BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1867_g1_i2 len=220 path=[198:0-133 451:134-219]

Length=220
                                                                      Score     E

ref|WP_029549492.1|  hypothetical protein                             66.6    4e-12   
ref|XP_004057866.1|  PREDICTED: LOW QUALITY PROTEIN: protein FAM65A   63.2    2e-09   
gb|AAO61995.1|  nef attachable protein                                55.1    5e-08   Aster yellows phytoplasma
gb|AAO61994.1|  conserved hypothetical protein                        51.6    8e-07   Aster yellows phytoplasma
gb|EGV91149.1|  hypothetical protein I79_026257                       48.9    8e-06   
ref|WP_039320995.1|  hypothetical protein                             47.4    4e-05   
ref|XP_002076042.1|  GK23686                                          46.6    4e-05   Drosophila willistoni
ref|WP_032127038.1|  hypothetical protein                             45.8    9e-05   
ref|WP_004589688.1|  hypothetical protein                             45.1    2e-04   



>ref|WP_029549492.1| hypothetical protein [Staphylococcus aureus]
Length=107

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    ICKWIFGPLCGLPSKRVYLHIKPRQKHSQNVSCDDCIQLTEVNNPADGAVLKLSFFGFCK  181
            I KW FG L GL  KR YL I  RQKHSQ +  D C QLT++N   D  VLK SF G CK
Sbjct  44   IWKWTFGALSGLCWKRKYLPITTRQKHSQKLVSDVCPQLTQLNISLDRTVLKHSFCGICK  103

Query  182  WICG  193
            W+ G
Sbjct  104  WLFG  107


 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +2

Query  56   LHIKPRQKHSQNVSCDDCIQLTEVNNPADGAVLKLSFFGFCKWICGPL*RFRWKR  220
            LHIK RQ+HSQ V CDDCIQ+TE+N P   A LK SF    KW  G L    WKR
Sbjct  5    LHIKSRQQHSQKVLCDDCIQVTELNIPFHRAGLKHSFCSIWKWTFGALSGLCWKR  59



>ref|XP_004057866.1| PREDICTED: LOW QUALITY PROTEIN: protein FAM65A [Gorilla gorilla 
gorilla]
Length=1281

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NLQVDIWTTLWPSFETGISSHQT*TEAFSECFL**LHSTHRGEQSC*WSSFETLFLWILQ  180
            NLQVDIW T+  S ET ISS++  TEAFSE  L  + ST   +    +SS ETLF   L 
Sbjct  715  NLQVDIWITVKISLETEISSYKIXTEAFSETSLTXVSSTKGVQPFFSYSSLETLFXKNLH  774

Query  181  VDMWTSVKISLET  219
            VD+W +VKISLET
Sbjct  775  VDIWITVKISLET  787


 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    NLQVDIWTTLWPSFETGISSHQT*TEAFSECFL**LHSTHRGEQSC*WSSFETLFLWILQ  180
            NL VDIW T+  S ETGISS++  TEAFSE  L  + ST+R +      S ETLFL  LQ
Sbjct  772  NLHVDIWITVKISLETGISSYKIXTEAFSETSLXCVSSTNRVQTFFXHCSLETLFLXNLQ  831

Query  181  VDMWTSVKISLE  216
            VD+  +VKIS+E
Sbjct  832  VDISITVKISME  843


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NLQVDIWTTLWPSFETGISSHQT*TEAFSECFL**LHSTHRGEQSC*WSSFETLFLWILQ  180
            N QVDI  T+  S ETGISS++  TEAFS+  L  + ST+  +    +S+ ETLF   LQ
Sbjct  658  NWQVDIXITVKSSLETGISSYKIXTEAFSKACLXXVSSTNGAQPFFXYSNLETLFWXNLQ  717

Query  181  VDMWTSVKISLET  219
            VD+W +VKISLET
Sbjct  718  VDIWITVKISLET  730



>gb|AAO61995.1| nef attachable protein [Aster yellows phytoplasma]
Length=65

 Score = 55.1 bits (131),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +2

Query  44   KRVYLHIKPRQKHSQNVSCDDCIQLTEVNNPADGAVLKLSFFGFCKWICGPL*RFRWKR  220
            +R YL IK RQ HSQ + CD C+QLTE N     AV K S    CKWI   L   RWKR
Sbjct  3    ERKYLRIKTRQYHSQKLLCDVCVQLTEFNLSFHRAVWKPSVCEVCKWIFKRLWGLRWKR  61



>gb|AAO61994.1| conserved hypothetical protein [Aster yellows phytoplasma]
Length=58

 Score = 51.6 bits (122),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  81   ILRMFPVMTAFNSQR*TILLMEQF*NSLSLDSASGYVDLCEDFVGN  218
            ILR + VM AFNSQ  T L +EQF N L + SASGY+++ E FVGN
Sbjct  2    ILRSYFVMCAFNSQSLTFLFIEQFGNPLFVKSASGYLNVFEAFVGN  47



>gb|EGV91149.1| hypothetical protein I79_026257 [Cricetulus griseus]
Length=60

 Score = 48.9 bits (115),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  81   ILRMFPVMTAFNSQR*TILLMEQF*NSLSLDSASGYVDLCEDFVGN  218
            ILR   VM AFNSQ  T L +EQ  N+L + SASGY DL E FVGN
Sbjct  2    ILRNSFVMCAFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGN  47



>ref|WP_039320995.1| hypothetical protein, partial [Pectobacterium carotovorum]
Length=80

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  81   ILRMFPVMTAFNSQR*TILLMEQF*NSLSLDSASGYVDLCEDFVGN  218
            ILR   VM AFNSQ  T L +EQ  N+L + SASGY D+ E FVGN
Sbjct  2    ILRNSFVMCAFNSQSLTFLFIEQLGNTLFVKSASGYSDIFEAFVGN  47



>ref|XP_002076042.1| GK23686 [Drosophila willistoni]
 gb|EDW87028.1| GK23686 [Drosophila willistoni]
Length=52

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  102  MTAFNSQR*TILLMEQF*NSLSLDSASGYVDLCEDFVGN  218
            M AFNSQ  T LLME+F +++ + SASGY+DL E FVGN
Sbjct  1    MCAFNSQSITFLLMEEFGDTVFVKSASGYLDLFEAFVGN  39



>ref|WP_032127038.1| hypothetical protein, partial [Piscirickettsia salmonis]
Length=60

 Score = 45.8 bits (107),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = +3

Query  6    ASGYLDHFVAFLRNGYIFTSNLDRSILRMFPVMTAFNSQR*TILLMEQF*NSLSLDS  176
            ASG    F    R G IF S LDR ILR   VM AFNSQ  T L +EQ  N+L + S
Sbjct  4    ASGDFRRFEVNGRKGNIFVSKLDRMILRNLFVMCAFNSQSLTFLFIEQLGNTLFVKS  60



>ref|WP_004589688.1| hypothetical protein, partial [Pseudoalteromonas agarivorans]
 gb|ENN96854.1| hypothetical protein J139_20472, partial [Pseudoalteromonas agarivorans 
S816]
Length=62

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = +2

Query  41   SKRVYLHIKPRQKHSQNVSCDDCIQLTEVNNPADGAVLKLSFFGFCKWICGPL  199
            S   YLHI+  QK S+   CD CIQ TE+N P   A LK SF    KW  G L
Sbjct  10   SLETYLHIETIQKPSEKHLCDVCIQDTELNIPYHRAGLKHSFCSIWKWTFGAL  62



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507827886552