICKNMGFHNTA  350



>ref|XP_006338009.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Solanum tuberosum]
Length=584

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 133/328 (41%), Positives = 192/328 (59%), Gaps = 30/328 (9%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS-  492
             +  +S+ ++C  TDF+ +C   LS+   +  + PK   E L+ ++  A +E+   +++S 
Sbjct  46    TTSKSIASVCSQTDFKKSCVNCLSSMANNQSATPK---EFLQKAIEVAIQEVRIGIERST  102

Query  493   --GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVM  666
               G+ +    L+K A  DC ELL+ A D+L  + +S+    +   +    +L NWLSAV 
Sbjct  103   SIGKAEAHDSLQKMATDDCKELLEYAIDELQASFSSVGDSSVHTIADRETELKNWLSAVF  162

Query  667   TYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE----------PS  816
             +YQ TCIDGF   E + A+  SL  A +L  N LA+V  +  +LS F            +
Sbjct  163   SYQQTCIDGFTQPELQKAISTSLLNATQLTDNVLAMVDAMTEILSKFNIPIGNKTDTTSA  222

Query  817   ESHAKRRLLAD-------------GVPEWMNDEQRRMLKADIPKQP-PNATVAKDGSGKF  954
             E+ A RRLL +             G P W++   R++L A     P PN  VAKDGSG+F
Sbjct  223   ETAASRRLLENEDIDKQEANNTNNGYPAWLSSSDRKLLAASNNGNPSPNVVVAKDGSGQF  282

Query  955   STINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
             +TI AAL A P   KGRY I+VKAGIYDE ++VTK  VNV MYGDG +KTIVTG KS  +
Sbjct  283   NTIAAALAAYPKNLKGRYTIYVKAGIYDEYIIVTKDQVNVFMYGDGPRKTIVTGHKSALN  342

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G+STYQ+A+F+ +G GF+ + +GF+NTA
Sbjct  343   GVSTYQSASFSAIGNGFIGKSMGFQNTA  370



>ref|XP_006851559.1| hypothetical protein AMTR_s00040p00188020 [Amborella trichopoda]
 gb|ERN13140.1| hypothetical protein AMTR_s00040p00188020 [Amborella trichopoda]
Length=586

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 184/305 (60%), Gaps = 8/305 (3%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLS-TAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEV  501
              ++  +C  TD +  C  +LS   G +  +   +PKEL+  S+ A  K++  A+K S  +
Sbjct  72    RAITTICGPTDHKQACIDSLSQIVGNNASATALEPKELIAASVKATIKQVTGALKLSDSM  131

Query  502   K------QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAV  663
             K       D    + A  DC +LL  A D+L  + + I G+ + +    A  L  WLSAV
Sbjct  132   KATATNGTDGRRLEGAIADCKQLLSFAIDELQDSFSDISGNDMKSLPDRAYQLRVWLSAV  191

Query  664   MTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLL  843
             +TY +TC+DG    E K  M   L  A  + SNALAI+++++ +LS+F+   S   RRLL
Sbjct  192   LTYHETCVDGLDHPELKATMRDGLANATVMTSNALAIITEISKILSSFQIPFSIPSRRLL  251

Query  844   ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVK  1023
               G PEW+N+  RR+L      +P NA VAKDGSG++  I+ A+ A+P  ++GR++I+VK
Sbjct  252   ETGFPEWLNEGDRRLLAGGGGVRP-NAVVAKDGSGQYKKISDAVAAIPENFQGRWIIYVK  310

Query  1024  AGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIG  1203
             AGIY+E V + K   NV MYGDG++KTIV+G+ +  DG ST+QTATF  +G+GF+ + + 
Sbjct  311   AGIYEEKVTIPKDANNVFMYGDGARKTIVSGRLNYVDGTSTFQTATFTALGDGFLCKSMA  370

Query  1204  FRNTA  1218
             F NTA
Sbjct  371   FSNTA  375



>tpg|DAA37472.1| TPA: hypothetical protein ZEAMMB73_350063 [Zea mays]
Length=562

 Score =   196 bits (498),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 195/309 (63%), Gaps = 17/309 (6%)
 Frame = +1

Query  322   GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS---  492
             G+SV++LC  T ++++CE+TLS A     +  + PKE+       A + +  AV++S   
Sbjct  48    GKSVESLCAPTLYKESCEKTLSQA----TNGTENPKEVFHSVAKVALESVKTAVEQSKTI  103

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
             GE K    + ++A +DC +LL+DA DDL   +    GD I    S + DL+ WL+ VMT+
Sbjct  104   GEAKASDSMTESAREDCKKLLEDAVDDLRGMLEMAGGD-IKVLISRSDDLETWLTGVMTF  162

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS--ESHAKRRLLA  846
              DTCIDGF D + K  M   L+ A EL SNALAI + L  +L   +    +  ++RRLL+
Sbjct  163   MDTCIDGFVDEKLKADMHTVLRNATELSSNALAITNSLGGILKKLDLGMFKKDSRRRLLS  222

Query  847   D----GVPEWMNDEQRRMLKADIPKQP-PNATVAKDGSGKFSTINAALKAMPAKYKGRYV  1011
             +    G P WM   +R++L A    QP PNA VAKDGSG+F TI  A+ AMP   +GRYV
Sbjct  223   EQDEKGWPVWMRSPERKLLAAG--NQPKPNAVVAKDGSGQFKTIQQAVDAMPKGQQGRYV  280

Query  1012  IFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMA  1191
             I+VKAG+YDE V+V K  VNV MYGDG +++ VTG+KS ADG++T +TATF+V   GF+ 
Sbjct  281   IYVKAGLYDEIVMVPKDKVNVFMYGDGPKQSRVTGRKSFADGITTMKTATFSVEASGFIC  340

Query  1192  QFIGFRNTA  1218
             + +GF NTA
Sbjct  341   KNMGFHNTA  349



>ref|XP_002275819.3| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=582

 Score =   196 bits (499),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 129/310 (42%), Positives = 188/310 (61%), Gaps = 15/310 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ++C   D++D C +TLS   ++  + PK   + ++ ++    KE+  ++  S ++ 
Sbjct  62    KAVASVCATADYKDACMQTLSPVAKNGSATPK---DYIQAAVQVTMKEIKSSMNLSEKLV  118

Query  505   QDTPlkkaaakdc--aellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
             Q T   +         +LL+ A D+L  + +S+    +      + ++ NWLSAV++YQ 
Sbjct  119   QATNDSRTQMALGDCKDLLQFAIDELQESFSSVGESDLQTLDQLSTEIMNWLSAVVSYQQ  178

Query  679   TCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE--SHAKRRLLA--  846
             TC+DG  +   +TAM+K L  A +L SNALAIVS ++ +L+ F  S       RRLL   
Sbjct  179   TCLDGVIEPRFQTAMQKGLLNATQLTSNALAIVSDISQILTKFNVSLDLKPNSRRLLGEI  238

Query  847   -----DGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
                  DG P W +   R++L   D  +  PNA VAKDGSG F+TI AAL A P   KGRY
Sbjct  239   DVLGHDGYPTWFSATDRKLLALHDNGRLTPNAIVAKDGSGHFTTIAAALAAYPKNLKGRY  298

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             VI+VKAGIY E + VTK  VNV MYGDG +KTIVTG KS  DG++TY+TATF+ +G+GF+
Sbjct  299   VIYVKAGIYREYITVTKDQVNVYMYGDGPRKTIVTGTKSYRDGITTYKTATFSAIGKGFV  358

Query  1189  AQFIGFRNTA  1218
             A+ +GF NTA
Sbjct  359   ARSMGFVNTA  368



>gb|EAY94388.1| hypothetical protein OsI_16156 [Oryza sativa Indica Group]
Length=568

 Score =   196 bits (498),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 204/333 (61%), Gaps = 22/333 (7%)
 Frame = +1

Query  271   RSGTKSK---TTPLDSGKSV-GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             RSG K+    T P ++  +  G+SV++LC  T ++++CE+TL+TA     S  + PKE+ 
Sbjct  28    RSGNKAGDNFTVPGEANLATSGKSVESLCAPTLYKESCEKTLTTA----TSGTENPKEVF  83

Query  439   RISMVAAGKEMDKAVKKS---GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
                  +A + +  AV+KS   GE K    + ++A +DC  LL+D+ DDL   I    GD 
Sbjct  84    STVAKSALESIKSAVEKSKAIGEAKTSDSMTESAREDCKALLEDSVDDLRGMIEMAGGD-  142

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             +    S + DL++WL+ VMT+ DTC DGF D + K  M   L+ A EL SNALAI + L 
Sbjct  143   VKVLFSRSDDLEHWLTGVMTFMDTCADGFADEKLKADMHSVLRNASELSSNALAITNTLG  202

Query  790   SVLSTFE----PSESHAKRRLLAD-----GVPEWMNDEQRRMLKADIPKQP-PNATVAKD  939
             ++    +      E+   R L+A+     G P WM    R++L +    +P PNA VA+D
Sbjct  203   AIFKKLDLDMFKGENPIHRSLIAEQETVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAQD  262

Query  940   GSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGK  1119
             GSG+F TI  A+ +MP  ++GRYVI+VKAG+YDE V+V K  VN+ MYGDG +++ VTG+
Sbjct  263   GSGQFKTIQEAVNSMPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKRSRVTGR  322

Query  1120  KSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             KS ADG++T +TATF+V   GF+ + +GF NTA
Sbjct  323   KSFADGITTMKTATFSVEAAGFICKNMGFHNTA  355



>dbj|BAK05856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   196 bits (499),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 153/403 (38%), Positives = 229/403 (57%), Gaps = 44/403 (11%)
 Frame = +1

Query  103   AFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSGT  282
             AF DF  ++ERRKAE+ ++++ +I IA   I I+L+    A    VM+  K    K   +
Sbjct  4     AFGDFGPLTERRKAEKARQVRKRIMIAGGTIAIILIVCGIA----VMLNGKHKEEKAGSS  59

Query  283   KSKTTPL----------DSG--KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKP  426
               K +            D G  K+V +++  +C   D++  CE +L+      +S+P   
Sbjct  60    SKKGSSSKGKSGGGGSEDGGDLKAVKKTITLMCQQVDYQGVCEESLTRCANASESSPMG-  118

Query  427   KELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGD  606
               ++R+++   G+ + +A  ++  +  D P  KAA  DC E    AK++L+  +  +  D
Sbjct  119   --VVRLAVRVIGEALAQAFDRTDLILSDEPHVKAAIADCKEFFLYAKEELNRTLGGM--D  174

Query  607   KIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQL  786
                + +     L  WLSAV+ +Q+TCIDGFPDGE K  +++S    KEL SNALA++ + 
Sbjct  175   AKDSITKQGYQLRIWLSAVIAHQETCIDGFPDGEFKDKVKESFIKGKELTSNALALIEKA  234

Query  787   ASVLSTFEPSESHAKRRLLA-----------------DGVPEWMNDEQRRMLKADIPKQP  915
             A++L+  +  +    RRLL                  DG+PEW+ + +RR+LK    K  
Sbjct  235   ATLLAGLKLPQ----RRLLVEEEGAAPPRRAEPVLGEDGIPEWVPESERRVLKGGGFKGE  290

Query  916   --PNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGD  1089
                N  VAKDGSG+F TIN AL AMP KY GRYVI VK G+Y+E V +T +M NVT+ GD
Sbjct  291   VKANVVVAKDGSGQFKTINEALNAMPKKYDGRYVIQVKEGVYEEYVTITGQMPNVTLNGD  350

Query  1090  GSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             GS+KTI+TGKK+  DG +T+++ATF   G+GFMA  +GF NTA
Sbjct  351   GSKKTIITGKKNFVDGTTTFKSATFTAQGDGFMAIGVGFENTA  393



>ref|NP_001132793.1| pectinesterase [Zea mays]
 gb|ACF81789.1| unknown [Zea mays]
 tpg|DAA61605.1| TPA: pectinesterase [Zea mays]
Length=623

 Score =   197 bits (500),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 201/318 (63%), Gaps = 24/318 (8%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             K+V +S+KA+C  TD+ D CE++L  A    +++   PK+++R ++   G  + +A  ++
Sbjct  99    KAVSKSIKAMCSQTDYTDACEKSLGKAA---NASSSSPKDIIRSAVEVIGDAIGQAFDRA  155

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
               +  + PL K A  DC E+  DAKDDL++ +  +  DK G  +  +  L  WLSAV+  
Sbjct  156   DLILSNDPLVKGAVADCKEVFADAKDDLNSTLKGVD-DKDG-IAKQSYQLRIWLSAVIAN  213

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA--  846
              +TC+DGFPD E K  +++S    KEL SNALA++ + +S+LS  +     +KRRLL   
Sbjct  214   METCVDGFPDDEFKAKVKESFNDGKELTSNALALIEKGSSLLSVLK---GGSKRRLLEEE  270

Query  847   ------------DGVPEWMNDEQRRMLKADIPKQP--PNATVAKDGSGKFSTINAALKAM  984
                         DG+PEW+ D +RR+LK    K    PN  VAKDGSGKF TIN AL AM
Sbjct  271   GEPAQAGPALDKDGIPEWVPDGERRVLKGGGFKSTLTPNVVVAKDGSGKFKTINEALAAM  330

Query  985   PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF  1164
             P  Y GRYVI VK G+Y+E V +TK M NVT  GDGS+K+IVTGKKS ADG++T++TATF
Sbjct  331   PKTYDGRYVIQVKEGVYEEYVTITKTMKNVTFLGDGSKKSIVTGKKSFADGITTFKTATF  390

Query  1165  AVVGEGFMAQFIGFRNTA  1218
                G+GFMA  +GF+NTA
Sbjct  391   TAQGDGFMAIGMGFQNTA  408



>gb|EMS59431.1| Putative pectinesterase/pectinesterase inhibitor 28 [Triticum 
urartu]
Length=608

 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 150/395 (38%), Positives = 227/395 (57%), Gaps = 30/395 (8%)
 Frame = +1

Query  103   AFQDFDLISERRKAERRKKLQMKiaiavvlilillvalaaavFYFVMVMEKDDGHKRSGT  282
             AF DF  ++ERRKAE+ +  Q+K  I V +  I ++ +   +   +   +K++    S  
Sbjct  6     AFGDFGPLTERRKAEKAR--QVKKRIMVAVGTIAIILIVCGIVVTLNGKQKEEKDGSSSK  63

Query  283   KSKTTPLDSG---------KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKEL  435
             K      D G         K+V +++  +C   D++  CE +L+   + ++S+P     +
Sbjct  64    KGSKGKSDGGGGEDGGGDLKAVKKTITMMCKQVDYQGVCEESLTRCAKANESSPLG---V  120

Query  436   LRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIG  615
             LR+++   G+ + +A  ++  +  +  L K A  DC E    AK++L+  +AS+  D   
Sbjct  121   LRLAVRVIGEALSEAFDRAELILTNDLLVKGAIADCKEFFGYAKEELNRTLASM--DAND  178

Query  616   NFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASV  795
             + +     L  WLSAV+T+Q+TCIDGFPDGE K  ++      KEL SNALA + + A+ 
Sbjct  179   SITKQGYQLSIWLSAVITHQETCIDGFPDGEFKDKVKLMFLKGKELTSNALAFIEKAATF  238

Query  796   LSTF------------EPSESHAKRRLLADGVPEWMNDEQRRMLKADIPKQP--PNATVA  933
             L+              E +   A+  L  DG+PEW+ + +RR+LK    K    PN  VA
Sbjct  239   LAGLKLPQRRLLVEEKEAAPRRAEPALGKDGIPEWVPESERRVLKGGGFKAEVKPNVVVA  298

Query  934   KDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVT  1113
             KDGSG+F TIN AL AMP KY GRYVI +KAG+YDE V +T +M NVT+ GDGS+ TI+T
Sbjct  299   KDGSGQFKTINEALIAMPKKYDGRYVIQLKAGVYDEYVTITSQMPNVTLTGDGSKTTIIT  358

Query  1114  GKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             GKK+  DG++T+++ATF   G+GFMA  +GF NTA
Sbjct  359   GKKNFVDGITTFKSATFTAQGDGFMAIGVGFENTA  393



>ref|NP_001052981.1| Os04g0458900 [Oryza sativa Japonica Group]
 emb|CAD40902.1| OSJNBa0036B21.20 [Oryza sativa Japonica Group]
 dbj|BAF14895.1| Os04g0458900 [Oryza sativa Japonica Group]
 gb|EAZ30965.1| hypothetical protein OsJ_15044 [Oryza sativa Japonica Group]
 dbj|BAH00497.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45776.1| ORW1943Ba0077G13.4 [Oryza rufipogon]
Length=568

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 131/333 (39%), Positives = 198/333 (59%), Gaps = 22/333 (7%)
 Frame = +1

Query  271   RSGTKSK---TTPLDSGKSV-GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             RSG K+    T P ++  +  G+SV++LC  T ++++CE+TL+TA     S  + PKE+ 
Sbjct  28    RSGNKAGDNFTVPGEANLATSGKSVESLCAPTLYKESCEKTLTTA----TSGTENPKEVF  83

Query  439   RISMVAAGKEMDKAVKKS---GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
                  +A + +  AV+KS   GE K  +     +A++  + L +   D    +  + G  
Sbjct  84    STVAKSALESIKSAVEKSKAIGEAKT-SDSMTESAREDCKALLEDSVDDLRGMVEMAGGD  142

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             +    S + DL++WL+ VMT+ DTC DGF D + K  M   L+ A EL SNALAI + L 
Sbjct  143   VKVLFSRSDDLEHWLTGVMTFMDTCADGFADEKLKADMHSVLRNASELSSNALAITNTLG  202

Query  790   SVLSTFE----PSESHAKRRLLAD-----GVPEWMNDEQRRMLKADIPKQP-PNATVAKD  939
             ++    +      E+   R L+A+     G P WM    R++L +    +P PNA VA+D
Sbjct  203   AIFKKLDLDMFKGENPIHRSLIAEQETVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAQD  262

Query  940   GSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGK  1119
             GSG+F TI  A+ +MP  ++GRYVI+VKAG+YDE V+V K  VN+ MYGDG +++ VTG+
Sbjct  263   GSGQFKTIQEAVNSMPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKRSRVTGR  322

Query  1120  KSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             KS ADG++T +TATF+V   GF+ + +GF NTA
Sbjct  323   KSFADGITTMKTATFSVEAAGFICKNMGFHNTA  355



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/326 (39%), Positives = 203/326 (62%), Gaps = 16/326 (5%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKPKELLR  441
             H      SKTTP  S  +  ++++A+C  TD+++TCE++L + AG   D     PKEL++
Sbjct  46    HGEGDQGSKTTPEISSST--KAIQAICQPTDYKETCEKSLMAEAGNTTD-----PKELVK  98

Query  442   ISMVAAGKEMDKAVKKSGEVKQDT--PlkkaaakdcaellkdakddldTAIASIKGDKIG  615
             +    A + +++A++ S  +++ +  P    A ++C ELL+ A DDL+ +   I   ++ 
Sbjct  99    VGFKIATRSLNEAIRNSTTLQELSKDPRTNQALQNCRELLEYAIDDLNESFERIGTFQMS  158

Query  616   NFSSHAADLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLA  789
                   ADL  WLS  +TY+ TC+DGF +  G+  T M++ LK+A+E+ +N L IV++L+
Sbjct  159   KLDEFVADLKIWLSGALTYEQTCLDGFENTTGDAGTRMQEFLKSAQEMTTNGLGIVNELS  218

Query  790   SVLSTFEPSESHAKRRLLADG---VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFST  960
             ++L + +       RRLL D    +P W++D +RR+++A      P+  VA+DGSGK+ T
Sbjct  219   TILGSLQ-IPGMTGRRLLEDDDHEMPSWISDGKRRLMQAGAAGMKPDLIVAQDGSGKYKT  277

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             INAAL  +P K    +VI+VKAGIY E VV+ K M ++TMYGDG  KT+VTG  +  DG+
Sbjct  278   INAALADVPLKSNKTFVIYVKAGIYKEIVVIPKHMTHLTMYGDGPTKTVVTGSLNFIDGI  337

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
              T++TATF+ +G  F A+ +GF NTA
Sbjct  338   QTFKTATFSAIGANFYARDMGFENTA  363



>ref|XP_006652375.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Oryza brachyantha]
Length=568

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 203/333 (61%), Gaps = 22/333 (7%)
 Frame = +1

Query  271   RSGTKSK---TTPLDSGKSV-GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             RSG K+    T P ++  +  G+SVK+LC  T ++++CE+TL+TA     +  + P+E+ 
Sbjct  28    RSGNKAGDNFTVPGEASLATSGKSVKSLCAPTLYKESCEKTLTTA----SNGTENPREVF  83

Query  439   RISMVAAGKEMDKAVKKS---GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
                   A + +  AV++S   G  K   P+ + A +DC ELL+D+ DDL   +    GD 
Sbjct  84    TAVAKVALESIKSAVERSKDIGSAKSSDPMTEGAREDCKELLEDSVDDLRGMVEMAGGD-  142

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             +    S + DL++WL+ VMT+ DTC DGF D + K  M++ L+ A EL SNALAI + L 
Sbjct  143   VKVLFSRSDDLEHWLTGVMTFMDTCADGFTDEKLKADMQQVLRNASELSSNALAITNSLG  202

Query  790   SVLSTFE----PSESHAKRRLLAD-----GVPEWMNDEQRRMLKADIPKQP-PNATVAKD  939
             ++    +      +S  +R LLA+     G P WM    R++L +    +P PNA VAKD
Sbjct  203   AIFKKLDLDMFKGDSLTRRSLLAEQEMVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAKD  262

Query  940   GSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGK  1119
             GSG+F +I  A+ AMP  + GRYVI+VK G+YDE V+V K  VN+ MYGDG + + VTG+
Sbjct  263   GSGQFKSIQEAVNAMPKGHPGRYVIYVKTGLYDEIVMVPKDKVNIFMYGDGPKSSRVTGR  322

Query  1120  KSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             KS ADG++T +TATF++   GF+ + +GF NTA
Sbjct  323   KSFADGITTMKTATFSIEAAGFICKNMGFHNTA  355



>gb|EPS69324.1| hypothetical protein M569_05439 [Genlisea aurea]
Length=569

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 139/332 (42%), Positives = 194/332 (58%), Gaps = 18/332 (5%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
             H +SG        D+  S  ++V  +C  T F+ +C  TLS  G   ++A   PK+ L  
Sbjct  28    HYKSGDDENKANKDALNSATKNVATICAATTFQKSCVDTLSPIG---NNASATPKDFLAA  84

Query  445   SMVAAGKEMDKAVKKSGEVKQDT--PlkkaaakdcaellkdakddldTAIASIKGDKIGN  618
             ++ AA KE+  A+ + GE  +    P+ K A +DC +L + A  DL  + +++   ++  
Sbjct  85    AINAAVKELQAAMARPGEAAKGATHPIDKMAVEDCKDLFQSAVADLQASFSAVGDSQMHT  144

Query  619   FSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVL  798
              S   A+L NW+SAV++Y   C DGF     ++A+   +  A +L  NALAIV  ++ +L
Sbjct  145   VSDREAELMNWMSAVISYSQACADGFDSPTIRSAVSDGILNATQLTDNALAIVGAISELL  204

Query  799   STFE-PSESHA------KRRLLA-----DGVPEWMNDEQRRMLKADIPKQPPNATVAKDG  942
              +F  P  + A       RRLL      D  P WM    R++L +    QP NA VAKDG
Sbjct  205   KSFNIPLNTTAGAGAATSRRLLEGSADDDVYPLWMPAGDRKLLASGSHPQP-NAVVAKDG  263

Query  943   SGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKK  1122
             SGK+STI+AAL A PA  KGRYVI+VKAG+Y E V V KKMVNV +YGDG +KTIVTG K
Sbjct  264   SGKYSTISAALAAYPANLKGRYVIYVKAGVYHEYVKVDKKMVNVYIYGDGPRKTIVTGSK  323

Query  1123  SLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             S ADG S  ++ TF+V G GF+A+ +GF NTA
Sbjct  324   SYADGYSVMESPTFSVAGNGFIAKSMGFTNTA  355



>ref|XP_002528620.1| Pectinesterase-4 precursor, putative [Ricinus communis]
 gb|EEF33778.1| Pectinesterase-4 precursor, putative [Ricinus communis]
Length=557

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 190/307 (62%), Gaps = 15/307 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGE--  498
             ++V  LC  T++++TC +TLS     D      PKEL++  ++A    + K++  S +  
Sbjct  43    KAVTQLCQPTNYKETCTQTLSGVNSTD------PKELIKAGILAISSSLTKSLNLSDDLV  96

Query  499   VKQDT-PlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             VK  + P  K A +DC  LLK+A ++L   +A +    +   +  A +   WLS++++YQ
Sbjct  97    VKAGSEPRTKLALEDCKTLLKEANEELQDTLAKMSDINLKTIADQADEFRIWLSSIISYQ  156

Query  676   DTCIDGF-PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF----EPSESHAKRRL  840
             + C+DGF  D E K+A++KS +   EL  N L I+  ++ VL +F        S+++R L
Sbjct  157   ELCMDGFDQDNEVKSAVQKSTEFGSELTDNVLNILGGISDVLKSFGLQFNLPGSNSRRLL  216

Query  841   LADGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIF  1017
              ADG P W++   R++L A +  K PPNA VA DGSGKF +IN A+ + P  +KGRYVI+
Sbjct  217   QADGYPTWLSGADRKLLAARNNAKLPPNAVVALDGSGKFKSINDAINSYPNGHKGRYVIY  276

Query  1018  VKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQF  1197
             VKAGIY E+V V K   N+ MYGDG +KTIVTGKKS   G++T+ TA+F V  +GF+ + 
Sbjct  277   VKAGIYHEAVKVPKTHTNIYMYGDGPRKTIVTGKKSFTSGINTWNTASFVVEADGFICKS  336

Query  1198  IGFRNTA  1218
             +GF+NTA
Sbjct  337   MGFQNTA  343



>gb|EAY94391.1| hypothetical protein OsI_16158 [Oryza sativa Indica Group]
Length=568

 Score =   194 bits (492),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 204/333 (61%), Gaps = 22/333 (7%)
 Frame = +1

Query  271   RSGTKSK---TTPLDSGKSV-GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             RSG K+    T P ++  +  G+SV++LC  T ++++CE+TL+TA     S  + PKE+ 
Sbjct  28    RSGNKAGDNFTVPGEANLATSGKSVESLCAPTLYKESCEKTLTTA----TSGTENPKEVF  83

Query  439   RISMVAAGKEMDKAVKKS---GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
                  +A + +  AV+KS   GE K    + ++A +DC  LL+D+ DDL   +    GD 
Sbjct  84    STVAKSALESIKSAVEKSKAIGEAKTSDSMTESAREDCKALLEDSVDDLRGMVEMAGGD-  142

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             +    S + +L++WL+ VMT+ DTC DGF D + K  M   L+ A EL SNALAI + L 
Sbjct  143   VKVLFSRSDELEHWLTGVMTFMDTCADGFADEKLKADMHSVLRNASELSSNALAITNTLG  202

Query  790   SVLSTFE----PSESHAKRRLLAD-----GVPEWMNDEQRRMLKADIPKQP-PNATVAKD  939
             ++    +      E+   R L+A+     G P WM    R++L +    +P PNA VA+D
Sbjct  203   AIFKKLDLDMFKGENPIHRSLIAEQETVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAQD  262

Query  940   GSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGK  1119
             GSG+F TI  A+ +MP  ++GRYVI+VKAG+YDE V+V K  VN+ MYGDG +++ VTG+
Sbjct  263   GSGQFKTIQEAVNSMPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKRSRVTGR  322

Query  1120  KSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             KS ADG++T +TATF+V   GF+ + +GF NTA
Sbjct  323   KSFADGITTMKTATFSVEAAGFICKNMGFHNTA  355



>ref|XP_010276571.1| PREDICTED: uncharacterized protein LOC104611288 [Nelumbo nucifera]
Length=870

 Score =   196 bits (499),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 129/325 (40%), Positives = 193/325 (59%), Gaps = 10/325 (3%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
             H +    +K     S  +  +SV A+C    +ED+C +TL+   +++ + P    + L+ 
Sbjct  30    HPKDDLSTKDITSGSTSTTMKSVSAICASAYYEDSCIKTLTPIAKNESATPH---DYLKA  86

Query  445   SMVAAGKEMDKAVKKSGEVKQDTPlkkaaakd--caellkdakddldTAIASIKGDKIGN  618
             S  A  +E+  A++K G + +D            C EL++ A  +L +AI+ +   K   
Sbjct  87    SFEAIVEEVQAALEKFGVIGKDANSSIDKMAVGDCKELMQYAISELQSAISMVNDPKRHP  146

Query  619   FSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVL  798
              S   A+L NWLSAV++Y++TC +GF   + K++ME  L  A +L  NALAIV++L+++L
Sbjct  147   ASDPIAELKNWLSAVVSYEETCTEGFEHPKLKSSMENGLLNATQLTGNALAIVTELSAIL  206

Query  799   STFEP---SESHAKRRLL-ADGVPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFSTI  963
                     +  +++RRLL A G P W   + R++L      Q  PNA VAKDGSG++ TI
Sbjct  207   RALNIRLDTNINSRRRLLDAQGYPTWFTLKDRKLLALQGNGQLTPNAVVAKDGSGQYKTI  266

Query  964   NAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLS  1143
               A+ A P     RYVI+VKAG YDE ++VTK   N+ MYGDG   TIVTGKKS A G S
Sbjct  267   AEAIAACPKNSVSRYVIYVKAGTYDEYIIVTKGQNNIFMYGDGPTSTIVTGKKSYATGTS  326

Query  1144  TYQTATFAVVGEGFMAQFIGFRNTA  1218
             T++TA+F+V+GEGF+A+ +GF NTA
Sbjct  327   TFRTASFSVIGEGFIAKSMGFENTA  351



>ref|XP_004229041.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=585

 Score =   194 bits (492),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 131/329 (40%), Positives = 190/329 (58%), Gaps = 31/329 (9%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS-  492
             +  +S+ ++C  TDF+ +C  +LS+   +  + PK   E L  ++  A +E+   + +S 
Sbjct  46    TTSKSIASVCSQTDFKKSCVNSLSSMANNQSATPK---EFLLKAIEVAIQEVRIGIDRST  102

Query  493   --GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVM  666
               G+ +   PL+K A  DC ELL+ A D+L  + +S+    +   +    +L NWLSAV 
Sbjct  103   YIGKAEAHDPLQKMATDDCKELLEYAIDELQASFSSVGDSSLHTIAERETELKNWLSAVF  162

Query  667   TYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF----------EPS  816
             +YQ TCIDGF   E +  +  SL  A +L  N LA+V  +  +LS F          + +
Sbjct  163   SYQQTCIDGFTQPEIQKTISTSLLNATQLTDNVLAMVDAMTEILSKFNIPIGKKTDNKSA  222

Query  817   ESHAKRRLLAD--------------GVPEWMNDEQRRMLKADIPKQP-PNATVAKDGSGK  951
             E+ A RRLL +              G P W++   R++L       P PNA VAKDGSG+
Sbjct  223   ETAASRRLLENEDNDEQQASNTKSGGYPAWLSASDRKLLAFSNNGNPAPNAVVAKDGSGQ  282

Query  952   FSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA  1131
             F+TI AAL A P   KGRY I+VKAGIYDE + VTK  VN+ MYGDG +KTI+TG KS  
Sbjct  283   FNTIAAALAAYPKNLKGRYTIYVKAGIYDEYITVTKDQVNIFMYGDGPRKTIITGHKSAL  342

Query  1132  DGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              G+STYQ+A+F+ +G GF+ + +GF+NTA
Sbjct  343   AGVSTYQSASFSAIGNGFIGKSMGFQNTA  371



>gb|ACF79975.1| unknown [Zea mays]
 gb|ACG46952.1| pectinesterase-1 precursor [Zea mays]
 gb|AFW58467.1| pectinesterase [Zea mays]
Length=563

 Score =   193 bits (491),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 141/331 (43%), Positives = 204/331 (62%), Gaps = 22/331 (7%)
 Frame = +1

Query  271   RSGTKSK---TTPLDSGKSV-GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             RSG K+    T P ++  +  G+SVK+LC  T ++++CE+TLS A     +  + PKE+ 
Sbjct  27    RSGKKAGDNFTVPGEASLATSGKSVKSLCAPTLYKESCEKTLSQA----TNGTENPKEVF  82

Query  439   RISMVAAGKEMDKAVKKS---GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
                   A + +  AV++S   GE K    + ++A +DC +LL+DA DDL   +    GD 
Sbjct  83    HSVAKVALESVQTAVEQSKSIGEAKASDSMTESAREDCKKLLEDAADDLRGMLEMAGGD-  141

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             I    S + DL+ WL+ VMT+ DTC+DGF D + K  M   L+ A EL SNALAI + L 
Sbjct  142   IKVLFSRSDDLETWLTGVMTFMDTCVDGFVDEKLKADMHSVLRNATELSSNALAITNSLG  201

Query  790   SVLSTFEPS--ESHAKRRLLAD-----GVPEWMNDEQRRMLKADIPKQP-PNATVAKDGS  945
              +L   +       ++RRLL+      G P WM   +R++L +    QP PNA VAKDGS
Sbjct  202   GILKKMDLGMFSKDSRRRLLSSEQDEKGWPVWMRSPERKLLASG--NQPKPNAIVAKDGS  259

Query  946   GKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKS  1125
             G+F +I  A+ A+P  ++GRYVI+VKAG+YDE V+V K  VN+ MYGDG +++ VTG+KS
Sbjct  260   GQFKSIQQAVDAVPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKQSRVTGRKS  319

Query  1126  LADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              ADG++T +TATF+V   GF+ + +GF NTA
Sbjct  320   FADGITTMKTATFSVEASGFICKNMGFHNTA  350



>gb|EAZ42935.1| hypothetical protein OsJ_27525 [Oryza sativa Japonica Group]
Length=649

 Score =   194 bits (493),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 150/372 (40%), Positives = 205/372 (55%), Gaps = 72/372 (19%)
 Frame = +1

Query  319   VGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKK--PKELLRISMVAAGKEMDKAVKKS  492
             V + +KA+C  TD++DTCE++L+ A  +  ++     PK+++R S+   G  ++KA  KS
Sbjct  78    VSKIIKAMCAQTDYKDTCEKSLAKAAANASASSSSSSPKDVVRASVAVIGDAIEKAFDKS  137

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
               +  D P  KAA  DC E+ ++AKDDLD  +A I    +   +     L  WLSAV+ +
Sbjct  138   SVIVSDDPRVKAAVADCKEIYENAKDDLDRTLAGIDAGGVDGLTKGGYQLRVWLSAVIAH  197

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHA-KRRLLA  846
             Q+TCIDGFPDG+ K  M  ++++ KEL SNALA++ + +S L+    P+ S A  RRLL+
Sbjct  198   QETCIDGFPDGDLKDKMRDAMESGKELTSNALALIGKASSFLAALHLPASSAASHRRLLS  257

Query  847   DGVPE---------------------WMNDEQ---------------RRMLK----ADIP  906
                 E                     +  DE                RR+L      + P
Sbjct  258   FAFDEDVTKQPEVNRSSGNSLRRLLSFAFDEDATKQPEVNRSSGNSLRRLLSFAFDENAP  317

Query  907   KQP----------------------------PNATVAKDGSGKFSTINAALKAMPAKYKG  1002
             KQP                            PN  VAKDGSGKF TIN AL AMP KY G
Sbjct  318   KQPKGNDDDVLVWVNRQERRLLKAKFQNKLKPNVVVAKDGSGKFKTINDALAAMPKKYTG  377

Query  1003  RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEG  1182
             RYVI+VK G+Y+E V +TKKM NVTMYGDG++KTI+TG ++  DGL+TY+TATF   G+G
Sbjct  378   RYVIYVKEGVYEEYVTITKKMANVTMYGDGAKKTIITGNRNFVDGLTTYKTATFNAQGDG  437

Query  1183  FMAQFIGFRNTA  1218
             FM   +GFRNTA
Sbjct  438   FMGVALGFRNTA  449



>ref|XP_009407600.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   193 bits (490),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 177/322 (55%), Gaps = 21/322 (7%)
 Frame = +1

Query  304   DSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAV  483
             DS  +  +SV A+C  TD+ D CERTLS+A     S    PKE+++ S +AA KE++ A 
Sbjct  37    DSLAASSKSVTAICASTDYTDVCERTLSSAINGSAS----PKEIIQASFMAAIKEIEAAS  92

Query  484   KKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAV  663
               S  V                       + +   A  +   +   +    D+  WLSAV
Sbjct  93    HLSKNVSLSATDSMNKDGFDICRRLFEDANEELQAAFSETHDLDGLARRTDDIKCWLSAV  152

Query  664   MTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE---PSESHAKR  834
             ++YQ TC+D     +  + M+  L TA ++ SNA+AIV  L+S+   F+      + A R
Sbjct  153   ISYQQTCLDSITQPDLHSTMKDGLVTASQVTSNAIAIVDGLSSLFKNFQVPINVTNIASR  212

Query  835   RLL-----ADGVPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFSTINAALKAMPAKY  996
             RLL     A G P W +   R++L A    +  PN  VA+DGSG + TINAAL AMP KY
Sbjct  213   RLLSQGSDAKGYPTWFSAHDRKLLAASARGELKPNMVVAQDGSGDYKTINAALNAMPKKY  272

Query  997   KGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVV-  1173
              GRYVI+VKAGIY E+V+VTK  VNV MYGDG +KT+VTG K+  DG+ T  TATF +  
Sbjct  273   TGRYVIYVKAGIYKENVLVTKDKVNVFMYGDGPRKTVVTGSKNNVDGVQTMNTATFVLCN  332

Query  1174  -------GEGFMAQFIGFRNTA  1218
                    G+GF+ + +GF NTA
Sbjct  333   WHFPAAEGQGFIGKSMGFSNTA  354



>ref|XP_009369703.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 188/318 (59%), Gaps = 26/318 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V A+C  TD+++ C  +L +  ++D + PK   +L++ ++ +  K M  A++ S  + 
Sbjct  43    KAVAAICDPTDYKEACIDSLGSVAKNDSATPK---DLIQAAIDSTIKTMKSAIENSSSIA  99

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGDK--IGNFSSHAA-----DLDNWLSAV  663
             +     KA        + D KD L++AIA ++     +G+ + H       +L NW SAV
Sbjct  100   KS---FKAINSTGKMAMDDCKDLLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAV  156

Query  664   MTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS------ESH  825
             +++Q +C+DG P  E +  M+ SL  A +L SNALAI S +A +L  F  +       + 
Sbjct  157   ISFQQSCLDGLPQEELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRPTS  216

Query  826   AKRRLL------ADGVPEWMNDEQRRML-KADIPKQPPNATVAKDGSGKFSTINAALKAM  984
             + RRLL       D  P W     RR+L K D     PNA VAKDGSG+F TI AAL A 
Sbjct  217   SSRRLLEQENDGHDQYPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAY  276

Query  985   PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF  1164
             P   +GRY+I+VKAG+Y+E V VTK  +NV MYGDG + T+VTG KS ADG++T  TATF
Sbjct  277   PKGLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGITTQNTATF  336

Query  1165  AVVGEGFMAQFIGFRNTA  1218
             A +G GF+A+ +GF+NTA
Sbjct  337   AAIGNGFLAKGMGFQNTA  354



>emb|CAH67075.1| OSIGBa0097P08.5 [Oryza sativa Indica Group]
Length=568

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/333 (39%), Positives = 197/333 (59%), Gaps = 22/333 (7%)
 Frame = +1

Query  271   RSGTKSK---TTPLDSGKSV-GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             RSG K+    T P ++  +  G+SV++LC  T ++++CE+TL+TA     S  + PKE+ 
Sbjct  28    RSGNKAGDNFTVPGEANLATSGKSVESLCAPTLYKESCEKTLTTA----TSGTENPKEVF  83

Query  439   RISMVAAGKEMDKAVKKS---GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
                  +A + +  AV+KS   GE K  +     +A++  + L +   D    +  + G  
Sbjct  84    STVAKSALESIKSAVEKSKAIGEAKT-SDSMTESAREDCKALLEDSVDDLRGMVEMAGGD  142

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             +    S + DL++WL+ VMT+ DTC DGF D + K  M   L+ A EL SNALAI + L 
Sbjct  143   VKVLFSRSDDLEHWLTGVMTFMDTCADGFADEKLKADMHSVLRNASELSSNALAITNTLG  202

Query  790   SVLSTFE----PSESHAKRRLLAD-----GVPEWMNDEQRRMLKADIPKQP-PNATVAKD  939
             ++    +      E+   R L+A+     G P WM    R++L +    +P PNA VA+D
Sbjct  203   AIFKKLDLDMFKGENPIHRSLIAEQETVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAQD  262

Query  940   GSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGK  1119
             GSG+F TI  A+ +MP  ++ RYVI+VKAG+YDE V+V K  VN+ MYGDG +++ VTG+
Sbjct  263   GSGQFKTIQEAVNSMPKGHQCRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKRSRVTGR  322

Query  1120  KSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             KS ADG++T +TATF+V   GF+ + +GF NTA
Sbjct  323   KSFADGITTMKTATFSVEAAGFICKNMGFHNTA  355



>ref|XP_009623162.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=584

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 190/328 (58%), Gaps = 30/328 (9%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKEL---LRISMVAAGKEMDKAVK  486
             +  +S+ ++C  TD++  C  +LS+   +  + PK   E    + I  V AG E   ++ 
Sbjct  46    TTSKSIASVCSQTDYKKACVNSLSSMANNQSATPKDFIEKAIEVAIQEVRAGMERSASI-  104

Query  487   KSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVM  666
               G+ +    L+K A +DC +LL  A D+L  + +S+  +++   +    +L NWLSAV+
Sbjct  105   --GKAEAHDSLQKMATEDCKDLLHFAIDELQASFSSVGDNELHKITDRETELKNWLSAVI  162

Query  667   TYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE--------PSES  822
             +YQ TC+DGF   E K A+  SL  A +L  N LAIV+ ++ +LS F          S +
Sbjct  163   SYQQTCMDGFTQPELKNAISTSLLNATQLTDNVLAIVAAISEILSAFNIPIGNSSTISAT  222

Query  823   HAKRRLLA--------------DGVPEWMNDEQRRMLKA--DIPKQPPNATVAKDGSGKF  954
                 RLL               +G P W     R++L A     + PPNA VAKDGSG++
Sbjct  223   TTTSRLLLEANNDDEEAVHNTENGFPSWFPSGDRKLLGARNSNSQSPPNAVVAKDGSGQY  282

Query  955   STINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLAD  1134
             +TI AAL A P   KGRYVI+VKAGIYDE + V K  VN+ MYGDG +KTIVTGKK   D
Sbjct  283   NTIAAALAAYPKNLKGRYVIYVKAGIYDEYITVAKDQVNIFMYGDGPRKTIVTGKKCNRD  342

Query  1135  GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G++TYQ+A+F+ VG GF+A+ +GF+NTA
Sbjct  343   GVTTYQSASFSAVGNGFIAKSLGFQNTA  370



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   194 bits (492),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/332 (39%), Positives = 189/332 (57%), Gaps = 25/332 (8%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
             H   G     TP     +  +++KA+C  TD+ +TCE++LS+A   D      PKEL++I
Sbjct  151   HGGRGNGGGATPTGEISTSTKAIKAICQPTDYRETCEKSLSSANTTD------PKELIKI  204

Query  445   SMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGN  618
                AA  E+ K +  S  VK+      A      + L++  + +D AI  +K   +++G 
Sbjct  205   GFQAAISEIKKVIANSSTVKE-----VAKDPMARQALENCHELMDYAIDDLKNSFNQLGE  259

Query  619   FS-----SHAADLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIV  777
             F       +  +L  WL   +TYQ TC+DGF +  GE    M+  LKT++EL SN LA+V
Sbjct  260   FDFSKLDEYIENLKIWLGGAITYQQTCLDGFMNTTGEAGKKMQALLKTSQELTSNGLAMV  319

Query  778   SQLASVLSTFEPSE----SHAKRRLLA-DGVPEWMNDEQRRMLKADIPKQPPNATVAKDG  942
             S+++S+L           S  +RRL A +G P W++ EQR  ++       PN  VAKDG
Sbjct  320   SEISSILGNLNIQNIGEISTGQRRLFAENGFPMWVSSEQRSRIRQTPATIKPNVVVAKDG  379

Query  943   SGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKK  1122
             SGK+++IN AL+ +P      +VI++KAG+Y E V+VTK M NV   GDG  KT +TG  
Sbjct  380   SGKYTSINEALQEVPKDNPTTFVIYIKAGVYKEQVIVTKSMTNVMFIGDGRTKTKITGDL  439

Query  1123  SLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             + ADG  T++TAT  VVG+GF+A+ IGF NTA
Sbjct  440   NYADGTGTFRTATVGVVGDGFIAKDIGFENTA  471



>emb|CAN67129.1| hypothetical protein VITISV_040170 [Vitis vinifera]
Length=1542

 Score =   197 bits (502),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/310 (42%), Positives = 189/310 (61%), Gaps = 15/310 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ++C   D++D C +TLS   ++  + PK   + ++ ++    KE+  ++  S ++ 
Sbjct  45    KAVASVCATADYKDACMQTLSPVAKNGSATPK---DYIQAAVQVTMKEIKSSMNLSEKLV  101

Query  505   QDTPlkkaaakdc--aellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
             Q T   +         +LL+ A D+L  + +S+    +      + ++ NWLSAV++YQ 
Sbjct  102   QATNDSRTQMALGDCKDLLQFAIDELQESFSSVGESDLQTLDQLSTEIMNWLSAVVSYQQ  161

Query  679   TCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE--SHAKRRLLA--  846
             TC+DG  +   +TAM+K L  A +L SNALAIVS ++ +L+ F  S       RRLL   
Sbjct  162   TCLDGVIEPRFQTAMQKGLLNATQLTSNALAIVSDISQILTKFNVSLDLKPNSRRLLGEI  221

Query  847   -----DGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
                  DG P W +   R++L + D  +  PNA VAKDGSG F+TI AAL A P   KGRY
Sbjct  222   DVLGHDGYPTWFSATDRKLLASHDNGRLTPNAIVAKDGSGHFTTIAAALAAYPKNLKGRY  281

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             VI+VKAGIY E + VTK  VNV MYGDG +KTIVTG KS  DG++TY+TATF+ +G+GF+
Sbjct  282   VIYVKAGIYREYITVTKDQVNVYMYGDGPRKTIVTGTKSYRDGITTYKTATFSAIGKGFV  341

Query  1189  AQFIGFRNTA  1218
             A+ +GF NTA
Sbjct  342   ARSMGFVNTA  351


 Score =   191 bits (485),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 187/310 (60%), Gaps = 14/310 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ++C   D++D C +TLS   ++  SA   PK+ ++ ++    K++  ++  S ++ 
Sbjct  575   KAVASVCATADYKDACMQTLSPVPKNGSSA--TPKDYIQAAVQVTIKQIKSSMNLSEKLF  632

Query  505   QDTPlkkaaakdc--aellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
             Q T   +         +LL+ A D+L  + +S+    +      + ++ NWLSA ++YQ 
Sbjct  633   QATNDSRTQMALGDCKDLLQFAIDELQESFSSVGESDLQTLDQLSTEIMNWLSAAVSYQQ  692

Query  679   TCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAK-RRLLA--  846
             TC+DG  +   + AM+K L  A +L SNALAIVS L+ +L+ F  P +     RRLL   
Sbjct  693   TCLDGVIEPRFQNAMQKGLLNATQLTSNALAIVSDLSQILTKFNVPLDLKPNSRRLLGEI  752

Query  847   -----DGVPEWMNDEQRRMLK-ADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
                  DG P W +   R++L   D  +  PNA VAKDGSG F+TI AAL A P   KGRY
Sbjct  753   EVLGHDGYPTWFSATDRKLLALQDNGRLTPNAIVAKDGSGHFTTIAAALAAYPKNLKGRY  812

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             VI+VKAGIY E + VTK  VNV MYGDG +KTIVTG K   DG++TY+TATF+ +G+GF+
Sbjct  813   VIYVKAGIYREYITVTKDHVNVYMYGDGPRKTIVTGTKCYRDGITTYKTATFSAIGKGFV  872

Query  1189  AQFIGFRNTA  1218
             A+ +GF NTA
Sbjct  873   ARSMGFVNTA  882



>ref|XP_004956918.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Setaria italica]
Length=634

 Score =   193 bits (490),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 200/320 (63%), Gaps = 26/320 (8%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             K+V +S+KA+C  TD+ D CE++L  A   + ++PK   +++R ++   G  + +A +++
Sbjct  108   KAVSKSIKAMCSQTDYTDACEKSLGKAATANATSPK---DIVRAAVEVIGDAIGQAFERA  164

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
               +  + P  KAA  DC E+  DAKDDL+  +  +  D     +     L  WLSAV+ +
Sbjct  165   DLIMSNDPRVKAAVADCKEIFGDAKDDLNRTVKGV--DAKDGIAKDGYQLRIWLSAVIAH  222

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA--  846
              +TCIDGFPD + K  ++ S    KEL SNALA++ + +S+LS  + S   +KRRLLA  
Sbjct  223   METCIDGFPDDDFKVKVKDSFTNGKELTSNALALIEKGSSILSAIKGS---SKRRLLAED  279

Query  847   --------------DGVPEWMNDEQRRMLKADIPKQP--PNATVAKDGSGKFSTINAALK  978
                           DG+PEW+ D +RR+LK    K    PN  VAKDGSGKF TIN AL 
Sbjct  280   EGAPASRAEPALDEDGIPEWVPDGERRVLKGGGFKSTLTPNVVVAKDGSGKFKTINEALA  339

Query  979   AMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTA  1158
             AMP    GRYVI VK G+Y+E V +TK MVNVT+ GDGS+K+IVTGKK+  DG++T++TA
Sbjct  340   AMPKSNNGRYVIQVKEGVYEEYVTITKAMVNVTLLGDGSKKSIVTGKKNFVDGITTFKTA  399

Query  1159  TFAVVGEGFMAQFIGFRNTA  1218
             TF   G+GFMA  +GF+NTA
Sbjct  400   TFTAQGDGFMAIGMGFQNTA  419



>gb|EMS49616.1| Putative pectinesterase/pectinesterase inhibitor 28 [Triticum 
urartu]
Length=563

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 196/308 (64%), Gaps = 16/308 (5%)
 Frame = +1

Query  322   GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS---  492
             G+SVK+LC  T ++++CE+TL++A     +  + PKE+      +A + +  AV++S   
Sbjct  50    GKSVKSLCAPTLYKESCEKTLTSA----SNGTENPKEVFATVAKSAMESIKSAVERSKSI  105

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
             GEVK   PL + A +DC ELL+D+ DDL   +    GD I    S   DL++W++ VMT+
Sbjct  106   GEVKSSDPLTEGARQDCKELLEDSVDDLKGMVEMAGGD-IKVLLSRTDDLEHWITGVMTF  164

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS--ESHAKRRLLA  846
              DTC DGF D + K  M+  L+ A EL SNALAI + L ++    +    ++ ++RRLL+
Sbjct  165   IDTCADGFADEKLKADMQGILRNATELSSNALAITNSLGAIFKKLDLDVFKTDSRRRLLS  224

Query  847   ---DGVPEWMNDEQRRMLKAD-IPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
                   P WM   +R++L +  +P   PNA VAKDGSGKF TI  A+ +MP  + GRYVI
Sbjct  225   AEESKYPAWMKAPERKLLASGGLPA--PNAVVAKDGSGKFKTIQDAVNSMPKDHPGRYVI  282

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQ  1194
             +VKAG+Y+E V+V K  VN+ MYGDG +++ VTG KS ADG++T +TATF++   GF+ +
Sbjct  283   YVKAGVYEEMVMVPKDKVNIFMYGDGPKQSRVTGSKSFADGITTMKTATFSIEAAGFICK  342

Query  1195  FIGFRNTA  1218
              +GF NTA
Sbjct  343   NMGFHNTA  350



>ref|XP_004298254.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Fragaria vesca subsp. vesca]
Length=577

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/331 (39%), Positives = 197/331 (60%), Gaps = 29/331 (9%)
 Frame = +1

Query  304   DSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAV  483
             D   S  ++V A+C  TD+++ C  +L+ A ++  ++PK   +L+R ++    +++  A+
Sbjct  36    DKLSSSSKAVIAMCEPTDYKEACVDSLAGAAKNQSASPK---DLIRSAVEYTVQQVKAAI  92

Query  484   KKSG----EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNW  651
             +KSG    E K      K A  DC ELL+ A + L  ++ ++    +   +   ADL NW
Sbjct  93    EKSGIIIKEAKDVNSTGKMAFDDCNELLESAIESLQYSLLTLVDADMPKINEKEADLKNW  152

Query  652   LSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF----EPSE  819
              SA M++Q++CIDG P  + K  M ++++ A++L SNALAIVS L+++L  F    +P+ 
Sbjct  153   FSAAMSFQESCIDGIPYEDLKKQMSEAMQNAEQLTSNALAIVSSLSNILGNFNIPLKPNN  212

Query  820   SHAKRRLLAD---------GVPEWMNDEQRRMLKADIPKQP---------PNATVAKDGS  945
             + +  R L D           P W +   R+++     K           PNA VAKDGS
Sbjct  213   NPSTARRLLDVEMETDEHGTFPTWFSAADRKLIAKQNKKNNNAGNGQAVKPNAVVAKDGS  272

Query  946   GKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKS  1125
             G++ TI AAL A P  ++GRYVI+VKAGIY+E V V K   NV MYGDG ++T+VTG+KS
Sbjct  273   GQYKTIGAALAAYPKGFQGRYVIYVKAGIYNEYVTVAKNQNNVFMYGDGPRETMVTGRKS  332

Query  1126  LADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              ADG++T  TATF VVG GF+A+ +GF+NTA
Sbjct  333   FADGITTQDTATFIVVGHGFIARGMGFQNTA  363



>ref|XP_009359792.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 127/318 (40%), Positives = 188/318 (59%), Gaps = 26/318 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V A+C  TD+++ C  +L +  ++D + PK   +L++ ++ +  K M  A++ S  + 
Sbjct  43    KAVAAICDPTDYKEACIDSLGSVAKNDSATPK---DLIQAAIDSTIKTMKSAIENSSSIA  99

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGDK--IGNFSSHAA-----DLDNWLSAV  663
             +     KA        + D KD L++AIA ++     +G+ + H       +L NW SAV
Sbjct  100   KS---FKAINSTGKMAMDDCKDLLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAV  156

Query  664   MTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS------ESH  825
             +++Q +C+DG P  E +  M+ SL  A +L SNALAI S +A +L  F  +       + 
Sbjct  157   ISFQQSCLDGIPQEELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRPTS  216

Query  826   AKRRLLA------DGVPEWMNDEQRRML-KADIPKQPPNATVAKDGSGKFSTINAALKAM  984
             + RRLL       D  P W     RR+L K D     PNA VAKDGSG+F TI AAL A 
Sbjct  217   SSRRLLEQENDGHDQYPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAY  276

Query  985   PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF  1164
             P   +GRY+I+VKAG+Y+E V VTK  +NV MYGDG + T+VTG KS ADG++T  TATF
Sbjct  277   PKGLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGITTQNTATF  336

Query  1165  AVVGEGFMAQFIGFRNTA  1218
             + +G GF+A+ +GF+NTA
Sbjct  337   SAIGNGFLAKGMGFQNTA  354



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   191 bits (485),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 130/330 (39%), Positives = 204/330 (62%), Gaps = 23/330 (7%)
 Frame = +1

Query  256   DDGHKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKPKE  432
             DD H      S+TTP  +  +  ++++A+C  TD+++TCE++L + AG   D     PKE
Sbjct  49    DDNHG-----SETTPEITSST--KAIQAICQPTDYKETCEKSLEAEAGNTTD-----PKE  96

Query  433   LLRISMVAAGKEMDKAVKKSGEVKQ--DTPlkkaaakdcaellkdakddldTAIASIKGD  606
             L+++    A + +++A+K S  +K+    P    A ++C ELL+ A DDL+ +   I   
Sbjct  97    LVKVGFKIATRSLNEAIKNSTTLKELAKDPRTNQALQNCRELLEYAIDDLNQSFERIGTF  156

Query  607   KIGNFSSHAADLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVS  780
             ++       ADL  WLS  +TY+ TC+DGF +  G+    M++ LK+A+++ +N L IV+
Sbjct  157   QMSKLDDFVADLKIWLSGALTYEQTCLDGFENTTGDAGVRMQEFLKSAQQMTTNGLGIVN  216

Query  781   QLASVLSTFE-PSESHAKRRLLADG---VPEWMNDEQRRMLKADIPKQPPNATVAKDGSG  948
             +L+++L + + P  S   RRLL D    +P W++D +RR+++A      P+  VA+DGSG
Sbjct  217   ELSTILGSLQLPGMS--GRRLLEDDDREMPSWVSDGKRRLMQAGAAAMKPDLVVAQDGSG  274

Query  949   KFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSL  1128
             K+ TINAAL  +P K    +VI VKAGIY E VV+ K M ++TMYGDG  KT+VTG  + 
Sbjct  275   KYKTINAALADVPLKSNKTFVIHVKAGIYKEIVVIPKHMTHLTMYGDGPTKTVVTGSLNF  334

Query  1129  ADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              DG+ T++TATF+ +G  F A+ +GF NTA
Sbjct  335   IDGIQTFKTATFSAIGANFYARDMGFENTA  364



>ref|XP_003632385.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=566

 Score =   191 bits (484),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 195/334 (58%), Gaps = 22/334 (7%)
 Frame = +1

Query  277   GTKSKTTPLDSGKSVGES--------VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKE  432
             G  S T P  S ++ G++        V ++C   D++D C +TLS   ++  SA   PK+
Sbjct  21    GIVSVTRPHGSDRTDGDTNMSSSMKAVASVCATADYKDACMQTLSPVPKNGSSA--TPKD  78

Query  433   LLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdc--aellkdakddldTAIASIKGD  606
              ++ ++    K++  ++  S ++ Q T   +         +LL+ A D+L  + +S+   
Sbjct  79    YIQAAVQVTIKQIKSSMNLSEKLFQATNDSRTQMALGDCKDLLQFAIDELQESFSSVGES  138

Query  607   KIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQL  786
              +      + ++ NWLSA ++YQ TC+DG  +   + AM+K L  A +L SNALAIVS L
Sbjct  139   DLQTLDQLSTEIMNWLSAAVSYQQTCLDGVIEPRFQAAMQKGLLNATQLTSNALAIVSDL  198

Query  787   ASVLSTFE-PSESHAK-RRLLA-------DGVPEWMNDEQRRMLKA-DIPKQPPNATVAK  936
             + +L+ F  P +     RRLL        DG P W +   R++L   D  +  PNA VAK
Sbjct  199   SQILTKFNVPLDLKPNSRRLLGEIEVLGHDGYPTWFSATDRKLLALQDNGRLTPNAIVAK  258

Query  937   DGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTG  1116
             DGSG F+TI AAL A P   KGRYVI+VKAGIY E + VTK  VNV MYGDG +KTIVTG
Sbjct  259   DGSGHFTTIAAALAAYPKNLKGRYVIYVKAGIYREYITVTKDHVNVYMYGDGPRKTIVTG  318

Query  1117  KKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              K   DG++TY+TATF+ +G+GF+A+ +GF NTA
Sbjct  319   TKCYRDGITTYKTATFSAIGKGFVARSMGFVNTA  352



>ref|XP_003579894.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=563

 Score =   190 bits (483),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 205/333 (62%), Gaps = 27/333 (8%)
 Frame = +1

Query  271   RSGTKSK---TTPLDSGKSV-GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             RSG K+    T P ++  +  G+SVK+LC  T ++++CE+TL++A     +  + PKE+ 
Sbjct  28    RSGNKAGDNFTVPGEATLATSGKSVKSLCAPTLYKESCEKTLTSA----SNGTENPKEVF  83

Query  439   RISMVAAGKEMDKAVKKS---GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDK  609
                   A + +  AV++S   GE K   PL + A +DC ELL+D+ DDL   +    GD 
Sbjct  84    STVAKTAMESIKSAVERSKSIGEAKSSDPLTEGARQDCKELLEDSVDDLKGMVEMAGGD-  142

Query  610   IGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLA  789
             I    S + DL++W++ VMT+ DTC DGF D + K  M+  L+ A EL SNALAI + L 
Sbjct  143   IKVLLSRSDDLEHWITGVMTFIDTCADGFADEKLKADMQGILRNATELSSNALAITTSLG  202

Query  790   SV-----LSTFEPSESHAKRRLLADG----VPEWMNDEQRRMLKAD-IPKQPPNATVAKD  939
             ++     L  F+   SH   RLL++      P+WM   +R++L +  +P   PNA VAKD
Sbjct  203   AIFKKLDLDVFKKDSSH---RLLSEKEEQKFPQWMKSPERKLLASGGMPA--PNAVVAKD  257

Query  940   GSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGK  1119
             GSGKF +I  A+ AMP  + GRYVI+VK G+YDE V++ K  VN+ MYGDG +++ VTG+
Sbjct  258   GSGKFKSIQEAVNAMPKGHPGRYVIYVKTGLYDEIVMIPKDKVNIFMYGDGPKQSRVTGR  317

Query  1120  KSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             KS  DG++T +TATF++   GF+ + +GF NTA
Sbjct  318   KSFKDGITTMKTATFSIEAAGFICKNMGFHNTA  350



>ref|XP_010247944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Nelumbo nucifera]
Length=465

 Score =   188 bits (478),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 120/305 (39%), Positives = 185/305 (61%), Gaps = 10/305 (3%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +SV A+C   D++D+C +TL+   +++ S P    + L+ +  A  +E+  A++K G + 
Sbjct  50    KSVSAICASADYKDSCIKTLTPVAKNESSTPH---DYLKAAFEAIVQEVQAAMEKFGVIG  106

Query  505   QDTPlkkaaakdc--aellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
             +D              +L++ A  +L +AI+ ++       S   A+  NWLSAV++Y++
Sbjct  107   KDANSSIDKMAVGDCKDLMQFAIAELQSAISMVEDPDRYPASDPVAEFKNWLSAVVSYEE  166

Query  679   TCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE---PSESHAKRRLL-A  846
             TC +GF   + K++ME  L  A +L  NAL IV++L+++L        +  +++RRLL A
Sbjct  167   TCTEGFEQPKLKSSMENGLLNATQLTGNALTIVTELSAILKALNIRFDTNINSRRRLLDA  226

Query  847   DGVPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVK  1023
              G P W   + R++L      Q  PNA VAKDGSG++ TI  A+ A P     RYVI+VK
Sbjct  227   QGYPNWFTLKDRKLLALQGNGQLTPNAVVAKDGSGQYKTIAEAIAACPKNSVSRYVIYVK  286

Query  1024  AGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIG  1203
             AG YDE ++VTK   N+ MYGDG   TIVTGKKS A G+ST+QTA+F+V+ +GF+A+ +G
Sbjct  287   AGTYDEYIIVTKGQNNIFMYGDGPTSTIVTGKKSNAAGISTFQTASFSVIADGFIAKSMG  346

Query  1204  FRNTA  1218
             F NTA
Sbjct  347   FENTA  351



>gb|EMT00807.1| Putative pectinesterase/pectinesterase inhibitor 28 [Aegilops 
tauschii]
Length=563

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 131/308 (43%), Positives = 194/308 (63%), Gaps = 16/308 (5%)
 Frame = +1

Query  322   GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS---  492
             G+SVK+LC  T ++++CE+TL++A     +  + PKE+      +A + +  AV++S   
Sbjct  50    GKSVKSLCAPTLYKESCEKTLTSA----SNGTENPKEVFATVAKSAMESIKSAVERSKSI  105

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
             GE K   PL + A +DC ELL+D+ DDL   +    GD I        DL++W++ VMT+
Sbjct  106   GEAKSSDPLTEGARQDCKELLEDSVDDLKGMVEMAGGD-IKVLLGRTDDLEHWITGVMTF  164

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS--ESHAKRRLLA  846
              DTC DGF D + K  M+  L+ A EL SNALAI + L ++    +    ++ ++RRLL+
Sbjct  165   IDTCADGFADEKLKADMQGILRNATELSSNALAITNSLGAIFKKLDLDVFKTDSRRRLLS  224

Query  847   ---DGVPEWMNDEQRRMLKAD-IPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
                   P WM   +R++L +  +P+  PNA VAKDGSGKF TI  A+ +MP  + GRYVI
Sbjct  225   AEESKYPAWMRAPERKLLASGGLPQ--PNAIVAKDGSGKFKTIQDAVNSMPKDHPGRYVI  282

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQ  1194
             +VKAG+Y+E V+V K   NV MYGDG +++ VTG KS ADG++T +TATF++   GF+ +
Sbjct  283   YVKAGVYEEMVMVPKDKANVFMYGDGPKQSRVTGSKSFADGITTMKTATFSIEAAGFICK  342

Query  1195  FIGFRNTA  1218
              +GF NTA
Sbjct  343   NMGFHNTA  350



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 128/332 (39%), Positives = 200/332 (60%), Gaps = 27/332 (8%)
 Frame = +1

Query  277   GTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTA-GEDDDSAPKKPKELLRISMV  453
             GTK+ +   +  ++  +++KA+C  TD+++TC ++LS+A G   D     PK+L++I+  
Sbjct  42    GTKTVSNDDEQIQTSMKAIKAICQPTDYKETCIKSLSSAAGNTTD-----PKDLVKIAFK  96

Query  454   AAGKEMDKAVKKSGEVKQ--DTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSS  627
              A K++ +AV +S  +K+    P    A  +C EL+  A D+L+++   +    I +   
Sbjct  97    IATKQIKEAVNRSVVLKELEKDPRASKALANCRELMDYAIDELNSSFDELGSIDIDDIDD  156

Query  628   HAADLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLS  801
                +L  WLSA +TYQ+TC+DGF +  G    +M K+LKTA EL  N LA+V+++AS+L+
Sbjct  157   ALENLKIWLSASLTYQETCLDGFQNTTGNAGESMRKALKTAGELTQNGLAMVTEVASILT  216

Query  802   TFE-PSESHAKRRLLA------------DGVPEWMNDEQRRMLKADIPKQPPNATVAKDG  942
             + + PS    KRRLL+            D  P W +  +RR+L A      PN TVAKDG
Sbjct  217   SLQMPS----KRRLLSSEQQSQCPFAMEDEFPTWTSAAKRRLLAASRANIKPNITVAKDG  272

Query  943   SGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKK  1122
             SGK+ TI+ AL+ +P      +VI +KAG+Y E V + + M ++ + GDG  KT +TG K
Sbjct  273   SGKYKTISEALRHVPKNSNETFVIHIKAGVYHEQVQINRSMTHLMIIGDGPTKTKITGNK  332

Query  1123  SLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +  DG  T++TAT AV+G+GFMA+ IGF N+A
Sbjct  333   NFVDGTPTFKTATVAVIGDGFMAKDIGFENSA  364



>gb|AEK07905.1| pectin methylesterase [Allium cepa]
Length=666

 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 135/366 (37%), Positives = 190/366 (52%), Gaps = 74/366 (20%)
 Frame = +1

Query  331   VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQD  510
             V+ LC  TD+++TC  +LS A     ++  KPK++++ ++    KE   A +K+ E K  
Sbjct  86    VQTLCSPTDYKETCISSLSKA----TNSSSKPKDIIKAAVSVIYKEASTAFEKAKEHKTS  141

Query  511   TPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCID  690
              P    A + C  LL ++K DL  ++  I    + +       L+ WLSAV +YQ+TC+D
Sbjct  142   DPQTVGAIEVCERLLNESKSDLMESMDKIDVSSLEDLPKAGPVLNVWLSAVRSYQETCVD  201

Query  691   GFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS------------------  816
              FP+GE +  M+ ++KT  EL SNALAI+ +  S LS                       
Sbjct  202   SFPEGESRDKMKDAMKTVNELTSNALAIIQKAGSFLSELNVPGFSRRLLTVDDENKMDGQ  261

Query  817   -------ESHAKRRLLAD--GVPEWM--NDEQRRMLKAD--IP-----------------  906
                    E H  RR L D  G+P W+  + E RR L  D  +P                 
Sbjct  262   GLPWWVMEHHEHRRSLVDDQGLPWWVMGHHEHRRSLVDDQGLPWWVMGHHEHRRSLVDDQ  321

Query  907   ----------------------KQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFV  1020
                                      PN  VA+DGSG+F+TI AA+ AMP +Y GRYVI+V
Sbjct  322   GLPWWVMGHHEHRRSLVQNAAATLKPNVVVAQDGSGQFTTIMAAINAMPEQYDGRYVIYV  381

Query  1021  KAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFI  1200
             KAG+YDE V + +++ N+TMYGDGS+KTIVTG K+   G  T+ TATFAV+G+GFM   +
Sbjct  382   KAGVYDEQVTIKRELKNITMYGDGSEKTIVTGSKNFNAGTPTFLTATFAVMGDGFMCIGM  441

Query  1201  GFRNTA  1218
             GFRNTA
Sbjct  442   GFRNTA  447



>ref|XP_010247575.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Nelumbo nucifera]
Length=922

 Score =   191 bits (485),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 127/316 (40%), Positives = 180/316 (57%), Gaps = 22/316 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++VKA+C  TDFED C +TL+    +  + P+   + L+ +  A   E++ A++KSG + 
Sbjct  46    KNVKAICALTDFEDACIKTLTPVANNKSATPE---DYLKAAFEATNGEVEAALEKSGVIG  102

Query  505   QDTPlkkaaakdcaellkdakddldTAIA-SIKGDKIGNFSSHA-ADLDNWLSAVMTYQD  678
             +D                      D   A S+ GD   N ++   A+  NWLSAV++YQ+
Sbjct  103   KDAQGSIDKMAVEDCKELLQFAIDDLQSAISMAGDPEKNKAADVTAEFKNWLSAVVSYQE  162

Query  679   TCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS---ESHAKRRLL-A  846
             +CIDGF   E K +M+  L  A +L SNAL I+ Q++S+L     +      ++RRLL A
Sbjct  163   SCIDGFEHPELKNSMQNGLLNATQLTSNALTIIGQMSSILKALNINFDFNIKSRRRLLDA  222

Query  847   DGVPEWMNDEQRRMLK-ADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKG-------  1002
              G P W     R++L   D  +  PNA VAKDGSG + TI  AL A P K KG       
Sbjct  223   QGYPTWFAPTDRKLLALQDNGRVAPNAVVAKDGSGHYKTIAEALAAYPKK-KGSQKNDSS  281

Query  1003  --RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF--AV  1170
               RYVI+VKAG YDE + +TK   N+ MYGDG   TI+TG KS  +G+ST+QTA+F  AV
Sbjct  282   TSRYVIYVKAGTYDEYITITKDQTNILMYGDGPTSTIITGHKSNREGISTFQTASFFVAV  341

Query  1171  VGEGFMAQFIGFRNTA  1218
             +G+GF+ + +GF NTA
Sbjct  342   IGDGFICRSMGFHNTA  357



>ref|XP_010038523.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=557

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 121/307 (39%), Positives = 189/307 (62%), Gaps = 12/307 (4%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ++C  TD+++ C ++L++   +  +    PKEL++ ++VA    M  ++  S  + 
Sbjct  44    KAVSSVCAPTDYKELCMKSLTSYAPNGTT---DPKELIKAAVVAIQDHMKGSLTFSQSLA  100

Query  505   QDTPlkkaaakd--caellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
              +    K       C +L + A D L  A +S+    +      AA++ NWLSAV++YQ+
Sbjct  101   TNATEAKTKMSLDDCKDLYQYAIDVLQAAFSSVGDSDLHTMEDRAAEIQNWLSAVVSYQE  160

Query  679   TCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAKRRLLADG  852
             +C+D   D + +T ++ ++  A  L SNAL+IV+ ++ VL++F  + + +   RRLL+ G
Sbjct  161   SCLDNMDDLKLRTDLQNNVLNASHLTSNALSIVTGMSQVLASFNIKLNLTTNSRRLLSTG  220

Query  853   ----VPEWMNDEQRRML-KADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIF  1017
                  P W +   R++L K D  +  PNA VAKDGSG++ TI AAL A P  ++GRYVI+
Sbjct  221   QGGDYPSWFSAADRKLLAKVDNGRVRPNAVVAKDGSGQYKTIKAALAAYPKGHRGRYVIY  280

Query  1018  VKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQF  1197
             VKAG+YDE + VTK  VNV MYGDG +KT+VTG KS   G+ T Q+ATFA VG GF+ + 
Sbjct  281   VKAGVYDEYIEVTKDQVNVFMYGDGPRKTLVTGHKSNRGGVPTMQSATFAAVGSGFLCKS  340

Query  1198  IGFRNTA  1218
             +GF+NTA
Sbjct  341   MGFQNTA  347



>ref|XP_002303172.1| hypothetical protein POPTR_0003s01580g [Populus trichocarpa]
 gb|EEE78151.1| hypothetical protein POPTR_0003s01580g [Populus trichocarpa]
Length=560

 Score =   187 bits (476),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 180/305 (59%), Gaps = 21/305 (7%)
 Frame = +1

Query  340   LCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGE--VKQDT  513
             LC  +D+++ C +TLS+    D      PKE ++ +++AA   + K+   S E  VK   
Sbjct  52    LCQPSDYKEACTKTLSSVNSTD------PKEFVKHAILAASDAVTKSFNFSEELIVKASK  105

Query  514   PlkkaaakdcaellkdakddldTAIASIKGDK-IGNFSSHAADLDNWLSAVMTYQDTCID  690
               ++  A D  + L D       A  S+ GD  +   ++  A+L +WLSAV+ YQ+TC+D
Sbjct  106   DKREKMALDDCKELLDYAVQELQASMSMVGDSDLHTTNNRVAELQSWLSAVLAYQETCVD  165

Query  691   GFPDGEE-KTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-----PSESHAKRRLLA-D  849
             GF D    K  +++    A +L  N LAI+S L+  L +       PS S   RRLL  D
Sbjct  166   GFDDKSTIKPIIQQGFVNASQLTDNVLAIISGLSDFLKSMGLQFNIPSNS---RRLLGED  222

Query  850   GVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKA  1026
             G P W +   R++L A D  K  PNA VA+DGSG+F TI+AA+ A P K KGRY+I+VKA
Sbjct  223   GFPTWFSGADRKLLAAQDKGKVKPNAVVAQDGSGQFKTISAAIAAYPNKLKGRYIIYVKA  282

Query  1027  GIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA-DGLSTYQTATFAVVGEGFMAQFIG  1203
             G Y E V + KK  NV +YGDG +KTIVTG KS A DGL T++TATF    +GF+A+ IG
Sbjct  283   GTYREYVTIDKKKPNVFIYGDGPRKTIVTGSKSFAKDGLGTWKTATFVAEADGFIAKSIG  342

Query  1204  FRNTA  1218
             F+NTA
Sbjct  343   FQNTA  347



>ref|XP_008390484.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=566

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 186/317 (59%), Gaps = 25/317 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V A+C  TD+++ C  +L +  ++D + PK   +L++ ++ +  K +  A++ S  + 
Sbjct  43    KAVAAICDPTDYKEACIDSLGSVAKNDSATPK---DLIQAAIDSTIKTVKSAIENSNSIA  99

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGDK--IGNFSSHAA-----DLDNWLSAV  663
             +     KA        + D KD L++AIA ++     +G+ + H       +L NW SAV
Sbjct  100   KS---FKAINSTGKMAMDDCKDLLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAV  156

Query  664   MTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE--------PSE  819
             +++Q +C+DG P  E +  M+ SL  A +L SNALAI + +A +L  F         P+ 
Sbjct  157   ISFQQSCLDGIPQEELQKLMKDSLLNATQLTSNALAIATSIAQILENFNITLNKDLRPTS  216

Query  820   SHAKRRLLADG---VPEWMNDEQRRML-KADIPKQPPNATVAKDGSGKFSTINAALKAMP  987
             S        DG    P W     RR+L K D     PNA VAKDGSG+F TI AAL A P
Sbjct  217   SSRILEQENDGHGQYPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAALAAYP  276

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFA  1167
                +GRY+I+VKAG+Y+E V VTK  VNV MYGDG +KT+VTG KS ADG++T  TATFA
Sbjct  277   KGLQGRYIIYVKAGVYNEYVTVTKNQVNVFMYGDGPRKTMVTGSKSFADGITTQNTATFA  336

Query  1168  VVGEGFMAQFIGFRNTA  1218
              +G GF+A+ +GF+NTA
Sbjct  337   AIGNGFLAKGMGFQNTA  353



>ref|XP_011008693.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   187 bits (474),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 180/305 (59%), Gaps = 21/305 (7%)
 Frame = +1

Query  340   LCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGE--VKQDT  513
             LC  +D+++ C +TLS+    D      PKE ++ +++AA   + K+   S E  VK   
Sbjct  50    LCQPSDYKEACTKTLSSVNSTD------PKEFVKHAILAASDAVKKSFNFSEELIVKASQ  103

Query  514   PlkkaaakdcaellkdakddldTAIASIKGDK-IGNFSSHAADLDNWLSAVMTYQDTCID  690
               ++  A D  + L D       A  S+ GD  +   ++  A+L +WLSAV+ YQ+TC+D
Sbjct  104   DKREKMALDDCKELLDYAVQELQASMSMVGDSDLHTTNNRVAELQSWLSAVLAYQETCVD  163

Query  691   GFPDGEE-KTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-----PSESHAKRRLLA-D  849
             GF D    K  +++    A +L  N LAI+S L+  L +       PS S   RRLLA D
Sbjct  164   GFDDKSPIKPTIQQGFVNASQLTDNVLAIISGLSDYLKSMGLQFNIPSNS---RRLLAED  220

Query  850   GVPEWMNDEQRRMLKAD-IPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKA  1026
             G P W +   R++L A    K  PNA VA+DGSG+F TI+AA+ A P K KGRY+I+VKA
Sbjct  221   GFPTWFSGADRKLLAAQGNGKVKPNAVVAQDGSGQFKTISAAIAAYPNKLKGRYIIYVKA  280

Query  1027  GIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA-DGLSTYQTATFAVVGEGFMAQFIG  1203
             G Y E V + KK  NV +YGDG +KTIVTG KS A DGL T++TATF    +GF+A+ IG
Sbjct  281   GTYREYVTIDKKKPNVFIYGDGPRKTIVTGSKSFAKDGLGTWKTATFVAEADGFIAKSIG  340

Query  1204  FRNTA  1218
             F+NTA
Sbjct  341   FQNTA  345



>ref|XP_007222606.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
 gb|EMJ23805.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
Length=568

 Score =   187 bits (474),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 127/321 (40%), Positives = 184/321 (57%), Gaps = 32/321 (10%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V A+C  TD+++ C  +LS   +++ +  K   +L++ ++ +    +  A+  SG + 
Sbjct  43    KAVAAICEPTDYKEACINSLSKVAKNESATAK---DLIQAAIDSTISTVKSAIDNSGNIA  99

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGD--KIGNFSSHAA-----DLDNWLSAV  663
             +               + D KD L++AIA ++     +G+   H       +L NWLSAV
Sbjct  100   KS---FSNLNSTGKMAMDDCKDLLESAIADLQASFSYVGDGDMHTMHDREDELKNWLSAV  156

Query  664   MTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE---------PS  816
             +++Q +C+DG P  E +  M+  L  A +L SNALAI S ++ +L +F          PS
Sbjct  157   ISFQQSCLDGIPQEELQKQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRNPS  216

Query  817   ESHAKRRLLADG------VPEWMNDEQRRMLKADIPKQP-PNATVAKDGSGKFSTINAAL  975
              S   RRLL          P W     RR+L +    Q  PNA VAKDGSG++ TI AAL
Sbjct  217   SS---RRLLEHNNDEQGQYPSWFRAADRRLLASQSNGQVRPNAVVAKDGSGQYKTIGAAL  273

Query  976   KAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQT  1155
              A P   KGRY+I+VKAGIY+E V VTK  VNV MYGDG +KT+VTG KS ADG++T  T
Sbjct  274   AAYPKGLKGRYIIYVKAGIYNEYVTVTKDQVNVFMYGDGPRKTMVTGSKSWADGITTQNT  333

Query  1156  ATFAVVGEGFMAQFIGFRNTA  1218
             ATFA +G GF+A+ +GF+NTA
Sbjct  334   ATFAAIGSGFLAKAMGFQNTA  354



>ref|XP_008223522.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=568

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 184/321 (57%), Gaps = 32/321 (10%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V A+C  TD+++ C  +LS   +++ +  K   +L++ ++ +    +  A+  SG + 
Sbjct  43    KAVAAICEPTDYKEACINSLSKVAKNESATAK---DLIQAAIDSTISTVKSAIDNSGNIA  99

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGD--KIGNFSSHAA-----DLDNWLSAV  663
             +               + D KD L++AIA ++     +G+   H       +L NWLSAV
Sbjct  100   KS---FSNLNSTGKMAMDDCKDLLESAIADLQASFSYVGDGDMHTMHDREDELKNWLSAV  156

Query  664   MTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE---------PS  816
             +++Q +C+DG P  E +  M+  L  A +L SNALAI S ++ +L +F          PS
Sbjct  157   ISFQQSCLDGIPQEELQKQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRNPS  216

Query  817   ESHAKRRLLADG------VPEWMNDEQRRMLKADIPKQP-PNATVAKDGSGKFSTINAAL  975
              S   RRLL          P W     RR+L +    Q  PNA VAKDGSG++ TI AAL
Sbjct  217   SS---RRLLEHNNDEQGQYPSWFRAADRRLLASQSNGQVRPNAVVAKDGSGQYKTIGAAL  273

Query  976   KAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQT  1155
              A P   KGRY+I+VKAGIY+E + VTK  VNV MYGDG +KT+VTG KS ADG++T  T
Sbjct  274   AAYPKGLKGRYIIYVKAGIYNEYITVTKDQVNVFMYGDGPRKTMVTGSKSWADGITTQNT  333

Query  1156  ATFAVVGEGFMAQFIGFRNTA  1218
             ATFA +G GF+A+ +GF+NTA
Sbjct  334   ATFAAIGSGFLAKAMGFQNTA  354



>ref|XP_004149499.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004164099.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN49780.1| hypothetical protein Csa_5G125700 [Cucumis sativus]
Length=567

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 127/313 (41%), Positives = 178/313 (57%), Gaps = 17/313 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGE--  498
             ++V A+C  TD++D C+ TL     +  S    PK+    +++A   E+ K    S    
Sbjct  44    KAVSAICSTTDYQDECKTTLDHVARNTSS--NDPKDYAEAAILATIGEITKGYNLSDSLI  101

Query  499   VKQDTPlkkaaakdcaellkdakddldTAIASIKGDK-IGNFSSHAADLDNWLSAVMTYQ  675
             V+  T      + +  + L     D   A  S  G+  +   S   AD+ NWLSAV++YQ
Sbjct  102   VEASTNASIKMSVEDCKDLLQFAIDELQASYSAVGESDLHTDSDRVADIKNWLSAVISYQ  161

Query  676   DTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAKRRLL  843
              +C+DG    D + K  M+  L  A +L SNALAIV+ ++++L  +  +     + RRLL
Sbjct  162   QSCLDGLGEFDPQLKQRMQDGLDVAGKLTSNALAIVTAVSNILDNYRLQLKVQPSGRRLL  221

Query  844   A------DGVPEWMNDEQRRML--KADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYK  999
                    DG P W+    R++L  K    +  PNA VAKDGSGK+ TI AAL A P   +
Sbjct  222   GTTVVDRDGFPTWLTGADRKLLASKQRGVRPTPNAVVAKDGSGKYKTIAAALAAYPKVLR  281

Query  1000  GRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGE  1179
             GRYVI+VKAGIYDE + +TK M NV MYGDG +KTIVTG+KS  DG +T  TA+FA +GE
Sbjct  282   GRYVIYVKAGIYDEYITLTKDMKNVFMYGDGPRKTIVTGRKSNRDGFTTQNTASFAAIGE  341

Query  1180  GFMAQFIGFRNTA  1218
             GF+ + +GF NTA
Sbjct  342   GFLCKSMGFTNTA  354



>gb|EYU26212.1| hypothetical protein MIMGU_mgv1a003546mg [Erythranthe guttata]
Length=579

 Score =   186 bits (471),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 128/325 (39%), Positives = 189/325 (58%), Gaps = 30/325 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V  +C  TD++ TC  +LST   ++ + P    + L+ ++  A +E+  A+     + 
Sbjct  44    KAVFTVCGETDYKKTCADSLSTVANNESATPM---DFLQAAINVAIQEVQAAMSLPDTIG  100

Query  505   Q--DTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
             +  + P +K A +DC +LL+ A  +L  + + +    +   S   A+L NWLSAV++YQ 
Sbjct  101   KSANDPQQKMAVEDCKDLLQYAVAELQASFSMVGDSSLHTISDREAELKNWLSAVISYQQ  160

Query  679   TCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE---PSESHAKRRLLAD  849
             TCIDGF   E + A+   L  A +L  NALAIV+ ++ +   F    PS S       + 
Sbjct  161   TCIDGFTTPELQKAISDGLLNATQLTDNALAIVTVISQIFQAFNINIPSNSILNSTAASS  220

Query  850   G-------------------VPEWMNDEQRRML--KADIPKQP-PNATVAKDGSGKFSTI  963
             G                    P W+    R++L  K+    QP PNA VA+DGSG + TI
Sbjct  221   GRLLEEDHDHDDDGTSSSSSFPAWLPAGDRKLLASKSGGGGQPAPNAVVAQDGSGGYKTI  280

Query  964   NAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLS  1143
             +AAL A P  +KGRYVI+VKAG+YDE+V +TK +VNV MYGDG +K+IVTGKK   DG+S
Sbjct  281   SAALAAYPKNHKGRYVIYVKAGVYDETVTITKDLVNVYMYGDGPRKSIVTGKKCFTDGVS  340

Query  1144  TYQTATFAVVGEGFMAQFIGFRNTA  1218
             T+QTA F  +G+GF+A+ +GFRNTA
Sbjct  341   TFQTAPFIAIGDGFIAKSMGFRNTA  365



>ref|XP_002462429.1| hypothetical protein SORBIDRAFT_02g025460 [Sorghum bicolor]
 gb|EER98950.1| hypothetical protein SORBIDRAFT_02g025460 [Sorghum bicolor]
Length=628

 Score =   186 bits (473),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 140/319 (44%), Positives = 197/319 (62%), Gaps = 22/319 (7%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             K+V +S+KA+C  TD+   CE++L   G+  +++   PK+++R ++   G  + +A  ++
Sbjct  100   KAVSKSIKAMCSQTDYTAACEKSL---GKAANASSSSPKDIVRSAVEVIGDAISQAFDRA  156

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
               +  + P  KAA  DC E+  DAKDDL++ +  +  DK G  S  +  L  WLSAV+  
Sbjct  157   DLILSNDPRVKAAVADCKEVFADAKDDLNSTLKGVD-DKDG-ISKQSYQLRIWLSAVIAN  214

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE--------------  810
              +TCIDGFPD E K  +++S    KEL SNA+A++ + +S+LS  +              
Sbjct  215   METCIDGFPDDEFKAKVKESFTDGKELTSNAMALIEKGSSLLSVLKGGSKRRLLEEEEEG  274

Query  811   -PSESHAKRRLLADGVPEWMNDEQRRMLKADIPKQP--PNATVAKDGSGKFSTINAALKA  981
               S S A   L  DG+PEW+ D +RR+LK    K     N  VAKDGSGKF TIN AL A
Sbjct  275   AASASQAGPALDKDGIPEWVPDGERRVLKGGGFKNTLKANVVVAKDGSGKFKTINEALAA  334

Query  982   MPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTAT  1161
             MP  Y GRYVI VK G+Y+E V +T+ M NVT  GDGS+K+IVTGKKS ADG++T++TAT
Sbjct  335   MPKTYDGRYVIQVKEGVYEEYVTITRTMKNVTFLGDGSKKSIVTGKKSFADGITTFKTAT  394

Query  1162  FAVVGEGFMAQFIGFRNTA  1218
             F    +GFMA  +GF+NTA
Sbjct  395   FTAQADGFMAIGMGFQNTA  413



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   185 bits (470),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 178/310 (57%), Gaps = 24/310 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V+A+C  TD+++TCE +LS A   D      PKEL+R++  AA   +  A+K S   K
Sbjct  56    KAVQAICSPTDYKETCESSLSGANTTD------PKELIRLAFNAAVNNIGDAIKNSTLFK  109

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIK--GDKIGNFSS-----HAADLDNWLSAV  663
                    AA     +      D L +AI  +K  GDK+G F +     +  DL  WLSAV
Sbjct  110   D-----AAADSSTKDAFDICDDVLGSAIDDLKRAGDKVGEFDATKVDEYVEDLKVWLSAV  164

Query  664   MTYQDTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFEPSE--SHAK  831
             +TYQ+TCID F +    TA  M+  LKTA+EL SN LA+VS ++S++   +         
Sbjct  165   ITYQETCIDAFENTTGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTS  224

Query  832   RRLLADGVPEWMND-EQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
             RRLL++  P W+     RR+L A      PNA VA DGSG+F TI  A+  +P K    +
Sbjct  225   RRLLSED-PYWIKSPHTRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQPF  283

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             VIF+KAG+Y E V + KK+  V M G+G  KT +TG KS A G+ T+ TAT AV GE FM
Sbjct  284   VIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGEDFM  343

Query  1189  AQFIGFRNTA  1218
             A+ IGF NTA
Sbjct  344   AKDIGFENTA  353



>ref|XP_004986923.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Setaria italica]
Length=585

 Score =   185 bits (469),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 138/203 (68%), Gaps = 9/203 (4%)
 Frame = +1

Query  637   DLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE--  810
             DL +WLSAV+T+Q +C+D FP GE +  ++ +++ A+E+ SNALAI+ Q A++ S  +  
Sbjct  160   DLQSWLSAVITFQGSCVDMFPKGEIRDEVKTAMEKAREISSNALAIIKQGAALASMLDLH  219

Query  811   -------PSESHAKRRLLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINA  969
                         A RRL  D VP W++ E+R ++ A      PN TVAKDGSG F++I+A
Sbjct  220   TDVDKGKGGGDGASRRLEEDVVPAWVHREERELIAAGKGGLTPNVTVAKDGSGDFASISA  279

Query  970   ALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTY  1149
             AL AMP KY GRY I+VK G+Y+E+V +T    N+TMYGDG++K+IVTG KS+ DG+  +
Sbjct  280   ALDAMPNKYTGRYFIYVKEGVYEETVNITNCRGNITMYGDGAKKSIVTGSKSVLDGIRMW  339

Query  1150  QTATFAVVGEGFMAQFIGFRNTA  1218
             +TATFAV G+ F A  +G RNTA
Sbjct  340   RTATFAVDGDSFTAMRLGIRNTA  362



>ref|XP_004975844.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Setaria italica]
Length=563

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 136/327 (42%), Positives = 203/327 (62%), Gaps = 15/327 (5%)
 Frame = +1

Query  271   RSGTK---SKTTPLDSGKSV-GESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             RSG K   S T P ++  +  G+SV++LC  T ++++CE+TLS A    ++       + 
Sbjct  27    RSGKKAGDSFTVPGEASLATSGKSVQSLCAPTLYKESCEKTLSGATNGTENPKDVFHSVA  86

Query  439   RISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGN  618
             ++++ +    M+++ K  GE K    + ++A +DC +LL+DA DDL   +    GD I  
Sbjct  87    KVALESVKSAMEQS-KAIGEAKSSDSMTESAREDCKKLLEDAVDDLKGMLEMAGGD-IKV  144

Query  619   FSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVL  798
               S + DL+ WL+ VMT+ DTCIDGF D + K  M   L+ A EL SNALAI + L  +L
Sbjct  145   LFSRSDDLETWLTGVMTFMDTCIDGFVDEKLKADMHSVLRNATELSSNALAITNSLGGLL  204

Query  799   STFEPS--ESHAKRRLLAD----GVPEWMNDEQRRMLKADIPKQP-PNATVAKDGSGKFS  957
                +    +  ++RRLL++    G P WM   +R+++ A    QP PNA VA+DGSG+F 
Sbjct  205   KKLDLDMFKKDSRRRLLSEQDEQGYPVWMRSPERKLMAAG--NQPKPNAVVAQDGSGQFK  262

Query  958   TINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADG  1137
             +I  A+ AMP    GRYVI+VKAG+Y+E V++ K  VN+ MYGDG +KT VTG+KS ADG
Sbjct  263   SIQQAVDAMPKGNTGRYVIYVKAGLYNEMVMIPKDKVNIFMYGDGPKKTRVTGRKSFADG  322

Query  1138  LSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             ++T +TATF++   GF+ + +GF NTA
Sbjct  323   ITTMKTATFSIEASGFICKNMGFHNTA  349



>ref|XP_007051270.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOX95427.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=555

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 190/314 (61%), Gaps = 29/314 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V   C  TD+++ C++TLS+    D      PK+ +  +++A+     +AVKK     
Sbjct  41    KAVSNFCSSTDYQEACKKTLSSVNSTD------PKDYVAQAILAS----QEAVKKFFNYS  90

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIK------GD-KIGNFSSHAADLDNWLSAV  663
                 ++          L D K+ +D AI S++      GD ++ + +   ADL  WLSAV
Sbjct  91    DSLIVQAKNDSRTKMALDDCKEMMDYAIQSLQASFSEVGDGELRSINDRIADLRTWLSAV  150

Query  664   MTYQDTCIDGFPDGEEKTAMEKSLKT----AKELGSNALAIVSQLASVLSTFEPSES-HA  828
             ++YQ +C+DGF   E +T M +++ T    A EL +NALAIV++L+ +LS F    +   
Sbjct  151   ISYQQSCLDGF---EPETTMHQTMTTGIADASELTANALAIVTKLSDILSKFGLQLAIPT  207

Query  829   KRRLLA---DGVPEWMNDEQRRML-KADIPKQPPNATVAKDGSGKFSTINAALKAMPAKY  996
              RRLL+   DG P W +   R++L + D     PNA VAKDGSG+F TI AAL A P   
Sbjct  208   ARRLLSVEKDGYPSWFSAADRKLLARIDNRNLRPNAVVAKDGSGQFRTIAAALAAAPKNS  267

Query  997   KGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVG  1176
             K R+VI+VKAGIY+E + V KK  N+ MYGDG +KTIVTG K+  DG ST+QTATF+ +G
Sbjct  268   KVRHVIYVKAGIYNEYITVDKKTTNILMYGDGPRKTIVTGHKNFVDGTSTWQTATFSAIG  327

Query  1177  EGFMAQFIGFRNTA  1218
             +GF+A+ +GF+NTA
Sbjct  328   DGFIAKSMGFQNTA  341



>ref|XP_011046152.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   183 bits (464),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 128/313 (41%), Positives = 184/313 (59%), Gaps = 26/313 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEV-  501
             ++V  LC  T +++ C  TLS     D      PKEL++  ++A    + K+   + ++ 
Sbjct  44    KAVGTLCQPTYYKEACTNTLSAVNSTD------PKELIKGGILAISDSLKKSSNLTDDLV  97

Query  502   ---KQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
                  D P  K A  DC ELL++A + L   ++ + G  + + S HA D   WLS+++ Y
Sbjct  98    VKNNSDEPRAKMALNDCKELLQNASERLQDTLSKVGGTDLQSLSDHADDYRTWLSSIIAY  157

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGS----NALAIVSQLASVLSTFE-----PSESH  825
             Q+ C+DGF   EE + ++  ++ + + GS    N L I++ L+ VL +       PS S 
Sbjct  158   QEMCLDGF---EENSPLKAQVQNSTDYGSQLTDNVLNILAGLSQVLGSLGLKFNVPSTS-  213

Query  826   AKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKG  1002
              +R L ADG P WM+   R++L +       PNA VA DGSGKF TINAAL A P   KG
Sbjct  214   -RRLLQADGYPSWMSAADRKLLASRGNGGARPNAVVAHDGSGKFKTINAALAAYPKGLKG  272

Query  1003  RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA-DGLSTYQTATFAVVGE  1179
             RYVI+VKAGIY E V VTK   NV +YGDG+++TIVTG K+ A DG+ T++TATF V  +
Sbjct  273   RYVIYVKAGIYREYVTVTKDKPNVFIYGDGARRTIVTGNKNFAKDGIGTWKTATFIVEAD  332

Query  1180  GFMAQFIGFRNTA  1218
             GF+A+ +GF NTA
Sbjct  333   GFIAKNMGFSNTA  345



>ref|XP_006344580.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13-like 
[Solanum tuberosum]
Length=655

 Score =   184 bits (467),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 125/299 (42%), Positives = 188/299 (63%), Gaps = 13/299 (4%)
 Frame = +1

Query  337   ALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTP  516
             A+C  TDF  +C   LS   + + S   +P +LL+ ++ AA  E+   + +  ++ +D P
Sbjct  151   AICAATDFSQSCGDILSKVLQANASG-AQPTDLLKATVSAAIDEIATGIVELDKINKDIP  209

Query  517   lkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGF  696
              K  A  DC  LL DAK DL+ +I  ++G  I + ++  A+L+N LSA +TYQ  C+DG+
Sbjct  210   EKAVAHDDCMALLGDAKKDLNASIYLLEGG-INDVATTTAELNNKLSAALTYQSMCVDGY  268

Query  697   PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLAD--GVPEWMN  870
             P+ ++ T ++ +LK  +E   N+LA+ S L+S         + AKRRLL    GVP W+ 
Sbjct  269   PEADQST-VQSALKKTEEHTINSLAVASGLSSSSPQ---PNNSAKRRLLTTRLGVPAWIK  324

Query  871   DEQRRMLKADIPKQPP---NATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDE  1041
                RRML  +  K      N T+AKDGSG FS+IN ALKA+P  ++GR+ I++K G+Y+E
Sbjct  325   QGDRRMLDEEEGKDMKAFINMTIAKDGSGNFSSINEALKAVPQSFEGRFFIYIKEGVYEE  384

Query  1042  SvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +VVV++  +     GDGSQK+I++G K++ D L+TYQTAT A+ G+GF+A  IGFRNTA
Sbjct  385   NVVVSQVNLTF--LGDGSQKSIISGSKNIVDDLTTYQTATVAISGDGFIAYKIGFRNTA  441



>ref|XP_002298186.1| hypothetical protein POPTR_0001s21630g [Populus trichocarpa]
 gb|EEE82991.1| hypothetical protein POPTR_0001s21630g [Populus trichocarpa]
Length=559

 Score =   182 bits (463),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 181/309 (59%), Gaps = 29/309 (9%)
 Frame = +1

Query  340   LCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPl  519
             LC  +++++ C  TLS+    D      PKE ++ +++AA      AVKKS    +D  +
Sbjct  51    LCQPSEYKEACTETLSSVNSTD------PKEFVKQAILAA----SDAVKKSFNFSEDLVV  100

Query  520   kkaaakdcaellkdakddldTAIASIKGDK--IGNFSSH-----AADLDNWLSAVMTYQD  678
             K +  K     L D K+ LD A+  ++     +G+   H      A+L +WLS+V+ YQ+
Sbjct  101   KASKDKREKMALDDCKELLDYAVQELQASMSLVGDSDLHTTNERVAELQSWLSSVLAYQE  160

Query  679   TCIDGFPDGEE-KTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-----PSESHAKRRL  840
             TC+DGF D    K  +E+    A  L  N LAI+S L+  L +       PS S   RRL
Sbjct  161   TCVDGFSDNSTIKPTIEQGFVDASHLTDNVLAIISGLSGFLKSVGLQFNIPSNS---RRL  217

Query  841   LA-DGVPEWMNDEQRRMLKAD-IPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
             LA DG P W +   R++L A    K  PNA VA+DGSG+F TI+AA+ A P   KGRY+I
Sbjct  218   LAEDGFPTWFSGADRKLLAAQGNGKVKPNAVVAQDGSGQFKTISAAIAAYPNNLKGRYII  277

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA-DGLSTYQTATFAVVGEGFMA  1191
             +VKAGIY E V V KK  NV +YGDG +KTIVTG KS A DGL T++TATF    +GF+A
Sbjct  278   YVKAGIYREYVTVDKKKPNVFIYGDGPRKTIVTGSKSFAKDGLGTWKTATFVAEADGFIA  337

Query  1192  QFIGFRNTA  1218
             + +GF+NTA
Sbjct  338   KSMGFQNTA  346



>gb|EAZ09211.1| hypothetical protein OsI_31486 [Oryza sativa Indica Group]
Length=413

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 134/201 (67%), Gaps = 24/201 (12%)
 Frame = +1

Query  676   DTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA---  846
             +TCIDGFPDGE +  +++S    +E  SNALA++ + +S LS  + S+    RRLLA   
Sbjct  2     ETCIDGFPDGEFRDKVKESFNNGREFTSNALALIEKASSFLSALKGSQ----RRLLAGEE  57

Query  847   ---------------DGVPEWMNDEQRRMLKADIPKQ--PPNATVAKDGSGKFSTINAAL  975
                            DG+PEW+ D  RR+LK    K    PN  VAKDGSGKF TIN AL
Sbjct  58    DNGGGAADPHLALAEDGIPEWVPDGDRRVLKGGGFKNNLTPNVIVAKDGSGKFKTINEAL  117

Query  976   KAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQT  1155
              AMP  Y GRYVI+VK G+Y E V +TKKM +VTMYGDGS+K+IVTG K+ ADGL+T++T
Sbjct  118   AAMPKTYSGRYVIYVKEGVYAEYVTITKKMASVTMYGDGSRKSIVTGSKNFADGLTTFKT  177

Query  1156  ATFAVVGEGFMAQFIGFRNTA  1218
             ATFA  G+GFMA  +GF+NTA
Sbjct  178   ATFAAQGDGFMAIGMGFQNTA  198



>ref|XP_002298185.1| hypothetical protein POPTR_0001s21650g [Populus trichocarpa]
 gb|EEE82990.1| hypothetical protein POPTR_0001s21650g [Populus trichocarpa]
Length=558

 Score =   182 bits (463),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 127/311 (41%), Positives = 183/311 (59%), Gaps = 22/311 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEV-  501
             ++V  LC  T +++ C  TLS     D      PKEL++  ++A    + K+   + ++ 
Sbjct  44    KAVSTLCQPTYYKEACTNTLSAVNSTD------PKELIKGGILAISDSLKKSSNLTDDLV  97

Query  502   ---KQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
                  D P  K A  DC ELL+DA + L   ++ + G  + + S HA D   WLS+++ Y
Sbjct  98    VKNNSDEPRAKMALNDCKELLQDASEQLQDTLSKVGGIDLQSLSDHADDYRTWLSSIIAY  157

Query  673   QDTCIDGFPDGEEKTAMEKSLKTAKELGS----NALAIVSQLASVLSTFE---PSESHAK  831
             Q+ C+DGF   EE + ++  ++ + + GS    N L I++ L+ VL +      + S ++
Sbjct  158   QEMCLDGF---EENSPLKAQVQNSTDYGSQLTDNVLNILAGLSQVLGSLGLKFNAPSTSR  214

Query  832   RRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
             R L ADG P WM+   R++L +       PNA VA DGSGKF TINAAL A P   KGRY
Sbjct  215   RLLQADGYPSWMSAADRKLLASRGNGGARPNAVVAHDGSGKFKTINAALAAYPKGLKGRY  274

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA-DGLSTYQTATFAVVGEGF  1185
             VI+VKAGIY E V VTK   NV +YGDG+++TIVTG K+ A DG+ T++TATF V   GF
Sbjct  275   VIYVKAGIYREYVTVTKDKPNVFIYGDGARRTIVTGNKNFAKDGIGTWKTATFIVEANGF  334

Query  1186  MAQFIGFRNTA  1218
             +A+ +GF NTA
Sbjct  335   IAKNMGFSNTA  345



>ref|XP_008466382.1| PREDICTED: pectinesterase-like isoform X2 [Cucumis melo]
Length=565

 Score =   182 bits (463),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 125/315 (40%), Positives = 180/315 (57%), Gaps = 21/315 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ++C  TD++  C+ TL   G +  S+   PKE L+ ++ A  +EM K    +  + 
Sbjct  42    KAVSSICSNTDYQQECQTTLGNVGHN--SSVDDPKEFLKAAITATIEEMKKGYNLTDNLM  99

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSH-----AADLDNWLSAVMT  669
              +     +      +     +  +D   AS     +G+   H      AD+ NWL+AV++
Sbjct  100   VEAANNASIKMTVDDCRDLLQSAIDELHASYS--TVGDPDLHTNEDRVADIKNWLTAVIS  157

Query  670   YQDTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAKRR  837
             YQ +C+DG    D + K  M+  L  A +L SNALAIV  ++ +L +   +     + RR
Sbjct  158   YQQSCLDGLEEFDPQLKQKMQGGLDVAAKLTSNALAIVDAVSDILKSLGLQLKVQPSGRR  217

Query  838   LLA------DGVPEWMNDEQRRMLKADI--PKQPPNATVAKDGSGKFSTINAALKAMPAK  993
             LL       DG P W+    R++L A     +  PNA VAKDGSG++ TI AAL A P  
Sbjct  218   LLGTTEVDNDGFPTWLTGADRKLLAAKRGGVRVKPNAVVAKDGSGQYKTIAAALAAYPKA  277

Query  994   YKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVV  1173
              KGRYVI+VKAGIY+E ++VTK M NV MYGDG +KTIVTG+KS  DG++T  TATFA +
Sbjct  278   LKGRYVIYVKAGIYNEYIIVTKDMKNVFMYGDGPRKTIVTGRKSNRDGINTQNTATFAAI  337

Query  1174  GEGFMAQFIGFRNTA  1218
             GEGF+ + +GF NTA
Sbjct  338   GEGFLCKSMGFTNTA  352



>ref|XP_008660035.1| PREDICTED: pectinesterase-like [Zea mays]
Length=591

 Score =   182 bits (463),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 123/318 (39%), Positives = 184/318 (58%), Gaps = 25/318 (8%)
 Frame = +1

Query  328   SVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---E  498
             SV+  C   D++ TC  TL TA    D A K P      ++ A  + + +   ++     
Sbjct  56    SVELFCAPADYQGTCHETLETALSRTDPA-KHPHAAAAAAITAVERALAEGFNRTSVLDA  114

Query  499   VKQDTPlkkaaakdcaellkd-akddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             V+Q        A     +L +  + +++ A++SI    +      A DL  WLSAV+T+Q
Sbjct  115   VRQSNDTLVWEAIHDCRMLLEDCRGNVERALSSIAWRGV---EGPAQDLQAWLSAVITFQ  171

Query  676   DTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS------ESHAKRR  837
              +C+D FP GE +  ++ +++ A+E+ SNALAI+ Q A++ S  + +      +    R+
Sbjct  172   GSCVDMFPKGEVRDEVKSTMEKAREVSSNALAIIKQGAALASMLDLNTGVDNVDGKGNRQ  231

Query  838   LLAD-------GVPEWMNDEQRRMLKADIPKQ----PPNATVAKDGSGKFSTINAALKAM  984
             L  D        VP W+ DE+R++L     ++     PN TVAKDGSG F+ I+AAL AM
Sbjct  232   LEEDEESASSLSVPTWVPDEERKLLGVKGGRRRAALTPNVTVAKDGSGDFTNISAALDAM  291

Query  985   PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF  1164
             P KY GRY I+VK G+YDE+V +T +M NVTMYGDGS+ +IVTG K++ DG+  ++TATF
Sbjct  292   PEKYSGRYFIYVKEGVYDETVNITGRMANVTMYGDGSKASIVTGSKNVVDGIRMWRTATF  351

Query  1165  AVVGEGFMAQFIGFRNTA  1218
             AV G+ FMA  +G RNTA
Sbjct  352   AVDGDSFMAMKLGIRNTA  369



>ref|XP_008466391.1| PREDICTED: pectinesterase-like isoform X3 [Cucumis melo]
Length=565

 Score =   182 bits (461),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 180/315 (57%), Gaps = 21/315 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ++C  TD++  C+ TL   G +  S+   PKE L+ ++ A  +EM K    +  + 
Sbjct  42    KAVSSICSNTDYQQECQTTLGNVGHN--SSVDDPKEFLKAAITATIEEMKKGYNLTDNLM  99

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSH-----AADLDNWLSAVMT  669
              +     +      +     +  +D   AS     +G+   H      AD+ NWL+AV++
Sbjct  100   VEAANNASIKMTVDDCRDLLQSAIDELHASYS--TVGDPDLHTNEDRVADIKNWLTAVIS  157

Query  670   YQDTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAKRR  837
             YQ +C+DG    D + K  M+  L  A +L SNALAIV  ++ +L +   +     + RR
Sbjct  158   YQQSCLDGLEEFDPQLKQKMQGGLDVAAKLTSNALAIVDAVSDILKSLGLQLKVQPSGRR  217

Query  838   LLA------DGVPEWMNDEQRRMLKADI--PKQPPNATVAKDGSGKFSTINAALKAMPAK  993
             LL       DG P W+    R++L A     +  PNA VAKDGSG++ TI AAL A P  
Sbjct  218   LLGTTEVDNDGFPTWLTGADRKLLAAKRGGVRVKPNAVVAKDGSGQYKTIAAALAAYPKA  277

Query  994   YKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVV  1173
              KGRYVI+VKAGIY+E ++VTK M NV MYGDG +KTIVTG+KS  DG++T  TATF  +
Sbjct  278   LKGRYVIYVKAGIYNEYIIVTKDMKNVFMYGDGPRKTIVTGRKSNRDGINTQNTATFVAI  337

Query  1174  GEGFMAQFIGFRNTA  1218
             GEGF+ + +GF+NTA
Sbjct  338   GEGFLCKSMGFQNTA  352



>ref|XP_004242900.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Solanum lycopersicum]
Length=652

 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 124/299 (41%), Positives = 190/299 (64%), Gaps = 12/299 (4%)
 Frame = +1

Query  337   ALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTP  516
             A+C GTDF  +C   LS   + + S   +P +LL+ ++ AA  E+   + +  ++ +D P
Sbjct  147   AICAGTDFSQSCGDILSKVVQANASG-AQPTDLLKATVSAAIDEIAAGIVELDKINKDIP  205

Query  517   lkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGF  696
              K  A  DC  LL  AK DL+ +I  ++G  + + ++  A+L+N LSA +T+Q  C+DG+
Sbjct  206   EKVVAHDDCMALLGYAKKDLNASIYLLEGG-VNDVATTTAELNNKLSAALTFQSMCVDGY  264

Query  697   PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLAD--GVPEWMN  870
             P+ ++ T ++ +LK  +E  +N+L + S L+S  S+   S + AKRRLL    GVP W+ 
Sbjct  265   PEADQST-VQSALKKTEEHTTNSLVVASGLSSSSSSQ--SNNSAKRRLLTTRLGVPAWIK  321

Query  871   DEQRRMLKADIPKQPP---NATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDE  1041
                RRML  +  K      N TVAKDGSG FS+IN ALKA+P  ++GR+ I++K G+Y+E
Sbjct  322   QGDRRMLDEEEGKDMKSFINMTVAKDGSGNFSSINEALKAVPQSFEGRFFIYIKEGVYEE  381

Query  1042  SvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +VVV++  +     GDGSQK+I++G K++ D L+TYQTAT A+ G+GF A  +GFRNTA
Sbjct  382   NVVVSQVNLTFV--GDGSQKSIISGSKNIVDDLTTYQTATVAISGDGFFAYKMGFRNTA  438



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   181 bits (460),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 190/319 (60%), Gaps = 33/319 (10%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEV  501
             ++++A+C  TD++D C  +L S AG   D     PK+L++ +  +A + +  A K S  +
Sbjct  57    KAIQAICQPTDYKDACVNSLTSKAGNTTD-----PKDLVQAAFASAMEHLSAAAKNSTLL  111

Query  502   KQDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNFS-----SHAADLDNWLSA  660
             ++            ++ L++ +D ++ AI  +K   +++G+F      +  AD+  WLSA
Sbjct  112   QE-----LNKDPRASQALQNCEDLVNYAIDDLKKSFNQVGDFDYSKMDNIIADIKIWLSA  166

Query  661   VMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKR  834
             V+TYQ+TC+DGF +  G+    M + LKT+ EL SN LAIV +++S+LS  +   ++  R
Sbjct  167   VITYQETCLDGFENTTGDAGEKMRQILKTSMELSSNGLAIVGEVSSILSNLQ--LANLNR  224

Query  835   RLLADG-----------VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKA  981
             RLL+D             P W + E R++L+A++ +  PN TVAKDGSG F TIN A++ 
Sbjct  225   RLLSDDPADPDNHIDDEFPYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQ  284

Query  982   MPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTAT  1161
             +P      +++++K GIY+E V + K   N+ M GDG  KT +TG  +  DG  T++TAT
Sbjct  285   LPKFSNQTFILYIKKGIYEEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTAT  344

Query  1162  FAVVGEGFMAQFIGFRNTA  1218
              AV+G+GF+A+ IGF N+A
Sbjct  345   VAVLGDGFIAKGIGFENSA  363



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score =   181 bits (458),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 177/307 (58%), Gaps = 16/307 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG--  495
             +S+K+ C   D+ +TCE TL  TAG         P +L +    A  + ++KAV++S   
Sbjct  44    KSIKSFCQPVDYRETCETTLEQTAGN-----ATNPTDLAKAIFKATSERIEKAVRESAVL  98

Query  496   -EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              ++K D P    A KDC ELL  A DDL T    + G +  NF     D+  WLS+ +TY
Sbjct  99    NDLKND-PRTSDALKDCEELLDYAIDDLKTTFDKLGGFQTSNFKRAVDDVKTWLSSALTY  157

Query  673   QDTCIDGFPDG---EEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLL  843
             Q+TC+DGF +    E    M K+LK+++EL  N LAIV Q A  L+  + +   ++R L 
Sbjct  158   QETCLDGFENSTSTEASEKMRKALKSSQELTENILAIVDQFADTLANLDIT-GFSRRLLG  216

Query  844   ADGVPEWMNDEQRRMLKADIPKQP--PNATVAKDGSGKFSTINAALKAMPAKYKGRYVIF  1017
              DGVP WM++ +RR+L+A    +   P+ TVA DGSG F TIN AL  +P K  G YV++
Sbjct  217   DDGVPVWMSNAKRRLLEATPGSKEFKPDVTVAADGSGDFKTINEALAKVPVKSTGTYVMY  276

Query  1018  VKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQF  1197
             VKAG Y E V V + + N+ M GDG+ KTI+TG KS    ++T  TAT   +G GF  + 
Sbjct  277   VKAGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLNITTKDTATMEAIGNGFFMRG  336

Query  1198  IGFRNTA  1218
             IG  NTA
Sbjct  337   IGVENTA  343



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 190/319 (60%), Gaps = 33/319 (10%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEV  501
             ++++A+C  TD++D C  +L S AG   D     PK+L++ +  +A + +  A K S  +
Sbjct  57    KAIQAICQPTDYKDACVNSLTSKAGNTTD-----PKDLVQAAFASAMEHLSAAAKNSTLL  111

Query  502   KQDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNFS-----SHAADLDNWLSA  660
             ++            ++ L++ +D ++ AI  +K   +++G+F      +  AD+  WLSA
Sbjct  112   QE-----LNKDPRASQALQNCEDLVNYAIDDLKKSFNQVGDFDYSKMDNIIADIKIWLSA  166

Query  661   VMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKR  834
             V+TYQ+TC+DGF +  G+    M + LKT+ EL SN LAIV +++S+LS  + +  +  R
Sbjct  167   VITYQETCLDGFENTTGDAGEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLA--NLNR  224

Query  835   RLLADG-----------VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKA  981
             RLL+D             P W + E R++L+A++ +  PN TVAKDGSG F TIN A++ 
Sbjct  225   RLLSDDPADPDNHIDDEFPYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQ  284

Query  982   MPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTAT  1161
             +P      +++++K GIY+E V + K   N+ M GDG  KT +TG  +  DG  T++TAT
Sbjct  285   LPKFSNQTFILYIKKGIYEEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTAT  344

Query  1162  FAVVGEGFMAQFIGFRNTA  1218
              AV+G+GF+A+ IGF N+A
Sbjct  345   VAVLGDGFIAKGIGFENSA  363



>ref|XP_011046142.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=559

 Score =   180 bits (457),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 180/309 (58%), Gaps = 29/309 (9%)
 Frame = +1

Query  340   LCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPl  519
             LC  +++++ C  TLS+    D      PK+ ++ +++AA      AVKKS    +D  +
Sbjct  51    LCQPSEYKEACTETLSSVNSTD------PKDFVKQAILAA----SDAVKKSFNFSEDLVV  100

Query  520   kkaaakdcaellkdakddldTAIASIKGDK--IGNFSSH-----AADLDNWLSAVMTYQD  678
             K +  K     L D K+ LD A+  ++     +G+   H      A+L +WLS+V  YQ+
Sbjct  101   KASKDKREKMALDDCKELLDYAVQELQASMSLVGDSDLHTTNERVAELQSWLSSVFAYQE  160

Query  679   TCIDGFPDGEE-KTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-----PSESHAKRRL  840
             TC+DGF D    K  +E+    A  L  N LAI+S L+  L +       PS S   RRL
Sbjct  161   TCVDGFSDNSTIKPTIEQGFVDASHLTDNVLAIISGLSGFLKSVGLQFNIPSNS---RRL  217

Query  841   LA-DGVPEWMNDEQRRMLKAD-IPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
             LA DG P W +   R++L A    K  PNA VA+DGSG+F TI+AA+ A P   KGRY+I
Sbjct  218   LAEDGFPTWFSGADRKLLAAQGNGKVKPNAVVAQDGSGQFKTISAAIAAYPNNLKGRYII  277

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA-DGLSTYQTATFAVVGEGFMA  1191
             +VKAGIY E V V KK  NV +YGDG +KTIVTG KS A DGL T++TATF    +GF+A
Sbjct  278   YVKAGIYREYVTVDKKKPNVFIYGDGPRKTIVTGSKSFAKDGLGTWKTATFVAEADGFIA  337

Query  1192  QFIGFRNTA  1218
             + +GF+NTA
Sbjct  338   KSMGFQNTA  346



>gb|KGN49779.1| hypothetical protein Csa_5G119700 [Cucumis sativus]
Length=566

 Score =   180 bits (456),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 179/315 (57%), Gaps = 21/315 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ++C   D++  C+ TL + G  ++S+ + PKE ++ ++ +  +EM K    +  + 
Sbjct  43    KAVASICSNADYQPECQTTLGSVG--NNSSVEDPKEFIKAAITSTIEEMKKGYNLTDNLM  100

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHA-----ADLDNWLSAVMT  669
              +            +     +  +D   AS     +G+   H      AD+ NWL+AV++
Sbjct  101   VEAANNATIKMSVDDCKDLLQSAIDELHASYS--TVGDPDLHTNEDRIADIKNWLTAVIS  158

Query  670   YQDTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAKRR  837
             YQ +C+DG    D + K  M+  L  A +L SNALAIV  ++ +L     +     + RR
Sbjct  159   YQQSCLDGLEEFDPQLKQKMQDGLDVAGKLTSNALAIVGAVSDILKELGLQLKVQPSGRR  218

Query  838   LL------ADGVPEWMNDEQRRMLKADI--PKQPPNATVAKDGSGKFSTINAALKAMPAK  993
             LL      +D  P W+    R++L A     +  PN  VAKDGSG++ TI AAL A P  
Sbjct  219   LLGTTEVDSDSFPTWLTGSDRKLLAAKRGGVRVKPNVVVAKDGSGQYKTIGAALAAYPKA  278

Query  994   YKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVV  1173
              KGRYVI+VKAG+Y+E ++VTK M N+ MYGDG +KTIVTG+KS  DG++T  TA+FA +
Sbjct  279   LKGRYVIYVKAGVYNEPIIVTKDMKNIFMYGDGPRKTIVTGRKSNRDGITTQNTASFAAI  338

Query  1174  GEGFMAQFIGFRNTA  1218
             GEGF+ + +GF NTA
Sbjct  339   GEGFLCKSMGFTNTA  353



>ref|XP_004149498.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 ref|XP_004171697.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=560

 Score =   179 bits (455),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 179/315 (57%), Gaps = 21/315 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ++C   D++  C+ TL + G  ++S+ + PKE ++ ++ +  +EM K    +  + 
Sbjct  37    KAVASICSNADYQPECQTTLGSVG--NNSSVEDPKEFIKAAITSTIEEMKKGYNLTDNLM  94

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHA-----ADLDNWLSAVMT  669
              +            +     +  +D   AS     +G+   H      AD+ NWL+AV++
Sbjct  95    VEAANNATIKMSVDDCKDLLQSAIDELHASYS--TVGDPDLHTNEDRIADIKNWLTAVIS  152

Query  670   YQDTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAKRR  837
             YQ +C+DG    D + K  M+  L  A +L SNALAIV  ++ +L     +     + RR
Sbjct  153   YQQSCLDGLEEFDPQLKQKMQDGLDVAGKLTSNALAIVGAVSDILKELGLQLKVQPSGRR  212

Query  838   LL------ADGVPEWMNDEQRRMLKADI--PKQPPNATVAKDGSGKFSTINAALKAMPAK  993
             LL      +D  P W+    R++L A     +  PN  VAKDGSG++ TI AAL A P  
Sbjct  213   LLGTTEVDSDSFPTWLTGSDRKLLAAKRGGVRVKPNVVVAKDGSGQYKTIGAALAAYPKA  272

Query  994   YKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVV  1173
              KGRYVI+VKAG+Y+E ++VTK M N+ MYGDG +KTIVTG+KS  DG++T  TA+FA +
Sbjct  273   LKGRYVIYVKAGVYNEPIIVTKDMKNIFMYGDGPRKTIVTGRKSNRDGITTQNTASFAAI  332

Query  1174  GEGFMAQFIGFRNTA  1218
             GEGF+ + +GF NTA
Sbjct  333   GEGFLCKSMGFTNTA  347



>gb|AFW88066.1| hypothetical protein ZEAMMB73_934481 [Zea mays]
Length=924

 Score =   182 bits (463),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 123/318 (39%), Positives = 184/318 (58%), Gaps = 25/318 (8%)
 Frame = +1

Query  328   SVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---E  498
             SV+  C   D++ TC  TL TA    D A K P      ++ A  + + +   ++     
Sbjct  56    SVELFCAPADYQGTCHETLETALSRTDPA-KHPHAAAAAAITAVERALAEGFNRTSVLDA  114

Query  499   VKQDTPlkkaaakdcaellkd-akddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             V+Q        A     +L +  + +++ A++SI    +      A DL  WLSAV+T+Q
Sbjct  115   VRQSNDTLVWEAIHDCRMLLEDCRGNVERALSSIAWRGV---EGPAQDLQAWLSAVITFQ  171

Query  676   DTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPS------ESHAKRR  837
              +C+D FP GE +  ++ +++ A+E+ SNALAI+ Q A++ S  + +      +    R+
Sbjct  172   GSCVDMFPKGEVRDEVKSTMEKAREVSSNALAIIKQGAALASMLDLNTGVDNVDGKGNRQ  231

Query  838   LLAD-------GVPEWMNDEQRRMLKADIPKQ----PPNATVAKDGSGKFSTINAALKAM  984
             L  D        VP W+ DE+R++L     ++     PN TVAKDGSG F+ I+AAL AM
Sbjct  232   LEEDEESASSLSVPTWVPDEERKLLGVKGGRRRAALTPNVTVAKDGSGDFTNISAALDAM  291

Query  985   PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF  1164
             P KY GRY I+VK G+YDE+V +T +M NVTMYGDGS+ +IVTG K++ DG+  ++TATF
Sbjct  292   PEKYSGRYFIYVKEGVYDETVNITGRMANVTMYGDGSKASIVTGSKNVVDGIRMWRTATF  351

Query  1165  AVVGEGFMAQFIGFRNTA  1218
             AV G+ FMA  +G RNTA
Sbjct  352   AVDGDSFMAMKLGIRNTA  369



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   180 bits (457),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 124/330 (38%), Positives = 196/330 (59%), Gaps = 22/330 (7%)
 Frame = +1

Query  277   GTKSKTTPLDSGKSVGESVKAL---CHGTDFEDTCERTL-STAGEDDDSAPKKPKELLRI  444
             GT++  T   + ++V +S KA+   C  TD+++TC +TL + AG   D     PKEL++ 
Sbjct  29    GTQNSDTDNYNHQAVSDSQKAIQTICEPTDYKETCIKTLQAEAGNSTD-----PKELIQA  83

Query  445   SMVAAGKEMDKAVKKSGEVK--QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGN  618
             +  A    +++A K S  ++  Q  P  K A ++C EL   A +DL+ + A  +     N
Sbjct  84    AFKATTNYINEAAKNSTVLQELQKDPRTKLALENCKELAHQAVEDLERSFAKFQTFDFSN  143

Query  619   FSSHAADLDNWLSAVMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLAS  792
                  AD+  WLS  +TYQ TC+DGF   +G+    M +SL+T+ EL SN LA+++ ++S
Sbjct  144   IDDMLADIKVWLSGALTYQQTCLDGFEGAEGDAGEKMRQSLETSMELTSNGLAMINDISS  203

Query  793   VLSTFEPSESHAKRRLLADGV--------PEWMNDEQRRMLKADIPKQPPNATVAKDGSG  948
             VL++ E   +   RRLL+D +        P W+++ +RR+L+A   K  P+  VAKDGSG
Sbjct  204   VLTSLE-LPAFTNRRLLSDDILGHGMDILPSWIDEGRRRLLRAKPRKVKPDLIVAKDGSG  262

Query  949   KFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSL  1128
              F+TIN AL  +    +  +V+++K G+Y+E V   K ++++T+ GDG  KT +TGK + 
Sbjct  263   NFTTINEALLNITKNEEKEFVLYIKEGVYEEKVTFHKNLLHLTVIGDGPTKTRITGKLNF  322

Query  1129  ADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              DG+ TY TAT AV+G+ F+A+ IGF N A
Sbjct  323   IDGVPTYHTATVAVLGDFFIAKDIGFENAA  352



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 182/312 (58%), Gaps = 30/312 (10%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V A+C  TD+++TCE +LS A   D      PKEL++++  AA   + +A+K S  +K
Sbjct  57    KAVHAICSPTDYKETCESSLSGANTTD------PKELIKVAFNAAVNNIGEAIKNSALLK  110

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIK--GDKIGNFSS-----HAADLDNWLSAV  663
                    AA     + L    D L++AI  +K  GDK+G F +     +  DL  WLSAV
Sbjct  111   D-----AAADNSTKDALDICNDVLESAIDDLKRAGDKVGAFDATKVDEYVEDLKVWLSAV  165

Query  664   MTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE----SH  825
             +TYQ+TCID F +  G+    M+  LKTA+EL SN LA+VS ++S++   +       + 
Sbjct  166   ITYQETCIDAFENTTGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGAT  225

Query  826   AKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKG  1002
               RRL ++   +W+N   RR+LK        PNA VA+DGSG+F TI  A+ ++P   + 
Sbjct  226   TSRRLFSN--DDWIN---RRVLKGRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEK  280

Query  1003  RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEG  1182
              +VI++KAG+Y E V + KKM  +   GDG  KT +TG KS A G+ T+QTAT AV  E 
Sbjct  281   TFVIYIKAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNAEE  340

Query  1183  FMAQFIGFRNTA  1218
             F A+ IGF NTA
Sbjct  341   FTAKNIGFENTA  352



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   179 bits (453),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 177/310 (57%), Gaps = 19/310 (6%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +++KA+C  TD++  C  +L   G +       P+EL++    AA K +  A  KS ++K
Sbjct  59    KAIKAICQPTDYKQECIASLKATGNNSSD----PQELVQAGFKAAMKLIQAAANKSVDLK  114

Query  505   Q--DTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
             Q    P    A   C EL+  A D+L  ++  +    I        D+  WLSA +TYQ+
Sbjct  115   QLEKDPRTSKALAGCKELMDFAIDELKYSMNKLGEFDITKLDEMLIDIRIWLSATITYQE  174

Query  679   TCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKRRLL--  843
             TC+DGF +  G     M+K+LKT+ +L SN LA+VSQ +S+L+  + P  S  +RRLL  
Sbjct  175   TCLDGFQNTTGNAAEKMKKALKTSMKLSSNGLAMVSQFSSMLTELQIPGIS--RRRLLEI  232

Query  844   ----ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPA-KYKGRY  1008
                  D  P+W N   RR+L A   +  PN  VAKDGSG+F TI AAL  +P  K    Y
Sbjct  233   PVLGHDDYPDWANPGMRRLLAAG-SRVKPNVVVAKDGSGQFRTIQAALDQVPKRKNNATY  291

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             VI +KAG+Y E + + K + ++ + GDG +KTI+TG K+  DG  T++TAT AV  E FM
Sbjct  292   VIHIKAGVYQEYLQIKKTVTHLMLIGDGPKKTIITGNKNFVDGTPTFKTATVAVTAEHFM  351

Query  1189  AQFIGFRNTA  1218
             A+ IGF NTA
Sbjct  352   ARDIGFENTA  361



>ref|XP_008466374.1| PREDICTED: pectinesterase-like isoform X1 [Cucumis melo]
Length=567

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 183/317 (58%), Gaps = 25/317 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V  +C   +++  C+ TLS A  +  S    PKE +R ++++  +E    VKK   + 
Sbjct  44    KAVSTICANANYQQECQNTLSNAAHNASS--DDPKEYVRAAILSTIEE----VKKGYNLT  97

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGD--KIGNFSSH-----AADLDNWLSAV  663
                 ++ A  +     ++D +D L  AI  ++     +G    H      AD+ NWL++V
Sbjct  98    DGFMIEAANNRSIKMGVEDCRDLLQFAIDQLQASYSTVGEPDLHTNADRVADIKNWLTSV  157

Query  664   MTYQDTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAK  831
             ++YQ +C+DG    D + K  M+  L  A +L SNALAIV  ++ +L++F  +     + 
Sbjct  158   ISYQQSCLDGLEEFDPQLKQKMQDGLSDAGKLTSNALAIVDAVSDILASFGLQLKAQPSG  217

Query  832   RRLLA------DGVPEWMNDEQRRML--KADIPKQPPNATVAKDGSGKFSTINAALKAMP  987
             RRLL       DG P W+    R++L  +    K  PNA VAKDGSG+F TI+AAL A P
Sbjct  218   RRLLGTTEVGKDGYPTWLTGADRKLLASRGGGAKVKPNAVVAKDGSGQFKTISAALAAYP  277

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFA  1167
                +GRYVI+VKAGIY+E V +TK M N+ MYGDG +KTIVTG KS   G +T  TATF 
Sbjct  278   KALRGRYVIYVKAGIYNEYVHITKDMKNIFMYGDGPKKTIVTGNKSNRGGFTTQDTATFI  337

Query  1168  VVGEGFMAQFIGFRNTA  1218
              +GEGF+ + +GF+NTA
Sbjct  338   AIGEGFLCKSMGFQNTA  354



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/311 (40%), Positives = 184/311 (59%), Gaps = 30/311 (10%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V A+C  TD+++TCE +LS A   D      PKEL++++  AA   + +A+K S  +K
Sbjct  57    KAVHAICSPTDYKETCESSLSGANTTD------PKELIKVAFNAAVNNIGEAIKNSALLK  110

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIK--GDKIGNFSS-----HAADLDNWLSAV  663
                    AA     + L    D L++AI  +K  GDK+G+F +     +  DL  WLSAV
Sbjct  111   D-----AAADNSTKDALDICNDVLESAIDDLKRAGDKVGSFDASKVDEYVEDLKVWLSAV  165

Query  664   MTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE----SH  825
             +TYQ+TCID F +  G+    M+  LKTA+EL SN LA+VS ++S++   +       + 
Sbjct  166   ITYQETCIDAFENTTGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGAT  225

Query  826   AKRRLLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGR  1005
               RRL ++   +W+   +RR+L+     +P NA VA+DGSG+F TI  A+ ++P   +  
Sbjct  226   TSRRLFSN--DDWI---KRRVLRGKAYAKP-NAVVAQDGSGQFKTIKEAIDSVPKNNEKT  279

Query  1006  YVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGF  1185
             +VI++KAG+Y E V + KKM  +   GDG  KT +TG KS A G+ T+QTAT AV  E F
Sbjct  280   FVIYIKAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNSEEF  339

Query  1186  MAQFIGFRNTA  1218
              A+ IGF NTA
Sbjct  340   TAKNIGFENTA  350



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 184/317 (58%), Gaps = 28/317 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLS-TAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG--  495
             +++K LC  T ++ TCER+L+ +AG   D     PKEL++I+   A K++D A KKS   
Sbjct  61    KAIKTLCQPTYYKQTCERSLAKSAGNTTD-----PKELIKIAFKLAEKQIDSASKKSLTL  115

Query  496   -EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              E+++D P  + A   C EL+  + ++L +++  +            AD+  WLSA +TY
Sbjct  116   LELEKD-PRTRGALNSCKELMTMSINELRSSLEKVADFDFSQLDELMADIKTWLSAAITY  174

Query  673   QDTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKRRLL  843
             ++TC+D F +        M+K+LKTA E+ SN L IVS ++SVL+  + P  S   RRLL
Sbjct  175   EETCLDAFENTTTNAGEKMKKALKTAMEMSSNGLDIVSGISSVLTDLQIPGVS---RRLL  231

Query  844   ADGVP------------EWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMP  987
              D +P             W++   RR+L A      P+  VAKDGSG + TI  AL  +P
Sbjct  232   QDDIPVAGHGDISQAFPAWIDPGTRRLLSAPPSNIKPDLVVAKDGSGDYKTILEALPQIP  291

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFA  1167
              K    +V+++K GIY+E V   + M N+ + GDG  KT +TG K+  DG++TY+TAT A
Sbjct  292   KKSNETFVLYIKEGIYEEYVEFNRSMTNLVVIGDGPDKTRITGSKNFVDGINTYRTATVA  351

Query  1168  VVGEGFMAQFIGFRNTA  1218
             V+G+ F+A+ IGF N+A
Sbjct  352   VIGDNFVARNIGFENSA  368



>ref|XP_008466403.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=567

 Score =   178 bits (451),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 122/315 (39%), Positives = 181/315 (57%), Gaps = 21/315 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +++ A+C  TD+++ C+ TL+   ++  S    PK+  + +++A  KE+ K    S  + 
Sbjct  44    KAISAICSTTDYQEECKNTLNHVAQNTSS--NDPKDYAKAAILATIKEITKGYNLSDSLI  101

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHA-----ADLDNWLSAVMT  669
              +     +      +     +  +D   AS     +G    H      AD+ NWLSAV++
Sbjct  102   VEAGNNASIKMSVEDCNDLLQFAIDELQASY--STVGESDLHTDADRIADIKNWLSAVVS  159

Query  670   YQDTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAKRR  837
             YQ +C+DG    D + K  M+  L  A +L SNALAI++ ++++L  +  +     + RR
Sbjct  160   YQQSCLDGLGEFDPQLKQRMQDGLDVAGKLTSNALAILTAVSNILDNYGLQLKVQPSGRR  219

Query  838   LL------ADGVPEWMNDEQRRML--KADIPKQPPNATVAKDGSGKFSTINAALKAMPAK  993
             LL      +DG P W+    R++L  K    +  PNA VAKDGSG++ TI AAL A P  
Sbjct  220   LLGTTEVDSDGFPTWLTGADRKLLASKQGGVRPTPNAVVAKDGSGQYKTIAAALAAYPKA  279

Query  994   YKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVV  1173
              +GRYVI+VKAGIYDE + VTK M NV MYGDG +KTIVTG+KS  DG +T  TA+FA +
Sbjct  280   LRGRYVIYVKAGIYDEYITVTKDMKNVFMYGDGPRKTIVTGRKSNRDGFTTQNTASFAAI  339

Query  1174  GEGFMAQFIGFRNTA  1218
             GEGF+ + +GF NTA
Sbjct  340   GEGFLCKSMGFTNTA  354



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   179 bits (453),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 189/311 (61%), Gaps = 25/311 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             ++VK +C  TD++ TCE TL   G +       P EL++ +  A  K++  A KKS    
Sbjct  56    KAVKDVCAPTDYKKTCEDTLIKNGNNT----SDPIELVKTAFKATMKQITDAAKKSQTMM  111

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD--LDN---WLSA  660
             E+++D P  + A   C EL+  A  +L  +      +++G F  H  D  L N   WLSA
Sbjct  112   ELQKD-PRTRMALDQCKELMDYALGELSNSF-----EELGKFEFHKLDEALINMRIWLSA  165

Query  661   VMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAK  831
              +++++TC++GF D  G     M+K+LKTA EL  N LAI+S+L++ +   + PS +   
Sbjct  166   AISHEETCLEGFQDTKGNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLN--S  223

Query  832   RRLLADGVPEWMNDEQRRMLK--ADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGR  1005
             RRLLA G+P W++   R++L+  A      P+  VA+DGSG+++TIN ALK +P K    
Sbjct  224   RRLLAQGIPSWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTT  283

Query  1006  YVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGF  1185
             +V+ +KAGIY E V V K M ++   GDG+ KTI++G KS  DG++TY+TAT A+VG+ F
Sbjct  284   FVVHIKAGIYKEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDYF  343

Query  1186  MAQFIGFRNTA  1218
             +A+ IGF NTA
Sbjct  344   IAKNIGFENTA  354



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   179 bits (453),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 189/311 (61%), Gaps = 25/311 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             ++VK +C  TD++ TCE TL   G +       P EL++ +  A  K++  A KKS    
Sbjct  56    KAVKDVCAPTDYKKTCEDTLIKNGNNT----SDPIELVKTAFKATMKQITDAAKKSQTMM  111

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD--LDN---WLSA  660
             E+++D P  + A   C EL+  A  +L  +      +++G F  H  D  L N   WLSA
Sbjct  112   ELQKD-PRTRMALDQCKELMDYALGELSNSF-----EELGKFEFHKLDEALINMRIWLSA  165

Query  661   VMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAK  831
              +++++TC++GF D  G     M+K+LKTA EL  N LAI+S+L++ +   + PS +   
Sbjct  166   AISHEETCLEGFQDTKGNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLN--S  223

Query  832   RRLLADGVPEWMNDEQRRMLK--ADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGR  1005
             RRLLA G+P W++   R++L+  A      P+  VA+DGSG+++TIN ALK +P K    
Sbjct  224   RRLLAQGIPSWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNTT  283

Query  1006  YVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGF  1185
             +V+ +KAGIY E V V K M ++   GDG+ KTI++G KS  DG++TY+TAT A+VG+ F
Sbjct  284   FVVHIKAGIYKEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDYF  343

Query  1186  MAQFIGFRNTA  1218
             +A+ IGF NTA
Sbjct  344   IAKNIGFENTA  354



>ref|NP_001050306.1| Os03g0399000 [Oryza sativa Japonica Group]
 gb|AAP12941.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 gb|ABF96446.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12220.1| Os03g0399000 [Oryza sativa Japonica Group]
 gb|EAZ27228.1| hypothetical protein OsJ_11166 [Oryza sativa Japonica Group]
Length=603

 Score =   178 bits (451),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 142/218 (65%), Gaps = 24/218 (11%)
 Frame = +1

Query  637   DLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE--  810
             DL  WLSAV+T+Q +C+D FP G  K  + ++++ A+E+ SNA+AI+ Q A+  +  +  
Sbjct  160   DLQAWLSAVITFQGSCVDMFPQGPIKDQVREAMEKAREISSNAIAIIQQGAAFAAMLDLH  219

Query  811   PSESHAKR---------------RLLADG----VPEWMNDEQRRMLKAD---IPKQPPNA  924
              SESHA                 R L D     VP W++DE RRML +    +    PN 
Sbjct  220   ASESHAAEGEELDVDHDIQHHVDRHLEDQSLPPVPPWLSDEDRRMLTSGEEFVAGLTPNV  279

Query  925   TVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKT  1104
             TVAKDGSG F+ I+AAL A+P  Y G+Y+I+VK G+YDE+V VT +M N+TMYGDGS+K+
Sbjct  280   TVAKDGSGDFTNISAALDALPEAYAGKYIIYVKEGVYDETVNVTSRMANITMYGDGSKKS  339

Query  1105  IVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             IVTG K++ADG+  ++TATFAV G+ F A  +G RNTA
Sbjct  340   IVTGSKNIADGVRMWKTATFAVDGDRFTAMRLGIRNTA  377



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 126/310 (41%), Positives = 180/310 (58%), Gaps = 21/310 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG--  495
             +S+K+ C   D+++TCER L +TAG         P +L ++        ++KA ++S   
Sbjct  42    KSIKSFCQPVDYKETCERALEATAGN-----ATSPTDLAKVIFKVTSDRIEKAARESAVL  96

Query  496   -EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              ++K D P    A ++C ELL  A DDL T    + G ++ NF +   DL  WLS+ +TY
Sbjct  97    NDLKND-PRTSGALRNCKELLDYAIDDLKTTFDRLGGFEMTNFKAAVDDLKTWLSSALTY  155

Query  673   QDTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA  846
             Q+TC+DGF +     A  M ++L T++EL  N LA+V + +  L++      H  RRLLA
Sbjct  156   QETCLDGFENTTTDAAAKMRRALNTSQELTENILALVDEFSETLASLGLPSFH--RRLLA  213

Query  847   D--GVPEWMNDE-QRRMLKADIPKQP---PNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
                G P WM D+ +RR+LKA  P  P   P+ TVA DGSG F TINAAL  +P K    Y
Sbjct  214   GNGGAPSWMTDDAKRRVLKA-TPGSPDFKPDVTVAADGSGDFKTINAALAKVPTKSATAY  272

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             V++VKAG Y E V V + + N+ + GDG+ KT+VTG KS A  ++T  TAT  V+G GF 
Sbjct  273   VMYVKAGTYKEYVSVPRNVTNLVVVGDGATKTVVTGSKSFAMNITTKDTATMEVIGNGFQ  332

Query  1189  AQFIGFRNTA  1218
              + +G  NTA
Sbjct  333   MRGVGVENTA  342



>ref|XP_007219746.1| hypothetical protein PRUPE_ppa024156mg [Prunus persica]
 gb|EMJ20945.1| hypothetical protein PRUPE_ppa024156mg [Prunus persica]
Length=574

 Score =   177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 124/318 (39%), Positives = 181/318 (57%), Gaps = 26/318 (8%)
 Frame = +1

Query  310   GKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKK  489
             G S+  SVKA+C  T ++D+C  +L   G   +S   KP++L ++++  A  E+ KA  +
Sbjct  61    GSSLSTSVKAVCDVTLYQDSCYSSL---GALVNSTNAKPEDLFKLAIRVAINELSKAASR  117

Query  490   -SGE-VKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAV  663
              SG+ +   T     +        +     LD    S+  DK  +      DL  WLS+ 
Sbjct  118   FSGDGILNGTSHDTLSKAALENCQELLSLALDHLNDSLSDDK--SLFDVFDDLKTWLSSS  175

Query  664   MTYQDTCIDGFPDG--EEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRR  837
              TYQ TCIDGF D   E K  +   LK + EL SN+LAIVS ++ V+S+ +       RR
Sbjct  176   GTYQQTCIDGFDDAKAELKDKIVSYLKNSTELTSNSLAIVSWISKVVSSVKL------RR  229

Query  838   LL-----------ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAM  984
             LL           ++GVPEW++   R++L++   ++  +  VA DGSGK+ TI+AALKA+
Sbjct  230   LLTHPATTATASYSEGVPEWLHPRDRKLLESSDLRKKADIVVASDGSGKYKTIHAALKAV  289

Query  985   PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF  1164
             P K K R VI+VK G+Y E+  V K   NV + GDGS  TIV+  +++ DG  T+ +ATF
Sbjct  290   PDKSKKRTVIYVKKGVYFENARVEKTKWNVLVVGDGSTATIVSAGRNVIDGTPTFSSATF  349

Query  1165  AVVGEGFMAQFIGFRNTA  1218
             AV G+GF+A+ IGFRNTA
Sbjct  350   AVFGKGFIARDIGFRNTA  367



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   177 bits (449),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 185/312 (59%), Gaps = 18/312 (6%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLST-AGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             +  ++++A+C  TD+ + C+ +L+  AG   D     PK+L+ +S  +A   + +A   S
Sbjct  60    TTSKAIRAICRPTDYAEECQSSLAARAGNVTD-----PKKLVELSFTSAMDSLREAFNHS  114

Query  493   GEVKQDT--PlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVM  666
               +++    P    A ++C ELL  A DDL  ++A   G  +   S    DL  WLSA +
Sbjct  115   SVLQEAAKDPRTSEALENCKELLDYAIDDLKNSVARFGGVDMAKMSDVVDDLKVWLSATI  174

Query  667   TYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRL  840
             TYQ TC+DGF +  G+    M K+L ++  L SNALAI+  ++SVL++F+ S     RRL
Sbjct  175   TYQQTCLDGFDNTTGDAADNMSKALNSSSALTSNALAIIDGISSVLASFQLSS--LGRRL  232

Query  841   LADG------VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKG  1002
             L+D        P W+ +++R++L        P+ TVA+DGSGK+ TI  AL A+P K   
Sbjct  233   LSDDEGERGEFPSWVGNDKRKLLALSTKDIKPDVTVAQDGSGKYKTITQALSAVPKKGNA  292

Query  1003  RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEG  1182
              +VI++K G+Y E+V+V + M NV M+GDG  KT +TG  +  DG ST++TAT AVVG+G
Sbjct  293   TFVIYIKEGVYKENVMVDRSMTNVMMFGDGPTKTKITGSLNYVDGTSTFKTATLAVVGDG  352

Query  1183  FMAQFIGFRNTA  1218
             F+ + +G  NTA
Sbjct  353   FIGKNLGVENTA  364



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   177 bits (449),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 126/310 (41%), Positives = 176/310 (57%), Gaps = 19/310 (6%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +++KA+C  TD++  C  +L   G +       PKEL++    AA K +  A  KS  + 
Sbjct  59    KAIKAICQPTDYKQECVASLKATGNNSSD----PKELVQAGFKAAMKLIQAAANKSVALN  114

Query  505   Q--DTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
             Q    P    A   C EL+  A D+L  ++  +    I        D+  WLSA +TYQ+
Sbjct  115   QLEKDPRASKALAGCKELMDFAIDELKYSMNKLGEFDISKLDEMLIDIRIWLSATITYQE  174

Query  679   TCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKRRLL--  843
             TC+DGF +  G     M+K+LKT+ +L SN LA+VSQ++S+LS  + P  S  +RRLL  
Sbjct  175   TCLDGFANTTGNAAEKMKKALKTSMKLSSNGLAMVSQISSMLSELQIPGIS--RRRLLEI  232

Query  844   ----ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPA-KYKGRY  1008
                  D  P+W N   RR+L A   K  PN  VAKDGSG+F TI  A+  +P  K    Y
Sbjct  233   PVLGHDDYPDWANPGMRRLLAAG-SKVKPNVVVAKDGSGQFKTIQEAIDQVPKRKNNATY  291

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             VI +KAG+Y E V+V K + ++ + GDG +KTI+TG K+  DG  T++TAT AV  E FM
Sbjct  292   VIHIKAGVYQEYVLVKKTLTHLMLIGDGPKKTIITGNKNFIDGTPTFKTATVAVTAEHFM  351

Query  1189  AQFIGFRNTA  1218
             A+ IGF NTA
Sbjct  352   ARDIGFENTA  361



>ref|XP_008656646.1| PREDICTED: pectinesterase-like [Zea mays]
 tpg|DAA45709.1| TPA: hypothetical protein ZEAMMB73_512323 [Zea mays]
Length=590

 Score =   177 bits (449),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 124/336 (37%), Positives = 193/336 (57%), Gaps = 24/336 (7%)
 Frame = +1

Query  268   KRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRIS  447
             +++G  S+ +  +  K++  SV+  C   D++ TC  TL  A    D   + P      +
Sbjct  37    EKAGYNSELSKRNMSKTM-RSVELFCAPADYQGTCHETLEAALSRTDP-DEHPHAAAAAA  94

Query  448   MVAAGKEMDKAVKKSG---EVKQDTPlkkaaakdcaellkd-akddldTAIASIKGDKIG  615
             + A  + + +   +S     V+Q        A     +L +  + +++ A++SI    + 
Sbjct  95    ITAVERALAEGFNRSSVLDAVRQSNDTLVWEAIHDCRMLLEDCRGNVERALSSIAWRGV-  153

Query  616   NFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASV  795
                  A DL  WLSAV+T+Q +C+D FP GE +  +  +++ A+E+ SNALAI+ Q A++
Sbjct  154   --DGPAQDLQAWLSAVITFQGSCVDMFPKGEVRDEVNNTMEKAREVSSNALAIIKQGAAL  211

Query  796   LSTFEPSESHAK--RRL---------LADGVPEWMNDEQRRMLKADIPKQ----PPNATV  930
              S  +   S  K  R+L          +  VP W+  E+R++L A   ++     PN TV
Sbjct  212   ASMLDLHTSLDKGGRQLEEKEKSASSSSSSVPTWVPSEERKLLGAKGERRRAALTPNVTV  271

Query  931   AKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIV  1110
             AKDGSG F+ I+AAL AMP KY GRY I+VK G+Y+E+V +T +M NVTMYGDGS+++IV
Sbjct  272   AKDGSGDFTNISAALDAMPEKYSGRYFIYVKEGVYEETVNITGRMANVTMYGDGSKRSIV  331

Query  1111  TGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TG K++ DG+  ++TATFAV G+ FMA  +G RNTA
Sbjct  332   TGSKNIVDGIRMWRTATFAVDGDSFMAMKLGIRNTA  367



>ref|XP_011007987.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=556

 Score =   177 bits (448),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 128/313 (41%), Positives = 177/313 (57%), Gaps = 27/313 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ALC  T +++ C  TLS     D      PKEL++  ++A    +  ++K S  V 
Sbjct  43    KAVSALCQPTYYKEACTNTLSALNSTD------PKELIKGGILA----ISASLKNSFNVT  92

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKG--DKIG-----NFSSHAADLDNWLSAV  663
              D   K   A      L D K+ L  A  S++    K+G     + S+   D   WLS++
Sbjct  93    DDLVAKTDNASRDKMALIDCKELLQNASESVEDTLSKVGEIDLLSLSNRTDDFRTWLSSI  152

Query  664   MTYQDTCIDGFPDGEE-KTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-----PSESH  825
             + YQ+ C+DGF +G   +  ++KS     EL  N L I++ L+ VL++       PS S 
Sbjct  153   IGYQEMCLDGFENGNSLRDQVQKSTDYGSELTDNVLNILAGLSQVLNSLGLKLNVPSTS-  211

Query  826   AKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKG  1002
              ++ L A+G P WM+   R++L +       PNA VA+DGSG+F TINAAL A P   KG
Sbjct  212   -RQLLQANGFPTWMSASDRKLLASRGNGGVRPNAVVAQDGSGQFKTINAALAAYPKNLKG  270

Query  1003  RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA-DGLSTYQTATFAVVGE  1179
             RYVI+VKAG Y E V V K   NV +YGDGS+KTIVTG K+ A DGL T++TATF V   
Sbjct  271   RYVIYVKAGTYREYVAVAKDQPNVFIYGDGSRKTIVTGNKNFAKDGLGTWKTATFIVEAN  330

Query  1180  GFMAQFIGFRNTA  1218
             GF+A+ IGF NTA
Sbjct  331   GFIAKSIGFTNTA  343



>ref|XP_002304074.1| hypothetical protein POPTR_0003s01550g [Populus trichocarpa]
 ref|XP_006388629.1| hypothetical protein POPTR_0133s00210g [Populus trichocarpa]
 gb|EEE79053.1| hypothetical protein POPTR_0003s01550g [Populus trichocarpa]
 gb|ERP47543.1| hypothetical protein POPTR_0133s00210g [Populus trichocarpa]
Length=556

 Score =   176 bits (447),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 177/313 (57%), Gaps = 27/313 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V ALC  T +++ C  TLS     D      PKEL++  ++A    +  ++K S  V 
Sbjct  43    KAVSALCQPTYYKEACTNTLSALNSTD------PKELIKGGILA----ISASLKNSFNVT  92

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKG--DKIG-----NFSSHAADLDNWLSAV  663
              D   K   A      L D K+ L  A  S++    K+G     + S+   D   WLS++
Sbjct  93    DDLVAKTDNASRDKMALNDCKELLQNASESLEDTLSKVGEIDLLSLSNRTDDFRTWLSSI  152

Query  664   MTYQDTCIDGFPDGEE-KTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-----PSESH  825
             + YQ+ C+DGF +G   +  ++KS     EL  N L I++ L+ VL++       PS S 
Sbjct  153   IGYQEMCLDGFENGSSLRDQVQKSTDYGSELTDNVLNILAGLSQVLNSLGLKLNIPSTS-  211

Query  826   AKRRLLADGVPEWMNDEQRRMLKA-DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKG  1002
              ++ L ADG P WM+   R++L +       PNA VA+DGSG+F TI+AAL A P   KG
Sbjct  212   -RQLLQADGFPTWMSASDRKLLASRGNGGVRPNAVVAQDGSGQFKTISAALAAYPKNLKG  270

Query  1003  RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA-DGLSTYQTATFAVVGE  1179
             RYVI+VKAG Y E V V K   NV +YGDGS+KTIVTG KS A DGL T++TATF V   
Sbjct  271   RYVIYVKAGTYREYVAVAKDQPNVFIYGDGSRKTIVTGNKSFAKDGLGTWKTATFIVEAN  330

Query  1180  GFMAQFIGFRNTA  1218
             GF+A+ IGF NTA
Sbjct  331   GFIAKSIGFTNTA  343



>tpg|DAA45708.1| TPA: hypothetical protein ZEAMMB73_512323 [Zea mays]
Length=648

 Score =   177 bits (450),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 124/336 (37%), Positives = 193/336 (57%), Gaps = 24/336 (7%)
 Frame = +1

Query  268   KRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRIS  447
             +++G  S+ +  +  K++  SV+  C   D++ TC  TL  A    D   + P      +
Sbjct  37    EKAGYNSELSKRNMSKTM-RSVELFCAPADYQGTCHETLEAALSRTDP-DEHPHAAAAAA  94

Query  448   MVAAGKEMDKAVKKSG---EVKQDTPlkkaaakdcaellkd-akddldTAIASIKGDKIG  615
             + A  + + +   +S     V+Q        A     +L +  + +++ A++SI    + 
Sbjct  95    ITAVERALAEGFNRSSVLDAVRQSNDTLVWEAIHDCRMLLEDCRGNVERALSSIAWRGV-  153

Query  616   NFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASV  795
                  A DL  WLSAV+T+Q +C+D FP GE +  +  +++ A+E+ SNALAI+ Q A++
Sbjct  154   --DGPAQDLQAWLSAVITFQGSCVDMFPKGEVRDEVNNTMEKAREVSSNALAIIKQGAAL  211

Query  796   LSTFEPSESHAK--RRL---------LADGVPEWMNDEQRRMLKADIPKQ----PPNATV  930
              S  +   S  K  R+L          +  VP W+  E+R++L A   ++     PN TV
Sbjct  212   ASMLDLHTSLDKGGRQLEEKEKSASSSSSSVPTWVPSEERKLLGAKGERRRAALTPNVTV  271

Query  931   AKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIV  1110
             AKDGSG F+ I+AAL AMP KY GRY I+VK G+Y+E+V +T +M NVTMYGDGS+++IV
Sbjct  272   AKDGSGDFTNISAALDAMPEKYSGRYFIYVKEGVYEETVNITGRMANVTMYGDGSKRSIV  331

Query  1111  TGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TG K++ DG+  ++TATFAV G+ FMA  +G RNTA
Sbjct  332   TGSKNIVDGIRMWRTATFAVDGDSFMAMKLGIRNTA  367



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score =   177 bits (448),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 125/308 (41%), Positives = 175/308 (57%), Gaps = 17/308 (6%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +S+K+ C   D+ +TCE+ L  A  +  S    P +L +         ++KAV++S    
Sbjct  44    KSIKSFCQPVDYRETCEKALRAAAGNATS----PTDLAKAIFKVTSDRIEKAVRESAVLN  99

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             E+K D P  K A  +C ELL  A DDL T    + G ++ NF S   DL  WLS+ +TYQ
Sbjct  100   ELKND-PRTKGALDNCRELLDYAIDDLKTTFDRLGGFEMTNFKSAVDDLRTWLSSALTYQ  158

Query  676   DTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLAD  849
             +TC+DGF +     A  M ++L +++EL  N LA+V + +  L+       H  RRLLAD
Sbjct  159   ETCLDGFENTTTAAAGKMRRALNSSQELTENILALVDEFSETLANLGIPSFH--RRLLAD  216

Query  850   ---GVPEWMNDEQRRMLKADIPKQ--PPNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
                GVP WM D +RR+ K     +   P+ TVAKDGSG F TINAAL  +P K    YV+
Sbjct  217   HAGGVPSWMPDAKRRLRKVSPGDKGFKPDVTVAKDGSGDFRTINAALAKVPVKSAATYVM  276

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQ  1194
             +VKAG Y E V V + + N+ M GDG+ KT++TG KS    ++T  TAT   +G GF+ +
Sbjct  277   YVKAGTYREYVSVPRNVTNLVMVGDGATKTVITGDKSFMMNITTKDTATMEALGNGFLMR  336

Query  1195  FIGFRNTA  1218
              IG  NTA
Sbjct  337   GIGVENTA  344



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   176 bits (447),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 123/308 (40%), Positives = 179/308 (58%), Gaps = 25/308 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +SVKA+C  TD+++TCE++L++A    D     PKEL++++  +   ++  A+K +  +K
Sbjct  52    KSVKAICQPTDYKETCEKSLASAKNTSD-----PKELIKVAFESTITDIKNAIKNTDLIK  106

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNF-----SSHAADLDNWLSAV  663
                    A      E L   +  LD +I  ++   DK+G F       +  DL  W+SA 
Sbjct  107   D-----AAKDPRTKEALHTCEGLLDVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISAS  161

Query  664   MTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKR  834
             +TYQ+TC+D F +  G+    M+K LKTA EL SN LA+++    +L++   P  S   R
Sbjct  162   ITYQETCLDAFQNTSGDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTSMNIPGIS---R  218

Query  835   RLLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
             RLLA+    ++ D  RR+L+    K  PNA VA DGSG+F TI  ALK +P K    YVI
Sbjct  219   RLLANDYTSFVEDGSRRLLQVSSTK--PNAVVALDGSGQFKTIKEALKGVPPKNIQPYVI  276

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQ  1194
              +KAG Y E V V + + NV   G+G  KT +TG K+ ADG +T+ TAT AV G+GF+A+
Sbjct  277   LIKAGEYKEIVDVPRGVTNVVFIGEGPTKTKITGNKNYADGTATFHTATVAVNGDGFVAR  336

Query  1195  FIGFRNTA  1218
              IGF NTA
Sbjct  337   DIGFENTA  344



>ref|XP_002528621.1| Pectinesterase-4 precursor, putative [Ricinus communis]
 gb|EEF33779.1| Pectinesterase-4 precursor, putative [Ricinus communis]
Length=568

 Score =   176 bits (447),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 183/313 (58%), Gaps = 20/313 (6%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +SV  +C  TD+++ CE++L++  +  D     PKE ++ +++A  +   K+   S  + 
Sbjct  47    KSVAQICQPTDYKEACEKSLNSVKDTKD-----PKEYVKAAILATVEAATKSFNLSSNLI  101

Query  505   QDTPlkkaaakdcae----llkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              D        +   E    LL+DA  +L  + +++    +       A+L NWLSAV++Y
Sbjct  102   VDAKNADNDTRMSLEDCKDLLQDAVQELQASFSTVGESTVNTMDQRIAELQNWLSAVVSY  161

Query  673   QDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-----PSES-HA  828
             QDTC++ F  P+   K+ M+  +  A +L SNALAI++ L+ +LSTF+      SES   
Sbjct  162   QDTCLEQFGDPNSNYKSQMQDGMVDATQLTSNALAIINALSQMLSTFDLKFDLTSESGDN  221

Query  829   KRRLLA---DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYK  999
              R+LL+    GVP W +  +RR++ AD     PN TVA+DGSG   T+  A+  +P K +
Sbjct  222   SRKLLSVDETGVPIWFDGAKRRLMAADTSAIKPNITVAQDGSGDVKTVTEAIAKIPLKSE  281

Query  1000  GRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGE  1179
               ++I+VKAG Y E  +V KKM+NV MYGDG +KTI+TG  S   G  T ++ATFA +G 
Sbjct  282   NPFIIYVKAGTYKEYPIVEKKMLNVFMYGDGPKKTIITGSHSNHTGWKTMRSATFAALGP  341

Query  1180  GFMAQFIGFRNTA  1218
             GFMA+ +GF NTA
Sbjct  342   GFMAKSMGFENTA  354



>ref|XP_008231878.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Prunus mume]
Length=574

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/318 (39%), Positives = 182/318 (57%), Gaps = 26/318 (8%)
 Frame = +1

Query  310   GKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKK  489
             G S+  SVKA+C  T ++D+C  +L   G   +S   KP++L ++++  A  E+ KA  +
Sbjct  61    GSSLSTSVKAVCDVTLYQDSCYSSL---GALVNSTNAKPEDLFKLAIRVAINELSKAASR  117

Query  490   -SGE-VKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAV  663
              SG+ +   T     +        +  +  LD    S+  DK  +      DL  WLS+ 
Sbjct  118   FSGDRILNGTSNDTLSKAALENCQELLRLALDHLNDSLSDDK--SLFDVFDDLKTWLSSS  175

Query  664   MTYQDTCIDGFPDG--EEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRR  837
              TYQ TCIDGF D   E K  +   LK + EL SN+LAIVS ++ V+S+ +       RR
Sbjct  176   GTYQQTCIDGFDDAKAELKDKIASYLKNSTELTSNSLAIVSWISKVVSSVKL------RR  229

Query  838   LL-----------ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAM  984
             LL           ++GVPEW++   R++L++   ++  +  VA DGSGK+ TI+AALK +
Sbjct  230   LLTHPATTATANYSEGVPEWLHPRDRKLLESSDLRKKADIVVASDGSGKYKTIHAALKVV  289

Query  985   PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF  1164
             P K K R VI+VK G+Y E+V V K   NV + GDGS  TIV+  +++ DG  T+ +ATF
Sbjct  290   PDKSKKRTVIYVKKGVYFENVRVEKTKWNVLVVGDGSTATIVSAGRNVIDGTPTFSSATF  349

Query  1165  AVVGEGFMAQFIGFRNTA  1218
             AV G+GF+A+ IGFRNTA
Sbjct  350   AVFGKGFIARDIGFRNTA  367



>ref|XP_010091418.1| putative pectinesterase/pectinesterase inhibitor 21 [Morus notabilis]
 gb|EXB44455.1| putative pectinesterase/pectinesterase inhibitor 21 [Morus notabilis]
Length=570

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 115/312 (37%), Positives = 182/312 (58%), Gaps = 20/312 (6%)
 Frame = +1

Query  331   VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG----E  498
             V+++C  TD++  CE+TLS    +        K++++ ++ A   ++ K++  S     E
Sbjct  50    VESVCSNTDYKTACEQTLSPLSHN---VTADYKDIIKAAVQATVDQVSKSLNLSESLLVE  106

Query  499   VKQDTPlkkaaakdcaellkdakddldTAIASIKGDK-IGNFSSHAADLDNWLSAVMTYQ  675
                +   +   A +    L         A  S+ GD  +      +A+L +WLS+V++Y 
Sbjct  107   ANNNNSTRLKMALEDCNDLLSLAIGQLQASFSMVGDSDMHTIKDRSAELRSWLSSVISYA  166

Query  676   DTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF----EPSESHAKRRLL  843
             +TCIDG  + + +  ++ +L+ A  L  NALAIVS ++ +LS F     P   +  RRLL
Sbjct  167   ETCIDGVEEPKFQGQLKGTLQNATALTDNALAIVSTISEILSAFGLKLNPKALNG-RRLL  225

Query  844   AD------GVPEWMNDEQRRMLKAD-IPKQPPNATVAKDGSGKFSTINAALKAMPAKYKG  1002
             +D      G+P W +   R+++      +  P+A VAKDGSG+F TI AAL A P  + G
Sbjct  226   SDTVIGNDGLPTWFSASDRKLMALHGNGRIKPHAVVAKDGSGQFKTIAAALAAYPKNHVG  285

Query  1003  RYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEG  1182
             RY+I+VKAG+Y+E + V K MVN+ MYGDG +KTIVTG+KS   G ST++TA+F+V+G G
Sbjct  286   RYIIYVKAGVYNEYITVEKNMVNIFMYGDGPRKTIVTGRKSYTGGFSTFRTASFSVIGAG  345

Query  1183  FMAQFIGFRNTA  1218
             F+ + +GF+NTA
Sbjct  346   FVCKGMGFQNTA  357



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 184/308 (60%), Gaps = 16/308 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +++KA+C  TD++D CE+TLS+   +       P EL+ ++  A+ K +  A  KS E+ 
Sbjct  50    KAIKAVCEPTDYKDACEKTLSSMSHNTSD----PMELVNVAFNASMKYVTDAFDKS-ELL  104

Query  505   QDT---PlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             +D    P    A + C+ELL+ A DDL  +I  +   +   +     DL  WLSA +TYQ
Sbjct  105   KDVSKDPASAEALRTCSELLEYATDDLKKSIEQLGSVQTNRYEQAVEDLKVWLSAAITYQ  164

Query  676   DTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLL--  843
             DTC+DGF   +     AM +++K + ++ SNALA+++Q  +++ +F  S SHA R+LL  
Sbjct  165   DTCVDGFEGINTSAAEAMHQAIKNSTQITSNALAMINQFDNLVGSFNIS-SHAGRKLLSG  223

Query  844   --ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIF  1017
               A+  P WM+  Q R L+    +  PN TVA+DG+G F TI+ ALK +P +    +VI+
Sbjct  224   TRANEFPWWMSAAQERFLQPAPAQIKPNVTVAQDGTGDFKTISEALKHVPKQNNDTFVIY  283

Query  1018  VKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADG-LSTYQTATFAVVGEGFMAQ  1194
             VKAG+Y E V+V K M +VTM GDG  KT +TG   +  G +ST++TAT AV GE F   
Sbjct  284   VKAGVYKEGVLVDKHMTHVTMIGDGPTKTKITGDVHVIQGKISTFKTATVAVAGEWFTGM  343

Query  1195  FIGFRNTA  1218
              +GF NTA
Sbjct  344   GLGFENTA  351



>emb|CDP17031.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 194/337 (58%), Gaps = 27/337 (8%)
 Frame = +1

Query  271   RSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISM  450
             + G  SK   + +G S+ +SV   C  T+F+D C +++ +     ++A   PK+ L  ++
Sbjct  28    KHGEDSKNNNV-AGSSM-KSVTTFCESTNFKDACAKSVESVA---NNATASPKDYLMAAL  82

Query  451   VAAGKEMDKAVKKSGEV------KQDTPlkkaaakdcaellkdakddldTAIASIKGDKI  612
              A  +E+ KA++ +         KQD P    AA+DC ELL  A D+L  AI+++   ++
Sbjct  83    NATIQEVQKALQVANATGSKVDPKQD-PYNHVAAQDCQELLGYAVDELQAAISTVGDSEL  141

Query  613   GNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLAS  792
                +    +L NWLSAV +YQ  C+D F   E ++A E  +  A +L  NA++IV+ L+ 
Sbjct  142   HTLNDRVDELLNWLSAVYSYQSDCLDEFDKPELRSAFENGMLNATQLTDNAVSIVASLSD  201

Query  793   VLSTFEPSESH-----AKRRLLADG--------VPEWMNDEQRRMLKADI-PKQPPNATV  930
             +L  F  S  +       RRLL D          P+W     RR+L A       PNA V
Sbjct  202   LLKGFNISLGNILPPAGGRRLLQDNDVMGHEESFPQWFPAGDRRLLAAHRRAGVLPNAVV  261

Query  931   AKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIV  1110
             AKDGSG+F TI+ AL A PA  +GRYVI+VKAGIY+E+V+V KK  NV +YGDG+ +TIV
Sbjct  262   AKDGSGQFKTISQALAAYPANLRGRYVIYVKAGIYEENVIVDKKQANVFIYGDGANRTIV  321

Query  1111  TGKKSLAD-GLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TG K+     + T  TATF+V+G+ FMA+ + FRNTA
Sbjct  322   TGSKNFGIMHIQTSNTATFSVLGDRFMARGMTFRNTA  358



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 178/326 (55%), Gaps = 39/326 (12%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V+A+C  TD+++TCE +L+ A   D      PKEL+R++  AA   +  A+K S   K
Sbjct  56    KAVQAICSPTDYKETCESSLAGANTTD------PKELIRLAFNAAVNNIGDAIKNSTLFK  109

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIK--GDKIGNFSS-----HAADLDNWLSAV  663
                    AA     +      D L +AI  +K  GDK+G F +     +  DL  WLSAV
Sbjct  110   D-----AAADSSTKDAFDICDDVLGSAIDDLKRAGDKVGEFDATKVDEYVEDLKVWLSAV  164

Query  664   MTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE--SHAK  831
             +TYQ+TCID F +  G+    M+  LKTA+EL SN LA+VS ++S++   +         
Sbjct  165   ITYQETCIDAFENTTGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTS  224

Query  832   RRLL---------------ADGV-PEWMND-EQRRMLKADIPKQPPNATVAKDGSGKFST  960
             RRLL               A G  P W+     RR+L A      PNA VA DGSG+F T
Sbjct  225   RRLLSKEERVLYGGDPTDYAPGEDPYWIKSPHSRRLLSAAAAPLKPNAVVALDGSGQFKT  284

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             I  A+  +P K    +VIF+KAG+Y E V + KK+  V M G+G  KT +TG KS A G+
Sbjct  285   IKDAINTIPKKNTQPFVIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGV  344

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
              T+ TAT AV GE FMA+ IGF NTA
Sbjct  345   KTFHTATVAVNGEDFMAKDIGFENTA  370



>gb|EAY90351.1| hypothetical protein OsI_11933 [Oryza sativa Indica Group]
Length=603

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 141/218 (65%), Gaps = 24/218 (11%)
 Frame = +1

Query  637   DLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE--  810
             DL  WLSAV+T+Q +C+D FP G  K  + ++++ A+E+ SNA+AI+ Q A+  +  +  
Sbjct  160   DLQAWLSAVITFQGSCVDMFPQGPIKDQVREAMEKAREISSNAIAIIQQGAAFAAMLDLH  219

Query  811   PSESHAKR---------------RLLADG----VPEWMNDEQRRMLKAD---IPKQPPNA  924
              SESHA                 R L D      P W++DE RRML +    +    PN 
Sbjct  220   ASESHAAEGEELDVDHDIQHHVDRHLEDQSLPPAPPWLSDEDRRMLTSGEEFVAGLTPNV  279

Query  925   TVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKT  1104
             TVAKDGSG F+ I+AAL A+P  Y G+Y+I+VK G+YDE+V VT +M N+TMYGDGS+K+
Sbjct  280   TVAKDGSGDFTNISAALDALPEAYAGKYIIYVKEGVYDETVNVTSRMANITMYGDGSKKS  339

Query  1105  IVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             IVTG K++ADG+  ++TATFAV G+ F A  +G RNTA
Sbjct  340   IVTGSKNIADGVRMWKTATFAVDGDRFTAMRLGIRNTA  377



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 187/310 (60%), Gaps = 23/310 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             ++VK +C  TD++ TCE TL   G +       P EL++ +  A  K++  A KKS    
Sbjct  56    KAVKDVCAPTDYKKTCEDTLIKNGNNT----SDPVELVKTAFRATMKQITDAAKKSQTMM  111

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD--LDN---WLSA  660
             E+++D P  + A   C EL+  A  +L  +      +++G F  H  D  L N   WLSA
Sbjct  112   ELQKD-PRTRMALDQCKELMDYALGELSNSF-----EELGKFEFHKLDEALINMRIWLSA  165

Query  661   VMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKR  834
              +++++TC++GF D  G     M+K+LKTA EL  N LAI+S+L++ +   +   S   R
Sbjct  166   AISHEETCLEGFQDTKGNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQ-IPSLNSR  224

Query  835   RLLADGVPEWMNDEQRRMLK--ADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
             RLL++G+P W++   R++L+  A      P+  VA+DGSG+++TIN ALK +P K    +
Sbjct  225   RLLSEGIPSWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINEALKFVPKKKNTTF  284

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             V+ +KAGIY+E V V K M ++   GDG  KTI++G KS  DG++TY+T T A+VG+ F+
Sbjct  285   VVHIKAGIYNEYVQVNKSMTHLVFIGDGPDKTIISGNKSYKDGITTYRTCTVAIVGDYFI  344

Query  1189  AQFIGFRNTA  1218
             A+ IGF NTA
Sbjct  345   AKNIGFENTA  354



>ref|XP_008375414.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Malus domestica]
Length=572

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 186/338 (55%), Gaps = 44/338 (13%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
             H +SG  SK      G  +  SVKA+C  T ++D+C  +LS     ++    KP+EL ++
Sbjct  52    HNKSGGNSK------GSGISTSVKAVCDVTLYQDSCYSSLSPLVNSNNV---KPEELFKL  102

Query  445   SMVAAGKEMDKAVKK--SGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGN  618
             ++  A  E+ KA     +G V   T   + +     +            + S+  D + +
Sbjct  103   AVQVAINELTKAASHFSAGGVLNATAKDRKSVAALKDCQD---------LLSLALDHLND  153

Query  619   FSSHAA-------DLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALA  771
               S A        DL  WLS+  TYQ TCI+GF +  GE K  +   LK + EL SN+LA
Sbjct  154   TLSDANSLVDVFDDLTTWLSSSGTYQQTCIEGFDEVKGELKDKVIGYLKNSTELTSNSLA  213

Query  772   IVSQLASVLSTFEPSESHAKRRLL---------ADGVPEWMNDEQRRMLKADIPKQPPNA  924
             IVS ++ +L++ +       RRLL         + GVPEW++ + R++L++   ++  + 
Sbjct  214   IVSWISKILNSVK------LRRLLTHPDPTDSYSQGVPEWLHRKDRKLLQSSDLRKKADI  267

Query  925   TVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKT  1104
              VA+DGSGK+ TI+ ALKA+P K K R +I+VK G+Y  +V V K   NV + GDGS  T
Sbjct  268   VVARDGSGKYKTIHDALKAVPNKSKKRTIIYVKKGVYYGNVRVEKSKWNVLVVGDGSTAT  327

Query  1105  IVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             IV+ K ++ DG  T+ TATFAV G GF+A+ IGFRNTA
Sbjct  328   IVSAKLNVVDGTPTFSTATFAVFGRGFIARDIGFRNTA  365



>ref|XP_008356804.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Malus domestica]
Length=572

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 186/338 (55%), Gaps = 44/338 (13%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
             H +SG  SK      G  +  SVKA+C  T ++D+C  +LS     ++    KP+EL ++
Sbjct  52    HNKSGGNSK------GSGISTSVKAVCDVTLYQDSCYSSLSPLVNSNNV---KPEELFKL  102

Query  445   SMVAAGKEMDKAVKK--SGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGN  618
             ++  A  E+ KA     +G V   T   + +     +            + S+  D + +
Sbjct  103   AVQVAINELTKAASHFSAGGVLNATAKDRKSVAALKDCQD---------LLSLALDHLND  153

Query  619   FSSHAA-------DLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALA  771
               S A        DL  WLS+  TYQ TCI+GF +  GE K  +   LK + EL SN+LA
Sbjct  154   TLSDANSLVDVFDDLTTWLSSSGTYQQTCIEGFDEVKGELKDKVIGYLKNSTELTSNSLA  213

Query  772   IVSQLASVLSTFEPSESHAKRRLL---------ADGVPEWMNDEQRRMLKADIPKQPPNA  924
             IVS ++ +L++ +       RRLL         + GVPEW++ + R++L++   ++  + 
Sbjct  214   IVSWISKILNSVK------LRRLLTHPDPTDSYSQGVPEWLHRKDRKLLQSSDLRKKADI  267

Query  925   TVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKT  1104
              VA+DGSGK+ TI+ ALKA+P K K R +I+VK G+Y  +V V K   NV + GDGS  T
Sbjct  268   VVARDGSGKYKTIHDALKAVPNKSKKRTIIYVKKGVYYGNVRVEKSKWNVLVVGDGSTAT  327

Query  1105  IVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             IV+ K ++ DG  T+ TATFAV G GF+A+ IGFRNTA
Sbjct  328   IVSAKLNVVDGTPTFSTATFAVFGRGFIARDIGFRNTA  365



>ref|XP_009766961.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Nicotiana sylvestris]
Length=574

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 184/326 (56%), Gaps = 20/326 (6%)
 Frame = +1

Query  274   SGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMV  453
             S  K+K +  D+G S+  S+KA+C  T + D+C  +LS      ++   KP+++ ++S++
Sbjct  51    SHNKNKASRDDNGSSIASSIKAVCSLTLYPDSCISSLSPYAAKGNNL--KPQDIYKMSVL  108

Query  454   AAGKEM----DKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNF  621
              A  E+    DK  +       + P    A + C ELL  A D L+  ++  +   +  F
Sbjct  109   VALNELSGASDKFFQSEAFKNINDPAAAKALESCHELLSLALDHLNDTLSVAENSLLDGF  168

Query  622   SSHAADLDNWLSAVMTYQDTCIDGFPDGEE---KTAMEKSLKTAKELGSNALAIVSQLAS  792
                  DL  WLS+  TYQ TCID F +        A  ++LK + E  SN+LA+V+ L  
Sbjct  169   D----DLRTWLSSAGTYQQTCIDSFENVTSIALSKAAGQNLKNSTEYTSNSLALVTSLEQ  224

Query  793   VLSTFEPSESHAKRRLL----ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFST  960
              +S+     +  +RRL+     D  P W++   R++L+   PK   NA VAKDGSGK+ +
Sbjct  225   SVSSLG---AIGRRRLMEFSGGDEYPSWLSSNDRKLLQKSAPKIKVNAVVAKDGSGKYKS  281

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             I AALKA P K K RYVI+VK GIY E+V + K   N+ + GDG   TIV+G ++  DG 
Sbjct  282   IKAALKAAPEKSKKRYVIYVKKGIYKENVRIEKTKWNIMIIGDGKDATIVSGNRNFIDGT  341

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
              T+Q+ATFAV G+GFMA+ +GF NTA
Sbjct  342   PTFQSATFAVFGKGFMARDMGFVNTA  367



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/307 (37%), Positives = 185/307 (60%), Gaps = 15/307 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +++K +C  TD+++ C  +L++    + +    PKEL+++S   A +++ K   +S    
Sbjct  67    KAIKTICQPTDYKEACVSSLTSVAGSNTT---DPKELVKLSFEVALEKVKKVAGQSALLK  123

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             EV++D P  + A   C E++  A D+L  +I  + G  + N      ++ +WLSA +TYQ
Sbjct  124   EVEKD-PGTRQALSICDEIMDYAIDELKNSIDQVGGFDLSNMEEIIENIRSWLSAAITYQ  182

Query  676   DTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA-  846
             +TC+D F +   K    M+K +KTA +L SN LAIV++L+ V ++F+    +  RRLL+ 
Sbjct  183   ETCVDAFENTTSKAGEQMKKVMKTATKLTSNTLAIVTELSDVFASFKIP--NFNRRLLST  240

Query  847   --DGVPEWMNDEQRRMLKADIPKQP-PNATVAKDGSGKFSTINAALKAMPAKYKGRYVIF  1017
               +G PEW++  +RR+   D P +  P+  VA+DGSG  +T+N AL  +PA     +VI+
Sbjct  241   SNEGFPEWVSQSKRRLFTEDTPAESIPDVVVAQDGSGNCTTVNEALALVPAYGIKPFVIY  300

Query  1018  VKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQF  1197
             VK GIY E+V + K M NV M GDG  K+++T   +  DG+ T+ TAT  VVG GF+A+ 
Sbjct  301   VKEGIYKENVNIEKNMTNVFMIGDGPTKSVITAGLNFVDGVKTFNTATVGVVGNGFVAKN  360

Query  1198  IGFRNTA  1218
             +GF N+A
Sbjct  361   MGFENSA  367



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/308 (41%), Positives = 178/308 (58%), Gaps = 18/308 (6%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS---G  495
             +S+K+ C   D+ +TCE TL  +  +       P +L +    A  +++++AV++S    
Sbjct  44    KSIKSFCQPVDYRETCESTLEASAGN----ASNPTDLAKAIFKATSEKIEQAVRESTVLN  99

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             ++K D      A KDC ELL  A DDL T    + G ++ NF     DL  WLS+ +TYQ
Sbjct  100   DLKND-QRTSGALKDCKELLDYAIDDLKTTFDKLGGFEMSNFKHAVDDLKTWLSSALTYQ  158

Query  676   DTCIDGFPDGEEKTAMEK---SLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKRRLL  843
             +TC+DGF +     A EK   +LK+++EL  N LA+V Q    L+  + PS S   RRLL
Sbjct  159   ETCLDGFENATSTDASEKMKNALKSSQELTENILALVDQFGDTLANLDLPSFS---RRLL  215

Query  844   AD-GVPEWMNDEQRRMLKAD--IPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
              D G+P W++D +RR+L+A    P+  P+ TVA DGSG F TIN AL  +P K    YV+
Sbjct  216   GDDGLPGWISDAKRRLLQASPGAPEFKPDVTVAADGSGDFKTINEALAKVPIKATATYVM  275

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQ  1194
             +VKAG Y E V V + + N+ M GDG+ KTI+TG KS    ++T  TAT   +G GF  +
Sbjct  276   YVKAGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLNITTKDTATMEAIGNGFFMR  335

Query  1195  FIGFRNTA  1218
              IG  NTA
Sbjct  336   GIGVENTA  343



>ref|XP_004151535.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
Length=566

 Score =   175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 182/317 (57%), Gaps = 25/317 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V  +C   ++++ C+ TL+ A  +  S    PKE ++ +++A   E    VKK   + 
Sbjct  43    KAVSTICSTANYQEECQNTLTNAAHNASS--DDPKEYVKAAILATIDE----VKKGYNLT  96

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGD--KIGNFSSH-----AADLDNWLSAV  663
                 ++ A  +     ++D +D L  AI  ++     +G    H      AD+ NWL++V
Sbjct  97    DGFLIEAANNRSIKMGVEDCRDLLQFAIDQLQASYSTVGEPDLHTNADRVADIKNWLTSV  156

Query  664   MTYQDTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAK  831
             ++YQ +C+DG    D + +  M+  L  A +L SNALAIV  ++ +L++F  +     + 
Sbjct  157   ISYQQSCLDGLEEFDPQLRQKMQDGLNGAGKLTSNALAIVDAVSDILASFGLQLKAQPSG  216

Query  832   RRLLA------DGVPEWMNDEQRRML--KADIPKQPPNATVAKDGSGKFSTINAALKAMP  987
             RRLL       DG P W+    R++L  +    K  PNA VAKDGSG+F TI+AAL A P
Sbjct  217   RRLLGTTEVDNDGYPTWLTGADRKLLASRGGGAKVKPNAVVAKDGSGQFKTISAALAAYP  276

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFA  1167
                +GRYVI+VKAGIY E V +TK M N+ MYGDG +KTIVTG KS   G +T  TATF 
Sbjct  277   KTLRGRYVIYVKAGIYKEYVHITKDMKNIFMYGDGPKKTIVTGNKSNRGGFTTQDTATFI  336

Query  1168  VVGEGFMAQFIGFRNTA  1218
              +GEGF+ + +GF+NTA
Sbjct  337   AIGEGFLCKSMGFQNTA  353



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   176 bits (446),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 181/308 (59%), Gaps = 21/308 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +++K +C  TD++ TCE TL    +D       P EL+R +  A  K++    KKS    
Sbjct  54    KAIKDVCAPTDYKKTCEDTLRKDAKDTSD----PLELVRTAFNATMKQISNVAKKSLTMI  109

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD-----LDNWLSA  660
             E+++D P  K A   C EL+  A  +L  +      D++G F  H  D     L  WLSA
Sbjct  110   ELQKD-PRTKMALDQCTELMDFAIGELSKSF-----DELGRFELHKVDDALIKLKVWLSA  163

Query  661   VMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKR  834
              ++++ TC+DGF    G+    M+K+LKTA +L  N LA+VS++ + L   E  E ++ R
Sbjct  164   TISHEQTCLDGFQGTQGDAGETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNS-R  222

Query  835   RLLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
             RLL+   P W++   RR+L A + +  P+  VA+DGSG++ TIN AL+ +P K    +V+
Sbjct  223   RLLSQEFPSWVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNNATFVV  282

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQ  1194
              +K+G Y E V V + M N+   GDG  K+I++G KS  DG++TY+TAT A++G+ F+A+
Sbjct  283   HIKSGTYKEYVQVNRTMPNLVFIGDGPTKSIISGNKSFKDGITTYRTATVAIIGDNFIAK  342

Query  1195  FIGFRNTA  1218
              +GF NTA
Sbjct  343   NMGFENTA  350



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   176 bits (445),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 114/310 (37%), Positives = 177/310 (57%), Gaps = 25/310 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +++K +C  TD++ TCE TL    +D       P EL+R +  A  K++    KKS    
Sbjct  54    KAIKDVCAPTDYKKTCEDTLRKDAKDTSD----PLELVRTAFNATMKQISNVGKKSLTMI  109

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNFSSHAAD-----LDNWL  654
             E+++D              L    + +D AI  +    D++G F  H  D     L  WL
Sbjct  110   ELQKDP--------RTKMALDQCTELMDYAIGELSKSFDELGRFELHKVDDALIKLKVWL  161

Query  655   SAVMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHA  828
             SA ++++ TC+DGF    G+    M+K+LKTA +L  N LA+VS++ + L   E  E ++
Sbjct  162   SATISHEQTCLDGFQGTQGDAGETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMNS  221

Query  829   KRRLLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
              RRLL+   P W++   RR+L A + +  P+  VA+DGSG++ TIN AL+ +P K    +
Sbjct  222   -RRLLSQEFPSWVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALQNVPKKNNATF  280

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             VI +K+G Y E V V + M N+   GDG  K+I++G KS  DG++TY+TAT A++G+ F+
Sbjct  281   VIHIKSGTYKEYVQVNRTMPNLVFIGDGPDKSIISGNKSFKDGITTYRTATVAIIGDNFI  340

Query  1189  AQFIGFRNTA  1218
             A+ +GF NTA
Sbjct  341   AKNMGFENTA  350



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 120/338 (36%), Positives = 192/338 (57%), Gaps = 30/338 (9%)
 Frame = +1

Query  262   GHKRSGTKSK----TTPLDSGKSVGESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKP  426
             G  RS + S+    T+P  S  +  ++++A+C  TD+ +TCE +L S AG   D     P
Sbjct  37    GFNRSESDSQSAAPTSPPPSVSTTTKAIQAICQPTDYRETCENSLTSAAGNTSD-----P  91

Query  427   KELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKG-  603
             KEL++ +   A   +  A++ S  +K+      A      + L +  + L  AI  +K  
Sbjct  92    KELIKAAFNVAIDHISAAIRNSSTLKE-----LAKDSRTNQALSNCDELLKYAIDDLKES  146

Query  604   -DKIGNFS-----SHAADLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGS  759
              D+IG F       +  DL  WLS  +TY+ TC+DGF +  GE    M+  L++++EL S
Sbjct  147   FDRIGPFEYEKLDEYVDDLKIWLSGAITYEQTCLDGFENTTGEAGLRMKAMLRSSQELTS  206

Query  760   NALAIVSQLASVLSTFEPSESHAKRRLLA-----DGVPEWMNDEQRRMLKADIPKQPPNA  924
             N LA+V++++S+L+++     +  RRLL+     D    W++D +RR+L+A       + 
Sbjct  207   NGLAMVTEISSILASYN-LPFNVSRRLLSSEDGDDTELSWLSDGKRRLLQATGKTIKADV  265

Query  925   TVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKT  1104
              VAKDGSGK+ T+N ALK +P K    +VI++K G+Y E V+  K M +V + GDG  KT
Sbjct  266   VVAKDGSGKYRTVNEALKDIPKKGNKTFVIYIKQGVYKEQVMFAKSMTHVMIIGDGPTKT  325

Query  1105  IVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              +TG  +  DG+ T++TAT +V+G  F+A+ IGF N+A
Sbjct  326   RITGSLNFIDGVQTFKTATVSVIGSNFIAKDIGFENSA  363



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 129/335 (39%), Positives = 192/335 (57%), Gaps = 32/335 (10%)
 Frame = +1

Query  262   GHKRSGTKSKTTPLDSGKSVG-ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             G  +SG  +  +  + G S   ++V A+C  TD+++TCE +L+ A   D      PKEL+
Sbjct  11    GRNKSGGDAAASSSNGGVSTSTKAVHAICTPTDYKETCESSLAGANTTD------PKELI  64

Query  439   RISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIK--GDKI  612
             +++  AA   +  A+K S  +K       AA     + L    D L++A+  ++  GDK+
Sbjct  65    KVAFNAAVNNIADAIKNSTLMKD-----AAADNSTKDALDVCNDVLESAVDDLRRAGDKV  119

Query  613   GNFSS-----HAADLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALA  771
             G F +     +  DL  WLSAV+TYQ+TCID F +  G+    M+  LKTA+EL SN+LA
Sbjct  120   GEFDATKMDEYVEDLKVWLSAVITYQETCIDAFENTTGDTAEKMKNLLKTARELSSNSLA  179

Query  772   IVSQLASVLSTFEPSE-----SHAKRRLLADGV-PEWMNDEQRRMLKADIPKQPPNATVA  933
             +VS ++S+L   +        + + RRL+++   P W    + R+L A+  K  PNA VA
Sbjct  180   MVSDISSILGQLQLGNLGGGGASSGRRLMSEEEEPYWT---KGRLLAANPLK--PNAVVA  234

Query  934   KDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVT  1113
             +DGSG+F TI  A+  +P K    ++I++KAG+Y E V + KK+  V   GDG  KT +T
Sbjct  235   QDGSGQFKTIKEAINTIPKKNNQTFIIYIKAGLYKEHVEIPKKVNKVVFIGDGPFKTRIT  294

Query  1114  GKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             G KS A G+ T+QTAT AV GE F A+ I F NTA
Sbjct  295   GSKSFAGGVKTFQTATVAVNGEEFTAKNIAFENTA  329



>ref|NP_001105487.1| pectin methylesterase1 [Zea mays]
 emb|CAA73733.1| pectin methylesterase-like protein [Zea mays]
Length=563

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 141/220 (64%), Gaps = 10/220 (5%)
 Frame = +1

Query  583   AIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSN  762
              +  + G  I    S + DL+ WL+ VMT+ DTC+DGF D + K  M   ++ A EL SN
Sbjct  133   GMLEMAGGDIKVLFSRSDDLETWLTGVMTFMDTCVDGFVDEKLKADMHSVVRNATELSSN  192

Query  763   ALAIVSQLASVLSTFEPS--ESHAKRRLLAD-----GVPEWMNDEQRRMLKADIPKQP-P  918
             ALAI + L  +L   +       ++RRLL+      G P WM   +R++L +    QP P
Sbjct  193   ALAITNSLGGILKKMDLGMFSKDSRRRLLSSEQDEKGWPVWMRSPERKLLASG--NQPKP  250

Query  919   NATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQ  1098
             NA VAKDGSG+F +I  A+ A+P  ++GRYVI+VKAG+YDE V+V K  VN+ MYGDG +
Sbjct  251   NAIVAKDGSGQFKSIQQAVDAVPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPK  310

Query  1099  KTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             ++ VTG+KS ADG++T +TATF+V   GF+ + +GF NTA
Sbjct  311   QSRVTGRKSFADGITTMKTATFSVEASGFICKNMGFHNTA  350



>ref|XP_004156120.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
Length=583

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 182/317 (57%), Gaps = 25/317 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V  +C   ++++ C+ TL+ A  +  S    PKE ++ +++A   E    VKK   + 
Sbjct  43    KAVSTICSTANYQEECQNTLTNAAHNASS--DDPKEYVKAAILATIDE----VKKGYNLT  96

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKGD--KIGNFSSH-----AADLDNWLSAV  663
                 ++ A  +     ++D +D L  AI  ++     +G    H      AD+ NWL++V
Sbjct  97    DGFLIEAANNRSIKMGVEDCRDLLQFAIDQLQASYSTVGEPDLHTNADRVADIKNWLTSV  156

Query  664   MTYQDTCIDGFP--DGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTF--EPSESHAK  831
             ++YQ +C+DG    D + +  M+  L  A +L SNALAIV  ++ +L++F  +     + 
Sbjct  157   ISYQQSCLDGLEEFDPQLRQKMQDGLNGAGKLTSNALAIVDAVSDILASFGLQLKAQPSG  216

Query  832   RRLLA------DGVPEWMNDEQRRML--KADIPKQPPNATVAKDGSGKFSTINAALKAMP  987
             RRLL       DG P W+    R++L  +    K  PNA VAKDGSG+F TI+AAL A P
Sbjct  217   RRLLGTTEVDNDGYPTWLTGADRKLLASRGGGAKVKPNAVVAKDGSGQFKTISAALAAYP  276

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFA  1167
                +GRYVI+VKAGIY E V +TK M N+ MYGDG +KTIVTG KS   G +T  TATF 
Sbjct  277   KTLRGRYVIYVKAGIYKEYVHITKDMKNIFMYGDGPKKTIVTGNKSNRGGFTTQDTATFI  336

Query  1168  VVGEGFMAQFIGFRNTA  1218
              +GEGF+ + +GF+NTA
Sbjct  337   AIGEGFLCKSMGFQNTA  353



>ref|XP_002273396.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Vitis vinifera]
 emb|CBI29155.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 120/320 (38%), Positives = 187/320 (58%), Gaps = 21/320 (7%)
 Frame = +1

Query  271   RSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISM  450
              SG KSK    ++G SV  S+KA+C  T + D+C  +L+   +   S+  KP++L  +SM
Sbjct  52    NSGGKSK----NAGNSVSTSIKAVCDVTLYPDSCYNSLAPMVK---SSQLKPEDLFNMSM  104

Query  451   VAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSH  630
               A  E+ +  ++  E +    +         +   +  D     + S     + NF   
Sbjct  105   EVALNELHRTFQRFSEHEGFKGITDKMLAGALDDCYELLDLAIDNLNSSLSSSLDNFD--  162

Query  631   AADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE  810
               DL  WLSA  TYQ+TCI+GF  G  ++++ + LK + E  SN+LAI+++++ +     
Sbjct  163   --DLKTWLSAAGTYQETCINGFESGNLRSSVLEFLKNSTEFSSNSLAIITEISKL-----  215

Query  811   PSESHAKRRLLA---DGVPEWMNDEQRRMLKAD-IPKQPPNATVAKDGSGKFSTINAALK  978
              + S + RRL+    D VP+W++ + R++L++    K+  +A VA DGSGK+ TI+ ALK
Sbjct  216   -AGSISSRRLMGLPEDKVPKWLSAKDRKLLQSSSTLKKKADAVVATDGSGKYKTISEALK  274

Query  979   AMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTA  1158
             A+P K K  +VI+VK G+Y+E+V V K   NV M GDG  KT+V+GK +  DG  T+ TA
Sbjct  275   AVPDKSKKSFVIYVKKGVYNENVRVEKSKWNVLMIGDGMNKTVVSGKLNFVDGTPTFSTA  334

Query  1159  TFAVVGEGFMAQFIGFRNTA  1218
             TFAV G+GF+A+ +GFRNTA
Sbjct  335   TFAVFGKGFVAREMGFRNTA  354



>gb|KHN00235.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=573

 Score =   174 bits (441),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 123/317 (39%), Positives = 180/317 (57%), Gaps = 24/317 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +SVKA+C GTD    C  TLST      S+   PK  +   + A  K + +A+  S  +K
Sbjct  42    KSVKAMCEGTDDPKLCHDTLSTV---KSSSVSDPKAYIAAGVEATAKSVIQALNMSDRLK  98

Query  505   QDT----PlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              +     P  K A  DC +L++ A D ++++   +    I      + DL NWLSA+++Y
Sbjct  99    VEHGDKDPGIKMALDDCKDLIEFALDSIESSANLVNEHNIQALHDQSPDLRNWLSAIISY  158

Query  673   QDTCIDGF---PDGEE---KTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE--SHA  828
             Q +C+DGF    +GEE   K     SL    +L    L IV+ L+ +L +F+     + A
Sbjct  159   QQSCMDGFNNGTNGEEEVKKQLHTDSLDQMGKLTGIVLDIVTNLSKILQSFDLKLDLNPA  218

Query  829   KRRLL---ADGVPEWMNDEQRRML----KADIPKQPPNATVAKDGSGKFSTINAALKAMP  987
              RRLL   A+G P W +   RR+L    + D P  PPNA VA DGSG+F ++  A+ + P
Sbjct  219   SRRLLEVDAEGFPTWFSAADRRLLDKMNQGDAP--PPNAVVALDGSGQFKSVKQAIDSYP  276

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFA  1167
               +KGR++I+VKAG+Y+E +++ KK  N+ +YGDG  KTI+TG K+  DG+ T QTATFA
Sbjct  277   KNFKGRFIIYVKAGVYNEYILIPKKSENIMIYGDGPTKTIITGNKNFIDGVKTMQTATFA  336

Query  1168  VVGEGFMAQFIGFRNTA  1218
                 GF+A+ I F NTA
Sbjct  337   NTAPGFIAKSIAFENTA  353



>ref|XP_003519736.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=573

 Score =   174 bits (441),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 123/317 (39%), Positives = 180/317 (57%), Gaps = 24/317 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +SVKA+C GTD    C  TLST      S+   PK  +   + A  K + +A+  S  +K
Sbjct  42    KSVKAMCEGTDDPKLCHDTLSTV---KSSSVSDPKAYIAAGVEATAKSVIQALNMSDRLK  98

Query  505   QDT----PlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              +     P  K A  DC +L++ A D ++++   +    I      + DL NWLSA+++Y
Sbjct  99    VEHGDKDPGIKMALDDCKDLIEFALDSIESSANLVNEHNIQALHDQSPDLRNWLSAIISY  158

Query  673   QDTCIDGF---PDGEE---KTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSE--SHA  828
             Q +C+DGF    +GEE   K     SL    +L    L IV+ L+ +L +F+     + A
Sbjct  159   QQSCMDGFNNGTNGEEEVKKQLHTDSLDQMGKLTGIVLDIVTNLSKILQSFDLKLDLNPA  218

Query  829   KRRLL---ADGVPEWMNDEQRRML----KADIPKQPPNATVAKDGSGKFSTINAALKAMP  987
              RRLL   A+G P W +   RR+L    + D P  PPNA VA DGSG+F ++  A+ + P
Sbjct  219   SRRLLEVDAEGFPTWFSAADRRLLGKMNQGDAP--PPNAVVALDGSGQFKSVKQAIDSYP  276

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFA  1167
               +KGR++I+VKAG+Y+E +++ KK  N+ +YGDG  KTI+TG K+  DG+ T QTATFA
Sbjct  277   KNFKGRFIIYVKAGVYNEYILIPKKSENIMIYGDGPTKTIITGNKNFIDGVKTMQTATFA  336

Query  1168  VVGEGFMAQFIGFRNTA  1218
                 GF+A+ I F NTA
Sbjct  337   NTAPGFIAKSIAFENTA  353



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   174 bits (440),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 122/323 (38%), Positives = 184/323 (57%), Gaps = 31/323 (10%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS---  492
             ++VK LC  TD++  CE++L + AG   D     P+EL++I+     K+M   +KK+   
Sbjct  34    KAVKTLCKPTDYQKECEKSLRAEAGNTTD-----PRELIKIAFKITIKKMGNGLKKTDFM  88

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              EV+ D P  K A + C +L+  + D+   ++  +    + N  +    L  WLS  +TY
Sbjct  89    HEVEND-PRSKMALETCKQLMNLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITY  147

Query  673   QDTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLA-SVLSTFEPSESHAKRRLL  843
             Q+TC+DGF +   K    M+  LK+   + SNALAI+S+LA +V+     ++    R+L+
Sbjct  148   QETCLDGFKNTTNKAGNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLV  207

Query  844   ADG-----------VPEWMNDEQ-------RRMLKADIPKQPPNATVAKDGSGKFSTINA  969
              D            +P W+ DE+       RR+L     K  PN  VAKDGSGK+ +IN 
Sbjct  208   EDSGDEHVFGQHKVIPSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQ  267

Query  970   ALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTY  1149
             ALK +P K +  +VI++K G+Y E V V KKM +V   GDGS+KT +TG K+  DGL+TY
Sbjct  268   ALKKVPEKNQKPFVIYIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNTY  327

Query  1150  QTATFAVVGEGFMAQFIGFRNTA  1218
             +TA+ AV G+ F+A  IGF N+A
Sbjct  328   RTASVAVEGDYFVAVNIGFENSA  350



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   174 bits (440),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 176/303 (58%), Gaps = 15/303 (5%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +SV+A+C  TD+++ CE++L++A    D     PKEL++++  +   ++  A+K +  +K
Sbjct  48    KSVQAMCQPTDYKEACEKSLASAKNTSD-----PKELIKVAFESTITDIKNAIKNTDLIK  102

Query  505   Q--DTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
                + P  K A   C  LL  + DDL  +   +    I     +  DL  W+SA +TYQ+
Sbjct  103   DAANDPRTKEALNTCDGLLDVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQE  162

Query  679   TCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKRRLLAD  849
             TC+D F +  G+    M+K LKTA EL SN LA+++    +L+    P  S   RRLLAD
Sbjct  163   TCLDAFQNTSGDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTNMNIPGIS---RRLLAD  219

Query  850   GVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAG  1029
                 ++ D  RR+L+  +    PNA VA DGSG+F TI  ALK +P K    YVI +KAG
Sbjct  220   DYTSFVEDGSRRLLQ--VSNTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVILIKAG  277

Query  1030  IYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFR  1209
              Y E V + + + NV   G+G  KT +TG K+ ADG +T+ T+T AV G+GF+A+ IGF 
Sbjct  278   EYKEMVDIPRGVTNVVFIGEGPTKTKITGNKNYADGTATFHTSTVAVNGDGFVAKDIGFE  337

Query  1210  NTA  1218
             NTA
Sbjct  338   NTA  340



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   174 bits (441),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 122/323 (38%), Positives = 184/323 (57%), Gaps = 31/323 (10%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTL-STAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS---  492
             ++VK LC  TD++  CE++L + AG   D     P+EL++I+     K+M   +KK+   
Sbjct  57    KAVKTLCKPTDYQKECEKSLRAEAGNTTD-----PRELIKIAFKITIKKMGNGLKKTDFM  111

Query  493   GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              EV+ D P  K A + C +L+  + D+   ++  +    + N  +    L  WLS  +TY
Sbjct  112   HEVEND-PRSKMALETCKQLMNLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITY  170

Query  673   QDTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLA-SVLSTFEPSESHAKRRLL  843
             Q+TC+DGF +   K    M+  LK+   + SNALAI+S+LA +V+     ++    R+L+
Sbjct  171   QETCLDGFKNTTNKAGNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLV  230

Query  844   ADG-----------VPEWMNDEQ-------RRMLKADIPKQPPNATVAKDGSGKFSTINA  969
              D            +P W+ DE+       RR+L     K  PN  VAKDGSGK+ +IN 
Sbjct  231   EDSGDEHVFGQHKVIPSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQ  290

Query  970   ALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTY  1149
             ALK +P K +  +VI++K G+Y E V V KKM +V   GDGS+KT +TG K+  DGL+TY
Sbjct  291   ALKKVPEKNQKPFVIYIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNTY  350

Query  1150  QTATFAVVGEGFMAQFIGFRNTA  1218
             +TA+ AV G+ F+A  IGF N+A
Sbjct  351   RTASVAVEGDYFVAVNIGFENSA  373



>ref|XP_009355064.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Pyrus x bretschneideri]
Length=572

 Score =   174 bits (440),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 182/342 (53%), Gaps = 52/342 (15%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
             H +SG  SK      G ++  SVKA+C  T ++D C  +L   G   +S+  KP+E+ ++
Sbjct  52    HNKSGGNSK------GSAISTSVKAVCDVTLYQDLCYSSL---GPLVNSSNVKPEEIFKL  102

Query  445   SMVAAGKEMDKAVKKS------GEVKQDTPlkkaaakdcaellkdakddldTAIASIKGD  606
             ++  A  E+ KA            + +DT    A                   + S+  D
Sbjct  103   AIQVAINELSKAATHFSADGVLNAIAKDTESVAALKDCQD-------------LLSLALD  149

Query  607   KIGNFSSHAA-------DLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGS  759
              + +  S A        DL  WLS+  TYQ TCI+GF D  GE K  +   LK + EL S
Sbjct  150   HLNDSLSDAKSLVDVFDDLKTWLSSSGTYQQTCIEGFDDVKGELKDKVVGYLKNSNELTS  209

Query  760   NALAIVSQLASVLSTFEPSESHAKRRLL---------ADGVPEWMNDEQRRMLKADIPKQ  912
             N+LAIVS ++ +L++         RRLL         + GVPEW++ + R++L++   ++
Sbjct  210   NSLAIVSWISKILNSVNL------RRLLTHPDPTDKYSQGVPEWLDRKDRKLLQSSDLRK  263

Query  913   PPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDG  1092
               +  VA +GS K+ TI  ALKA+P K K R VI+VK G+Y  +V V K   NV + GDG
Sbjct  264   KADIVVASNGSSKYKTIQEALKAVPDKSKKRTVIYVKKGVYYGNVRVEKSKWNVLVVGDG  323

Query  1093  SQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             S  TIVT K ++ DG  T+ TATFAV G+GF+A+ IGFRNTA
Sbjct  324   SNATIVTAKLNVVDGTPTFSTATFAVFGKGFIARDIGFRNTA  365



>ref|XP_002467727.1| hypothetical protein SORBIDRAFT_01g033140 [Sorghum bicolor]
 gb|EER94725.1| hypothetical protein SORBIDRAFT_01g033140 [Sorghum bicolor]
Length=596

 Score =   174 bits (440),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 119/323 (37%), Positives = 183/323 (57%), Gaps = 30/323 (9%)
 Frame = +1

Query  328   SVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---E  498
             SV+  C   DF+ TC  TL +A    D A + P      ++ A  + + +   ++     
Sbjct  55    SVELFCAPADFQGTCRDTLESALSRTDPA-EHPHAAAAAAITAVERALAEGFNRTSVLDA  113

Query  499   VKQDTPlkkaaakdcaellkd-akddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             V+Q        A     +L +  + ++  A++SI    +      A DL +WLSAV+T+Q
Sbjct  114   VRQSNDTLVWEAIRDCRMLLEDCQGNVQRALSSIAWRGV---DGPAQDLQSWLSAVITFQ  170

Query  676   DTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHA---------  828
              +C+D FP GE +  +  +++ A+E+ SNALAI+ Q A++ S  + +             
Sbjct  171   GSCVDMFPKGEVRDEVNATMEKAREISSNALAIIKQGAALASMIDINGGPDDGDDDANGK  230

Query  829   -KRRLLADG--------VPEWMNDEQRRMLKADIPKQ----PPNATVAKDGSGKFSTINA  969
              +R+L  +G        VP W+  E+R++L     ++     PN TVAKDGSG F+ I+A
Sbjct  231   GERQLEEEGEPASSASSVPTWVPSEERKLLGVKGGRRKAALTPNVTVAKDGSGDFANISA  290

Query  970   ALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTY  1149
             AL AMP KY GRY I+VK G+YDE V +T +M NVTMYGDGS++++VTG K++ DG+  +
Sbjct  291   ALDAMPEKYTGRYFIYVKEGVYDEMVNITGRMANVTMYGDGSKRSVVTGNKNIVDGVRMW  350

Query  1150  QTATFAVVGEGFMAQFIGFRNTA  1218
             +TATFAV G+ FMA  +G +NTA
Sbjct  351   RTATFAVDGDSFMAMKLGIKNTA  373



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 177/314 (56%), Gaps = 25/314 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLS-TAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG--  495
             ++VKA+C  TD+  TCE  L   AG   D     P+EL++++   A K +++A KKS   
Sbjct  60    KAVKAICQPTDYRKTCEENLQKAAGNTTD-----PRELIKMAFKIAEKHVNEASKKSKVL  114

Query  496   -EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              E+ +D P  + A + C EL+  + D+L  ++  +    I       AD+  WLSA +TY
Sbjct  115   EELSKD-PRTRGALQSCRELMTMSVDELKQSLNKVTDFDITEIEKLMADVKTWLSASITY  173

Query  673   QDTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA  846
             Q+TC+DGF +        M+K LK + EL +N LAIVS ++S + + E   S  +RRLL 
Sbjct  174   QETCLDGFQNTTTNAGKEMKKGLKLSMELSANLLAIVSGISSAIPSLE---SLGQRRLLQ  230

Query  847   DGVP----------EWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKY  996
             D +P           W +  +RR+L A   K   +  VAKDGSG FSTI  AL  +P K 
Sbjct  231   DDLPVLGHGDQIFPTWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIRDALHHVPIKS  290

Query  997   KGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVG  1176
                +V+++KAGIY E +   K M N+ + GDG + T + G K+  DG++TY TAT  V+G
Sbjct  291   SKTFVLYIKAGIYQEYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLG  350

Query  1177  EGFMAQFIGFRNTA  1218
             + F+A+ IGF N A
Sbjct  351   DNFVAKNIGFENNA  364



>ref|XP_010939548.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=576

 Score =   173 bits (439),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/343 (34%), Positives = 175/343 (51%), Gaps = 35/343 (10%)
 Frame = +1

Query  274   SGTKSKTTPLDSGKSVGES-----VKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             +G +   T    G  VG S     V A C  T ++DTCERTLS       S    P E++
Sbjct  24    AGVRRSQTTSSGGGDVGLSSTSRYVSAFCQPTQYQDTCERTLSKV-----SNSTAPNEII  78

Query  439   RISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAI----------  588
             ++++ A    +        ++ +D P            +          +          
Sbjct  79    QMAINATKDAIRSKFDVPDKILKDIPSLAPNLPQRNLSMLQDALTDCKKLLEDTIDFLDA  138

Query  589   ASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNAL  768
               +  + + +    + D+  W++++     +C+DG        AM K L  + EL SNAL
Sbjct  139   TYVLSNNMEDLVLRSNDVITWMTSMNLQVSSCLDGIEHPAVHQAMIKELGNSTELRSNAL  198

Query  769   AIVSQLASVLSTFE---PSESHAKRRLL----------ADGVPEWMNDEQRRMLKADIPK  909
              +V++ + V   F     + + ++RRLL          ++G P W++   R++L  D+ K
Sbjct  199   TMVARASKVFQAFGIQLNTGADSRRRLLTHDETVYDRDSEGYPTWLSTTDRKLLAQDMVK  258

Query  910   QPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGD  1089
               PN  VAKDGSG F TIN ALKAMPA Y GRYVI+VKAG+Y+E V++ KK +N+ MYGD
Sbjct  259   --PNVVVAKDGSGNFKTINDALKAMPAAYPGRYVIYVKAGVYNEKVLIDKKKINIFMYGD  316

Query  1090  GSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             GS+KTIVTG  +   G+ T QTA+FAV   GF+ + +GFRNTA
Sbjct  317   GSKKTIVTGNANYKAGVKTDQTASFAVQAPGFICKHMGFRNTA  359



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   174 bits (441),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 182/309 (59%), Gaps = 21/309 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++VK +C  TD++ TCE TL   G++     +  K   RI+M     ++  A KKS  ++
Sbjct  57    KAVKDVCAPTDYKKTCEDTLIKNGKNTTDPVELVKTAFRITM----NQITDAAKKSQTMR  112

Query  505   --QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD-----LDNWLSAV  663
               Q  P  + A   C EL+  A  +L  +      +++G F  H  D     L  WLSA 
Sbjct  113   ELQKDPRTRMALDQCKELMDYALGELSNSF-----EELGKFEFHLLDEALINLRIWLSAA  167

Query  664   MTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRR  837
             +++++TC++GF    G     M+K+LKTA EL  N LAI+S++++ +   +    ++ RR
Sbjct  168   ISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNYVGQMQMPGLNS-RR  226

Query  838   LLADGVPEWMNDEQRRMLKADIPKQPPNA--TVAKDGSGKFSTINAALKAMPAKYKGRYV  1011
             LLAD VP W++   RR+L+A  P     A   VA+DGSG+++TIN A+K +P K    +V
Sbjct  227   LLADEVPSWVDQRGRRLLQAAAPYSDAKADIVVAQDGSGQYTTINDAMKNVPKKKNTTFV  286

Query  1012  IFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMA  1191
             + +KAGIY E V V + M ++   GDG  KTI++G K+  DG++TY+TAT A+VG+ F+A
Sbjct  287   VHIKAGIYKEYVQVNRSMTHLVFIGDGPDKTIISGNKNFKDGITTYRTATVAIVGDHFIA  346

Query  1192  QFIGFRNTA  1218
             + IGF NTA
Sbjct  347   KNIGFENTA  355



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   174 bits (441),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/310 (38%), Positives = 185/310 (60%), Gaps = 23/310 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             ++VK +C  TD+  TCE TL   G++       P EL++ +  A  K++    KKS    
Sbjct  56    KAVKDVCAPTDYRKTCEDTLIQNGQNT----TDPMELVKTAFSATMKQITDVAKKSQTMM  111

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD-----LDNWLSA  660
             E+++D P  + A   C EL+  A  +L ++      +++G F  H  D     L  WLSA
Sbjct  112   ELQKD-PRTRMALDQCTELMDYALGELSSSF-----EELGKFEFHKLDEALINLRIWLSA  165

Query  661   VMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKR  834
              +++++TC++GF    G     M+K+LKTA EL  N LAI+S++++ +   +    ++ R
Sbjct  166   AISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNS-R  224

Query  835   RLLADGVPEWMNDEQRRMLKADIPKQ--PPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
             RLLA+G P W++   RR+L+A        P+  VA+DGSG+++TIN AL  +P K    +
Sbjct  225   RLLAEGFPSWVDQRGRRLLQAAAAYSDVKPDIVVAQDGSGQYTTINDALMFVPKKKNTTF  284

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             V+ +KAGIY E V V K M ++   GDG +KTI++G KS  DG++TY+TAT A+VG+ F+
Sbjct  285   VVHIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGNKSYKDGITTYRTATVAIVGDYFI  344

Query  1189  AQFIGFRNTA  1218
             A+ IGF NTA
Sbjct  345   AKNIGFENTA  354



>ref|XP_009339254.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Pyrus x bretschneideri]
 ref|XP_009339262.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Pyrus x bretschneideri]
Length=572

 Score =   173 bits (438),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 124/336 (37%), Positives = 183/336 (54%), Gaps = 40/336 (12%)
 Frame = +1

Query  265   HKRSGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRI  444
             H +SG  S+      G  +  SVKA+C  T ++D+C  +L   G   +S   KP+EL ++
Sbjct  52    HNKSGGNSE------GSGISTSVKAVCDVTLYQDSCYSSL---GPLVNSNNVKPEELFKL  102

Query  445   SMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFS  624
             ++  A  E+ KA   +     D            +    A       + S+  D + +  
Sbjct  103   AVQVANNELTKA---ASHFSAD----GVLNATAKDRKSAAALKDCQDLLSLALDHLNDTL  155

Query  625   SHAA-------DLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIV  777
             S A        DL  WLS+  TYQ TCI+GF +  GE K  +   LK + EL SN+LAIV
Sbjct  156   SSANSLVDVFDDLKTWLSSSGTYQQTCIEGFDEVKGELKDKVIGYLKNSTELTSNSLAIV  215

Query  778   SQLASVLSTFEPSESHAKRRLL---------ADGVPEWMNDEQRRMLKADIPKQPPNATV  930
             S ++ +L++ +       RRLL         + GVPEW++ + R++L++   ++  +  V
Sbjct  216   SWISKILNSVK------LRRLLTHPDPTDSYSQGVPEWLHRKDRKLLQSSDLRKKADIVV  269

Query  931   AKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIV  1110
             A+DGSGK+ TI+ ALKA+P K K R +I+VK G+Y  +V V K   NV + GDGS  TIV
Sbjct  270   ARDGSGKYKTIHDALKAVPNKSKKRTIIYVKKGVYYGNVRVEKSKWNVLVVGDGSTATIV  329

Query  1111  TGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             + K ++ DG  T+ TATFAV G GF+A+ IGFRNTA
Sbjct  330   SAKLNVVDGTPTFSTATFAVFGRGFIARDIGFRNTA  365



>tpg|DAA44942.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=566

 Score =   172 bits (437),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 123/308 (40%), Positives = 173/308 (56%), Gaps = 17/308 (6%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +S+K+ C   D+ +TCE+ L  A  +  S    P EL +         + KAV++S    
Sbjct  44    KSIKSFCQPVDYRETCEKALEAAAGNATS----PTELAKAIFKVTSDRIAKAVRESALLN  99

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             E+K D      A  +C ELL  A DDL T    + G ++ NF S   DL  WLS+ +TYQ
Sbjct  100   ELKHDR-RTSGALHNCGELLDYAIDDLRTTFDRLGGFEMTNFKSAVDDLRTWLSSALTYQ  158

Query  676   DTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLAD  849
             +TC+DGF +     A  M K+L +++EL  N LA+V + +  L+       H  RRLLA+
Sbjct  159   ETCLDGFENTTTPAAGKMRKALNSSQELTENILALVDEFSETLANLGLPSFH--RRLLAE  216

Query  850   ---GVPEWMNDEQRRMLKADIPKQP--PNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
                G P WM D +RR+L     ++   P+ TVAKDGSG F TINAAL  +P K    YV+
Sbjct  217   HARGAPSWMPDAKRRLLLVSPGEKGFRPDVTVAKDGSGDFRTINAALAKVPLKSATTYVM  276

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQ  1194
             +VKAG Y E V V + + N+ M GDG+ KT++TG KS    ++T  TAT   +G GF+ +
Sbjct  277   YVKAGKYREYVSVARNVTNLVMVGDGATKTVITGHKSFMMNITTKDTATMEAIGNGFLMR  336

Query  1195  FIGFRNTA  1218
              IG +NTA
Sbjct  337   GIGVKNTA  344



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 177/310 (57%), Gaps = 25/310 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +++K +C  TD++ TCE TL      D      P EL++ +     K++    KKS    
Sbjct  53    KAIKEVCAPTDYKKTCEDTL----RKDAQNTSDPLELVKTAFNVTMKQISDVAKKSQTMI  108

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNFSSHAAD-----LDNWL  654
             E+++D              L   K+ +D AI  +    +++G F  H  D     L  WL
Sbjct  109   ELQKDP--------RAKMALDQCKELMDYAIGELSNSFEELGKFEFHKIDEALVKLRLWL  160

Query  655   SAVMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHA  828
             SA +++++TC++GF    G+    ++K+LKTA +L  N LA+VS+++S L   +  E  +
Sbjct  161   SATISHEETCLEGFQGTQGDAGETIKKALKTAVQLTHNGLAMVSEMSSYLGQLQIPE-MS  219

Query  829   KRRLLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
              RRLL+   P WM+   RR+L A + +  P+  VA+DGSG++ TIN AL  +P K    +
Sbjct  220   SRRLLSQDFPSWMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALLNVPKKKNTTF  279

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             V+ +K GIY E V V + M ++   GDGS KT++TG K+  DG++TY+TAT A+VG+ F+
Sbjct  280   VVHIKGGIYKEYVQVNRSMTHLVFIGDGSDKTVITGDKNYKDGITTYKTATVAIVGDHFI  339

Query  1189  AQFIGFRNTA  1218
             A+ IGF NTA
Sbjct  340   AKNIGFENTA  349



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   172 bits (437),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 126/332 (38%), Positives = 187/332 (56%), Gaps = 38/332 (11%)
 Frame = +1

Query  307   SGKSVGE------SVKALCHGTDFEDTCERTLS-TAGEDDDSAPKKPKELLRISMVAAGK  465
             S KS GE      ++K++C   D++ TCE++L  +AG   D     PKEL++ +   A K
Sbjct  46    SHKSTGEISASMKAIKSICQPADYKKTCEKSLEKSAGNTTD-----PKELIKAAFKIAQK  100

Query  466   EMDKAVKKSG---EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAA  636
             ++ +A KKS    E+++D P  + A + C EL+  +  +L  +   +    I       A
Sbjct  101   KIREAAKKSATLEELEKD-PRTRDALQSCKELMDMSISELQNSFDKVADFDITMLDDFMA  159

Query  637   DLDNWLSAVMTYQDTCIDGF----PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLST  804
             DL  WLSAV+TY+ TC+DGF     D  EK  M+K++K A E+ +N L I+  L+S L+ 
Sbjct  160   DLRTWLSAVITYEGTCLDGFENTTSDAGEK--MKKAMKAAIEMSTNGLDIIDGLSSALAD  217

Query  805   FEPSESHAKRRLLADG-----------VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGK  951
              + +     RRLL +             P W++   RR+L A   K  PN TVAKDGSG 
Sbjct  218   LQIT--GVNRRLLQEDEVLGHDDVPSKFPSWVDAGTRRLLAAPPSKIKPNLTVAKDGSGD  275

Query  952   FSTINAALKAMPAKYKGR---YVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKK  1122
             F TI  AL ++P   KG    +V+++KAG+Y E V  TK M  + + GDG +KT +TG K
Sbjct  276   FKTIRGALDSIPKPKKGSTQTFVLYIKAGVYQEYVEFTKSMDYLMVIGDGPEKTRITGNK  335

Query  1123  SLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +  DG++TY TAT  V+G+ F+A+ IGF N+A
Sbjct  336   NFVDGVNTYHTATVVVLGDNFIAKNIGFENSA  367



>ref|XP_003559753.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=575

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 125/315 (40%), Positives = 176/315 (56%), Gaps = 25/315 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +SVKA C   D+++TCE  LS    D    P  P EL +    A   +++KAV +S    
Sbjct  47    KSVKAFCQPMDYKETCEAELSKMSGDK---PTSPTELAKAIFEATSAKINKAVAESATLE  103

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             E+K D      A ++C ELL+ A +DL T+   + G ++ +F+    DL  WLSA +TYQ
Sbjct  104   ELKND-KRTSGALQNCKELLEYAVEDLKTSFDKLGGFEMTDFNKAVDDLKTWLSAALTYQ  162

Query  676   DTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLAD  849
             +TC+DGF +  G+    M+ +L  ++EL  + LA+V Q ++ L +     S  KRRLLAD
Sbjct  163   ETCLDGFLNTTGDASAKMKGALNASQELTEDILAVVDQFSATLGSL----SFGKRRLLAD  218

Query  850   -GVPEWMNDEQRRMLKADIPKQ-----------PPNATVAKDGSGKFSTINAALKAMPAK  993
              G P WM D +RR+++A                 PN TVA DGSG F TIN AL  +P K
Sbjct  219   DGAPTWMTDGKRRLMEASAGAPSSSSSSSPMDFEPNVTVAADGSGDFKTINEALAKVPPK  278

Query  994   YKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVV  1173
                 YV++VKAG Y E V V + + N+ M GDG++KTI+TG K+    L+T  TAT   +
Sbjct  279   STAMYVMYVKAGTYKEYVSVGRPITNLVMIGDGAEKTIITGNKNFKMNLTTKDTATMEAI  338

Query  1174  GEGFMAQFIGFRNTA  1218
             G GF  + I   NTA
Sbjct  339   GNGFFMRDIRVENTA  353



>ref|XP_002519324.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF43188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=570

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 137/221 (62%), Gaps = 9/221 (4%)
 Frame = +1

Query  583   AIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSN  762
             ++ ++K           ADL NWLSAVM+Y++TC+DG  D      M   L  A EL SN
Sbjct  135   SLLTVKNSSFDAVKEREADLKNWLSAVMSYKETCLDGLNDTNLHKPMSDGLVNATELTSN  194

Query  763   ALAIVSQLASVLSTFE-PSE--SHAKRRLLA---DGVP--EWMNDEQRRML-KADIPKQP  915
             ALAIVS ++ + + F  PS   + A RRL+    DG P   WM +  R++L  A      
Sbjct  195   ALAIVSAISDIGNAFRIPSNLNASATRRLMEAEDDGFPFPTWMPNADRKLLGSATNANVK  254

Query  916   PNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGS  1095
             PNA VA+DGSG++ TI AAL A P    GRY+I VKAG+YDE + + K  VNV +YGDG 
Sbjct  255   PNAIVAQDGSGQYKTIAAALAAYPKDLVGRYIINVKAGVYDEYITINKDQVNVFIYGDGP  314

Query  1096  QKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             +KT VTG K    G ST++TA+F+ VG+GFMA+ IGF+NTA
Sbjct  315   RKTTVTGDKCNKKGFSTFKTASFSAVGDGFMAKSIGFQNTA  355



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 119/314 (38%), Positives = 176/314 (56%), Gaps = 25/314 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLS-TAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG--  495
             ++VKA+C  TD+  TCE  L   AG   D     P+EL++++   A K +++A KKS   
Sbjct  60    KAVKAICQPTDYRKTCEENLQKAAGNTTD-----PRELIKMAFKIAEKHLNEASKKSKVL  114

Query  496   -EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              E+ +D P  + A + C EL+  + D+L  ++  +    I       AD+  WLSA +TY
Sbjct  115   EELSKD-PRTRGALQSCKELMTMSVDELKQSLNKVTDFDITEIEKLMADVKTWLSASITY  173

Query  673   QDTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA  846
             Q+TC+DGF +        M+K LK + EL +N LAIVS ++S + + E   S  +RRLL 
Sbjct  174   QETCLDGFQNTTTNAGKEMKKGLKLSMELSANLLAIVSGISSAIPSLE---SLGQRRLLQ  230

Query  847   DGVP----------EWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKY  996
             D +P           W +  +RR+L A   K   +  VAKDGSG FSTI  AL  +P K 
Sbjct  231   DDLPVLGHGDQIFPTWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIREALHHVPIKS  290

Query  997   KGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVG  1176
                +V+++KAGIY E +   K M N+ + GDG + T + G K+  DG++TY TAT  V+G
Sbjct  291   SKTFVLYIKAGIYQEYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLG  350

Query  1177  EGFMAQFIGFRNTA  1218
             + F+A+ IGF   A
Sbjct  351   DNFVAKNIGFEKNA  364



>ref|XP_009612569.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Nicotiana tomentosiformis]
Length=575

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 122/326 (37%), Positives = 183/326 (56%), Gaps = 20/326 (6%)
 Frame = +1

Query  274   SGTKSKTTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMV  453
             S  K+K +  D+G S+  S+KA+C  T + D+C  +LS      ++   KP+++ ++S++
Sbjct  51    SHNKNKASRDDNGSSIASSIKAVCSLTLYPDSCITSLSPYAAKGNNL--KPQDIYKMSVL  108

Query  454   AAGKEM----DKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNF  621
              A  E+    DK  +       + P    A + C ELL  A D L+  ++  +      F
Sbjct  109   VALNELSGASDKFFQSEAFKNINDPAAAKALESCHELLSLALDHLNDTLSVAENSLFDGF  168

Query  622   SSHAADLDNWLSAVMTYQDTCIDGFPDGEE---KTAMEKSLKTAKELGSNALAIVSQLAS  792
                  D+  WLS+  TYQ TCID F +        A  ++LK + E  SN+LA+V+ L  
Sbjct  169   D----DIRTWLSSAGTYQQTCIDSFKNVTSIALSKAAGQNLKNSTEYTSNSLALVTSLEQ  224

Query  793   VLSTFEPSESHAKRRLL----ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFST  960
              +S+     +  +RRL+     D  P W++   R++L+   PK   NA VAKDGSGK+ +
Sbjct  225   SVSSLG---AIGRRRLMEFSGGDEYPSWLSSNDRKLLQKSAPKIKVNAVVAKDGSGKYKS  281

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             I AALKA P K K RYVI+VK GIY E+V + K   N+ + GDG   TIV+G ++  DG 
Sbjct  282   IKAALKAAPEKSKKRYVIYVKQGIYKENVRIEKTKWNIMIIGDGKDATIVSGNRNFIDGT  341

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
              T+++ATFAV G+GFMA+ +GF NTA
Sbjct  342   PTFKSATFAVFGKGFMARDMGFVNTA  367



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   172 bits (437),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 178/310 (57%), Gaps = 25/310 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +++K +C  TD+++TCE TL      D      P EL++ +  A  K++    KKS    
Sbjct  54    KAIKDVCAPTDYKETCEDTL----RKDAKNTSDPLELVKTAFNATMKQISDVAKKSQTMI  109

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNFSSHAAD-----LDNWL  654
             E+++D              L   K+ +D AI  +    +++G F  H  D     L  WL
Sbjct  110   ELQKD--------PRTKMALDQCKELMDYAIGELSKSFEELGRFEFHKVDEALIKLRIWL  161

Query  655   SAVMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHA  828
             SA ++++ TC+DGF    G     ++K+LKTA +L  N LA+VS++++ L   +  E ++
Sbjct  162   SATISHEQTCLDGFQGTQGNAGETIKKALKTAVQLTHNGLAMVSEMSNYLGQMQIPEMNS  221

Query  829   KRRLLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
              RRLL+   P WM+   RR+L A + +   +  VA+DGSG++ TIN AL  +P K    +
Sbjct  222   -RRLLSQEFPSWMDGRARRLLNAPMSEVKLDIVVAQDGSGQYKTINEALNYVPKKKNTTF  280

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             V+ +KAGIY E V V + M ++   GDG +KT+++G KS  DG++TY+TAT A+VG+ F+
Sbjct  281   VVHIKAGIYKEYVQVNRSMTHLVFIGDGPEKTVISGSKSYKDGITTYKTATVAIVGDHFI  340

Query  1189  AQFIGFRNTA  1218
             A+ IGF NTA
Sbjct  341   AKNIGFENTA  350



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/320 (38%), Positives = 187/320 (58%), Gaps = 26/320 (8%)
 Frame = +1

Query  304   DSGKSVGESVKAL---CHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMD  474
             DS   +  SVKA+   C  TDF+ TCE +L+  G +       P EL++ +  A  K++ 
Sbjct  46    DSDAQITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNT----TDPVELVKTAFSATMKQIT  101

Query  475   KAVKKSG---EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD--  639
              A KKS    E+++D P  K A   C EL+  A  +L  +      +++G F  H  D  
Sbjct  102   AAAKKSQTMMELQKD-PRTKMALDQCKELMDYALGELSNSF-----EELGKFEFHLLDEA  155

Query  640   ---LDNWLSAVMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLST  804
                L  WLSA +++++TC++GF    G     M+K+LKTA EL  N LAI+S++++ +  
Sbjct  156   LINLRIWLSAAISHEETCLEGFEGTQGNAGETMKKALKTAIELTRNGLAIISEMSNFVGQ  215

Query  805   FEPSESHAKRRLLADGVPEWMNDEQRRMLKADIPKQ--PPNATVAKDGSGKFSTINAALK  978
                 E  + RRLL+  +P W++   RR+L+A        P+  VA+DGSG++ TIN ALK
Sbjct  216   MGIPE-FSSRRLLSQEIPSWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALK  274

Query  979   AMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTA  1158
              +P K    +V+++KAGIY E V + K M ++   GDG +KTI++G K+  DG++TY+T 
Sbjct  275   FVPKKKNTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQ  334

Query  1159  TFAVVGEGFMAQFIGFRNTA  1218
             T A++G+ F+A+ IGF NTA
Sbjct  335   TVAIIGDSFIAKNIGFVNTA  354



>gb|KDP28007.1| hypothetical protein JCGZ_19087 [Jatropha curcas]
Length=568

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 140/219 (64%), Gaps = 7/219 (3%)
 Frame = +1

Query  583   AIASIKGDKIGNFSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSN  762
             +++++    +       A+L NWLSAVM+Y  TC++GF +      M ++L  +  L SN
Sbjct  135   SLSAVDNSSVDTIQDGQAELKNWLSAVMSYHHTCLEGFANTPLFKPMVQTLINSTHLTSN  194

Query  763   ALAIVSQLASVLSTF----EPSESHAKRRLLADGV--PEWMNDEQRRMLKA-DIPKQPPN  921
             ALAIVS ++ +LS F      + +   RRL+  G   P WM+   R++L + +     PN
Sbjct  195   ALAIVSGISDILSAFGVPQNVNANQTSRRLMNSGYASPTWMSIGDRKLLASRNNANVEPN  254

Query  922   ATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQK  1101
             A VA+DGSG++ TI AAL A P     RYVI+VKAG+Y+E+V + K  VNV MYGDG ++
Sbjct  255   AIVAQDGSGRYKTIRAALAAYPKNLTERYVIYVKAGVYNENVTIAKDKVNVFMYGDGPRR  314

Query  1102  TIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             TIVTG KS  +G+ T +TA+F+ +G+GFMA+ +GF+NTA
Sbjct  315   TIVTGNKSYKNGIPTIRTASFSAIGDGFMAKSMGFQNTA  353



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 117/310 (38%), Positives = 185/310 (60%), Gaps = 18/310 (6%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++++ +C  TD+++ C R+L  AG +       PKEL++ S  AA K + +A KKS  +K
Sbjct  58    KAIEGICQPTDYKEACVRSLREAGAN----TADPKELIKASFKAAMKHIAEAAKKSTVLK  113

Query  505   Q--DTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQD  678
             +   TP  + A  +C +L+  A +DL+ +   +   +        ADL  WLSAV+TYQD
Sbjct  114   ELEKTPRAQQALSNCKKLMGFAINDLERSFDKLGELEFSKLDDALADLKVWLSAVVTYQD  173

Query  679   TCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLADG  852
             TC+DGF +  G     M ++LK+++EL SN LA+V +++  L+  + + ++  R+LL+D 
Sbjct  174   TCLDGFQNTTGNAGHKMREALKSSEELTSNVLAMVDEISLALA--KMNLTNFNRKLLSDD  231

Query  853   --------VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
                        W    +R++L   + K  PN  VAKDGSG+F TIN ALK +P   +  +
Sbjct  232   NVIGHGDDFSMWATSLKRKLLSKTVAKLKPNLVVAKDGSGRFRTINEALKHIPLNSRKTF  291

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             V+ +KAG+Y E VV  +KM NV + GDG  KT ++  K+ ADG +T++TAT +V G+ F+
Sbjct  292   VLHIKAGVYKEQVVFDEKMTNVMLVGDGPTKTRISFNKNYADGTTTFKTATVSVFGDNFI  351

Query  1189  AQFIGFRNTA  1218
             A+ IGF N+A
Sbjct  352   ARDIGFENSA  361



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   173 bits (438),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/320 (38%), Positives = 187/320 (58%), Gaps = 26/320 (8%)
 Frame = +1

Query  304   DSGKSVGESVKAL---CHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMD  474
             DS   +  SVKA+   C  TDF+ TCE +L+  G +       P EL++ +  A  K++ 
Sbjct  46    DSDAQITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNT----TDPVELVKTAFSATMKQIT  101

Query  475   KAVKKSG---EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD--  639
              A KKS    E+++D P  K A   C EL+  A  +L  +      +++G F  H  D  
Sbjct  102   AAAKKSQTMMELQKD-PRTKMALDQCKELMDYALGELSNSF-----EELGKFEFHLLDEA  155

Query  640   ---LDNWLSAVMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLST  804
                L  WLSA +++++TC++GF    G     M+K+LKTA EL  N LAI+S++++ +  
Sbjct  156   LINLRIWLSAAISHEETCLEGFEGTQGNAGETMKKALKTAIELTRNGLAIISEMSNFVGQ  215

Query  805   FEPSESHAKRRLLADGVPEWMNDEQRRMLKADIPKQ--PPNATVAKDGSGKFSTINAALK  978
                 E  + RRLL+  +P W++   RR+L+A        P+  VA+DGSG++ TIN ALK
Sbjct  216   MGIPE-FSSRRLLSQEIPSWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALK  274

Query  979   AMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTA  1158
              +P K    +V+++KAGIY E V + K M ++   GDG +KTI++G K+  DG++TY+T 
Sbjct  275   FVPKKKNTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQ  334

Query  1159  TFAVVGEGFMAQFIGFRNTA  1218
             T A++G+ F+A+ IGF NTA
Sbjct  335   TVAIIGDSFIAKNIGFVNTA  354



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   172 bits (435),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 183/318 (58%), Gaps = 32/318 (10%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++++ +C  T +++TC+ +L    E +      PK+L++     A  ++++ +K S  +K
Sbjct  50    KAIETICQATTYKETCQSSL----EKETGDTTDPKDLIKAEFQVAADKVNEVIKNSNTLK  105

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNF-----SSHAADLDNWLSAV  663
             +      A     ++ L   K+ L+TA+  + G  DK+G F     S + ADL  WLSA 
Sbjct  106   E-----YAKDPMASQALGVCKELLETAVEDLLGAVDKMGPFDVSKISDYLADLKVWLSAA  160

Query  664   MTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRR  837
             + +Q TC+D F D  GE    M   LKTA+EL SN LA+VS+++ ++ +    + ++ RR
Sbjct  161   VNHQATCLDAFEDTKGEAGEKMRGFLKTAQELTSNGLAMVSEISRLVDS---PKLNSHRR  217

Query  838   LLADG-----------VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAM  984
             L++             VP WM+D    +L A      PN  VAKDG+GK+ TIN ALK +
Sbjct  218   LMSSSKGGQTKRNYKPVPGWMSDRHLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEV  277

Query  985   PAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATF  1164
             P K    +VI++K G+Y+E+V+V K+M NV M GDG   T ++G KS ADG++T  TATF
Sbjct  278   PQKSNEAFVIYIKKGMYEETVIVDKEMTNVVMIGDGPTMTRISGSKSHADGITTMNTATF  337

Query  1165  AVVGEGFMAQFIGFRNTA  1218
             A VG  F+A+ IGF NTA
Sbjct  338   AAVGNYFVAKGIGFENTA  355



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   172 bits (435),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 127/353 (36%), Positives = 200/353 (57%), Gaps = 34/353 (10%)
 Frame = +1

Query  229   FYFVMVMEKDDGHKRSGTKSKTTPLDSGKSVG-ESVKALCHGTDFEDTCERTLSTAGEDD  405
             F   MV+    G   S +K  +   D   +   ++++A+C  TD+++TC+++L +AG + 
Sbjct  20    FLVAMVIAVTVGVTTSWSKGGSKSNDGQTTTSTKAIQAICQPTDYKETCQKSLESAGVNS  79

Query  406   DSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTA  585
                  +PKEL++     A  ++ + +K S  +++      A      + L++ K+ LD A
Sbjct  80    ----TEPKELIKAGFKVAMDKLHEVIKNSTTLQE-----LAKDPGANQALENCKELLDYA  130

Query  586   IASIKG--DKIGNFS-----SHAADLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLK  738
             I  +    DK+G F      ++A DL  WLSA MTY+ TC+DGF +  G+    M++ L 
Sbjct  131   IGDLAASFDKLGPFDISKIDAYAEDLKIWLSAAMTYEQTCLDGFQNTTGDAGEKMKRLLN  190

Query  739   TAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLADG------------VPEWMNDEQR  882
             + +EL SN LA+VS++ SVL +F   +S  +RRLLA G            +P W++    
Sbjct  191   STQELTSNGLAMVSEITSVLGSFNVKQS--QRRLLAAGAGGGTKKNTPKVIPVWIDKRTM  248

Query  883   RMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGR-YVIFVKAGIYDESvvvtk  1059
              + +A      P+ TVAKDGSG+  +I  A+K +P     + +VI+VK G+Y+E V++ K
Sbjct  249   DVARATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVYNEYVMIDK  308

Query  1060  kmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              M NV M GDG  KT +TG K+ ADG  T+QTAT AVVG+ F+A+ IGF N+A
Sbjct  309   FMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFENSA  361



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   172 bits (435),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 127/353 (36%), Positives = 200/353 (57%), Gaps = 34/353 (10%)
 Frame = +1

Query  229   FYFVMVMEKDDGHKRSGTKSKTTPLDSGKSVG-ESVKALCHGTDFEDTCERTLSTAGEDD  405
             F   MV+    G   S +K  +   D   +   ++++A+C  TD+++TC+++L +AG + 
Sbjct  20    FLVAMVIAVTVGVTTSRSKGGSKSNDGQTTTSTKAIQAICQPTDYKETCQKSLESAGVNS  79

Query  406   DSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTA  585
                  +PKEL++     A  ++ + +K S  +++      A      + L++ K+ LD A
Sbjct  80    ----TEPKELIKAGFKVAMDKLHEVIKNSTTLQE-----LAKDPGANQALENCKELLDYA  130

Query  586   IASIKG--DKIGNFS-----SHAADLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLK  738
             I  +    DK+G F      ++A DL  WLSA MTY+ TC+DGF +  G+    M++ L 
Sbjct  131   IGDLAASFDKLGPFDISKIDAYAEDLKIWLSAAMTYEQTCLDGFQNTTGDAGEKMKRLLN  190

Query  739   TAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLADG------------VPEWMNDEQR  882
             + +EL SN LA+VS++ SVL +F   +S  +RRLLA G            +P W++    
Sbjct  191   STQELTSNGLAMVSEITSVLGSFNVKQS--QRRLLAAGAGGDTKKNTPKIIPVWIDKRAM  248

Query  883   RMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGR-YVIFVKAGIYDESvvvtk  1059
              + +A      P+ TVAKDGSG+  +I  A+K +P     + +VI+VK G+Y+E V++ K
Sbjct  249   DVSRATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVYNEHVMIDK  308

Query  1060  kmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              M NV M GDG  KT +TG K+ ADG  T+QTAT AVVG+ F+A+ IGF N+A
Sbjct  309   FMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFENSA  361



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   171 bits (434),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 112/307 (36%), Positives = 165/307 (54%), Gaps = 26/307 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +SV  +C  TD+++TC ++L+ A   +D     PK+LL+++  A   ++   +K S  + 
Sbjct  50    KSVNVICQQTDYKETCVKSLAKANNTND-----PKDLLKVAFGATINDLFDVIKNSALLI  104

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKG--DKIG-----NFSSHAADLDNWLSAV  663
              +                        AI  ++   D+IG      F  +A DL  WLSA 
Sbjct  105   NEASKDPRTKDALKTCGDLLD----VAIDDVRRSFDEIGVFDATKFKDYADDLKTWLSAS  160

Query  664   MTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRR  837
             +TYQ+TC+D F +  GE    M K LK A EL SN+LA+VS    VL+          RR
Sbjct  161   ITYQETCLDAFENTTGETGEKMRKLLKNAGELTSNSLAMVSSFGQVLTDLNLKIPGVNRR  220

Query  838   LLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIF  1017
             LL        N  +R + + +     PN  VA DGSG++ +IN AL+A+P K   ++VIF
Sbjct  221   LL--------NAHERMLNEVNSNGLKPNVVVAIDGSGQYKSINEALRAVPKKNTQKFVIF  272

Query  1018  VKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQF  1197
             +KAGIY E + + KKM ++   G+G  KT +TG K+ ADG+ T+QTAT A+ G+ FMA+ 
Sbjct  273   IKAGIYKEYIDIPKKMNHIVFIGEGPTKTKITGNKNFADGIGTFQTATVAINGDNFMAKD  332

Query  1198  IGFRNTA  1218
             IG  NTA
Sbjct  333   IGIENTA  339



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   171 bits (434),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 191/353 (54%), Gaps = 50/353 (14%)
 Frame = +1

Query  268   KRSGTKSKTTPLDSGKSVG---ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELL  438
             K++G ++   P + G  V    ++V+A+C  TD++ TC  +LS A   D      PKEL+
Sbjct  33    KKNGDETDDAPTNGGGGVSATTKAVQAICSPTDYKQTCTESLSGANSTD------PKELI  86

Query  439   RISMVAAGKEMDKAVKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKG--DKI  612
             +++     K + +++K S   K       AA +     L    + L+T+I  ++   +KI
Sbjct  87    KVAFEYTVKNIKESIKNSTLYKD-----AAADERTKGALDVCSEVLNTSIEDLERSFEKI  141

Query  613   GNFSSHAAD-----LDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALA  771
             G F     D     +  WLS  +TYQ+TC+D F +  G+    M+  L+T+ EL SN LA
Sbjct  142   GEFDMSKVDDLVDDVKTWLSGAITYQETCLDAFENTTGDTGEKMKNLLQTSGELLSNGLA  201

Query  772   IVSQLASVLSTFEPSESHAKRRLLAD------------------------GVPEWMNDEQ  879
             +V+  +S+LS+       + RRLL+D                        G P +++ + 
Sbjct  202   MVTDFSSILSSLG---GFSSRRLLSDEGRSLYHLDPTDYAPGEDPKMGFEGTPSFVDSKA  258

Query  880   RRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtk  1059
             R++L A      PNA VAKDGSG++ TI AALK +P K    +VI+VKAG+Y E+V++ +
Sbjct  259   RKLLAATPATLKPNAVVAKDGSGQYGTIAAALKTLPKKTNQTFVIYVKAGVYKETVIIPR  318

Query  1060  kmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
              + N+ + GDG +KT + G K+ ADG+ T+ TA  AV G+GF+A+ IG  NTA
Sbjct  319   HVNNIVLIGDGPEKTRIIGNKNYADGVQTFHTAVLAVNGDGFLAKDIGIENTA  371



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   172 bits (435),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 186/320 (58%), Gaps = 26/320 (8%)
 Frame = +1

Query  304   DSGKSVGESVKAL---CHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMD  474
             DS   +  SVKA+   C  TD++ TCE TL   G +       P EL++ +     K++ 
Sbjct  46    DSEGQINASVKAVKDVCAPTDYKKTCEDTLIKNGNNT----TDPMELVKTAFSVTMKQIT  101

Query  475   KAVKKSG---EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD--  639
              A KKS    E+++D P  + A   C EL+  A  +L  +      +++G F  H  D  
Sbjct  102   DAAKKSQTMMELQKD-PRTRMALDQCKELMDYALGELSNSF-----EELGKFEFHKLDEA  155

Query  640   ---LDNWLSAVMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLST  804
                L  WLSA +++++TC++GF    G     M+K+LKTA EL  N LAI+S++++ +  
Sbjct  156   LINLRIWLSAAISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQ  215

Query  805   FEPSESHAKRRLLADGVPEWMNDEQRRMLK--ADIPKQPPNATVAKDGSGKFSTINAALK  978
              E    ++ RRLLA  +P W++   RR+L+  A      P+  VA+DGSG+++TIN ALK
Sbjct  216   MEIPGLNS-RRLLAQEIPSWVDQRGRRLLQDAAAYSDSKPDIVVAQDGSGQYTTINDALK  274

Query  979   AMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTA  1158
              +P K    +V+ +KAG+Y E V V K M ++   GDG  KTI++G K+  DG++TY+TA
Sbjct  275   NVPKKKNTTFVVHIKAGLYKEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTA  334

Query  1159  TFAVVGEGFMAQFIGFRNTA  1218
             T A+VG+ F+A+ IGF NTA
Sbjct  335   TVAIVGDYFIAKNIGFVNTA  354



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   171 bits (433),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 121/313 (39%), Positives = 180/313 (58%), Gaps = 30/313 (10%)
 Frame = +1

Query  331   VKALCHGTDFEDTCERTLS-TAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVKQ  507
             ++A+C  T +++TC+ +L   AG+  D     PKEL++     A  ++++ ++ S     
Sbjct  51    IEAICQPTSYKETCQSSLEKVAGDTTD-----PKELVKAGFQVAADKVNEVIQNS-----  100

Query  508   DTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNFS-----SHAADLDNWLSAVM  666
             DT    A     ++ L   K+ L+TA+  + G  DK+G F       +  DL  WLSA +
Sbjct  101   DTLKDLAKDPMASQALDVCKEMLNTAVEDLLGAVDKMGPFEISKVDDYLEDLKVWLSAAV  160

Query  667   TYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRL  840
              +Q TC+D F D  GE    M+  LKTA+EL SN LA+V+Q++S+L +   + SH  RRL
Sbjct  161   NHQATCVDAFKDTKGEAGDKMKGFLKTAQELTSNGLAMVTQISSLLGSLNLN-SH--RRL  217

Query  841   LA-------DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYK  999
             L+         VP WM   Q ++L A      PN  VA+DGSGK+ TI  ALK +P K  
Sbjct  218   LSAHSKRNYQAVPSWMGARQLQLLTATPQSLKPNVVVAQDGSGKYKTIKEALKEVPTKSN  277

Query  1000  GRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGE  1179
               +VI++K G+Y E +++ ++M NV M GDG  KT ++G K+ ADG +T  TATFA VG+
Sbjct  278   ETFVIYIKEGVYKEEIIIDRQMTNVFMIGDGPTKTKISGSKNKADGTATMHTATFAAVGD  337

Query  1180  GFMAQFIGFRNTA  1218
              F+A+ I F NTA
Sbjct  338   YFVAKDIRFENTA  350



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   172 bits (435),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 180/317 (57%), Gaps = 23/317 (7%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG  495
             S  ++++++C  T ++ TC  +L   GE        PK+L+++S     K++ +A+  S 
Sbjct  45    STKKAIESICQTTQYQTTCVESLEATGE----CSSDPKDLIQMSFQVTIKKIKEAIDNST  100

Query  496   ---EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVM  666
                ++++D   K A        L+   D   T I   +  +  + S   ADL  WLS  +
Sbjct  101   FMQKLEKDPRAKMALENCEMLALQAVNDLNRTHI-KFESFEFNDLSHWIADLKIWLSGAI  159

Query  667   TYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRL  840
             TYQ+TC+DGF D  GE    M+K+L  + +L SNAL+++++++ V ++     +  +RRL
Sbjct  160   TYQETCLDGFEDTTGEAGEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSN--RRRL  217

Query  841   LADG----------VPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFSTINAALKAMP  987
             L D           +P+W++  +RR+L  ++  +  P+  VAKDGSGK+  IN ALK +P
Sbjct  218   LFDDTPVLGHGIELLPDWIDVGRRRLLAVNMSNEIKPDVVVAKDGSGKYKFINDALKHIP  277

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFA  1167
                   YV+++K G+Y+E V +   M N+ + GDG  KT +TG +S  DG+ TYQT+T A
Sbjct  278   EHRNQTYVLYIKEGVYNEKVEILSTMSNLVIIGDGPTKTRITGNQSFKDGIPTYQTSTVA  337

Query  1168  VVGEGFMAQFIGFRNTA  1218
             ++G+ F+A+ IGF NTA
Sbjct  338   IMGDYFVAKDIGFENTA  354



>ref|XP_007035986.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06912.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=597

 Score =   171 bits (434),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 184/329 (56%), Gaps = 23/329 (7%)
 Frame = +1

Query  292   TTPLDSGKSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEM  471
             TT  D   +  +SV A+C  T F+  C  TL +   ++ +    PK+ ++ ++    +E+
Sbjct  53    TTEKDVLSTTSKSVAAICSPTQFKQACVDTLGSVANNESAV---PKDFIQAAIHVTLQEL  109

Query  472   DKAVKKSGEV--KQDTPlkkaaakdcaellkdakddldTAIASIKGDK-IGNFSSHAADL  642
               A+ KSG +     +      AKD  + L     D   A  S+ GD  + N     A++
Sbjct  110   QAALNKSGSIFGSAVSDKTVKMAKDDCDELLQYAVDELQASFSVVGDSDLHNMEQREAEI  169

Query  643   DNWLSAVMTYQDTCIDGFPDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSES  822
              NWL+AV+++Q++C+D  P  + +  +   L  A +L SNALAIV+ ++ ++S F  + S
Sbjct  170   KNWLNAVISFQESCVDQIPQPQLQQQLSNCLLNASQLTSNALAIVNSISQIMSAFNLTSS  229

Query  823   ------HAKRRLLAD--------GVPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFS  957
                       R L D          P W++ + R++L      Q  PNA VAKDGSG++ 
Sbjct  230   LNLNLGGGNDRQLMDEPNPDHDTTYPSWVSSKDRKLLAGGNNAQLTPNAVVAKDGSGQYK  289

Query  958   TINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADG  1137
             TI  ALKA P   +GRYVI+VKAGIY+E + V K  VNV MYGDG +KT+VTG+KS  DG
Sbjct  290   TIGDALKAYPKNLQGRYVIYVKAGIYNEYITVDKDKVNVFMYGDGPRKTMVTGRKSNRDG  349

Query  1138  LSTYQTATF--AVVGEGFMAQFIGFRNTA  1218
              +T  TA+F  A +G+GF+A+ +GF+NTA
Sbjct  350   YTTTDTASFFAAAIGDGFIAKAMGFQNTA  378



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   171 bits (433),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 119/319 (37%), Positives = 187/319 (59%), Gaps = 34/319 (11%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLS-TAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEV  501
             ++++ +C  T +++TC+ +L   AG+  D     PK+L++     A  ++++ +K S  +
Sbjct  50    KAIETICQPTTYKETCQSSLEKEAGDTTD-----PKDLIKAGFKVAADKVNEVIKNSNTL  104

Query  502   KQDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNFSS-----HAADLDNWLSA  660
             K+            ++ L   K+ L+TA+  + G  DK+G F +     + ADL  WLSA
Sbjct  105   KEHA-----KDPMTSQALGVCKELLETAVEDLLGAVDKMGPFDASKIDDYLADLKVWLSA  159

Query  661   VMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKR  834
              + +Q TC+D F D  GE    M+  LKTA+EL SN LA+VS+++ ++ +    + ++ R
Sbjct  160   AVNHQATCLDAFKDTKGEAGEKMKGFLKTAQELTSNGLAMVSEISRLVGS---PKLNSHR  216

Query  835   RLLADG-----------VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKA  981
             RL++             VP WM+D    +L A      PN  VAKDG+GK+ TIN ALK 
Sbjct  217   RLMSSSKGGQRNRNYKPVPGWMSDRDLDLLTATPESLKPNVVVAKDGTGKYKTINEALKE  276

Query  982   MPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTAT  1161
             +P K K  +VI++K G+Y+E+V+V K+M NV M GDG   T ++G KS ADG++T +TAT
Sbjct  277   VPQKSKEAFVIYIKKGVYEETVIVDKQMTNVVMIGDGPTMTRISGSKSHADGVTTMKTAT  336

Query  1162  FAVVGEGFMAQFIGFRNTA  1218
             FA +G  F+A+ IGF NTA
Sbjct  337   FAALGNYFVAKGIGFENTA  355



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   171 bits (432),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 179/311 (58%), Gaps = 28/311 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +SVKA+C  TD+++ CE++L++A    D     PKEL++++  +   ++  A+K +  ++
Sbjct  53    KSVKAMCQPTDYKEACEKSLASAKNTSD-----PKELIKVAFESTITDIKNAMKNTSLIQ  107

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNF-----SSHAADLDNWLSAV  663
             +      A      + L+  +  L+ +I  ++   DK+G F       +  DL  W+SA 
Sbjct  108   E-----AAKDPRTKDALQTCESLLNVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISAS  162

Query  664   MTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKR  834
             +TYQ+TC+D F +  GE    M+K LKTA EL SN LA+V+    +L+    P  S   R
Sbjct  163   ITYQETCLDAFENTTGETGEKMKKLLKTAGELTSNGLAMVTSFGEMLTNLHVPGIS---R  219

Query  835   RLL---ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGR  1005
             RLL   ++    ++    RR+L+    K  PNA VA+DGSG++ TI  ALKA+P K    
Sbjct  220   RLLTTDSEYTSAFVEAGSRRLLQVSGAK--PNAVVAQDGSGQYKTIKEALKAVPPKNNQT  277

Query  1006  YVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGF  1185
             YVI +KAG Y E V + + + NV   G+G  KT +TG K+ ADG  TY TAT AV G+GF
Sbjct  278   YVILIKAGEYKEMVDIPRSITNVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGF  337

Query  1186  MAQFIGFRNTA  1218
             +A+ IGF NTA
Sbjct  338   VARDIGFENTA  348



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   171 bits (432),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 120/311 (39%), Positives = 180/311 (58%), Gaps = 28/311 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             +SV+A+C  TD+++ CE++L++A    D     PKEL++++  +   ++  A+K +  ++
Sbjct  53    KSVQAMCQPTDYKEACEKSLASAKNTSD-----PKELIKVAFESTITDIKNAMKNTSLIQ  107

Query  505   QDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNF-----SSHAADLDNWLSAV  663
             +      A      + L+  +  L+ +I  ++   DK+G F       +  DL  W+SA 
Sbjct  108   E-----AAKDPRTKDALQTCESLLNVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISAS  162

Query  664   MTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKR  834
             +TYQ+TC+D F +  GE    M+K LKTA EL SN LA+VS    +L+    P  S   R
Sbjct  163   ITYQETCLDAFENTTGETGEKMKKLLKTAGELTSNGLAMVSSFGEMLTNLHIPGIS---R  219

Query  835   RLL---ADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGR  1005
             RLL   ++    ++    RR+L+    K  PNA VA+DGSG++ TI  ALKA+P K    
Sbjct  220   RLLTTDSEYTSAFVEAGSRRLLQVSGAK--PNAVVAQDGSGQYKTIKEALKAVPPKNNQT  277

Query  1006  YVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGF  1185
             YVI +KAG Y E V + + M+NV   G+G  KT +TG K+ ADG  TY TAT AV G+GF
Sbjct  278   YVILIKAGEYKEMVDIPRSMINVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGF  337

Query  1186  MAQFIGFRNTA  1218
             +A+ IGF NTA
Sbjct  338   VARDIGFENTA  348



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   172 bits (435),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 186/322 (58%), Gaps = 23/322 (7%)
 Frame = +1

Query  304   DSGKSVGESVKAL---CHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMD  474
             ++G+ V  S KA+   C  T ++ TC  +L ++ E        PKEL++ S     +++ 
Sbjct  38    NNGQDVTTSQKAIESICQTTRYQHTCVESLESSAE----GSSDPKELIQKSFQVTMEKIK  93

Query  475   KAVKKSGEVK--QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDN  648
             +A++ S  ++  +  P  K A ++C +L   A +DL+      +  +  + S   ADL  
Sbjct  94    EAIENSTMLQKLEKDPRAKLALENCQKLAWQAVNDLNRTHIKFESFEFNDLSHWIADLKI  153

Query  649   WLSAVMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSES  822
             WLS  +TYQ+TC+DGF    GE +  M+++L ++ EL SNAL ++++++SV ++     S
Sbjct  154   WLSGAITYQETCLDGFEKTTGETEEKMKRALNSSMELTSNALYMITEISSVFTSLNAGSS  213

Query  823   HAKRRLLADG----------VPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAA  972
               +RRLL D           +P+W++  +RR+L A   K  P+  VAKDGSGK+ TIN A
Sbjct  214   SRRRRLLFDEAPVLGHGNELLPDWVDMRRRRLLAAKEIK--PDIVVAKDGSGKYKTINEA  271

Query  973   LKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQ  1152
             LK +P      YV+++K GIY+E V  T  M N+ + GDG  KT +TG ++  DG  TY 
Sbjct  272   LKNIPNNRNQTYVLYIKQGIYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYL  331

Query  1153  TATFAVVGEGFMAQFIGFRNTA  1218
             TAT AV+G+ F+A+ IGF N+A
Sbjct  332   TATAAVMGDYFIAKDIGFENSA  353



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   171 bits (432),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 121/304 (40%), Positives = 174/304 (57%), Gaps = 26/304 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +SV+A+C  TD+++TCE++L+ A   +D     PKEL++++  A   ++   +K S    
Sbjct  48    KSVQAICQPTDYKETCEKSLANAKNIND-----PKELIKVAFNATINDLSNVIKNSASLI  102

Query  496   -EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              E K+D P  K A + C  LL  A DDL  +       ++     +  DL  WLS+ +TY
Sbjct  103   DEAKKD-PRTKDALQTCQGLLDVAIDDLTRSFDKFDKFEVSKIKDYTDDLKTWLSSAITY  161

Query  673   QDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA  846
             Q+TC+D F +  G+    M+K LK A EL SN LA+VS    V++    +     RRLL 
Sbjct  162   QETCLDAFENTTGDTGEKMKKLLKNAGELTSNGLAMVSSFGEVVANL--NIPGVNRRLL-  218

Query  847   DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKA  1026
                     D   RML   +    PN  VA DGSG++ +IN AL A+P K   +YVIF+KA
Sbjct  219   --------DAHERMLSDSLK---PNVIVAIDGSGQYKSINEALNAVPKKNTQKYVIFIKA  267

Query  1027  GIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGF  1206
             G+Y+E V + +KM N+   G+G  KT +TG  + ADG  T++TATFAV G+ FMA+ IGF
Sbjct  268   GVYNEHVEIPRKMNNIIFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGF  327

Query  1207  RNTA  1218
              NTA
Sbjct  328   ENTA  331



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/316 (34%), Positives = 183/316 (58%), Gaps = 21/316 (7%)
 Frame = +1

Query  316   SVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG  495
             S  ++++++C  T ++ TC  +L + GE        PKEL++ S     K++ +A+  S 
Sbjct  45    STKKAIESICQTTQYQTTCVESLESTGE----CSSDPKELIQKSFQVTIKKIKEAIDNST  100

Query  496   EVK--QDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMT  669
              ++  +  P  K A ++C +L   A +DL+      +  +  + S   ADL  WLS  +T
Sbjct  101   FMQKLEKDPRAKMALENCEKLALQAVNDLNRTHLKFESFEFNDLSHWIADLKIWLSGAIT  160

Query  670   YQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLL  843
             YQ++C+DGF D  GE    M+K+L  + +L SNAL+++++++ V ++     +  +RRLL
Sbjct  161   YQESCLDGFEDTTGEAGEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSN--RRRLL  218

Query  844   ADG----------VPEWMNDEQRRMLKADIPKQ-PPNATVAKDGSGKFSTINAALKAMPA  990
              D           +P+W++  +RR+L  ++  +  P+  VAKDGSGK+  IN ALK +P 
Sbjct  219   FDDTPVLGHGIELLPDWIDVGRRRLLAVNVSNEIKPDVVVAKDGSGKYKFINDALKHIPE  278

Query  991   KYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAV  1170
                  YV+++K G+YDE V +   M N+ + GDG  KT +TG +S   G+ TYQT+T A+
Sbjct  279   HRNQTYVLYIKEGVYDEKVEILSTMSNLVIIGDGPTKTRITGNQSFKGGVPTYQTSTVAI  338

Query  1171  VGEGFMAQFIGFRNTA  1218
             +G+ F+A+ IGF NTA
Sbjct  339   MGDYFVAKDIGFENTA  354



>ref|XP_010067062.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Eucalyptus grandis]
Length=579

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/326 (38%), Positives = 184/326 (56%), Gaps = 14/326 (4%)
 Frame = +1

Query  277   GTKSKTTPLDSGKS--VGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISM  450
             GT      + SGK   +  SVKA+C  T ++++C  +L  A   + S   +P +L ++S+
Sbjct  48    GTSVHANNMSSGKPRPLSTSVKAVCDVTLYKNSCLSSL--APRANSSGQVRPGDLFKLSI  105

Query  451   VAAGKEMDKAV---KKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNF  621
               A +E+ KA     + G +  +T + + A+       +     LD   +S+      N 
Sbjct  106   QVALEELAKATGYFSEQGTIFNNTMVNETASAALESCHELLGLALDHLNSSLSSSDASNV  165

Query  622   SSHAADLDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKS-LKTAKELGSNALAIVSQLAS  792
              +   DL  WLSA  T Q TCIDGF +  G  K  +  S LK + EL SN+LAI++ ++S
Sbjct  166   LNSGDDLRTWLSAAGTCQQTCIDGFDESAGAIKENVAASYLKNSGELISNSLAIITWISS  225

Query  793   VLSTFE----PSESHAKRRLLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFST  960
             + S+F+     S  H    L    VP+W++ ++R +L++   ++  NA VAKDGSGK+ T
Sbjct  226   ITSSFKLRRLMSMPHPSHHLGHHKVPKWVHRKERELLQSSDLRKKANAVVAKDGSGKYKT  285

Query  961   INAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGL  1140
             I AAL A+P K    +VI+VK G+Y E+V V K   NV M GDG   T+VTG  +  DG 
Sbjct  286   IGAALNAVPDKSNNTFVIYVKKGVYSENVRVEKSKWNVMMVGDGMDATLVTGSLNFIDGT  345

Query  1141  STYQTATFAVVGEGFMAQFIGFRNTA  1218
              T++TATFAV G+GF+A+ +GFRNTA
Sbjct  346   PTFKTATFAVFGQGFIARDMGFRNTA  371



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 173/304 (57%), Gaps = 26/304 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +SV+A+C  TD+++TCE++L+ A   +D     PKEL++++  A   ++   +K S    
Sbjct  48    KSVQAICQPTDYKETCEKSLANAKNIND-----PKELIKVAFNATINDLSDVIKNSASLI  102

Query  496   -EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              E K+D P  K A + C  L+  A DDL  +       ++     +  DL  WLS+ +TY
Sbjct  103   DEAKKD-PRTKDALQTCQGLVDVAIDDLTRSFDKFDKFEVSKIKDYTDDLKTWLSSAITY  161

Query  673   QDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA  846
             Q+TC+D F +  G+    M+K LK A EL SN LA+VS    V++    +     RRLL 
Sbjct  162   QETCLDAFENTTGDTGEKMKKLLKNAGELTSNGLAMVSSFGEVVANL--NIPGVNRRLL-  218

Query  847   DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYVIFVKA  1026
                     D   RML   +    PN  VA DGSG++ +IN AL A+P     RYVIF+KA
Sbjct  219   --------DAHERMLSDSLK---PNVVVAIDGSGQYKSINEALNAVPKMNTQRYVIFIKA  267

Query  1027  GIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQFIGF  1206
             G+Y+E V + +KM N+   G+G  KT +TG  + ADG  T++TATFAV G+ FMA+ IGF
Sbjct  268   GVYNEHVEIPRKMNNIVFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGF  327

Query  1207  RNTA  1218
              NTA
Sbjct  328   ENTA  331



>gb|KDP43631.1| hypothetical protein JCGZ_16918 [Jatropha curcas]
Length=561

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 176/316 (56%), Gaps = 27/316 (9%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEVK  504
             ++V  +C  TD++  CE++LS      D     PKE L+ +++A     ++A KKS  + 
Sbjct  41    KNVAQICQPTDYKKACEQSLSNVNNTQD-----PKEFLKAAILAT----EEAAKKSFNLS  91

Query  505   QDTPlkkaaakdcaellkda-kddldTAIASIKGD--KIGNFSSH-----AADLDNWLSA  660
              D  +K +++ +   +  +  K+ LD A+  ++    ++G    H      A+L NWLSA
Sbjct  92    SDLLVKASSSDNDTRMSLEDCKELLDDAVQELQASFSEVGENQQHTTKRRVAELQNWLSA  151

Query  661   VMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFE-----PSE  819
             V++YQ TC+D F  P+ + KT ME+ +  A +L SNALAIV   + +LST          
Sbjct  152   VISYQQTCLDQFGDPNSQYKTEMEEGMVDAGQLTSNALAIVDAFSDILSTMGLKVNFGGS  211

Query  820   SHAKRRLLA---DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPA  990
             +   R+LL+   DG P W++  +RR+L  D+    PN TVA DGSG   T+   +  +P 
Sbjct  212   NDTSRKLLSVDEDGYPSWLSASRRRLLAVDLATLKPNVTVAADGSGDVKTVTEGIAKIPP  271

Query  991   KYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAV  1170
             K    + I+VKAG Y E   V KKM NV MYGDG  KTI+TG  S   G  T ++ATFA 
Sbjct  272   KNVDPFYIYVKAGTYKEYPTVEKKMNNVFMYGDGPLKTIITGDHSNKTGYKTMRSATFAA  331

Query  1171  VGEGFMAQFIGFRNTA  1218
             +GEGF A+ I F NTA
Sbjct  332   LGEGFTAKSIAFENTA  347



>gb|EAZ07185.1| hypothetical protein OsI_29431 [Oryza sativa Indica Group]
Length=663

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 143/371 (39%), Positives = 199/371 (54%), Gaps = 71/371 (19%)
 Frame = +1

Query  319   VGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKK-PKELLRISMVAAGKEMDKAVKKSG  495
             V + +KA+C  TD++D CE++L+ A  +  ++    PK+++R+S+   G  ++KA  KS 
Sbjct  78    VSKIIKAMCAQTDYKDACEKSLAKAAANISASSSSSPKDVVRVSVAVIGDAIEKAFDKSS  137

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
              +  D P  KAA  DC E+ ++AKDDLD  +A I    +   +     L  WLSAV+ +Q
Sbjct  138   AIVSDDPRVKAAVADCKEIYENAKDDLDRTLAGIDAGGVDGLTKGGYQLRVWLSAVIAHQ  197

Query  676   DTCI-------------DGFPDGEEKTA-------MEKSLKTAKELGSNALAIVSQLAS-  792
             +TCI             D    G+E T+          S   A  L +++ A   +L S 
Sbjct  198   ETCIDGFPDGDLKDKMRDAMESGKELTSNALALIGKASSFLAALHLPASSAASHRRLLSF  257

Query  793   ----------------------VLS-------TFEP----SESHAKRRLLA---------  846
                                   +LS       T +P    S  ++ RRLL+         
Sbjct  258   AFDEDVTKQPEVNRSSGNSLRRLLSFAFDEDATKQPEVNRSSGNSLRRLLSFAFDENAPK  317

Query  847   ------DGVPEWMNDEQRRMLKADIP-KQPPNATVAKDGSGKFSTINAALKAMPAKYKGR  1005
                   D V  W+N ++RR+LKA    K  P+  VAKDGSGKF TIN AL AMP KY GR
Sbjct  318   QPKGNDDDVLVWVNRQERRLLKAKFQNKLKPHVVVAKDGSGKFKTINDALAAMPKKYTGR  377

Query  1006  YVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGF  1185
             YVI+VK G+Y+E V +TKKM NVTMYGDGS+KTI+TG ++  DGL+TY+TATF   G+GF
Sbjct  378   YVIYVKEGVYEEYVTITKKMANVTMYGDGSKKTIITGNRNFVDGLTTYKTATFNAQGDGF  437

Query  1186  MAQFIGFRNTA  1218
             M   +GFRNTA
Sbjct  438   MGVALGFRNTA  448



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 120/308 (39%), Positives = 176/308 (57%), Gaps = 19/308 (6%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS---G  495
             +S+K+ C   D+++ CE TL     +  S  +  K + +    A  + +++AV++S    
Sbjct  44    KSIKSFCEPVDYKEACESTLEKTAGNATSTTELAKAIFK----ATSERIEQAVRESSVLN  99

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTYQ  675
             E+K D      A  +C ELL  A DDL T    + G ++ NF     DL  WLS+ +TYQ
Sbjct  100   ELKHD-QRTAGALNNCKELLNYAMDDLKTTFEQLGGFEMTNFKHALDDLKTWLSSALTYQ  158

Query  676   DTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFE-PSESHAKRRLLA  846
             +TC+DGF +     A  M+K+L  ++EL  N L+IV +    L+  E P+ S   RRLL 
Sbjct  159   ETCVDGFENTTTDAAAKMKKALNASQELTENILSIVDEFGDTLANLELPNLS---RRLLG  215

Query  847   D-GVPEWMNDEQRRMLKADIPKQP---PNATVAKDGSGKFSTINAALKAMPAKYKGRYVI  1014
             D GVP WM+D +RR+L+A  P +P   P+ TVA DGSG + TIN AL  +P K    +V+
Sbjct  216   DDGVPGWMSDTKRRLLQAK-PSEPEFKPDITVASDGSGDYKTINEALAKVPLKSADTFVM  274

Query  1015  FVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMAQ  1194
             ++KAG Y E V V + + N+ M GDG+ KTI+TG KS    ++T  T+T   +G GF  +
Sbjct  275   YIKAGTYKEYVSVARNVTNLVMIGDGASKTIITGDKSFMLNITTKDTSTMEAIGNGFFMR  334

Query  1195  FIGFRNTA  1218
              IG  NTA
Sbjct  335   GIGVENTA  342



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 180/316 (57%), Gaps = 26/316 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLST-AGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEV  501
             +++K++C  TD+++ C  +LS+ +G   D     PK+L++     A K + +A KKS  V
Sbjct  59    KAIKSICQPTDYKEECINSLSSESGNTTD-----PKKLIQAGFKVAMKYLSEAAKKS-VV  112

Query  502   KQDT---PlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSAVMTY  672
              QD    P    A   C +L++++ DDL  ++  +    I  F     DL  WLSA +TY
Sbjct  113   LQDLEKDPRASKALGHCKQLMENSIDDLKHSVDKLGEFDISKFDQMLMDLKIWLSATVTY  172

Query  673   QDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRRLLA  846
             Q+TC+DGF +  GE    M+K+LKT+  L SN L +VS+++SV S  + S     RRL +
Sbjct  173   QETCLDGFQNTTGEAAEKMKKALKTSMRLSSNGLTMVSEISSVFSDLQLSS--MGRRLFS  230

Query  847   DG----VP--------EWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPA  990
             D     +P        EW     RR++     K  PN  VAKDGSGK++TIN ALK +P 
Sbjct  231   DEEESELPVLGHSDEAEWFGGGVRRLMAVHPTKVKPNIVVAKDGSGKYTTINEALKDIPR  290

Query  991   KYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAV  1170
             + +  +VI++K G+Y E V + + M N+ + GDG+ KT +TG K+  DG  T  TAT  V
Sbjct  291   RSENTFVIYIKEGVYKEYVTIERNMTNLLIIGDGANKTRITGDKNFIDGFPTSLTATVVV  350

Query  1171  VGEGFMAQFIGFRNTA  1218
             +G+ F A+ IGF NTA
Sbjct  351   LGDHFRARDIGFENTA  366



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 181/309 (59%), Gaps = 21/309 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSGEV-  501
             ++VK +C  TD++ TCE +L   G +       P EL++ +     K++  A KKS  + 
Sbjct  58    KAVKDICAPTDYKKTCEYSLIKNGNNT----TDPMELVKTAFSVTMKQITDAAKKSQTII  113

Query  502   -KQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD-----LDNWLSAV  663
               Q  P  + A   C EL+  A  +L  +      +++G    H  D     L  WLSA 
Sbjct  114   DLQKDPRTRMALDQCKELMDYALGELSNSF-----EELGKLEFHKLDEVLINLRIWLSAA  168

Query  664   MTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKRR  837
             +++++TC++GF    G     M+K+LKTA EL  N LAI+S++++ +   +    ++ RR
Sbjct  169   ISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLNS-RR  227

Query  838   LLADGVPEWMNDEQRRMLKA--DIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRYV  1011
             LLA  +P W++   RR+L+A  +     P+  VA+DGSG+++TIN ALK +P K    +V
Sbjct  228   LLAQEIPSWVDQRGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKKNTTFV  287

Query  1012  IFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFMA  1191
             + +KAGIY E V V K M ++   GDG +KTI++G K+  DG++TY+TAT A+VG+ F+A
Sbjct  288   VHIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVGDYFIA  347

Query  1192  QFIGFRNTA  1218
             + IGF NTA
Sbjct  348   KNIGFVNTA  356



>ref|XP_010067063.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Eucalyptus grandis]
Length=582

 Score =   169 bits (429),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 126/329 (38%), Positives = 185/329 (56%), Gaps = 33/329 (10%)
 Frame = +1

Query  307   SGKSVGE------SVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKE  468
             S KS GE      SVKA+C  T ++D+C  +L  A   + S   +P++L ++S+  A +E
Sbjct  54    SNKSNGEPQPLSTSVKAVCDVTLYKDSCLSSL--APMANSSGQVRPEDLFKLSIRVALEE  111

Query  469   MDKAV---KKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD  639
             + KA     + G V  +  + + A+       +     LD   +S+      N    A D
Sbjct  112   LAKAAGYFSEPGTVFNNNAVNETASAALDSCRELLGLALDHLNSSLSSSDASNVLDSADD  171

Query  640   LDNWLSAVMTYQDTCIDGFPD--GEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEP  813
             L  WLS   T Q TCIDGF +  G  K  +   LK A EL SN+LAI++ ++SV+S+F+ 
Sbjct  172   LRTWLSTAGTCQQTCIDGFDESAGAIKENVASYLKNAGELTSNSLAIITWISSVVSSFK-  230

Query  814   SESHAKRRLLA--------------DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGK  951
                   RRL++                VP+W++ + R +L++   ++  NA VAKDGSGK
Sbjct  231   -----LRRLMSLPHPYHHLGRHHGHHRVPKWVHRKDRELLQSSDLRKKANAVVAKDGSGK  285

Query  952   FSTINAALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLA  1131
             + TI AALKA+P K K  ++I+VK G+Y E+V V K   NV M GDG   T+VTG  ++ 
Sbjct  286   YKTIGAALKAVPDKSKKTFIIYVKKGVYSENVRVEKSKWNVVMVGDGMDATVVTGSLNVV  345

Query  1132  DGLSTYQTATFAVVGEGFMAQFIGFRNTA  1218
             DG  T+Q+ATFAV G+GF+A+ +GFRNTA
Sbjct  346   DGTPTFQSATFAVFGKGFVAREMGFRNTA  374



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   170 bits (431),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/310 (36%), Positives = 177/310 (57%), Gaps = 25/310 (8%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             +++K +C  TD+++TCE TL    +D       P EL++ +  A  K++    KKS    
Sbjct  55    KAIKDVCAPTDYKETCEDTLRKDAKDTSD----PLELVKTAFNATMKQISDVAKKSQTMI  110

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKG--DKIGNFSSHAAD-----LDNWL  654
             E+++D              L   K+ +D AI  +    +++G F  H  D     L  WL
Sbjct  111   ELQKD--------PRAKMALDQCKELMDYAIGELSKSFEELGKFEFHKVDEALVKLRIWL  162

Query  655   SAVMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHA  828
             SA ++++ TC+DGF    G     ++K+LKTA +L  N LA+V+++++ L   +  E ++
Sbjct  163   SATISHEQTCLDGFQGTQGNAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNS  222

Query  829   KRRLLADGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
              RRLL+   P WM+   RR+L A + +  P+  VA+DGSG++ TIN AL  +P K    +
Sbjct  223   -RRLLSQEFPSWMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKNTTF  281

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             V+ +K GIY E V V + M ++   GDG  KT+++G KS  DG++TY+TAT A+VG+ F+
Sbjct  282   VVHIKEGIYKEYVQVNRSMTHLVFIGDGPDKTVISGSKSYKDGITTYKTATVAIVGDHFI  341

Query  1189  AQFIGFRNTA  1218
             A+ I F NTA
Sbjct  342   AKNIAFENTA  351



>ref|XP_003535291.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor VGDH2-like 
[Glycine max]
Length=561

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 179/315 (57%), Gaps = 21/315 (7%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKE----LLRISMVAAGKEMDKA  480
             KS   +V ALC G+D +  C   LS++   D      PKE    ++R SM +  K ++ +
Sbjct  41    KSTNRAVTALCQGSDDKKLCHDVLSSSNSTD------PKEYIATVVRSSMDSVIKALNMS  94

Query  481   VKKSGEVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSA  660
              + + E    +   K A +DC +LL+ A  DL+ +   +K   + +     A+L NWL A
Sbjct  95    DRLTVEHGNSSAGMKMALEDCKDLLQSAMHDLEASGVLVKESSLQDVHQRTAELKNWLGA  154

Query  661   VMTYQDTCIDGFPDGEEKTAMEK----SLKTAKELGSNALAIVSQLASVLSTFEP--SES  822
             V+ YQ +C+DGF    EK   E+    SL    +L   AL +VS +  +L + +   +  
Sbjct  155   VVAYQQSCLDGFDTDGEKKVQEQLQSGSLDNVGKLTGLALDVVSGITHILQSLDLDLALK  214

Query  823   HAKRRLLA---DGVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINAALKAMPAK  993
              A RRLL    DG P W++   R++L  D     P+ATVAKDGSG+F T+  A+ + P  
Sbjct  215   PASRRLLDVDDDGFPTWVSSADRKLLAND--PVLPHATVAKDGSGQFHTVLDAINSYPKH  272

Query  994   YKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVV  1173
             ++GRYVI+VKAGIYDE + V KK  N+ +YGDG  KTI+TG+K+  +G  T +TATF+ V
Sbjct  273   HQGRYVIYVKAGIYDEYITVDKKKPNLLIYGDGPSKTIITGRKNFHEGTKTMRTATFSTV  332

Query  1174  GEGFMAQFIGFRNTA  1218
              E FMA+ I F NTA
Sbjct  333   AEDFMAKSIAFENTA  347



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 116/310 (37%), Positives = 183/310 (59%), Gaps = 23/310 (7%)
 Frame = +1

Query  325   ESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKSG---  495
             ++VK +C  TD+  TCE TL   G++       P EL++ +     K++  A KKS    
Sbjct  56    KAVKDVCAPTDYRKTCEDTLIKNGKNT----TDPMELVKTAFSVTMKQITDAAKKSQTMM  111

Query  496   EVKQDTPlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAAD-----LDNWLSA  660
             E+++D P  + A   C EL+  A  +L  +      +++G F  H  D     L  WLSA
Sbjct  112   ELQKD-PRTRMALDQCKELMDYALGELSNSF-----EELGKFEFHLLDEALINLRIWLSA  165

Query  661   VMTYQDTCIDGF--PDGEEKTAMEKSLKTAKELGSNALAIVSQLASVLSTFEPSESHAKR  834
              +++++TC++GF    G     M+K+LKTA EL  N LAI+S++++ +   +    ++ R
Sbjct  166   AISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNS-R  224

Query  835   RLLADGVPEWMNDEQRRMLKADIPKQ--PPNATVAKDGSGKFSTINAALKAMPAKYKGRY  1008
             RLLA+G P W++   R++L+A        P+  VA+DGSG+++TIN AL+ +P K    +
Sbjct  225   RLLAEGFPSWLDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYTTINEALQFVPKKKNTTF  284

Query  1009  VIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTYQTATFAVVGEGFM  1188
             V+ +KAG+Y E V V K M ++   GDG  KTI++G K+  DG++TY+TAT A+VG  F+
Sbjct  285   VVHIKAGLYKEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNYFI  344

Query  1189  AQFIGFRNTA  1218
             A+ IGF NTA
Sbjct  345   AKNIGFENTA  354



>sp|Q42920.1|PME_MEDSA RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=P65; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Medicago sativa]
 gb|AAA91128.1| putative pectinesterase [Medicago sativa]
Length=447

 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 129/203 (64%), Gaps = 5/203 (2%)
 Frame = +1

Query  619   FSSHAADLDNWLSAVMTYQDTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLAS  792
              S +A DL  WL+  +++Q TC+DGF +   K    M K LKT+ EL SNA+ ++  ++ 
Sbjct  30    LSEYAFDLKVWLTGTLSHQQTCLDGFANTTTKAGETMTKVLKTSMELSSNAIDMMDAVSR  89

Query  793   VLSTFEPSESHAKRRLLAD-GVPEWMNDEQRRMLKADIPKQPPNATVAKDGSGKFSTINA  969
             +L  F+ S+    RRLL+D G+P W+ND  RR+L        PNA VA+DGSG+F T+  
Sbjct  90    ILKGFDTSQYSVSRRLLSDDGIPSWVNDGHRRLLAGG--NVQPNAVVAQDGSGQFKTLTD  147

Query  970   ALKAMPAKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADGLSTY  1149
             ALK +P K    +VI VKAG+Y E+V V K+M  VT+ GDG  KT  TG  + ADG++TY
Sbjct  148   ALKTVPPKNAVPFVIHVKAGVYKETVNVAKEMNYVTVIGDGPTKTKFTGSLNYADGINTY  207

Query  1150  QTATFAVVGEGFMAQFIGFRNTA  1218
              TATF V G  FMA+ IGF NTA
Sbjct  208   NTATFGVNGANFMAKDIGFENTA  230



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 132/318 (42%), Positives = 179/318 (56%), Gaps = 21/318 (7%)
 Frame = +1

Query  313   KSVGESVKALCHGTDFEDTCERTLSTAGEDDDSAPKKPKELLRISMVAAGKEMDKAVKKS  492
             K+  ++VKA+C  TD+++TC  +  +A  +      +P +L+R+      K + + +KK+
Sbjct  48    KTTTKAVKAVCAITDYKETCINSFMSASPNS----TQPLDLIRLGFDLTIKSIHEGIKKA  103

Query  493   G-EVKQDT---PlkkaaakdcaellkdakddldTAIASIKGDKIGNFSSHAADLDNWLSA  660
               E+K+     P  K A   C EL+ D+ DDL        G  +        DL  WLS 
Sbjct  104   ADELKEKAAKDPEAKRALDLCHELMIDSTDDLSKCFDKFDGFNLSEIEEFVEDLRVWLSG  163

Query  661   VMTYQDTCIDGFPDGEEKTA--MEKSLKTAKELGSNALAIVSQLASVLSTFEPSE-----  819
              M +Q TCID F + +   A  M K  KT+KEL SN LA+VS +++ L  F  +E     
Sbjct  164   SMAFQQTCIDTFDEVKSDLAQDMAKIFKTSKELTSNGLAMVSGISTFLPQFNITEINDDL  223

Query  820   -SHAKRRLLA--DGVPEWMNDEQRRMLKADI-PKQPPNATVAKDGSGKFSTINAALKAMP  987
              S+A R+LL+  DG P WM  E R+++ A   PK  PNA VA DGSG+F +IN ALK +P
Sbjct  224   GSYA-RKLLSTEDGFPTWMRPETRKLMAAVTGPKVKPNAVVALDGSGQFKSINDALKTVP  282

Query  988   AKYKGRYVIFVKAGIYDESvvvtkkmvnvtmYGDGSQKTIVTGKKSLADG-LSTYQTATF  1164
                K  +VI++K GIY E V VTK M  VT  GDG  KTIVTG  +   G + TYQTAT 
Sbjct  283   KNNKFPFVIYIKQGIYKEKVDVTKTMTYVTFIGDGPTKTIVTGNLNFGIGNVKTYQTATV  342

Query  1165  AVVGEGFMAQFIGFRNTA  1218
             AV GE F A+ IGF NTA
Sbjct  343   AVNGENFTAKDIGFENTA  360



Lambda      K        H        a         alpha
   0.315    0.131    0.377    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3061147228170