BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1865_g1_i1 len=1613 path=[1710:0-1419 3249:1420-1612]

Length=1613
                                                                      Score     E

emb|CDP02313.1|  unnamed protein product                                479   1e-162   
ref|XP_007032740.1|  Alpha/beta-Hydrolases superfamily protein is...    465   2e-157   
ref|XP_010660624.1|  PREDICTED: monoacylglycerol lipase ABHD6           460   3e-155   
gb|EYU34607.1|  hypothetical protein MIMGU_mgv1a008929mg                455   2e-153   
ref|XP_007217738.1|  hypothetical protein PRUPE_ppa007817mg             454   6e-153   
ref|XP_003607803.1|  2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hy...    451   6e-152   
ref|XP_004505362.1|  PREDICTED: uncharacterized hydrolase YugF-like     449   2e-151   
ref|XP_009365964.1|  PREDICTED: uncharacterized protein LOC103955788    446   3e-150   
ref|XP_002315003.1|  hydrolase family protein                           443   3e-149   Populus trichocarpa [western balsam poplar]
ref|XP_011012018.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    444   5e-149   
ref|XP_009360520.1|  PREDICTED: uncharacterized protein LOC103950980    440   1e-147   
ref|XP_011009403.1|  PREDICTED: monoacylglycerol lipase ABHD6           440   1e-147   
ref|XP_011085690.1|  PREDICTED: uncharacterized protein LOC105167...    440   2e-147   
ref|XP_002306073.2|  hypothetical protein POPTR_0004s11910g             440   2e-147   Populus trichocarpa [western balsam poplar]
ref|XP_009356390.1|  PREDICTED: epoxide hydrolase 3                     438   5e-147   
ref|XP_011012036.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    436   2e-146   
ref|XP_011012026.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    437   2e-146   
ref|XP_007224008.1|  hypothetical protein PRUPE_ppa014966mg             436   3e-146   
ref|XP_003556692.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    436   4e-146   
ref|XP_010089627.1|  Uncharacterized protein L484_021020                435   1e-145   
ref|XP_008230875.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    435   3e-145   
gb|KDP41297.1|  hypothetical protein JCGZ_15704                         432   1e-144   
ref|XP_008243859.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    430   6e-144   
ref|XP_008243858.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    430   1e-143   
ref|XP_010259692.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    429   2e-143   
ref|XP_004304231.1|  PREDICTED: 2-hydroxy-6-oxononadienedioate/2-...    429   2e-143   
ref|XP_002512087.1|  alpha/beta hydrolase, putative                     429   3e-143   Ricinus communis
ref|XP_010680705.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    427   5e-143   
ref|XP_010044415.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    426   1e-142   
ref|XP_010030791.1|  PREDICTED: uncharacterized protein LOC104420695    427   1e-142   
ref|XP_003516364.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    425   1e-141   
ref|NP_001241322.1|  uncharacterized protein LOC100800197               424   1e-141   
ref|XP_009360519.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      424   1e-141   
ref|XP_010258064.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    424   2e-141   
ref|XP_007032741.1|  Alpha/beta-Hydrolases superfamily protein is...    422   2e-141   
ref|XP_006437940.1|  hypothetical protein CICLE_v10031818mg             425   2e-141   
ref|XP_002274292.1|  PREDICTED: monoacylglycerol lipase ABHD6           423   3e-141   Vitis vinifera
ref|XP_006484200.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      425   3e-141   
ref|XP_010554287.1|  PREDICTED: monoacylglycerol lipase ABHD6           423   4e-141   
ref|XP_008445456.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    422   6e-141   
gb|EYU42126.1|  hypothetical protein MIMGU_mgv1a009241mg                423   6e-141   
ref|XP_010680706.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    422   7e-141   
ref|XP_008445455.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    422   1e-140   
ref|XP_009793916.1|  PREDICTED: monoacylglycerol lipase ABHD6           422   1e-140   
ref|XP_003614082.1|  2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hy...    422   1e-140   
ref|XP_007153527.1|  hypothetical protein PHAVU_003G042900g             419   1e-139   
ref|NP_198738.2|  hydrolase, alpha/beta fold family protein             419   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870798.1|  hydrolase, alpha/beta fold family protein          418   3e-139   
ref|XP_008379424.1|  PREDICTED: uncharacterized protein LOC103442420    417   3e-139   
gb|EPS70191.1|  hypothetical protein M569_04568                         417   3e-139   
ref|XP_009139824.1|  PREDICTED: uncharacterized protein LOC103863...    418   4e-139   
ref|XP_004239057.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      418   5e-139   
ref|XP_004490171.1|  PREDICTED: uncharacterized hydrolase YugF-like     419   6e-139   
ref|XP_010044416.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    416   9e-139   
ref|XP_009793906.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      417   1e-138   
ref|XP_004144177.1|  PREDICTED: uncharacterized hydrolase YugF-like     416   2e-138   
emb|CDY36414.1|  BnaC05g10150D                                          416   2e-138   
ref|NP_172837.1|  alpha/beta-Hydrolases superfamily protein             416   3e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011070944.1|  PREDICTED: monoacylglycerol lipase ABHD6           415   1e-137   
ref|XP_006348698.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      415   1e-137   
ref|XP_008791305.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    414   1e-137   
gb|KFK33206.1|  hypothetical protein AALP_AA6G344600                    414   1e-137   
ref|XP_006348804.1|  PREDICTED: epoxide hydrolase 4-like                416   1e-137   
ref|XP_010939161.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    413   2e-137   
ref|XP_009148670.1|  PREDICTED: monoacylglycerol lipase abhd6-B         413   2e-137   
emb|CDX98133.1|  BnaA06g08840D                                          413   2e-137   
gb|KFK43632.1|  hypothetical protein AALP_AA1G151700                    412   6e-137   
ref|XP_004239058.1|  PREDICTED: epoxide hydrolase 4-like                413   1e-136   
ref|XP_006285675.1|  hypothetical protein CARUB_v10007139mg             411   1e-136   
ref|XP_009140214.1|  PREDICTED: uncharacterized protein LOC103864...    411   1e-136   
ref|XP_010476412.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      410   3e-136   
emb|CDP00428.1|  unnamed protein product                                410   5e-136   
ref|XP_009596052.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      411   5e-136   
ref|XP_006417085.1|  hypothetical protein EUTSA_v10008133mg             409   8e-136   
ref|XP_009596053.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    410   1e-135   
ref|XP_009139823.1|  PREDICTED: uncharacterized protein LOC103863...    409   1e-135   
ref|XP_006348697.1|  PREDICTED: epoxide hydrolase 3-like                410   1e-135   
ref|XP_006405655.1|  hypothetical protein EUTSA_v10027834mg             408   2e-135   
ref|XP_010458848.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      408   2e-135   
ref|XP_004298378.1|  PREDICTED: uncharacterized hydrolase YugF-like     408   2e-135   
ref|XP_004239464.1|  PREDICTED: epoxide hydrolase 3-like                409   3e-135   
ref|XP_010450832.1|  PREDICTED: uncharacterized protein LOC104732927    406   1e-134   
ref|XP_010495613.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      406   1e-134   
ref|XP_010435823.1|  PREDICTED: uncharacterized protein LOC104719577    404   6e-134   
ref|XP_010939160.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    405   6e-134   
ref|XP_010680707.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      402   4e-133   
ref|XP_002527610.1|  alpha/beta hydrolase, putative                     400   8e-133   Ricinus communis
ref|XP_002324110.2|  hydrolase family protein                           400   8e-133   Populus trichocarpa [western balsam poplar]
gb|EPS71122.1|  hypothetical protein M569_03637                         399   2e-132   
ref|XP_009140215.1|  PREDICTED: uncharacterized protein LOC103864...    400   2e-132   
ref|XP_011012054.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    399   2e-132   
ref|XP_010091569.1|  putative hydrolase yugF                            395   7e-131   
ref|XP_006837141.1|  hypothetical protein AMTR_s00110p00143020          396   9e-131   
ref|XP_010552541.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    395   2e-130   
ref|XP_008460251.1|  PREDICTED: uncharacterized protein LOC103499...    395   5e-130   
ref|XP_011012045.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    392   2e-129   
ref|XP_006605541.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    391   4e-129   
dbj|BAJ90728.1|  predicted protein                                      392   1e-128   
ref|XP_007032742.1|  Alpha/beta-Hydrolases superfamily protein is...    388   3e-128   
gb|KEH27853.1|  alpha/beta fold hydrolase                               386   2e-127   
ref|XP_010258065.1|  PREDICTED: uncharacterized protein LOC104597...    387   2e-127   
ref|XP_010939163.1|  PREDICTED: uncharacterized protein LOC105058...    385   5e-127   
ref|XP_011085691.1|  PREDICTED: uncharacterized protein LOC105167...    382   6e-126   
ref|XP_007045882.1|  Alpha/beta-Hydrolases superfamily protein is...    380   2e-125   
ref|XP_009402991.1|  PREDICTED: uncharacterized protein LOC103986...    381   4e-125   
ref|XP_009365974.1|  PREDICTED: uncharacterized protein LOC103955800    380   5e-125   
ref|XP_008365517.1|  PREDICTED: uncharacterized protein LOC103429153    380   6e-125   
ref|XP_002463151.1|  hypothetical protein SORBIDRAFT_02g038540          382   1e-124   Sorghum bicolor [broomcorn]
ref|XP_004958222.1|  PREDICTED: monoacylglycerol lipase abhd6-B-l...    382   2e-124   
ref|XP_004958223.1|  PREDICTED: monoacylglycerol lipase abhd6-B-l...    381   2e-124   
ref|XP_010259725.1|  PREDICTED: uncharacterized protein LOC104599...    378   4e-124   
ref|XP_010258068.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    376   6e-124   
ref|XP_010258066.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    378   7e-124   
ref|XP_006573146.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    377   1e-123   
ref|XP_010939162.1|  PREDICTED: uncharacterized protein LOC105058...    377   2e-123   
ref|XP_010259714.1|  PREDICTED: uncharacterized protein LOC104599...    377   2e-123   
gb|KEH27855.1|  alpha/beta fold hydrolase                               374   2e-122   
ref|XP_010042149.1|  PREDICTED: uncharacterized protein LOC104431167    372   2e-121   
ref|XP_007157835.1|  hypothetical protein PHAVU_002G102200g             369   6e-121   
gb|KEH27854.1|  alpha/beta fold hydrolase                               366   6e-120   
ref|XP_010235921.1|  PREDICTED: uncharacterized protein LOC100842211    368   3e-119   
ref|XP_011000104.1|  PREDICTED: uncharacterized protein LOC105107762    365   7e-119   
ref|XP_009140216.1|  PREDICTED: uncharacterized protein LOC103864...    364   1e-118   
ref|XP_008791306.1|  PREDICTED: uncharacterized protein LOC103708...    364   2e-118   
ref|XP_008791309.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    363   2e-118   
ref|NP_001130641.1|  uncharacterized protein LOC100191741               365   4e-118   Zea mays [maize]
ref|XP_008667052.1|  PREDICTED: uncharacterized protein LOC100191...    365   4e-118   
ref|XP_009402999.1|  PREDICTED: uncharacterized protein LOC103986...    361   2e-117   
ref|XP_008460252.1|  PREDICTED: uncharacterized protein LOC103499...    358   7e-117   
ref|XP_010552549.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    356   4e-116   
gb|EMS57377.1|  putative hydrolase yugF                                 356   1e-115   
gb|KCW86501.1|  hypothetical protein EUGRSUZ_B03156                     353   5e-115   
ref|XP_009596055.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    355   1e-114   
ref|XP_008791308.1|  PREDICTED: uncharacterized protein LOC103708...    353   1e-114   
ref|XP_006658774.1|  PREDICTED: uncharacterized protein LOC102720166    357   2e-114   
gb|EMT01626.1|  hypothetical protein F775_13684                         355   5e-114   
ref|XP_002890023.1|  F16A14.4                                           357   1e-111   
gb|AAF79393.1|AC068197_3  F16A14.4                                      352   9e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303265.1|  hypothetical protein CARUB_v10009998mg             337   2e-108   
ref|XP_009403015.1|  PREDICTED: uncharacterized protein LOC103986...    334   3e-107   
gb|KDP27240.1|  hypothetical protein JCGZ_19939                         331   1e-106   
ref|XP_001755897.1|  predicted protein                                  327   8e-104   
ref|XP_009403007.1|  PREDICTED: uncharacterized protein LOC103986...    324   4e-103   
ref|XP_002971012.1|  hypothetical protein SELMODRAFT_411752             321   2e-101   
ref|XP_002962073.1|  hypothetical protein SELMODRAFT_403595             320   2e-101   
emb|CAN73949.1|  hypothetical protein VITISV_027382                     322   7e-101   Vitis vinifera
gb|KDO36350.1|  hypothetical protein CISIN_1g027952mg                   309   2e-98    
gb|KCW86502.1|  hypothetical protein EUGRSUZ_B03156                     300   2e-94    
ref|XP_008667053.1|  PREDICTED: uncharacterized protein LOC100191...    293   1e-90    
gb|KHN42948.1|  hypothetical protein glysoja_007478                     284   6e-88    
gb|EEE67540.1|  hypothetical protein OsJ_25019                          294   1e-86    Oryza sativa Japonica Group [Japonica rice]
gb|EEC82399.1|  hypothetical protein OsI_26767                          294   3e-86    Oryza sativa Indica Group [Indian rice]
emb|CDY37879.1|  BnaC04g31270D                                          267   3e-82    
gb|KHN29994.1|  Abhydrolase domain-containing protein 4                 266   9e-82    
emb|CDP11627.1|  unnamed protein product                                256   1e-78    
emb|CBI21218.3|  unnamed protein product                                249   1e-75    
ref|XP_008379861.1|  PREDICTED: uncharacterized protein LOC103442839    241   8e-73    
ref|XP_001419533.1|  predicted protein                                  242   5e-71    Ostreococcus lucimarinus CCE9901
dbj|BAB09377.1|  unnamed protein product                                237   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003081161.1|  Predicted hydrolase/acyltransferase (alpha/b...    237   4e-69    
ref|XP_007045883.1|  Alpha/beta-Hydrolases superfamily protein is...    228   2e-67    
emb|CDP11628.1|  unnamed protein product                                229   3e-67    
ref|XP_002506267.1|  predicted protein                                  231   7e-67    Micromonas commoda
ref|XP_005823494.1|  hypothetical protein GUITHDRAFT_78864              229   1e-66    
gb|KHG06003.1|  AB hydrolase superfamily protein yfhM                   220   2e-65    
ref|XP_004154782.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    214   1e-61    
gb|KGN53683.1|  hypothetical protein Csa_4G102320                       211   2e-61    
ref|XP_004137282.1|  PREDICTED: uncharacterized protein LOC101203865    213   6e-61    
ref|XP_003056635.1|  predicted protein                                  222   5e-60    
ref|XP_005646223.1|  alpha/beta-hydrolase                               210   3e-59    
emb|CBI21219.3|  unnamed protein product                                200   2e-57    
emb|CBJ26140.1|  Predicted hydrolase/acyltransferase (alpha/beta ...    206   8e-57    
ref|XP_007510436.1|  predicted protein                                  197   8e-55    
ref|XP_002950067.1|  hypothetical protein VOLCADRAFT_80939              194   1e-52    
ref|WP_012409274.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        185   3e-50    
ref|WP_015114334.1|  alpha/beta fold family hydrolase                   185   5e-50    
ref|WP_039715107.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        184   5e-50    
ref|WP_015119251.1|  alpha/beta hydrolase                               183   3e-49    
ref|WP_017655578.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        182   4e-49    
ref|XP_001697563.1|  predicted protein                                  180   7e-48    Chlamydomonas reinhardtii
ref|WP_015177307.1|  alpha/beta hydrolase fold protein                  179   1e-47    
ref|WP_006633653.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        179   1e-47    
ref|XP_005851190.1|  hypothetical protein CHLNCDRAFT_56722              183   3e-47    
ref|WP_015205999.1|  putative hydrolase or acyltransferase of alp...    177   3e-47    
ref|WP_015150232.1|  alpha/beta hydrolase                               176   6e-47    
ref|WP_015187486.1|  alpha/beta hydrolase fold protein                  177   6e-47    
ref|WP_013192311.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        176   6e-47    
ref|WP_015195239.1|  alpha/beta hydrolase fold protein                  175   1e-46    
ref|WP_015127998.1|  alpha/beta fold family hydrolase                   174   5e-46    
ref|XP_002294669.1|  hypothetical protein THAPSDRAFT_38512              172   6e-46    Thalassiosira pseudonana CCMP1335
ref|WP_028089867.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        173   9e-46    
ref|WP_015139157.1|  alpha/beta hydrolase                               173   1e-45    
ref|WP_015152588.1|  alpha/beta fold family hydrolase                   173   1e-45    
ref|WP_028083076.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        173   1e-45    
ref|WP_010994492.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        172   2e-45    
ref|WP_015201848.1|  alpha/beta fold family hydrolase                   172   2e-45    
ref|WP_011321370.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        172   2e-45    
ref|WP_027403060.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        172   3e-45    
ref|WP_015171176.1|  alpha/beta fold family hydrolase                   172   3e-45    
ref|WP_019495697.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        171   4e-45    
ref|WP_039739843.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        171   5e-45    
ref|WP_026734344.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        171   7e-45    
ref|WP_015215498.1|  alpha/beta hydrolase fold protein                  171   8e-45    
ref|WP_038088965.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        171   9e-45    
ref|WP_039199653.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        170   1e-44    
ref|WP_017288461.1|  hypothetical protein                               170   1e-44    
ref|WP_027843092.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        170   2e-44    
ref|WP_006511278.1|  putative hydrolase or acyltransferase of alp...    169   2e-44    
ref|WP_029632482.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [      169   4e-44    
ref|WP_016876396.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        168   9e-44    
ref|WP_017299876.1|  hypothetical protein                               167   1e-43    
ref|WP_002769309.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        167   1e-43    
ref|WP_015199657.1|  alpha/beta fold family hydrolase                   167   1e-43    
ref|WP_023174970.1|  alpha/beta hydrolase fold protein                  167   2e-43    
ref|WP_023069724.1|  alpha/beta hydrolase fold family protein           167   2e-43    
ref|WP_002785603.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        167   2e-43    
ref|WP_002782224.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        166   3e-43    
ref|WP_008235829.1|  Possible alpha/beta hydrolase superfamily,sl...    166   3e-43    
ref|WP_035986471.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        166   3e-43    
ref|WP_009782335.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        166   3e-43    
ref|WP_023075561.1|  alpha beta hydrolase fold protein                  166   4e-43    
ref|WP_015083686.1|  alpha/beta hydrolase                               166   4e-43    
ref|WP_026719732.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        166   4e-43    
ref|WP_036031001.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        166   4e-43    
ref|WP_024544649.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        166   5e-43    
ref|WP_002758663.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        166   5e-43    
ref|WP_006275693.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        166   5e-43    
ref|WP_015229468.1|  alpha/beta hydrolase                               166   5e-43    
ref|WP_009455245.1|  MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dieno...    166   6e-43    
ref|WP_015160153.1|  putative hydrolase or acyltransferase of alp...    165   1e-42    
ref|WP_015144885.1|  alpha/beta hydrolase                               165   1e-42    
ref|WP_006197036.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        165   1e-42    
ref|WP_002779013.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        165   1e-42    
ref|WP_036484443.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        164   1e-42    
ref|WP_009341995.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        166   2e-42    
ref|WP_039729299.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        164   2e-42    
ref|WP_015205233.1|  alpha/beta fold family hydrolase                   164   2e-42    
ref|WP_030007549.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        164   2e-42    
ref|WP_019507262.1|  hypothetical protein                               164   2e-42    
ref|WP_012268327.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        164   3e-42    
ref|WP_016867408.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        164   3e-42    
ref|WP_015225519.1|  alpha/beta fold family hydrolase                   163   4e-42    
ref|WP_024969304.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        163   4e-42    
dbj|GAL91400.1|  2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase    163   5e-42    
ref|WP_026082547.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        163   5e-42    
ref|WP_002752793.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        163   6e-42    
gb|KEI66482.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase             163   6e-42    
ref|WP_026794503.1|  MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dieno...    162   6e-42    
ref|WP_008207219.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        162   7e-42    
ref|WP_036396441.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        162   7e-42    
ref|WP_016858657.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        162   8e-42    
gb|KFM27905.1|  2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxonon...    164   8e-42    
ref|WP_002797335.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        162   8e-42    
gb|EPF21499.1|  Lipase 1 precursor                                      162   8e-42    
ref|WP_017720433.1|  hypothetical protein                               162   9e-42    
ref|WP_004268196.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        162   9e-42    
ref|WP_015955157.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        162   1e-41    
ref|WP_036832532.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        162   1e-41    
ref|WP_009631931.1|  putative hydrolase or acyltransferase of alp...    162   1e-41    
ref|WP_015184992.1|  alpha/beta hydrolase                               162   2e-41    
ref|WP_017310889.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        161   2e-41    
ref|WP_026788915.1|  MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dieno...    160   3e-41    
ref|WP_017746208.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        160   4e-41    
ref|WP_002745917.1|  alpha/beta hydrolase fold family protein           160   4e-41    
ref|WP_036022434.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        159   7e-41    
ref|WP_002794359.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        160   8e-41    
ref|WP_026736125.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        159   9e-41    
gb|KFB82328.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase             159   1e-40    
ref|WP_015155384.1|  alpha/beta fold family hydrolase                   159   1e-40    
gb|EKU98658.1|  putative hydrolase or acyltransferase of alpha/be...    159   1e-40    
ref|WP_035150545.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        159   2e-40    
ref|WP_026797143.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        159   2e-40    
ref|WP_017321765.1|  hypothetical protein                               159   2e-40    
ref|WP_006618162.1|  alpha/beta hydrolase fold protein                  158   2e-40    
ref|WP_011143822.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        158   3e-40    
ref|WP_002737806.1|  alpha/beta hydrolase fold family protein           158   3e-40    
ref|XP_004150995.1|  PREDICTED: uncharacterized protein LOC101210221    153   3e-40    
ref|WP_037220955.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        158   4e-40    
ref|WP_012306494.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        158   4e-40    
gb|KGN53681.1|  hypothetical protein Csa_4G102300                       152   5e-40    
ref|WP_021829970.1|  2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hy...    157   6e-40    
ref|WP_006624358.1|  MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dieno...    157   6e-40    
ref|WP_014276736.1|  putative 2-hydroxy-6-oxohepta-2,4-dienoate h...    157   7e-40    
ref|WP_006098677.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        157   7e-40    
ref|XP_004166688.1|  PREDICTED: uncharacterized protein LOC101227833    153   8e-40    
ref|WP_039717001.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        157   8e-40    
ref|WP_007305965.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        156   9e-40    
emb|CDP19863.1|  unnamed protein product                                151   1e-39    
ref|WP_011612530.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        156   1e-39    
ref|XP_002177000.1|  predicted protein                                  159   1e-39    
ref|WP_036005958.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        157   1e-39    
ref|WP_021832251.1|  2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hy...    156   1e-39    
ref|WP_018398865.1|  hypothetical protein                               156   1e-39    
ref|WP_036481539.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        155   2e-39    
ref|WP_022608535.1|  putative hydrolase or acyltransferase (alpha...    155   3e-39    
ref|WP_011143319.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        155   3e-39    
ref|WP_009628874.1|  alpha/beta hydrolase fold protein                  155   4e-39    
gb|KCW56284.1|  hypothetical protein EUGRSUZ_I02027                     149   4e-39    
ref|WP_011143051.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        155   4e-39    
ref|WP_017662818.1|  hypothetical protein                               154   8e-39    
ref|WP_013321718.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        153   2e-38    
ref|WP_012627387.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        152   4e-38    
ref|WP_015188447.1|  alpha/beta hydrolase fold protein                  152   5e-38    
ref|WP_012165464.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        151   8e-38    
ref|WP_026099742.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        150   1e-37    
ref|WP_015220151.1|  alpha/beta fold family hydrolase                   150   1e-37    
ref|WP_010477736.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        151   1e-37    
gb|EWM25946.1|  Alpha/beta hydrolase fold-1                             150   3e-37    
ref|WP_017304318.1|  hypothetical protein                               150   3e-37    
ref|WP_008277446.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        149   3e-37    
ref|WP_015182596.1|  alpha/beta hydrolase                               150   3e-37    
ref|WP_036531078.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        149   4e-37    
ref|WP_006455244.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        149   4e-37    
ref|XP_005783538.1|  hypothetical protein EMIHUDRAFT_434393             152   6e-37    
gb|KIE08054.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase             147   8e-37    
ref|WP_015223646.1|  alpha/beta fold family hydrolase                   147   1e-36    
ref|WP_017292381.1|  hypothetical protein                               147   2e-36    
ref|WP_012595084.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        147   2e-36    
gb|EHJ12249.1|  Alpha/beta hydrolase fold containing protein            143   1e-35    
ref|WP_015783835.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        145   1e-35    
ref|WP_011244126.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        144   2e-35    
ref|WP_015119740.1|  alpha/beta hydrolase                               144   3e-35    
ref|WP_006102445.1|  hydrolase, alpha/beta fold family protein          144   5e-35    
ref|WP_017328034.1|  hypothetical protein                               142   1e-34    
ref|WP_009544964.1|  MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dieno...    141   2e-34    
ref|WP_015133325.1|  alpha/beta fold family hydrolase                   139   1e-33    
ref|WP_011378388.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        139   2e-33    
gb|EJK73990.1|  hypothetical protein THAOC_04362                        141   3e-33    
ref|WP_008190446.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        133   1e-31    
dbj|BAM51266.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase            130   9e-31    
ref|WP_010872160.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        130   1e-30    
ref|XP_005534950.1|  similar to 2-hydroxy-6-oxohepta-2,4-dienoate...    130   8e-30    
ref|WP_038531141.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        128   9e-30    
gb|AIE75980.1|  putative alpha/beta hydrolase superfamily               128   1e-29    
ref|XP_008365518.1|  PREDICTED: uncharacterized protein LOC103429154    118   2e-27    
ref|WP_012408632.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase        120   2e-27    
ref|XP_005856033.1|  hypothetical protein NGA_0515200                   108   7e-23    
ref|XP_005784176.1|  hypothetical protein EMIHUDRAFT_231364             108   1e-22    
ref|XP_005788588.1|  hypothetical protein EMIHUDRAFT_440689             105   5e-21    
ref|WP_011132719.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      97.4    6e-19    
ref|WP_012195651.1|  alpha/beta hydrolase                             96.3    1e-18    
ref|WP_011820484.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      95.5    2e-18    
gb|AHF63376.1|  putative 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase  95.1    3e-18    
ref|WP_011127805.1|  alpha/beta hydrolase                             94.4    6e-18    
ref|WP_036910625.1|  MULTISPECIES: alpha/beta hydrolase               94.0    7e-18    
gb|KGG29597.1|  putative alpha/beta hydrolase                         94.0    8e-18    
ref|WP_006909623.1|  alpha/beta hydrolase                             93.6    1e-17    
ref|WP_036902653.1|  alpha/beta hydrolase                             93.6    1e-17    
ref|WP_032527488.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      92.8    2e-17    
ref|WP_038554291.1|  alpha/beta hydrolase                             92.8    2e-17    
ref|WP_011130435.1|  alpha/beta hydrolase                             92.8    2e-17    
ref|WP_025968125.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      92.0    4e-17    
ref|WP_025955882.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      92.0    4e-17    
ref|WP_027482331.1|  hydrolase                                        91.7    4e-17    
ref|WP_032519124.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      91.3    6e-17    
ref|WP_011364585.1|  alpha/beta hydrolase                             91.3    7e-17    
gb|AIQ95239.1|  putative alpha/beta hydrolase                         90.9    9e-17    
ref|WP_011825644.1|  alpha/beta hydrolase                             90.9    9e-17    
ref|WP_025933693.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      90.1    2e-16    
ref|WP_011818623.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      90.1    2e-16    
ref|WP_025924609.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      89.7    2e-16    
ref|WP_025923357.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      89.7    2e-16    
ref|WP_025932057.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      89.7    2e-16    
ref|WP_025881708.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      89.7    2e-16    
ref|WP_039359183.1|  hypothetical protein                             89.7    2e-16    
ref|WP_025972242.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      89.7    3e-16    
ref|WP_025928513.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      89.4    3e-16    
ref|XP_005784177.1|  hypothetical protein EMIHUDRAFT_231367           88.6    4e-16    
ref|WP_025922417.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      89.0    4e-16    
ref|WP_025894688.1|  MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dieno...  89.0    4e-16    
ref|WP_025935193.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      89.0    4e-16    
ref|WP_038655338.1|  alpha/beta hydrolase                             89.0    4e-16    
ref|WP_025979803.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      89.0    4e-16    
ref|WP_011824076.1|  alpha/beta hydrolase                             89.0    4e-16    
ref|WP_009365475.1|  alpha/beta hydrolase                             88.6    5e-16    
ref|WP_025946102.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      88.2    7e-16    
ref|WP_025906629.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      88.2    7e-16    
ref|WP_025927620.1|  MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dieno...  88.2    7e-16    
gb|AIQ97646.1|  putative alpha/beta hydrolase                         88.2    7e-16    
ref|WP_011863144.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      88.2    8e-16    
gb|KGG20034.1|  putative alpha/beta hydrolase                         88.2    8e-16    
ref|WP_036906694.1|  alpha/beta hydrolase                             87.8    8e-16    
ref|WP_025926672.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      88.2    8e-16    
ref|WP_025913638.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.8    8e-16    
gb|AII45532.1|  alpha/beta hydrolase                                  87.8    9e-16    
ref|WP_036909992.1|  alpha/beta hydrolase                             87.8    9e-16    
ref|WP_011360174.1|  alpha/beta hydrolase                             87.8    1e-15    
gb|KGG13950.1|  putative alpha/beta hydrolase                         87.8    1e-15    
ref|WP_025935958.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.8    1e-15    
ref|WP_011376647.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.8    1e-15    
ref|WP_036892276.1|  MULTISPECIES: alpha/beta hydrolase               87.4    1e-15    
ref|WP_025961279.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.4    1e-15    
ref|WP_011294751.1|  alpha/beta hydrolase                             87.4    1e-15    
ref|WP_032515107.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.4    1e-15    
ref|WP_025980538.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.4    1e-15    
ref|WP_011125261.1|  alpha/beta hydrolase                             87.4    1e-15    
ref|WP_025964863.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.4    1e-15    
ref|WP_025890949.1|  MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dieno...  87.4    1e-15    
ref|WP_036920339.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.4    1e-15    
ref|WP_011935203.1|  alpha/beta hydrolase                             87.0    1e-15    
ref|WP_036896896.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.0    2e-15    
ref|WP_025964343.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.0    2e-15    
ref|WP_028951830.1|  alpha/beta hydrolase                             87.0    2e-15    
ref|WP_025930511.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      87.0    2e-15    
gb|KGG03429.1|  putative alpha/beta hydrolase                         87.0    2e-15    
ref|WP_025891787.1|  MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dieno...  87.0    2e-15    
ref|WP_035833143.1|  alpha/beta hydrolase                             86.3    3e-15    
gb|KEF41120.1|  alpha/beta hydrolase                                  86.3    3e-15    
ref|WP_025939415.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      86.3    3e-15    
gb|EDX87024.1|  hydrolase, alpha/beta fold family protein             86.3    4e-15    
gb|EAQ74028.1|  putative 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase  85.9    4e-15    
ref|WP_032522605.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      85.9    4e-15    
ref|WP_019475850.1|  hypothetical protein                             85.5    5e-15    
ref|WP_032516686.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      85.9    5e-15    
ref|WP_038016641.1|  alpha/beta hydrolase                             85.9    5e-15    
ref|WP_025941829.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      85.1    6e-15    
ref|WP_037980319.1|  alpha/beta hydrolase                             85.1    7e-15    
ref|WP_011618959.1|  alpha/beta hydrolase                             83.6    1e-14    
ref|WP_011933440.1|  alpha/beta hydrolase                             84.0    1e-14    
ref|WP_032514243.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      83.6    2e-14    
ref|WP_035217406.1|  hypothetical protein                             82.8    3e-14    
ref|WP_012610697.1|  alpha/beta hydrolase fold protein                83.2    3e-14    
gb|KGF93639.1|  putative alpha/beta hydrolase                         83.2    3e-14    
ref|WP_006054366.1|  alpha/beta hydrolase                             82.8    4e-14    
ref|WP_015230897.1|  alpha/beta hydrolase                             82.8    4e-14    
gb|EHA63136.1|  alpha/beta hydrolase fold protein                     82.4    6e-14    
ref|WP_038013576.1|  alpha/beta hydrolase                             82.0    6e-14    
ref|XP_008452066.1|  PREDICTED: pheophytinase, chloroplastic isof...  82.8    6e-14    
gb|KDO37343.1|  hypothetical protein CISIN_1g037210mg                 77.4    1e-13    
ref|WP_009789543.1|  alpha/beta hydrolase                             81.3    1e-13    
ref|WP_034352966.1|  hydrolase                                        81.3    1e-13    
ref|WP_036482122.1|  alpha/beta hydrolase                             81.3    1e-13    
ref|WP_026672128.1|  hydrolase                                        80.1    2e-13    
ref|WP_025914742.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      80.5    2e-13    
ref|WP_039728732.1|  alpha/beta hydrolase                             80.5    3e-13    
ref|WP_010303532.1|  alpha/beta hydrolase                             80.1    3e-13    
ref|WP_032524591.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      80.1    3e-13    
ref|WP_032125533.1|  hypothetical protein                             79.3    5e-13    
ref|WP_017719587.1|  alpha/beta hydrolase                             79.3    5e-13    
ref|WP_019587859.1|  hypothetical protein                             79.0    8e-13    
gb|KHG23301.1|  2-hydroxymuconic semialdehyde hydrolase               80.1    8e-13    
ref|WP_015132795.1|  alpha/beta fold family hydrolase                 78.6    1e-12    
ref|XP_011011738.1|  PREDICTED: pheophytinase, chloroplastic          79.7    1e-12    
ref|WP_036531515.1|  alpha/beta hydrolase                             78.6    1e-12    
ref|WP_002807632.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      78.2    1e-12    
gb|KGF73397.1|  alpha/beta hydrolase                                  78.2    1e-12    
ref|WP_015228700.1|  alpha/beta hydrolase                             78.2    1e-12    
ref|XP_010531046.1|  PREDICTED: pheophytinase, chloroplastic          79.0    2e-12    
ref|WP_036946910.1|  alpha/beta hydrolase                             77.8    2e-12    
ref|WP_015125161.1|  alpha/beta hydrolase                             77.8    2e-12    
ref|XP_002890024.1|  hypothetical protein ARALYDRAFT_334678           75.1    2e-12    
ref|XP_007046891.1|  Alpha/beta-Hydrolases superfamily protein        78.6    2e-12    
ref|WP_011429396.1|  alpha/beta hydrolase                             77.8    2e-12    
ref|XP_006425649.1|  hypothetical protein CICLE_v10025882mg           77.4    2e-12    
ref|XP_006466818.1|  PREDICTED: bifunctional epoxide hydrolase 2-...  77.4    2e-12    
ref|WP_015224473.1|  alpha/beta fold family hydrolase                 77.4    3e-12    
ref|WP_014803895.1|  alpha/beta hydrolase fold containing protein     77.4    3e-12    
ref|WP_006105341.1|  alpha/beta hydrolase                             77.0    3e-12    
ref|WP_006519669.1|  putative hydrolase or acyltransferase of alp...  77.0    3e-12    
ref|WP_011433031.1|  alpha/beta hydrolase                             77.4    3e-12    
gb|ESA33699.1|  alpha beta hydrolase                                  77.4    3e-12    
ref|WP_035139542.1|  alpha/beta hydrolase                             76.6    4e-12    
ref|WP_006635765.1|  alpha/beta hydrolase                             77.0    4e-12    
ref|WP_031293859.1|  alpha/beta hydrolase                             77.0    4e-12    
gb|ABK96091.1|  unknown                                               77.8    4e-12    
ref|XP_006383178.1|  hydrolase family protein                         77.4    5e-12    
ref|WP_019502484.1|  hypothetical protein                             76.6    5e-12    
ref|WP_006099021.1|  alpha/beta hydrolase                             76.6    6e-12    
gb|KDO70956.1|  hypothetical protein CISIN_1g017361mg                 77.4    6e-12    
ref|XP_006425650.1|  hypothetical protein CICLE_v10025882mg           77.4    6e-12    
ref|XP_008452064.1|  PREDICTED: pheophytinase, chloroplastic isof...  77.4    6e-12    
ref|XP_006599374.1|  PREDICTED: epoxide hydrolase 3-like isoform X2   76.6    7e-12    
ref|WP_012007911.1|  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase      75.9    7e-12    
ref|WP_015177980.1|  alpha/beta hydrolase fold protein                75.9    7e-12    
ref|WP_023586687.1|  hydrolase                                        76.3    8e-12    
gb|KEH20426.1|  alpha/beta fold hydrolase                             77.0    8e-12    
ref|XP_006466817.1|  PREDICTED: bifunctional epoxide hydrolase 2-...  77.0    8e-12    
ref|WP_036917933.1|  MULTISPECIES: alpha/beta hydrolase               75.9    8e-12    
ref|XP_007156062.1|  hypothetical protein PHAVU_003G255100g           76.6    9e-12    
ref|WP_007540307.1|  hypothetical protein                             75.9    9e-12    
ref|WP_033365608.1|  alpha/beta hydrolase                             75.5    9e-12    
ref|WP_030006811.1|  alpha/beta hydrolase                             75.5    9e-12    
ref|WP_012305663.1|  alpha/beta hydrolase                             75.9    1e-11    
ref|WP_018633843.1|  2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hy...  75.1    1e-11    
ref|WP_039192240.1|  hypothetical protein                             74.7    1e-11    
ref|XP_003547979.1|  PREDICTED: epoxide hydrolase 3-like isoform X1   76.3    1e-11    
ref|WP_016874915.1|  hypothetical protein                             75.1    1e-11    
ref|WP_016908908.1|  hypothetical protein                             74.7    2e-11    
gb|KHN11109.1|  Putative hydrolase yugF                               75.9    2e-11    
gb|AFK41677.1|  unknown                                               75.5    2e-11    
gb|ETK31186.1|  hydrolase                                             74.7    2e-11    
ref|XP_007204516.1|  hypothetical protein PRUPE_ppa018291mg           75.5    2e-11    
ref|XP_010113484.1|  hypothetical protein L484_026818                 75.5    2e-11    
ref|XP_004146511.1|  PREDICTED: uncharacterized hydrolase YugF-like   75.5    2e-11    
ref|WP_036332824.1|  hydrolase                                        74.3    2e-11    
ref|WP_039715274.1|  alpha/beta hydrolase                             74.3    2e-11    
ref|WP_018399872.1|  hypothetical protein                             74.3    2e-11    
ref|WP_030207170.1|  hydrolase                                        74.7    3e-11    
ref|WP_006041706.1|  alpha/beta hydrolase                             74.3    3e-11    
ref|WP_004926043.1|  hydrolase                                        74.3    3e-11    



>emb|CDP02313.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   479 bits (1234),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 229/296 (77%), Positives = 257/296 (87%), Gaps = 0/296 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV EIKDPFAR+LA+RIQRLPV+VGFSES IMSSC+KP  Q D +PVVLLHCF
Sbjct  45    FPSFLPKEVKEIKDPFARTLAQRIQRLPVKVGFSESCIMSSCVKPRFQHDTDPVVLLHCF  104

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLED  +E WAIDILGWGFSDLER P CDAASKRYHLYQLW+++IKRP
Sbjct  105   DSSCLEWRCTYPLLEDAALETWAIDILGWGFSDLERLPPCDAASKRYHLYQLWRTHIKRP  164

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAIDFAVNFPEAV KL+LINASVY EGTG +TKLPK +AY GVSLLKS+
Sbjct  165   MILVGPSLGAAVAIDFAVNFPEAVEKLILINASVYAEGTGLLTKLPKFLAYAGVSLLKSL  224

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  FD + LS   DW NVGRLHCLLPWWEDA VN+MLSGGYNVV+QIK+VN++
Sbjct  225   PLRLYANLLAFDDIPLSKCFDWANVGRLHCLLPWWEDATVNYMLSGGYNVVNQIKQVNKK  284

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
              LVI G  D +V+++LAMRL  ELP+A VHQIP+ GHLPHVE+P  VA+LIADFAR
Sbjct  285   VLVIWGECDNIVNSKLAMRLHGELPDASVHQIPDCGHLPHVEKPEIVARLIADFAR  340



>ref|XP_007032740.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY03666.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=342

 Score =   465 bits (1196),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 216/298 (72%), Positives = 257/298 (86%), Gaps = 0/298 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V +IKDPFAR+LARRI+RLPVQ+  S+S IMSSC++P+IQ D  PVVLLHCF
Sbjct  45    FPSFLPKQVEKIKDPFARNLARRIKRLPVQIECSDSFIMSSCVQPLIQRDANPVVLLHCF  104

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWRR YPLLE++G+EAWAID+LGWGFSDL R P C+ ASKRYHLYQLW SYIKRP
Sbjct  105   DSSCLEWRRAYPLLEESGLEAWAIDVLGWGFSDLGRLPPCNVASKRYHLYQLWNSYIKRP  164

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVAIDFAVN+PEAV KLVLIN SVY EGTG + KLP++VAY GVSLLK+ 
Sbjct  165   VVLVGPSLGAAVAIDFAVNYPEAVKKLVLINPSVYAEGTGNLAKLPRVVAYAGVSLLKTF  224

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  F+G+SLS +LDWTNVGRLHC +PWW+DA VNFM+SGGYNVV QIK+V Q+
Sbjct  225   PLRLYANLLAFNGISLSRSLDWTNVGRLHCHMPWWKDATVNFMVSGGYNVVSQIKQVKQK  284

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             TL+I G  D++VSN+LAMRL  ELP A + ++P+SGHLPHVE+P  V KLIADFA+ +
Sbjct  285   TLLICGENDRIVSNQLAMRLLFELPKARMQRVPDSGHLPHVEKPRRVVKLIADFAQSN  342



>ref|XP_010660624.1| PREDICTED: monoacylglycerol lipase ABHD6 [Vitis vinifera]
Length=368

 Score =   460 bits (1184),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 220/306 (72%), Positives = 260/306 (85%), Gaps = 2/306 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V +IKDPFARSLA+RIQRLPVQ+G S S IMSSC+KPVI+ +  PVVLLHCF
Sbjct  42    FPSFLPKQVEKIKDPFARSLAQRIQRLPVQIGSSGSCIMSSCVKPVIRSNSNPVVLLHCF  101

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+EAWA+D+LGWGFSDLER P CD ASKR+HLYQLWKS+IKRP
Sbjct  102   DSSCLEWRCTYPLLEEAGLEAWAVDVLGWGFSDLERLPPCDVASKRHHLYQLWKSHIKRP  161

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVGPSLGAAVAIDFAVN+PEAV KLVLI ASVY EGTG ++KL + +AY GVSLLKS 
Sbjct  162   VILVGPSLGAAVAIDFAVNYPEAVEKLVLIGASVYAEGTGNLSKLYRPLAYAGVSLLKSF  221

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+ + L  +  +S +T+ DWTNVG LHCLLPWWEDA VNFM SGGYNV+ QIK+V Q+
Sbjct  222   PLRLCSNLLAYKSISFATSFDWTNVGLLHCLLPWWEDATVNFMKSGGYNVIAQIKQVKQK  281

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TLVI G  D++VSN+LAMRL  EL +AI+H IP+ GHLPH+E+P+SVAKLIADFA+GD  
Sbjct  282   TLVIWGEHDQIVSNKLAMRLQHELQDAIMHHIPDCGHLPHLEKPNSVAKLIADFAQGDR-  340

Query  300   TCVESY  283
              C E++
Sbjct  341   -CQEAH  345



>gb|EYU34607.1| hypothetical protein MIMGU_mgv1a008929mg [Erythranthe guttata]
Length=358

 Score =   455 bits (1171),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 210/296 (71%), Positives = 251/296 (85%), Gaps = 0/296 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV++I+DP AR+LA+RIQRLPV+VGFSESSIMSSC+ P ++ D  PVVLLHCF
Sbjct  38    FPSFLPKEVYKIRDPSARTLAQRIQRLPVKVGFSESSIMSSCVTPKVRRDSNPVVLLHCF  97

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLED G+EAWA+DILGWGFSDLERRP C+ ASKRYHLYQLWKS+IKRP
Sbjct  98    DSSCLEWRSAYPLLEDAGLEAWAVDILGWGFSDLERRPPCNVASKRYHLYQLWKSHIKRP  157

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAA AIDFAVNFPEAV KL+LINA+VY  GTG +TKLP ++AY   S+LKSI
Sbjct  158   MILVGPSLGAAAAIDFAVNFPEAVDKLILINANVYANGTGVLTKLPTLMAYAMASVLKSI  217

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             P+R YAKL  F+G+SLS  LD+T+VGRLHCL+PWWEDA VNFM SGGYNV  QIKKV Q+
Sbjct  218   PIRWYAKLLVFNGISLSKMLDYTDVGRLHCLMPWWEDATVNFMQSGGYNVTGQIKKVKQK  277

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             TL+I+   D +V ++ A RL  ELPNA V ++P  GH+PH+E+P+ +A+LIA+FA+
Sbjct  278   TLLISSECDNIVDSKFAERLKNELPNASVRKVPECGHMPHIEKPYLIARLIAEFAQ  333



>ref|XP_007217738.1| hypothetical protein PRUPE_ppa007817mg [Prunus persica]
 gb|EMJ18937.1| hypothetical protein PRUPE_ppa007817mg [Prunus persica]
Length=354

 Score =   454 bits (1167),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 216/298 (72%), Positives = 250/298 (84%), Gaps = 0/298 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDP+AR+LA+R++RLPVQ+G SES IMSSC+KP  Q +  PVVLLHCF
Sbjct  55    FPSFLPKEVEKIKDPYARTLAQRMERLPVQIGSSESFIMSSCVKPQKQSEINPVVLLHCF  114

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE+ G+EAWA+D+LGWGFSDLERRP C AASKR+HLYQ WKSYI+RP
Sbjct  115   DSSCLEWRCAYPLLEEAGLEAWAVDVLGWGFSDLERRPPCSAASKRHHLYQFWKSYIRRP  174

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGA+VAIDFAV+ P AV KLVLINASVY EGTG + KLPK +AY GVSLLKSI
Sbjct  175   MILVGPSLGASVAIDFAVHHPVAVEKLVLINASVYAEGTGDLAKLPKFLAYAGVSLLKSI  234

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  F+G+SLSTT DWTNVGRLHCLLPWW+DA V+FM SGGYNV+ QIK+V Q+
Sbjct  235   PLRLYANLLAFNGISLSTTFDWTNVGRLHCLLPWWKDATVSFMSSGGYNVISQIKQVKQK  294

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              LVI   +D ++S +  +RL  ELP AI+  IP+SGHLPHVE P SVAKLIA FAR D
Sbjct  295   VLVICSEQDHIISYKQILRLRCELPCAIMRLIPDSGHLPHVENPTSVAKLIAGFARND  352



>ref|XP_003607803.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago 
truncatula]
 gb|AES90000.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=331

 Score =   451 bits (1159),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 245/301 (81%), Gaps = 0/301 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V+ IKDPFAR+LA RIQRLPV V FSE+ IMSSC+KP++Q  + P+VLLH F
Sbjct  23    FPSFLPKDVNRIKDPFARTLATRIQRLPVSVKFSENPIMSSCVKPLVQNKENPIVLLHGF  82

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WAIDILGWGFSDLE+ P+CD  SKR H YQ WKSYIK+P
Sbjct  83    DSSCLEWRYTYPLLEEAGIETWAIDILGWGFSDLEKLPSCDVVSKREHFYQFWKSYIKKP  142

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG+AVAIDFA+N+PEAV KLVLI+ASVY EGTG +  LP+  AY GV LLKS+
Sbjct  143   MILVGPSLGSAVAIDFAINYPEAVEKLVLIDASVYTEGTGNLATLPRAAAYAGVYLLKSV  202

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F  +S ST+LDWTN+GRLHCLLPWWEDA VNFM SGGYNV  QIK V Q+
Sbjct  203   PLRVYANYLSFTNISFSTSLDWTNIGRLHCLLPWWEDAAVNFMTSGGYNVASQIKMVKQK  262

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+LA++L  ELP+AI+ QIP+ GHLPHVE P SV KLI +F + D  
Sbjct  263   TLIIWGENDRIISNKLAVQLHCELPDAIIRQIPDCGHLPHVERPDSVVKLIKEFVQKDTK  322

Query  300   T  298
             T
Sbjct  323   T  323



>ref|XP_004505362.1| PREDICTED: uncharacterized hydrolase YugF-like [Cicer arietinum]
Length=329

 Score =   449 bits (1155),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 213/308 (69%), Positives = 246/308 (80%), Gaps = 3/308 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V+ IKDPFARSLA RIQRLPV V FSE+ IMSSC+KP++Q    PVVLLH F
Sbjct  21    FPSFLPKDVNRIKDPFARSLATRIQRLPVSVKFSENPIMSSCVKPLMQNKANPVVLLHGF  80

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WAIDILGWGFSDL + P+CD  SKR H YQ WKSYIKR 
Sbjct  81    DSSCLEWRYTYPLLEEAGLETWAIDILGWGFSDLAKLPSCDVVSKREHFYQFWKSYIKRA  140

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG+AVAIDFAVN+PEAV KLVLI+ASVY EGTG +  LP+ +AY GV LLKSI
Sbjct  141   MILVGPSLGSAVAIDFAVNYPEAVEKLVLIDASVYAEGTGNLATLPRAIAYAGVYLLKSI  200

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             P+RIYA    F  +S ST+LDWTN+GRLHCLLPWWEDA VNFM+SGGYNV  QIK V Q+
Sbjct  201   PIRIYANYLSFTNISFSTSLDWTNIGRLHCLLPWWEDAAVNFMISGGYNVASQIKMVKQK  260

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+LA+RL  ELP +I+ QIP+ GHLPHVE P SV KLI +F + D  
Sbjct  261   TLIIWGENDQIISNKLAVRLHCELPESIIRQIPDCGHLPHVERPDSVVKLIEEFVQKDTK  320

Query  300   T---CVES  286
             T   CV S
Sbjct  321   TVNQCVPS  328



>ref|XP_009365964.1| PREDICTED: uncharacterized protein LOC103955788 [Pyrus x bretschneideri]
Length=343

 Score =   446 bits (1148),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 211/298 (71%), Positives = 247/298 (83%), Gaps = 0/298 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FPLFLPKEV +IKDP+AR+LARR++RLPV +G SES IMSSC++P+ Q +  PVVLLHCF
Sbjct  44    FPLFLPKEVEKIKDPYARTLARRMERLPVPIGSSESCIMSSCVRPLKQSEINPVVLLHCF  103

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE+ G+EAWA+D+LGWGFSDLERRP C AASKR HLYQ WKSYI+RP
Sbjct  104   DSSCLEWRCVYPLLEEAGLEAWAVDVLGWGFSDLERRPPCSAASKRDHLYQFWKSYIRRP  163

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG +VAIDFA ++P AV KLVLINASVY EGTG M KLPK VAY GVSLLKS 
Sbjct  164   MILVGPSLGGSVAIDFAYHYPVAVEKLVLINASVYAEGTGEMAKLPKAVAYAGVSLLKST  223

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA +  F+G+SL+TT DWTNVGRLHCL PWW+DA V+FM SGGYNV+ QIK+V Q+
Sbjct  224   PLRFYANMLAFNGISLATTFDWTNVGRLHCLQPWWKDATVSFMTSGGYNVISQIKQVKQK  283

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              LVI   +D ++S +  +RL  ELP AI+  IP++GHLPHVE P SVAKLIA+FAR D
Sbjct  284   VLVICSEQDNIISYKQILRLRCELPFAIMRLIPDTGHLPHVENPTSVAKLIAEFARND  341



>ref|XP_002315003.1| hydrolase family protein [Populus trichocarpa]
 gb|EEF01174.1| hydrolase family protein [Populus trichocarpa]
Length=335

 Score =   443 bits (1140),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 210/309 (68%), Positives = 252/309 (82%), Gaps = 2/309 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  IKDPFAR LA RI+RLPV  GF++ SIMSSC+KP+IQ +  PVVLLH F
Sbjct  29    FPSFLPKEVENIKDPFARRLATRIERLPV--GFADRSIMSSCVKPLIQSEGSPVVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T+PLLE+ G+E WA+D+LGWGFSDLER P+CD ASKR HLYQLWKSYI+RP
Sbjct  87    DSSCLEWRYTFPLLEEAGLETWAVDVLGWGFSDLERLPSCDVASKRDHLYQLWKSYIRRP  146

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +IL+GPSLGAAVAIDFAVN PEAV KLVLI+ASVY E TG + KLP+ +AY GV LLKS 
Sbjct  147   IILIGPSLGAAVAIDFAVNHPEAVEKLVLIDASVYAEDTGNLAKLPRAIAYAGVYLLKST  206

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  F+ L L+T++DW NVGRLHCL PWWEDA VNFM +GGYNV  QIKKV Q+
Sbjct  207   PLRLYANLIAFNSLPLNTSIDWMNVGRLHCLYPWWEDATVNFMNTGGYNVSAQIKKVKQK  266

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+LA+RL  ELP+A++ QIP+ GHLPHVE+P+SVAKLI DF   D +
Sbjct  267   TLIIWGEDDQIISNKLAVRLHCELPDAVIRQIPDCGHLPHVEKPNSVAKLILDFVGEDSN  326

Query  300   TCVESYCKI  274
                +S  ++
Sbjct  327   KEAQSVSQV  335



>ref|XP_011012018.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Populus 
euphratica]
Length=344

 Score =   444 bits (1141),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 208/300 (69%), Positives = 246/300 (82%), Gaps = 0/300 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  IKDPFAR LA RI+RLPV VGF++ SIMSSC+KP+IQ +  PVVLLH F
Sbjct  29    FPSFLPKEVENIKDPFARRLATRIERLPVSVGFADRSIMSSCVKPLIQSEGSPVVLLHGF  88

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T+PLLE+ G+E WA+D+LGWGFSDLER P+CD ASKR HLYQLWKSYI+RP
Sbjct  89    DSSCLEWRYTFPLLEEAGIETWAVDVLGWGFSDLERLPSCDVASKRDHLYQLWKSYIRRP  148

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +IL+GPSLGAAVAIDFAVN PEAV KLVLI+ASVY E TG + KLP+ +AY GV LLKS 
Sbjct  149   IILIGPSLGAAVAIDFAVNHPEAVEKLVLIDASVYAEDTGNLAKLPRAIAYAGVYLLKST  208

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y  L  F+ L L+T++DW NVGRLHCL PWWEDA VNFM  GGYNV  QIKKV Q+
Sbjct  209   PLRLYVNLIAFNSLPLNTSIDWMNVGRLHCLYPWWEDATVNFMNCGGYNVSAQIKKVKQK  268

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+LA+RL  ELP+AI+ QIP+ GH+PHVE+P+SVA LI DF   D +
Sbjct  269   TLIIWGEDDQIISNKLAVRLHCELPDAIIRQIPDCGHIPHVEKPNSVANLILDFLGEDSN  328



>ref|XP_009360520.1| PREDICTED: uncharacterized protein LOC103950980 [Pyrus x bretschneideri]
Length=342

 Score =   440 bits (1131),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 208/297 (70%), Positives = 244/297 (82%), Gaps = 0/297 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDP+AR LA+R++RLPV +G SES IMSSC++P  Q +  PVVLLHCF
Sbjct  43    FPSFLPKEVEKIKDPYARKLAQRMERLPVSIGSSESYIMSSCVRPPKQSEINPVVLLHCF  102

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE+ G+EAWA+D+LGWGFSDLER P C AASKR+HLYQ WKSYI+RP
Sbjct  103   DSSCLEWRCAYPLLEEAGLEAWAVDVLGWGFSDLERCPPCSAASKRHHLYQFWKSYIRRP  162

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG +VAIDFA ++P AV KLVLINASVY EGTG M KLPK VAY GVSLLKS 
Sbjct  163   MVLVGPSLGGSVAIDFAYHYPVAVEKLVLINASVYAEGTGDMAKLPKAVAYAGVSLLKST  222

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA +  F+G+SL+TT DWTNVGRLHCLLPWW+DA V+FM SGGYNVV QIK+V Q+
Sbjct  223   PLRFYANMLAFNGISLATTFDWTNVGRLHCLLPWWKDATVSFMTSGGYNVVSQIKQVKQK  282

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
              LVI   +D ++S +  +RL  ELP+AI+  IP+SGHLPHV+ P SVAKLIA FAR 
Sbjct  283   VLVICSEQDNIISYKQILRLRCELPSAIMRLIPDSGHLPHVDNPASVAKLIARFARN  339



>ref|XP_011009403.1| PREDICTED: monoacylglycerol lipase ABHD6 [Populus euphratica]
Length=360

 Score =   440 bits (1132),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 251/300 (84%), Gaps = 2/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE--PVVLLH  1027
             FP FLPKEV +IKDPFARSLA+RI+RLPVQ+G+S+S IMSSC+KP+ +   +  PVVLLH
Sbjct  42    FPSFLPKEVEKIKDPFARSLAKRIERLPVQMGYSKSCIMSSCVKPLFRQSNKTTPVVLLH  101

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIK  847
             CFDSSCLEWR T PLLE+ G+EAWAID+LGWGFSDLE RP CD ASKR+HLYQLWKS+I+
Sbjct  102   CFDSSCLEWRCTLPLLEEAGLEAWAIDVLGWGFSDLETRPPCDMASKRHHLYQLWKSHIR  161

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             RPMILVGPSLGA+VAIDF V++PEAV KLVLIN SVY EGTG + KLP+ VAY GVSLLK
Sbjct  162   RPMILVGPSLGASVAIDFTVHYPEAVEKLVLINPSVYAEGTGHLAKLPESVAYAGVSLLK  221

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVN  487
             S+PLR+YA +  F+ +   T LDWTNVGRLHCLLPWW+DA V+FMLSGGYNV+ QIK+V 
Sbjct  222   SVPLRLYANMLAFNSIPFLTILDWTNVGRLHCLLPWWKDATVSFMLSGGYNVISQIKQVK  281

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              +TL+I G +D++VS +L ++L  EL NAI+ ++ +SGHLPHV+ P  VAKLIA+FA  D
Sbjct  282   HKTLIICGEKDQIVSYKLVVKLHSELSNAIIREVYDSGHLPHVDNPKWVAKLIANFAEDD  341



>ref|XP_011085690.1| PREDICTED: uncharacterized protein LOC105167616 isoform X1 [Sesamum 
indicum]
Length=363

 Score =   440 bits (1132),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/291 (73%), Positives = 241/291 (83%), Gaps = 0/291 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEVH I+DP ARSLA+RIQRLPVQVGFSES IMSSC+ P +  D  PVVLLHCF
Sbjct  42    FPSFLPKEVHNIRDPSARSLAQRIQRLPVQVGFSESCIMSSCVTPRVCRDANPVVLLHCF  101

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLED G+EAWAIDILGWGFSDLERRP C+ ASKR HLYQLWKS+I RP
Sbjct  102   DSSCLEWRSAYPLLEDAGLEAWAIDILGWGFSDLERRPPCNVASKRNHLYQLWKSHIGRP  161

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M LVGPSLGAAVAIDF VNFPEAV KLVLINA+VY +GTG ++ LPK +AY   SLLKSI
Sbjct  162   MTLVGPSLGAAVAIDFTVNFPEAVDKLVLINANVYAKGTGVLSNLPKSMAYPMASLLKSI  221

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             P+R YAKL  F+G+SLS  +D+TNVGRLHCLLPWWEDA VNFMLSGGYNV  QIK V Q+
Sbjct  222   PMRWYAKLLIFNGISLSRIVDYTNVGRLHCLLPWWEDATVNFMLSGGYNVAGQIKHVRQK  281

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLI  328
              L+I   RD +VSN+LA RL  ELPNA + ++ + GH+PH+E+P+ +AKLI
Sbjct  282   ALLICSERDNIVSNKLAERLHNELPNASMRKVADCGHMPHIEKPYVIAKLI  332



>ref|XP_002306073.2| hypothetical protein POPTR_0004s11910g [Populus trichocarpa]
 gb|EEE86584.2| hypothetical protein POPTR_0004s11910g [Populus trichocarpa]
Length=360

 Score =   440 bits (1131),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 210/310 (68%), Positives = 253/310 (82%), Gaps = 3/310 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE--PVVLLH  1027
             FP FLPKEV  IKDPFARSLA+RI+RLPVQ+G+S+S IMSSC+KP+I+   +  PVVLLH
Sbjct  42    FPSFLPKEVERIKDPFARSLAKRIERLPVQIGYSKSCIMSSCVKPLIRQSNKTTPVVLLH  101

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIK  847
             CFDSSCLEWR T PLLE+ G+EAWAID+LGWGFSDLE RP CD ASKR HLYQLWKS+I+
Sbjct  102   CFDSSCLEWRCTLPLLEEAGLEAWAIDVLGWGFSDLETRPPCDMASKRDHLYQLWKSHIR  161

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             RPMILVGPSLGA+VAIDF V +PEAV KLVLIN SVY EGTG + KLP+ VAY GVSLLK
Sbjct  162   RPMILVGPSLGASVAIDFTVRYPEAVEKLVLINPSVYAEGTGHLAKLPESVAYAGVSLLK  221

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVN  487
             S+PLR+YA +  F+ +   T LDWTNVGRLHCLLPWW+DA V+FMLSGGYNV+ QIK+V 
Sbjct  222   SLPLRLYANMLAFNNIPFLTILDWTNVGRLHCLLPWWKDATVSFMLSGGYNVISQIKQVK  281

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              +TL+I G +D++VS +L ++L  EL NAI+ ++ +SGHLPHV+ P  VAKLIA+FA  D
Sbjct  282   HKTLIICGEKDQIVSYKLVVKLHSELSNAIIREVYDSGHLPHVDNPKWVAKLIANFAEDD  341

Query  306   EDTCVES-YC  280
                  +S +C
Sbjct  342   AGVDAKSPFC  351



>ref|XP_009356390.1| PREDICTED: epoxide hydrolase 3 [Pyrus x bretschneideri]
Length=338

 Score =   438 bits (1126),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 206/309 (67%), Positives = 250/309 (81%), Gaps = 2/309 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDPFAR LA RI+RLPV   F E+S+MSSC+KP++Q +  PVVLLH F
Sbjct  32    FPSFLPKEVEKIKDPFARKLAARIERLPV--SFGENSVMSSCVKPLVQSETSPVVLLHGF  89

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P C+  SKR H YQLWKSYIKRP
Sbjct  90    DSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPPCNVVSKREHFYQLWKSYIKRP  149

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAIDFAV+ PEAV +LVL++ASVY EGTG +  +PKM+AY GV +LKS+
Sbjct  150   MILVGPSLGAAVAIDFAVSHPEAVERLVLVDASVYTEGTGNLATMPKMLAYAGVYILKSL  209

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLRIYA    F G+SL+T+LDWTN+GRLHCL PWWEDA V+FM+SGGYNV  QI++V QR
Sbjct  210   PLRIYANFLSFSGISLATSLDWTNIGRLHCLFPWWEDAAVDFMMSGGYNVSAQIEQVKQR  269

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++S++L +RL  ELPNAI+ QIP  GHLPHVE+  SVAKLI +F + D+ 
Sbjct  270   TLIIWGEDDQIISSKLGVRLHCELPNAILRQIPECGHLPHVEKASSVAKLIVEFFQQDQY  329

Query  300   TCVESYCKI  274
               V+   ++
Sbjct  330   KEVQCISQV  338



>ref|XP_011012036.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X3 [Populus 
euphratica]
Length=335

 Score =   436 bits (1122),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 245/300 (82%), Gaps = 2/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  IKDPFAR LA RI+RLPV  GF++ SIMSSC+KP+IQ +  PVVLLH F
Sbjct  29    FPSFLPKEVENIKDPFARRLATRIERLPV--GFADRSIMSSCVKPLIQSEGSPVVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T+PLLE+ G+E WA+D+LGWGFSDLER P+CD ASKR HLYQLWKSYI+RP
Sbjct  87    DSSCLEWRYTFPLLEEAGIETWAVDVLGWGFSDLERLPSCDVASKRDHLYQLWKSYIRRP  146

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +IL+GPSLGAAVAIDFAVN PEAV KLVLI+ASVY E TG + KLP+ +AY GV LLKS 
Sbjct  147   IILIGPSLGAAVAIDFAVNHPEAVEKLVLIDASVYAEDTGNLAKLPRAIAYAGVYLLKST  206

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y  L  F+ L L+T++DW NVGRLHCL PWWEDA VNFM  GGYNV  QIKKV Q+
Sbjct  207   PLRLYVNLIAFNSLPLNTSIDWMNVGRLHCLYPWWEDATVNFMNCGGYNVSAQIKKVKQK  266

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+LA+RL  ELP+AI+ QIP+ GH+PHVE+P+SVA LI DF   D +
Sbjct  267   TLIIWGEDDQIISNKLAVRLHCELPDAIIRQIPDCGHIPHVEKPNSVANLILDFLGEDSN  326



>ref|XP_011012026.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X2 [Populus 
euphratica]
Length=342

 Score =   437 bits (1123),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 245/300 (82%), Gaps = 2/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  IKDPFAR LA RI+RLPV  GF++ SIMSSC+KP+IQ +  PVVLLH F
Sbjct  29    FPSFLPKEVENIKDPFARRLATRIERLPV--GFADRSIMSSCVKPLIQSEGSPVVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T+PLLE+ G+E WA+D+LGWGFSDLER P+CD ASKR HLYQLWKSYI+RP
Sbjct  87    DSSCLEWRYTFPLLEEAGIETWAVDVLGWGFSDLERLPSCDVASKRDHLYQLWKSYIRRP  146

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +IL+GPSLGAAVAIDFAVN PEAV KLVLI+ASVY E TG + KLP+ +AY GV LLKS 
Sbjct  147   IILIGPSLGAAVAIDFAVNHPEAVEKLVLIDASVYAEDTGNLAKLPRAIAYAGVYLLKST  206

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y  L  F+ L L+T++DW NVGRLHCL PWWEDA VNFM  GGYNV  QIKKV Q+
Sbjct  207   PLRLYVNLIAFNSLPLNTSIDWMNVGRLHCLYPWWEDATVNFMNCGGYNVSAQIKKVKQK  266

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+LA+RL  ELP+AI+ QIP+ GH+PHVE+P+SVA LI DF   D +
Sbjct  267   TLIIWGEDDQIISNKLAVRLHCELPDAIIRQIPDCGHIPHVEKPNSVANLILDFLGEDSN  326



>ref|XP_007224008.1| hypothetical protein PRUPE_ppa014966mg [Prunus persica]
 gb|EMJ25207.1| hypothetical protein PRUPE_ppa014966mg [Prunus persica]
Length=336

 Score =   436 bits (1121),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 201/299 (67%), Positives = 246/299 (82%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDPFAR LA RI+RLPV   F E+ +MSSC+KP++Q +  PVVLLH F
Sbjct  30    FPSFLPKEVEKIKDPFARKLAARIERLPV--SFGENCVMSSCVKPLVQSNTSPVVLLHGF  87

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P+C+ ASKR H +QLW+SYIK+P
Sbjct  88    DSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPSCNVASKRDHFFQLWESYIKKP  147

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAIDFAV+ PEAV +LVLI+ASVY EGTG +  +PKM+AY GVSLLKS+
Sbjct  148   MILVGPSLGAAVAIDFAVSHPEAVERLVLIDASVYTEGTGDLASMPKMLAYAGVSLLKSL  207

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR Y    CF G+SLST LDW NVGRLHCL PWWEDA V+FM+SGGYNV  QI++V Q+
Sbjct  208   PLRFYVNFLCFSGISLSTNLDWANVGRLHCLFPWWEDATVDFMMSGGYNVSAQIEQVKQK  267

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++S++L +RL  ELPNA++ QIP+ GH+PHVE+P SVAK+I +  + D+
Sbjct  268   TLIIWGEDDQIISSKLGVRLHCELPNAVIRQIPDCGHIPHVEKPSSVAKMIVELVQQDQ  326



>ref|XP_003556692.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Glycine 
max]
 gb|KHN20518.1| Putative hydrolase yugF [Glycine soja]
Length=346

 Score =   436 bits (1121),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 239/301 (79%), Gaps = 0/301 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEVH IKDPFAR+LA RI RLPV V FSE+ IMSSC+KP +Q    PVVLLH F
Sbjct  38    FPSFLPKEVHRIKDPFARNLAMRIHRLPVSVRFSENPIMSSCVKPSMQNTANPVVLLHGF  97

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G E WA+DILGWGFSDLE+ P+CD  SKR H YQ WKS+IK+ 
Sbjct  98    DSSCLEWRYTYPLLEEAGFETWAVDILGWGFSDLEKLPSCDVVSKRDHFYQFWKSHIKKA  157

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG+AVAIDFAVN+PEAV KLVLI+ASVY EGTG +  LP+  AY GV +LKSI
Sbjct  158   MILVGPSLGSAVAIDFAVNYPEAVEKLVLIDASVYAEGTGNLATLPRAAAYAGVYVLKSI  217

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F  L+ ST+LDWTN+GRLHCLLPWWEDA V+FM SGGYNV  QI+KV Q+
Sbjct  218   PLRLYANYLSFTSLTFSTSLDWTNIGRLHCLLPWWEDATVDFMTSGGYNVASQIEKVKQK  277

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+LA+RL  EL +AI+ QIP+ GHLPHVE P SV K I +F +   +
Sbjct  278   TLIIWGENDRIISNKLAVRLHCELADAIIRQIPDCGHLPHVERPDSVVKFIVEFVQSKTN  337

Query  300   T  298
             T
Sbjct  338   T  338



>ref|XP_010089627.1| Uncharacterized protein L484_021020 [Morus notabilis]
 gb|EXB38098.1| Uncharacterized protein L484_021020 [Morus notabilis]
Length=349

 Score =   435 bits (1119),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/301 (69%), Positives = 243/301 (81%), Gaps = 2/301 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQGDKEPVVLLH  1027
             FP FLPKEV  IKDPFAR+LA+RI+RLPV  Q G S S  MSSC+KP+ + +  PVVLLH
Sbjct  26    FPSFLPKEVQNIKDPFARNLAQRIERLPVKWQFGDSSSYTMSSCVKPLKRRETNPVVLLH  85

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIK  847
             CFDSSCLEWR  +PLLE+ G+E WA+D+LGWGFSDLER P CD ASKR HLYQ W SYIK
Sbjct  86    CFDSSCLEWRCAHPLLEEVGLETWAVDVLGWGFSDLERLPPCDVASKRNHLYQFWNSYIK  145

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             RPM+LVGPSLGAAVAIDFAVN+PEAV KLVLINASVY EGTG + KLPKMVAY GVS LK
Sbjct  146   RPMVLVGPSLGAAVAIDFAVNYPEAVKKLVLINASVYAEGTGNLAKLPKMVAYAGVSFLK  205

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVN  487
             S+PLR YA +  F+G+SL+TTLDWTNVGRLHCLLPWW+DA V+FM SGGYNV  QIK+V 
Sbjct  206   SMPLRFYANILAFNGISLATTLDWTNVGRLHCLLPWWKDATVSFMRSGGYNVAGQIKQVK  265

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              + L+I G  D+++S +  MRL  EL ++ +  IP SGHLPHVE+P SVA+LI +FAR D
Sbjct  266   HKALIICGENDQIISYKQTMRLHCELSDSKMRLIPESGHLPHVEKPVSVAQLIEEFARDD  325

Query  306   E  304
              
Sbjct  326   N  326



>ref|XP_008230875.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103330103 
[Prunus mume]
Length=372

 Score =   435 bits (1118),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 213/316 (67%), Positives = 248/316 (78%), Gaps = 18/316 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDP+AR+LA+R++RLPVQ+G SES IMSSC+KP  Q +  PVVLLHCF
Sbjct  55    FPSFLPKEVEKIKDPYARTLAQRMERLPVQIGSSESFIMSSCVKPHKQSEINPVVLLHCF  114

Query  1020  D----SSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSY  853
             +    SSCLEWR  YPLLE+ G+EAWA+D+LGWGFSDLERRP C AASKR+HLYQ WKSY
Sbjct  115   ECLHLSSCLEWRCAYPLLEEAGLEAWAVDVLGWGFSDLERRPPCSAASKRHHLYQFWKSY  174

Query  852   IKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSL  673
             I+RPMILVGPSLGA+VAIDFAV+ P AV KLVLINASVY EGTG + KLPK +AY GVSL
Sbjct  175   IRRPMILVGPSLGASVAIDFAVHHPVAVEKLVLINASVYAEGTGDLAKLPKFLAYAGVSL  234

Query  672   LKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKK  493
             LKSIPLR+YA L  F+G+SLSTT DWTNVGRLHCLLPWW+DA V+FM SGGYNV+ QIK+
Sbjct  235   LKSIPLRLYANLLAFNGISLSTTFDWTNVGRLHCLLPWWKDATVSFMRSGGYNVISQIKQ  294

Query  492   VNQRTLVITGMRDKLVSNELAMRLCR--------------ELPNAIVHQIPNSGHLPHVE  355
             V Q+ LVI   +D ++S +  +  C               ELP AI+  IP+SGHLPHVE
Sbjct  295   VKQKALVICSEQDHIISYKQILAQCFILRLVVIEMQRLRCELPYAIMRLIPDSGHLPHVE  354

Query  354   EPHSVAKLIADFARGD  307
              P SV KLIA FAR D
Sbjct  355   NPTSVVKLIAGFARND  370



>gb|KDP41297.1| hypothetical protein JCGZ_15704 [Jatropha curcas]
Length=335

 Score =   432 bits (1110),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 247/305 (81%), Gaps = 2/305 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKE++ IKDPFAR LA RI+RLPV   FSES IMSSC+KP++Q +  P+VLLH F
Sbjct  31    FPSFLPKEINNIKDPFARKLAARIERLPV--SFSESCIMSSCVKPLVQSNMNPLVLLHGF  88

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T+PLLE+ G+E WA DILGWGFSDLER P+CD  SKR H YQ W S+I+RP
Sbjct  89    DSSCLEWRYTFPLLEEAGMETWAFDILGWGFSDLERLPSCDVVSKRNHFYQFWTSHIRRP  148

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVGPSLGAAVAIDF+VN PEAV KL+LI+ASVY EGTG +  LP+ +AY GV LLKS+
Sbjct  149   IILVGPSLGAAVAIDFSVNHPEAVEKLILIDASVYTEGTGNLVNLPRTLAYAGVYLLKSV  208

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y     F G+SLST++DW NVGR+HCL PWWEDA V+FMLSGGYNV+ QI+KV ++
Sbjct  209   PLRLYVNFLAFSGISLSTSIDWMNVGRVHCLYPWWEDATVDFMLSGGYNVIAQIEKVKKK  268

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D ++SN+LA+RL  ELPNAI+ QIP  GHLPHVE+P+SVAKL+ +F + D  
Sbjct  269   TLIIWGEDDHIISNKLAVRLHCELPNAILRQIPECGHLPHVEKPNSVAKLMLEFVKEDCS  328

Query  300   TCVES  286
             T V++
Sbjct  329   TEVQT  333



>ref|XP_008243859.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X2 [Prunus mume]
Length=330

 Score =   430 bits (1105),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 200/299 (67%), Positives = 244/299 (82%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +I+DPFAR LA RI+RLPV   F E+ +MSSC+KP++Q +  PVVLLH F
Sbjct  30    FPSFLPKEVEKIRDPFARKLAARIERLPVS--FGENCVMSSCVKPLVQSNASPVVLLHGF  87

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P+C+ ASKR H +QLWKSY+K+P
Sbjct  88    DSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPSCNVASKRDHFFQLWKSYVKKP  147

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAIDFAV+ PEAV +LVLI+ASVY EGTG +  +PKM+AY GVSLLKS 
Sbjct  148   MILVGPSLGAAVAIDFAVSHPEAVERLVLIDASVYTEGTGDLASMPKMLAYAGVSLLKSP  207

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR Y     F G+SL T LDWTNVGRLHCL PWWEDA V+FM+SGGYNV  QI++V Q+
Sbjct  208   PLRFYVNFLGFSGISLGTNLDWTNVGRLHCLFPWWEDATVDFMMSGGYNVSAQIEQVKQK  267

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++S++L +RL  ELPNA++ QIP+ GHLPHVE+P SVAK+I +  + D+
Sbjct  268   TLIIWGEDDQIISSKLGVRLHCELPNAVIRQIPDCGHLPHVEKPSSVAKMIVELVQQDQ  326



>ref|XP_008243858.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Prunus mume]
Length=352

 Score =   430 bits (1105),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/299 (67%), Positives = 244/299 (82%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +I+DPFAR LA RI+RLPV   F E+ +MSSC+KP++Q +  PVVLLH F
Sbjct  30    FPSFLPKEVEKIRDPFARKLAARIERLPVS--FGENCVMSSCVKPLVQSNASPVVLLHGF  87

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P+C+ ASKR H +QLWKSY+K+P
Sbjct  88    DSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPSCNVASKRDHFFQLWKSYVKKP  147

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAIDFAV+ PEAV +LVLI+ASVY EGTG +  +PKM+AY GVSLLKS 
Sbjct  148   MILVGPSLGAAVAIDFAVSHPEAVERLVLIDASVYTEGTGDLASMPKMLAYAGVSLLKSP  207

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR Y     F G+SL T LDWTNVGRLHCL PWWEDA V+FM+SGGYNV  QI++V Q+
Sbjct  208   PLRFYVNFLGFSGISLGTNLDWTNVGRLHCLFPWWEDATVDFMMSGGYNVSAQIEQVKQK  267

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++S++L +RL  ELPNA++ QIP+ GHLPHVE+P SVAK+I +  + D+
Sbjct  268   TLIIWGEDDQIISSKLGVRLHCELPNAVIRQIPDCGHLPHVEKPSSVAKMIVELVQQDQ  326



>ref|XP_010259692.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259701.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010259707.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Nelumbo 
nucifera]
Length=329

 Score =   429 bits (1102),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 202/296 (68%), Positives = 237/296 (80%), Gaps = 0/296 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDPFAR LA+RI+R+PVQV FSES IMSSC+KP+ QG+  PVVLLH F
Sbjct  31    FPSFLPKEVEKIKDPFARKLAKRIERVPVQVSFSESCIMSSCVKPLFQGETNPVVLLHGF  90

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEW  T+PLLE+  +E W +DILGWGFSDLER P C  A+KR HLYQLW+SYIK+P
Sbjct  91    DSSCLEWSNTHPLLEEARLETWTVDILGWGFSDLERLPACTVATKREHLYQLWRSYIKKP  150

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAV IDF VN P+AV K+VLI A VY EGTG + KLP+  AY GV+LLKSI
Sbjct  151   MILVGPSLGAAVTIDFTVNHPDAVEKVVLIGAGVYTEGTGRLAKLPRATAYAGVALLKSI  210

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  +  +S  T LDWT+VGRLHCLLPWWEDA V+FMLSGGYNV   IK+V Q+
Sbjct  211   PLRLYANLLAYKRISYGTILDWTSVGRLHCLLPWWEDATVDFMLSGGYNVSSHIKQVKQK  270

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
              L+I G  DK+ S +LA+RL  ELPNAI+ QIP+ GHLPHV+ P +V+KLI DF R
Sbjct  271   ALIIWGEDDKIFSRKLAVRLHCELPNAIIRQIPDCGHLPHVDRPETVSKLIVDFIR  326



>ref|XP_004304231.1| PREDICTED: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate 
hydrolase-like [Fragaria vesca subsp. vesca]
Length=349

 Score =   429 bits (1104),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/299 (68%), Positives = 248/299 (83%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFS-ESSIMSSCIKPVIQGDKEPVVLLHC  1024
             FP FLPKEV +IKDPFAR+LA+R++RLPVQ+G   E+ IMSSC+KP++Q    PVVLLHC
Sbjct  50    FPPFLPKEVEKIKDPFARNLAQRMERLPVQMGLDDETCIMSSCVKPLVQTKNNPVVLLHC  109

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR TYPLLE+ G+EAWAID+LGWGFSDLER P C+  SKR+HLYQ WKSYI+R
Sbjct  110   FDSSCLEWRCTYPLLEEAGLEAWAIDVLGWGFSDLERLPPCNPESKRHHLYQFWKSYIRR  169

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PMILVGPSLGA+VAIDFAV++P AV KLVLINASVY EG+  + +LP+++AY GVSLL+S
Sbjct  170   PMILVGPSLGASVAIDFAVSYPFAVEKLVLINASVYSEGSK-LAELPRILAYAGVSLLRS  228

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             IPLR+YA    F+ +SL+TT DWTNVGRLHCLLPWW+DA V+FM SGGYNVV QIK+V Q
Sbjct  229   IPLRLYANTLAFNDISLATTFDWTNVGRLHCLLPWWKDATVSFMSSGGYNVVAQIKQVKQ  288

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             + L+I    D++++ +  +RL  ELP+AI+  IP+ GHLPHV+ P SVAKLIA FAR D
Sbjct  289   KALIICSEEDRIITYKQTLRLRCELPSAIMRLIPDGGHLPHVDNPTSVAKLIAGFARND  347



>ref|XP_002512087.1| alpha/beta hydrolase, putative [Ricinus communis]
 gb|EEF50756.1| alpha/beta hydrolase, putative [Ricinus communis]
Length=340

 Score =   429 bits (1102),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 206/307 (67%), Positives = 242/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFS--ESSIMSSCIKPVIQGDKEPVVLLH  1027
             FP FLPKEV +IKDPFAR LA RI+RLPV V FS  ES IM+SC+KP+ Q    PVVLLH
Sbjct  29    FPSFLPKEVEDIKDPFARKLATRIERLPVHVNFSKKESCIMTSCVKPLTQSKTSPVVLLH  88

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIK  847
              FDSSCLEWR T PLLE++G E WAIDILG GFSDLE  P CD ASKR HLYQ W+S+I 
Sbjct  89    GFDSSCLEWRYTLPLLEESGAETWAIDILGSGFSDLETLPPCDVASKRKHLYQFWRSHIS  148

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             +P+ILVGPSLGAA+AIDFAVN PEAV KLVLI+ASVY EGTG + KLP+++AY GV LLK
Sbjct  149   KPIILVGPSLGAAIAIDFAVNHPEAVEKLVLIDASVYAEGTGGLAKLPRLLAYAGVYLLK  208

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVN  487
             S+PLR+YA   CF G SLST +DW NVGRLHCL PWWEDA VNFM+SGGYNV  QI+KV 
Sbjct  209   SVPLRLYAHFLCFSGTSLSTGIDWINVGRLHCLYPWWEDATVNFMMSGGYNVSSQIEKVK  268

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             +RTL+I G  D++VS +L +RL  EL N+I+ QIP+ GHLPHVE+P+ +AKLI +F R D
Sbjct  269   KRTLIIWGEDDQIVSYKLGVRLHCELSNSIIRQIPDCGHLPHVEKPYDLAKLIMEFVRED  328

Query  306   EDTCVES  286
                  +S
Sbjct  329   SRKEAQS  335



>ref|XP_010680705.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=328

 Score =   427 bits (1099),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 201/296 (68%), Positives = 241/296 (81%), Gaps = 0/296 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKE+  IKD FAR+LA+RIQRLPVQ+ FS +SIMSSC++P++QG+ +P+VLLH F
Sbjct  33    FPSFLPKEIDNIKDKFARNLAQRIQRLPVQLTFSGTSIMSSCVRPMVQGNTDPIVLLHGF  92

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E+WAIDILGWGFSDLE    CDAASKR HLYQ WKSYIKRP
Sbjct  93    DSSCLEWRYTYPLLEEAGLESWAIDILGWGFSDLEGLQQCDAASKRNHLYQFWKSYIKRP  152

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAID AVN PEAV KL+LI+ASVY EGTG M KLP++ AY GV+LLKS+
Sbjct  153   MILVGPSLGAAVAIDLAVNHPEAVSKLILIDASVYSEGTGEMAKLPRLFAYAGVALLKSV  212

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y  L  F+ +S +T+LDW N+GRLHCL PWWEDA VNFM SGGYNVV  I +V Q+
Sbjct  213   PLRLYVNLIAFNDVSFNTSLDWMNIGRLHCLYPWWEDAAVNFMTSGGYNVVPLINQVKQQ  272

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             TL+I G  D+++S +LA +L  EL  A + QIP+ GH+PHVE+P SVA LI  F +
Sbjct  273   TLIIWGEDDQIISYKLAFKLHSELQGATLRQIPDCGHIPHVEKPTSVADLIIRFVQ  328



>ref|XP_010044415.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Eucalyptus 
grandis]
 gb|KCW86500.1| hypothetical protein EUGRSUZ_B03156 [Eucalyptus grandis]
Length=328

 Score =   426 bits (1096),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/298 (67%), Positives = 239/298 (80%), Gaps = 2/298 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V  IKD +AR LA RI+RLPV +  S++ IMSSC+KP+++G+  PVVLLH F
Sbjct  22    FPPFLPKQVENIKDSYARKLASRIERLPVNL--SDNCIMSSCVKPLVKGETNPVVLLHGF  79

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLED G+E WA+DILGWGFSDLE+ P C+ A+KR H YQLWKSYIK+P
Sbjct  80    DSSCLEWRYTYPLLEDAGLETWAVDILGWGFSDLEQLPACNVANKRNHFYQLWKSYIKKP  139

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAA+AIDFAV  PEAV KLVLI+ASVY EGTG M  LP+ +AY GVS+LKS 
Sbjct  140   MILVGPSLGAAIAIDFAVIHPEAVEKLVLIDASVYAEGTGDMANLPRAIAYAGVSILKSF  199

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR +  +  F GL LST LDWTNVGRLHC  PWWEDA V+FMLSGGYNV  QI +V QR
Sbjct  200   PLRFWVNVLAFRGLPLSTNLDWTNVGRLHCRYPWWEDASVDFMLSGGYNVTEQINQVKQR  259

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              L++ G  DK++S ELA++L  ELPN+I+ QIP+ GHLPHVE+P+ VA LIADF + D
Sbjct  260   ALIVWGEDDKIISKELAVKLHAELPNSILRQIPDCGHLPHVEKPNIVANLIADFVQED  317



>ref|XP_010030791.1| PREDICTED: uncharacterized protein LOC104420695 [Eucalyptus grandis]
Length=339

 Score =   427 bits (1097),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 197/301 (65%), Positives = 246/301 (82%), Gaps = 2/301 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQGDKEPVVLLH  1027
             FP FLPKEV +IKDPFAR LA++I+R+PV  Q+  S+  +MSSC+KP I+ +  PVVLLH
Sbjct  38    FPSFLPKEVEKIKDPFARRLAQKIERVPVPVQIESSDGWVMSSCVKPSIRSNNNPVVLLH  97

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIK  847
             CFDSSCLEWR  YPLLE+ G+E WA+D+LGWGFSDLE+RP C  +SKR+HLYQLWK++I+
Sbjct  98    CFDSSCLEWRHAYPLLEEAGLEVWAVDVLGWGFSDLEKRPPCGVSSKRHHLYQLWKTHIR  157

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             RPM+LVGPSLGAA AIDFAVN  EAV KLVLIN  VY EGTG + K+PK+VAY GVSLLK
Sbjct  158   RPMVLVGPSLGAAAAIDFAVNHSEAVEKLVLINGCVYEEGTGQLAKVPKLVAYAGVSLLK  217

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVN  487
             SIPLR+YA +  F G+SL+T  DWTNVGRLHCLLPWW+DA V+FM SGGYNVV QIK+V 
Sbjct  218   SIPLRLYANMLAFKGISLATCFDWTNVGRLHCLLPWWKDASVSFMRSGGYNVVDQIKEVK  277

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             Q+ L++ G  D++++ +L +RL  ELP+AI+ Q+P+ GHL HVE+P+++A LIADF RG 
Sbjct  278   QKVLIVYGEHDRIITKKLQVRLHCELPSAIIRQVPDCGHLLHVEKPNAIADLIADFVRGS  337

Query  306   E  304
              
Sbjct  338   N  338



>ref|XP_003516364.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Glycine 
max]
 gb|KHN03648.1| 2-hydroxy-6-oxononadienedioate/2-hydroxy-6- oxononatrienedioate 
hydrolase [Glycine soja]
Length=343

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 239/309 (77%), Gaps = 0/309 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP+E+H I+DPFAR  A RIQRLPV V FSE+ IMSSC+KP++Q  + PVVLLH F
Sbjct  35    FPSFLPREIHNIQDPFARKFALRIQRLPVPVRFSENPIMSSCVKPLVQTKETPVVLLHGF  94

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR   PLLE++G+E WAIDILGWGFSDLE+ P CD  SKR H YQ WKSYI+RP
Sbjct  95    DSSCLEWRYVLPLLEESGIETWAIDILGWGFSDLEKLPPCDVVSKRDHFYQFWKSYIRRP  154

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG+AVAIDFAVN+PEAV KLVLI ASVY EGTG +  LP+ VAY GV+LLKS+
Sbjct  155   MILVGPSLGSAVAIDFAVNYPEAVKKLVLIGASVYAEGTGKLATLPRAVAYAGVNLLKSL  214

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F  +S ST+LDWTNVGRLHC LPWW+DA V+FM SGGY+V   I KV Q 
Sbjct  215   PLRLYATYLTFTKISFSTSLDWTNVGRLHCFLPWWDDATVDFMTSGGYSVAPLIGKVKQN  274

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+ A+RL  ELP+AI+ QIP  GHLPH+E P S  KLI +F + +  
Sbjct  275   TLIIWGENDRIISNKFAVRLHCELPDAIIRQIPYCGHLPHLERPDSTIKLIVEFVQRESK  334

Query  300   TCVESYCKI  274
             T  +   ++
Sbjct  335   TFSQCVAQV  343



>ref|NP_001241322.1| uncharacterized protein LOC100800197 [Glycine max]
 gb|ACU19826.1| unknown [Glycine max]
Length=344

 Score =   424 bits (1091),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/309 (64%), Positives = 240/309 (78%), Gaps = 0/309 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP+E+H I+DPFAR  A RIQRLPV V FSE+ IMSSC+KP++Q  + PVVLLH F
Sbjct  36    FPSFLPRELHTIQDPFARKFALRIQRLPVPVRFSENPIMSSCVKPLVQTKETPVVLLHGF  95

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR   PLLE++G+E WAIDILGWGFSDL + P CD  SKR H YQ WKSYI+RP
Sbjct  96    DSSCLEWRYVLPLLEESGIETWAIDILGWGFSDLGKLPPCDVVSKRDHFYQFWKSYIRRP  155

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVGPSLG+AVA+DFAVN+PEAV KLVLI ASVY EGTG +  LP+ VAY GV+LLKS+
Sbjct  156   IILVGPSLGSAVAVDFAVNYPEAVEKLVLIGASVYSEGTGKLATLPRAVAYAGVNLLKSL  215

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F  +S ST+LDWTNVGRLHC LPWW+DA V+FM SGGYNV   I KV Q+
Sbjct  216   PLRLYATYLTFTKISFSTSLDWTNVGRLHCFLPWWDDATVDFMTSGGYNVSPLIGKVKQK  275

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+ A+RL  ELP+AI+ QIPN GHLPH+E P S  KLI +F + +  
Sbjct  276   TLIIWGENDRIISNKFAVRLHCELPDAIIRQIPNCGHLPHLERPDSTIKLIVEFVQRESK  335

Query  300   TCVESYCKI  274
             T  +   ++
Sbjct  336   TLSQCVAQV  344



>ref|XP_009360519.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Pyrus x bretschneideri]
Length=323

 Score =   424 bits (1089),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 237/297 (80%), Gaps = 0/297 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDP+AR LA+R++RLPV +  SES IMSSC++P+ Q +  PVVLLHCF
Sbjct  24    FPSFLPKEVQKIKDPYARKLAQRMERLPVSIASSESCIMSSCVRPLKQCEINPVVLLHCF  83

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE+ G+EAWA+D+LGWGFSDL   P C  ASKR+HLYQ WKSYI+RP
Sbjct  84    DSSCLEWRCAYPLLEEAGLEAWAVDVLGWGFSDLGSCPPCSVASKRHHLYQFWKSYIRRP  143

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG +VAIDFA + P AV KLVLINASVY EG G M KLPK VAY GVSLLKS 
Sbjct  144   MVLVGPSLGGSVAIDFAYHHPIAVEKLVLINASVYAEGIGEMAKLPKAVAYAGVSLLKST  203

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA +  F+ +SL+TT DWTNVGRLHCLLPWW+DA V+FM SGGYNVV QIK+V Q+
Sbjct  204   PLRFYASMLAFNSISLATTFDWTNVGRLHCLLPWWKDATVSFMTSGGYNVVSQIKQVKQK  263

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
              LVI   +D ++S +  +RL  ELP+AI+  IP+SGHLPHV+ P S+AKLI  FAR 
Sbjct  264   VLVICSEQDNIISYKQILRLRCELPSAIMRLIPDSGHLPHVDNPASIAKLIVGFARN  320



>ref|XP_010258064.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Nelumbo 
nucifera]
Length=329

 Score =   424 bits (1089),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/297 (69%), Positives = 246/297 (83%), Gaps = 0/297 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP++V +IKDPFAR LA+RI+RLPVQV FSESSIMSSC++P++Q +  PVVLLH F
Sbjct  30    FPSFLPRQVEKIKDPFARKLAKRIERLPVQVSFSESSIMSSCVRPLLQSETNPVVLLHGF  89

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P+CD  SKR HLYQLW+SYIK+P
Sbjct  90    DSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPSCDVTSKRDHLYQLWRSYIKKP  149

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAID AVN PE+V KL+LI+A VY EGTG + KLP+ VAY GVS+LKS+
Sbjct  150   MILVGPSLGAAVAIDIAVNHPESVQKLILIDAGVYAEGTGNLAKLPRTVAYAGVSVLKSM  209

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  F  +S  T LD TNVGRLHCLLPWWEDA V+FM+SGGYNV   I +VNQ+
Sbjct  210   PLRLYANLLAFKKISFDTILDQTNVGRLHCLLPWWEDATVDFMISGGYNVSRLIDQVNQK  269

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             TL+I G  DK+ S+E A+RL  +LPNAI+HQ+ + GHLPHV+ P+SVAKLI DF + 
Sbjct  270   TLIIWGEDDKIFSSEFAVRLHHQLPNAIIHQLSDCGHLPHVDRPNSVAKLIVDFVQA  326



>ref|XP_007032741.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY03667.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=310

 Score =   422 bits (1086),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/265 (74%), Positives = 231/265 (87%), Gaps = 0/265 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V +IKDPFAR+LARRI+RLPVQ+  S+S IMSSC++P+IQ D  PVVLLHCF
Sbjct  45    FPSFLPKQVEKIKDPFARNLARRIKRLPVQIECSDSFIMSSCVQPLIQRDANPVVLLHCF  104

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWRR YPLLE++G+EAWAID+LGWGFSDL R P C+ ASKRYHLYQLW SYIKRP
Sbjct  105   DSSCLEWRRAYPLLEESGLEAWAIDVLGWGFSDLGRLPPCNVASKRYHLYQLWNSYIKRP  164

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVAIDFAVN+PEAV KLVLIN SVY EGTG + KLP++VAY GVSLLK+ 
Sbjct  165   VVLVGPSLGAAVAIDFAVNYPEAVKKLVLINPSVYAEGTGNLAKLPRVVAYAGVSLLKTF  224

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  F+G+SLS +LDWTNVGRLHC +PWW+DA VNFM+SGGYNVV QIK+V Q+
Sbjct  225   PLRLYANLLAFNGISLSRSLDWTNVGRLHCHMPWWKDATVNFMVSGGYNVVSQIKQVKQK  284

Query  480   TLVITGMRDKLVSNELAMRLCRELP  406
             TL+I G  D++VSN+LAMRL  ELP
Sbjct  285   TLLICGENDRIVSNQLAMRLLFELP  309



>ref|XP_006437940.1| hypothetical protein CICLE_v10031818mg [Citrus clementina]
 gb|ESR51180.1| hypothetical protein CICLE_v10031818mg [Citrus clementina]
Length=381

 Score =   425 bits (1093),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/298 (67%), Positives = 238/298 (80%), Gaps = 0/298 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  IKDPFAR LA RI+RLPV V FSES IMSS +KP+      PVVLLH F
Sbjct  73    FPSFLPKEVENIKDPFARKLAARIERLPVHVNFSESCIMSSVVKPLKPSKTSPVVLLHGF  132

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P C+  SKR H YQLWK+YIKRP
Sbjct  133   DSSCLEWRCTYPLLEEAGLETWAVDILGWGFSDLERLPPCNVTSKREHFYQLWKTYIKRP  192

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVA+DFAVN PEAV  LV I+ASVY EGTG   KLP ++AY GV LL+SI
Sbjct  193   MILVGPSLGAAVAVDFAVNHPEAVENLVFIDASVYAEGTGNSAKLPSIIAYAGVYLLRSI  252

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             P+R+YA +   +  S ST +DWTN+GRLHCL PWWEDA V+FM+SGGYNV  QI++V Q+
Sbjct  253   PVRLYASILALNHTSFSTIIDWTNIGRLHCLYPWWEDATVSFMVSGGYNVSTQIEQVKQK  312

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             TL+I G  D+++S++LA+RL  ELPNAI+ QIP+ GHLPHVE+P +VAKLI +F + +
Sbjct  313   TLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQEN  370



>ref|XP_002274292.1| PREDICTED: monoacylglycerol lipase ABHD6 [Vitis vinifera]
 ref|XP_010649640.1| PREDICTED: monoacylglycerol lipase ABHD6 [Vitis vinifera]
 ref|XP_010649646.1| PREDICTED: monoacylglycerol lipase ABHD6 [Vitis vinifera]
 emb|CBI27283.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   423 bits (1088),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/309 (67%), Positives = 244/309 (79%), Gaps = 3/309 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP F+PKEV  IKDPFAR LA RI+RLPVQ+  S S IMSSC+KP+      PVVLLH F
Sbjct  32    FPSFIPKEVERIKDPFARKLATRIERLPVQLSSSNSCIMSSCVKPLSPSKTSPVVLLHGF  91

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P+CD A+KR H YQLWKS+IKRP
Sbjct  92    DSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPSCDVATKRDHFYQLWKSHIKRP  151

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAIDF  N PEAV KLVLI+ASVY EGTG + KLP+ VAY GV +LKSI
Sbjct  152   MILVGPSLGAAVAIDFTANHPEAVDKLVLIDASVYTEGTGNLMKLPRAVAYAGVYILKSI  211

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA +  F  +S + + DWT VGRLHCL PWWEDA VNFM+SGGYNV  QI++V ++
Sbjct  212   PLRFYANVLAFKSISFTRSSDWTKVGRLHCLYPWWEDATVNFMISGGYNVSSQIQQVKKK  271

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD--  307
             TL+I G  D+++SN+LA+RL  ELPNAI+ QIP+ GHLPHVE+PHSV+KLI +F + D  
Sbjct  272   TLIIWGEDDQIISNKLAVRLHCELPNAIISQIPDCGHLPHVEKPHSVSKLIMEFVQEDSY  331

Query  306   -EDTCVESY  283
              E  C+  Y
Sbjct  332   KEAQCISQY  340



>ref|XP_006484200.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Citrus sinensis]
Length=379

 Score =   425 bits (1092),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/298 (67%), Positives = 238/298 (80%), Gaps = 0/298 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  IKDPFAR LA RI+RLPV V FSES IMSS +KP+      PVVLLH F
Sbjct  71    FPSFLPKEVENIKDPFARKLAARIERLPVHVNFSESCIMSSVVKPLKPSKTSPVVLLHGF  130

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P C+  SKR H YQLWK+YIKRP
Sbjct  131   DSSCLEWRCTYPLLEEAGLETWAVDILGWGFSDLERLPPCNVTSKREHFYQLWKTYIKRP  190

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVA+DFAVN PEAV  LV I+ASVY EGTG   KLP ++AY GV LL+SI
Sbjct  191   MILVGPSLGAAVAVDFAVNHPEAVENLVFIDASVYAEGTGNSAKLPSIIAYAGVYLLRSI  250

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             P+R+YA +   +  S ST +DWTN+GRLHCL PWWEDA V+FM+SGGYNV  QI++V Q+
Sbjct  251   PVRLYASILALNHTSFSTIIDWTNIGRLHCLYPWWEDATVSFMVSGGYNVSTQIEQVKQK  310

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             TL+I G  D+++S++LA+RL  ELPNAI+ QIP+ GHLPHVE+P +VAKLI +F + +
Sbjct  311   TLIIWGEDDQIISSKLAVRLHCELPNAIIRQIPDCGHLPHVEKPGAVAKLIVEFIQEN  368



>ref|XP_010554287.1| PREDICTED: monoacylglycerol lipase ABHD6 [Tarenaya hassleriana]
 ref|XP_010554288.1| PREDICTED: monoacylglycerol lipase ABHD6 [Tarenaya hassleriana]
Length=336

 Score =   423 bits (1087),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 203/305 (67%), Positives = 240/305 (79%), Gaps = 2/305 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  IKD FAR+LA RI+RLPVQV F+E+SIMSSC+ P++Q +  PVVLLH F
Sbjct  30    FPAFLPKEVERIKDTFARNLAARIKRLPVQVSFAENSIMSSCVTPLVQTEGNPVVLLHGF  89

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+EAWA DILGWGFSDLE+ P CD ASKR H YQ WKS+IKRP
Sbjct  90    DSSCLEWRYTYPLLEEAGLEAWAFDILGWGFSDLEKLPLCDVASKREHFYQFWKSHIKRP  149

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVGPSLGAAVAID AV  P+AV  LVL++ASVY EGTG +  LPK  AY GV LLKSI
Sbjct  150   VILVGPSLGAAVAIDIAVKHPDAVESLVLMDASVYAEGTGNLATLPKAAAYAGVYLLKSI  209

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y    CF G+SL T+ DWT +GRLHCL PWWEDA V+FM SGGYNV   I+KV+Q+
Sbjct  210   PLRLYVNFLCFSGISLETSWDWTKIGRLHCLYPWWEDATVSFMSSGGYNVTSLIEKVSQK  269

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL++ G  D+++S++LA RL  EL NA V QIP  GHLPHVE+P +VAKLI++FA   E 
Sbjct  270   TLILWGEDDQIISSKLASRLHGELSNAHVRQIPECGHLPHVEKPAAVAKLISEFA--GEI  327

Query  300   TCVES  286
              C E+
Sbjct  328   CCEEA  332



>ref|XP_008445456.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X2 [Cucumis 
melo]
Length=332

 Score =   422 bits (1086),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 203/298 (68%), Positives = 236/298 (79%), Gaps = 2/298 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV++IKD FAR+LA RI+RLPV   FS+S IMSSC+KP IQ  K PVVLLH F
Sbjct  32    FPSFLPKEVYDIKDQFARNLASRIERLPV--SFSDSCIMSSCVKPSIQSKKCPVVLLHGF  89

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+D+LGWGFSDLER P CD  SKR HLYQLWKSYIKRP
Sbjct  90    DSSCLEWRYTYPLLEEAGLETWAVDVLGWGFSDLERLPPCDVTSKRVHLYQLWKSYIKRP  149

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M++VGPSLGAAVAIDFAVN+PEAV +LVLI+ASVY EGTG +  LP+++AY GV LLKSI
Sbjct  150   MVIVGPSLGAAVAIDFAVNYPEAVDRLVLIDASVYAEGTGNLATLPRLIAYAGVFLLKSI  209

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y     F  +  ST LDW N+GRLHCLLPWWEDA V+FMLSGGY V  QI+KV Q+
Sbjct  210   PLRVYVNFLTFTSIPFSTGLDWANIGRLHCLLPWWEDATVSFMLSGGYKVSSQIEKVKQK  269

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             TL+I G  D++VS +L +RL  ELPNA+   I   GHLPHVE+P+ VAKLI  F   D
Sbjct  270   TLIIWGEDDQIVSYKLGVRLHCELPNAVFRPIAECGHLPHVEKPNLVAKLITQFIHED  327



>gb|EYU42126.1| hypothetical protein MIMGU_mgv1a009241mg [Erythranthe guttata]
Length=348

 Score =   423 bits (1087),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 241/306 (79%), Gaps = 0/306 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
              P FLPKE+  IKDPFAR LA RI+R+PV +  S +SIMSSC+KP  Q DK P+VLLH F
Sbjct  40    IPAFLPKELESIKDPFARKLASRIERMPVHLSLSNTSIMSSCVKPKEQPDKCPLVLLHGF  99

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T P+LE++G+E WA+D+LGWGFSDLE+ P+C  ASKR HLYQ WKSYIKRP
Sbjct  100   DSSCLEWRYTLPMLEESGLETWAVDVLGWGFSDLEKLPSCSVASKRDHLYQFWKSYIKRP  159

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M LVGPSLGAAVAIDF VN+PEAV KL+LI+ASVY EGTG + KLPK+VAY GV LL+S+
Sbjct  160   MTLVGPSLGAAVAIDFVVNYPEAVDKLILIDASVYAEGTGNLAKLPKLVAYAGVYLLRSL  219

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR++A    F+G +    L+W  +GRLHCLLPWW DA V+FM+SGGYNV   IK+V ++
Sbjct  220   PLRLFATSLTFNGAAWDKCLEWAKIGRLHCLLPWWADATVDFMISGGYNVTANIKQVKKK  279

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G +D+++ N LA+RL  ELPNAI+ QIP+ GH+PHVE+P +V+KLI +F R + D
Sbjct  280   TLIIWGEKDQIIDNRLAVRLHSELPNAIIRQIPDCGHIPHVEKPDAVSKLIKEFVRAESD  339

Query  300   TCVESY  283
               V  +
Sbjct  340   IVVPRF  345



>ref|XP_010680706.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=327

 Score =   422 bits (1085),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 200/296 (68%), Positives = 241/296 (81%), Gaps = 1/296 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKE+  IKD FAR+LA+RIQRLPVQ+ FS +SIMSSC++P++QG+ +P+VLLH F
Sbjct  33    FPSFLPKEIDNIKDKFARNLAQRIQRLPVQLTFSGTSIMSSCVRPMVQGNTDPIVLLHGF  92

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E+WAIDILGWGFSDL  +  CDAASKR HLYQ WKSYIKRP
Sbjct  93    DSSCLEWRYTYPLLEEAGLESWAIDILGWGFSDLGLQ-QCDAASKRNHLYQFWKSYIKRP  151

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAID AVN PEAV KL+LI+ASVY EGTG M KLP++ AY GV+LLKS+
Sbjct  152   MILVGPSLGAAVAIDLAVNHPEAVSKLILIDASVYSEGTGEMAKLPRLFAYAGVALLKSV  211

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y  L  F+ +S +T+LDW N+GRLHCL PWWEDA VNFM SGGYNVV  I +V Q+
Sbjct  212   PLRLYVNLIAFNDVSFNTSLDWMNIGRLHCLYPWWEDAAVNFMTSGGYNVVPLINQVKQQ  271

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             TL+I G  D+++S +LA +L  EL  A + QIP+ GH+PHVE+P SVA LI  F +
Sbjct  272   TLIIWGEDDQIISYKLAFKLHSELQGATLRQIPDCGHIPHVEKPTSVADLIIRFVQ  327



>ref|XP_008445455.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Cucumis 
melo]
Length=338

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/304 (67%), Positives = 238/304 (78%), Gaps = 2/304 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV++IKD FAR+LA RI+RLPV   FS+S IMSSC+KP IQ  K PVVLLH F
Sbjct  32    FPSFLPKEVYDIKDQFARNLASRIERLPV--SFSDSCIMSSCVKPSIQSKKCPVVLLHGF  89

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+D+LGWGFSDLER P CD  SKR HLYQLWKSYIKRP
Sbjct  90    DSSCLEWRYTYPLLEEAGLETWAVDVLGWGFSDLERLPPCDVTSKRVHLYQLWKSYIKRP  149

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M++VGPSLGAAVAIDFAVN+PEAV +LVLI+ASVY EGTG +  LP+++AY GV LLKSI
Sbjct  150   MVIVGPSLGAAVAIDFAVNYPEAVDRLVLIDASVYAEGTGNLATLPRLIAYAGVFLLKSI  209

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y     F  +  ST LDW N+GRLHCLLPWWEDA V+FMLSGGY V  QI+KV Q+
Sbjct  210   PLRVYVNFLTFTSIPFSTGLDWANIGRLHCLLPWWEDATVSFMLSGGYKVSSQIEKVKQK  269

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D++VS +L +RL  ELPNA+   I   GHLPHVE+P+ VAKLI  F   D  
Sbjct  270   TLIIWGEDDQIVSYKLGVRLHCELPNAVFRPIAECGHLPHVEKPNLVAKLITQFIHEDSR  329

Query  300   TCVE  289
               V+
Sbjct  330   KEVQ  333



>ref|XP_009793916.1| PREDICTED: monoacylglycerol lipase ABHD6 [Nicotiana sylvestris]
Length=351

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/299 (66%), Positives = 239/299 (80%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V  IKD  AR LA RI+RLPV    S+  ++SSC+KP  Q    PVVLLH F
Sbjct  39    FPDFLPKQVENIKDSSARKLASRIERLPVN--LSKGCVLSSCVKPKEQNSANPVVLLHGF  96

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T+P+LE+ G+E WA+DILGWGFSDLER P+CD ASKR HLYQLW +YIKRP
Sbjct  97    DSSCLEWRYTFPMLEEAGLETWAVDILGWGFSDLERLPSCDVASKRDHLYQLWSTYIKRP  156

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+VN+PEAV +LVLI+ASVY EGTG +  LPK VAY G+ LLKS+
Sbjct  157   MVLVGPSLGSAVAIDFSVNYPEAVDRLVLIDASVYAEGTGNLATLPKAVAYAGIYLLKSV  216

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+GL LST +DWTN+GRLHCLLPWWEDA VNFM+SGGYNVV QI+ V Q+
Sbjct  217   PLRLYATSLTFNGLPLSTCIDWTNIGRLHCLLPWWEDATVNFMISGGYNVVSQIEHVKQK  276

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++  +L +RL  ELPNAI+ QIP  GH+PHVE+P +V++LI +F R D+
Sbjct  277   TLIIWGEDDQIIDYKLGVRLHCELPNAIIRQIPKCGHIPHVEKPDAVSRLIVEFVRSDQ  335



>ref|XP_003614082.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Medicago 
truncatula]
 gb|AES97040.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=355

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 240/311 (77%), Gaps = 0/311 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKE+H IKDPFAR  A RIQRLPV V F E+ IMSSC+KP++Q  + P+VLLH F
Sbjct  42    FPPFLPKEIHSIKDPFARKFAMRIQRLPVPVSFVENPIMSSCVKPLVQNKEPPIVLLHGF  101

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE++G E WAIDILGWGFSDLE  P CD  SKR H YQ WKSYI+RP
Sbjct  102   DSSCLEWRYGYPLLEESGFETWAIDILGWGFSDLENLPPCDVVSKRNHFYQFWKSYIRRP  161

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG+AVAIDFAVN+PEAV KL+LI+ASVY EGTG +  LP+ VAY GV LLKS+
Sbjct  162   MILVGPSLGSAVAIDFAVNYPEAVEKLILIDASVYAEGTGNLATLPRSVAYAGVYLLKSL  221

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F  +SL T LD TNVGRLHCLLPWW+DA V+FM SGGY +   I+KV Q+
Sbjct  222   PLRLYANYLTFTNMSLRTILDGTNVGRLHCLLPWWDDATVDFMTSGGYKIAPLIRKVKQK  281

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D++VSN+LA++L  ELP+AI+ QIP+ GH+PH+E P S  KLI +F + ++ 
Sbjct  282   TLIIWGENDRIVSNKLAVQLHCELPDAILRQIPDCGHIPHLERPDSTIKLIVEFIQTEKK  341

Query  300   TCVESYCKIKE  268
                +   ++ +
Sbjct  342   KLSQRVSQVSQ  352



>ref|XP_007153527.1| hypothetical protein PHAVU_003G042900g [Phaseolus vulgaris]
 gb|ESW25521.1| hypothetical protein PHAVU_003G042900g [Phaseolus vulgaris]
Length=343

 Score =   419 bits (1078),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 234/306 (76%), Gaps = 0/306 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKE+H I+DPFAR LA RIQRLPV V FSE+ IMSSC+KPV+Q  + PVVLLH F
Sbjct  34    FPSFLPKELHTIEDPFARKLAMRIQRLPVPVRFSENPIMSSCVKPVVQSKETPVVLLHGF  93

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR   PLLE++G+E WAIDILGWGFSDLE+ P CD  SKR H YQ WK YI+RP
Sbjct  94    DSSCLEWRYVLPLLEESGIETWAIDILGWGFSDLEKLPPCDVESKRDHFYQFWKCYIRRP  153

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M LVGPSLG+AVAIDFAVN+PEAV KLVLI ASVY EGTG +  LP+ VAY GV+LLKS 
Sbjct  154   MTLVGPSLGSAVAIDFAVNYPEAVEKLVLIGASVYAEGTGKLATLPRAVAYAGVNLLKSF  213

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F  +S  T+LDWTNVGRLHC LPWW DA V+FM SGGYNV   I KV Q+
Sbjct  214   PLRLYATYLTFTNISFGTSLDWTNVGRLHCSLPWWNDATVDFMTSGGYNVAPLIGKVKQK  273

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+ A++L  ELP+A + QIP+ GHLPH+E P S  KLI +F +  E 
Sbjct  274   TLIIWGENDRIISNKFAVQLHCELPDASIRQIPHCGHLPHLERPDSTIKLIVEFVQQREA  333

Query  300   TCVESY  283
               +  Y
Sbjct  334   KKLNPY  339



>ref|NP_198738.2| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
 gb|AAO42208.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63827.1| unknown protein [Arabidopsis thaliana]
 gb|AED94409.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
Length=330

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 239/300 (80%), Gaps = 3/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQ-GDKEPVVLL  1030
             FP FLPKE+  IKDPFAR+LA+RI R+PV  Q+G    S+MSSCIKP++Q  DK PVVLL
Sbjct  28    FPTFLPKEIQNIKDPFARALAQRIVRIPVPLQMGNFRGSVMSSCIKPLVQLHDKSPVVLL  87

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRRTYPLLE   +E WAID+LGWGFSDLE+ P CDAASKR+HL++LWK+YI
Sbjct  88    HCFDSSCLEWRRTYPLLEQACLETWAIDVLGWGFSDLEKLPPCDAASKRHHLFELWKTYI  147

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG + +LPK +AY GV LL
Sbjct  148   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGRLKELPKSIAYAGVKLL  207

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMV+FM+SGGYNV   IK +
Sbjct  208   KSFPLRLLANVLAFCSSPLSENIDWTNIGRLHCQMPWWEDAMVDFMISGGYNVASHIKHI  267

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             + +TLV+    D++VSN+L+++L  EL NA++ ++P+SGHLPHVE P  + KLI+DFA G
Sbjct  268   DHKTLVVCSENDQIVSNQLSVKLLCELANAVLREVPDSGHLPHVENPKHIVKLISDFASG  327



>ref|XP_002870798.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47057.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=330

 Score =   418 bits (1074),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 239/300 (80%), Gaps = 3/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQ-GDKEPVVLL  1030
             FP FLPKE+  I+DPFAR+LA+RI R+PV  QVG    S+MSSCIKP++Q  DK PVVLL
Sbjct  28    FPAFLPKEIQNIRDPFARALAQRIVRIPVPLQVGNFRGSVMSSCIKPLVQLHDKSPVVLL  87

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRRTYPLLE   +E WAID+LGWGFSDLE+ P CDAASKR+HL++LWK+YI
Sbjct  88    HCFDSSCLEWRRTYPLLEQACLETWAIDVLGWGFSDLEKLPPCDAASKRHHLFELWKTYI  147

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG + +LPK +AY GV LL
Sbjct  148   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGRLKELPKSIAYAGVKLL  207

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMV+FM+SGGYNV   IK +
Sbjct  208   KSFPLRLLANVLAFCSSPLSENIDWTNIGRLHCQMPWWEDAMVDFMISGGYNVASHIKLI  267

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             + +TLV+    D++VSN+L+++L  EL NA++ ++P+SGHLPHVE P  + KLI+DFA G
Sbjct  268   DHKTLVVCSENDQIVSNQLSVKLLCELANAVLREVPDSGHLPHVENPKHIVKLISDFASG  327



>ref|XP_008379424.1| PREDICTED: uncharacterized protein LOC103442420 [Malus domestica]
Length=323

 Score =   417 bits (1073),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 237/298 (80%), Gaps = 0/298 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDP+AR+LA+R++RLPV +  SES IMSSC++P  Q +  PVVLLHCF
Sbjct  24    FPSFLPKEVEKIKDPYARTLAQRMERLPVPIASSESCIMSSCVRPRKQSEINPVVLLHCF  83

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE+ G+EAWA+D+LGWGFSDL   P C  ASKR+HLYQ+WKSYI+RP
Sbjct  84    DSSCLEWRCAYPLLEEAGLEAWAVDVLGWGFSDLGSCPPCSPASKRHHLYQIWKSYIRRP  143

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG +VAIDFA ++P AV KLVLINASVY E TG M KLPK   Y GVSLLK  
Sbjct  144   MVLVGPSLGGSVAIDFAYHYPXAVEKLVLINASVYAEXTGDMAKLPKAAXYAGVSLLKXT  203

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA +  F+ +SL+TT DWTNVGRLHCLLPWW+DA V+FM SGGYNVV QIK+V Q+
Sbjct  204   PLRFYANMLAFNXISLATTFDWTNVGRLHCLLPWWKDATVSFMSSGGYNVVSQIKQVKQK  263

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              LVI   +D ++S +  +RL  ELP AI+  + ++GHLPHVE P SVAKLIA+FA+ D
Sbjct  264   VLVICSEQDNIISYKQILRLRCELPFAIMRLLXDTGHLPHVENPASVAKLIAEFAQND  321



>gb|EPS70191.1| hypothetical protein M569_04568, partial [Genlisea aurea]
Length=321

 Score =   417 bits (1073),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 240/295 (81%), Gaps = 3/295 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEVH I+DP AR+LA+ IQRLPVQV FSE  IMSSC+ P I+ D  PVVLLHCF
Sbjct  30    FPSFLPKEVHNIRDPSARTLAKWIQRLPVQVDFSEKCIMSSCVVPKIRSDSNPVVLLHCF  89

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  +PLLE  GVEAWAIDILGWGFSDLE RP C+ A+KRYHLYQLWKS+I+RP
Sbjct  90    DSSCLEWRSVHPLLEGLGVEAWAIDILGWGFSDLETRPPCNVAAKRYHLYQLWKSHIQRP  149

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAAVAIDFA N+PEAV KL+LIN  VY    G M KLPK +AY  VSLLK+I
Sbjct  150   MVLVGPSLGAAVAIDFAANYPEAVEKLILINGCVYA---GPMKKLPKPLAYAMVSLLKAI  206

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YAKL  F+GLS+S  LD+TNVGRLHCL+PWWED+MV+FMLSGGYNV   IKKV ++
Sbjct  207   PLRCYAKLLVFEGLSMSQILDFTNVGRLHCLMPWWEDSMVDFMLSGGYNVTSLIKKVKKK  266

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
              LVI+  RD +V+ +L+ RL  ELP+AI  ++   GH+PHVE+P+ +A++IA+F+
Sbjct  267   ALVISSERDNIVNFKLSERLQEELPDAIGRRVSGCGHMPHVEKPYLIAEMIAEFS  321



>ref|XP_009139824.1| PREDICTED: uncharacterized protein LOC103863821 isoform X2 [Brassica 
rapa]
Length=333

 Score =   418 bits (1074),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 195/300 (65%), Positives = 238/300 (79%), Gaps = 4/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQG-DKEPVVLL  1030
             FP+FLPKEV +IKDPFAR+LA+RI R+PV  Q+G  +  +MSSCIKP++Q  DK PVVLL
Sbjct  32    FPVFLPKEVKDIKDPFARALAQRIVRIPVPLQMGNFKGCVMSSCIKPIVQQHDKSPVVLL  91

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRRTYPLLE   +E WAID+LGWGFSDL + P CDAASKR+HL++LWK+YI
Sbjct  92    HCFDSSCLEWRRTYPLLEQASLETWAIDVLGWGFSDLGKLPPCDAASKRHHLFELWKTYI  151

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG +  LPK +AY GV LL
Sbjct  152   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGALKDLPKSIAYAGVKLL  211

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMV+FM+SGGYNV   IK +
Sbjct  212   KSFPLRLLANVLAFSS-PLSENIDWTNIGRLHCQMPWWEDAMVDFMISGGYNVASHIKHI  270

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             NQ+TLV+    D++VSN+L+++L  EL NA+  ++P+SGHLPHVE P    KLI+DFA G
Sbjct  271   NQKTLVVCSENDQIVSNQLSVKLLCELQNAVFREVPDSGHLPHVENPKQFVKLISDFASG  330



>ref|XP_004239057.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Solanum lycopersicum]
Length=351

 Score =   418 bits (1075),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 241/299 (81%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP ++  IKDP+AR LA RI+R+PV +  S+  IMSSC+KP  Q +  PVVLLH F
Sbjct  39    FPDFLPIQIENIKDPYARKLASRIERIPVNL--SKGCIMSSCVKPKEQTEANPVVLLHGF  96

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T P+LED G+E WA+DILGWGFSDL R P+CD ASKR HLYQLW ++IK+P
Sbjct  97    DSSCLEWRYTLPMLEDAGLETWAVDILGWGFSDLGRLPSCDVASKRDHLYQLWSTHIKKP  156

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+V +PEAV +LVLI+ASVY EGTG +  LPK VAY GV LLKS+
Sbjct  157   MVLVGPSLGSAVAIDFSVKYPEAVDRLVLIDASVYAEGTGNLATLPKAVAYAGVYLLKSL  216

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+GL  ST +DWTN+GRLHC LPWWEDA+VNFM+SGGYNV+ QI+ V Q+
Sbjct  217   PLRLYATSLAFNGLPFSTCIDWTNIGRLHCSLPWWEDALVNFMISGGYNVISQIEHVKQK  276

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++ N+LA+RL  ELPNAI+ QIP  GH+PHVE+P +V++LIADF R D+
Sbjct  277   TLIIWGEDDQIIDNKLAVRLHCELPNAILRQIPKCGHIPHVEKPDAVSRLIADFVRPDQ  335



>ref|XP_004490171.1| PREDICTED: uncharacterized hydrolase YugF-like [Cicer arietinum]
Length=370

 Score =   419 bits (1076),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 194/311 (62%), Positives = 239/311 (77%), Gaps = 0/311 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP E+H +KDPFAR  A RIQRLPV V F+E+SIMSSC+KP++Q  + P+VLLH F
Sbjct  57    FPPFLPNEIHTVKDPFARKFAMRIQRLPVPVSFAENSIMSSCVKPLVQSKEPPIVLLHGF  116

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE+ G E WAIDILGWGF DL   P CD  SKR H YQ WKSYI+RP
Sbjct  117   DSSCLEWRYGYPLLEEAGFETWAIDILGWGFCDLANLPPCDVVSKRNHFYQFWKSYIRRP  176

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG+AVAIDF VNFPEAV KL+LI+ASVY +GTG +  LP+ VAY GVSLLKS+
Sbjct  177   MILVGPSLGSAVAIDFTVNFPEAVDKLILIDASVYSKGTGNLATLPRSVAYAGVSLLKSL  236

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F  +SL T LD TNVGRLHCLLPWW+DA V+FM SGGYNV   I+KV Q+
Sbjct  237   PLRLYANYLTFTNMSLRTILDGTNVGRLHCLLPWWDDATVDFMTSGGYNVSSLIRKVKQK  296

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D++++N+LA++L  ELP+AI+ QIP+ GH+PH+E P S  KLI +F + +  
Sbjct  297   TLIIWGENDRIINNKLAVQLHCELPDAILRQIPDCGHIPHLERPDSTIKLIVEFIQTENK  356

Query  300   TCVESYCKIKE  268
                +   ++++
Sbjct  357   KLSQCVSQVRQ  367



>ref|XP_010044416.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X2 [Eucalyptus 
grandis]
Length=324

 Score =   416 bits (1070),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 199/298 (67%), Positives = 236/298 (79%), Gaps = 6/298 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V  IKD +AR LA RI+RLPV +  S++ IMSSC+KP+++G+  PVVLLH F
Sbjct  22    FPPFLPKQVENIKDSYARKLASRIERLPVNL--SDNCIMSSCVKPLVKGETNPVVLLHGF  79

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLED G+E WA+DILGWGFSDL     C+ A+KR H YQLWKSYIK+P
Sbjct  80    DSSCLEWRYTYPLLEDAGLETWAVDILGWGFSDL----ACNVANKRNHFYQLWKSYIKKP  135

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAA+AIDFAV  PEAV KLVLI+ASVY EGTG M  LP+ +AY GVS+LKS 
Sbjct  136   MILVGPSLGAAIAIDFAVIHPEAVEKLVLIDASVYAEGTGDMANLPRAIAYAGVSILKSF  195

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR +  +  F GL LST LDWTNVGRLHC  PWWEDA V+FMLSGGYNV  QI +V QR
Sbjct  196   PLRFWVNVLAFRGLPLSTNLDWTNVGRLHCRYPWWEDASVDFMLSGGYNVTEQINQVKQR  255

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              L++ G  DK++S ELA++L  ELPN+I+ QIP+ GHLPHVE+P+ VA LIADF + D
Sbjct  256   ALIVWGEDDKIISKELAVKLHAELPNSILRQIPDCGHLPHVEKPNIVANLIADFVQED  313



>ref|XP_009793906.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Nicotiana sylvestris]
Length=357

 Score =   417 bits (1073),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 239/299 (80%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V  IKDPFAR LA RI+RLPV   FS+  +MSSC+KP  Q +  PVVLLH F
Sbjct  60    FPDFLPKQVENIKDPFARKLASRIERLPVN--FSKGCVMSSCVKPKEQTEANPVVLLHGF  117

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DS+CLEWR   PLLE+ G+E WA+DILGWGFSDLER P+CD ASKR HLYQLW +YIKRP
Sbjct  118   DSTCLEWRYALPLLEEAGLETWAVDILGWGFSDLERLPSCDVASKRDHLYQLWSTYIKRP  177

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+VN+PEAV +LVLI+A VY EGTG +  LPK +AY GV LLKSI
Sbjct  178   MVLVGPSLGSAVAIDFSVNYPEAVDRLVLIDACVYAEGTGSLATLPKALAYAGVYLLKSI  237

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+GL L+T +DWTN+GRLHCLLPWWED  VNFM+SGGYNV+ QI+ V Q+
Sbjct  238   PLRLYATSLTFNGLPLNTCIDWTNIGRLHCLLPWWEDTTVNFMISGGYNVIDQIQHVKQK  297

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++  +LA+RL  ELPNAI+ Q+P  GH+PHVE+P +V++LI +F   D+
Sbjct  298   TLIIWGEDDQIIDYKLAVRLHCELPNAIICQVPKCGHIPHVEKPDAVSRLILEFIHSDQ  356



>ref|XP_004144177.1| PREDICTED: uncharacterized hydrolase YugF-like [Cucumis sativus]
 ref|XP_004171701.1| PREDICTED: uncharacterized hydrolase YugF-like [Cucumis sativus]
 gb|KGN47647.1| hypothetical protein Csa_6G366450 [Cucumis sativus]
Length=338

 Score =   416 bits (1069),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 236/304 (78%), Gaps = 2/304 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
              P FLPKEV+ IKD  AR+LA RIQRLPV   FS+  IMSSC+KP IQ    PVVLLH F
Sbjct  32    LPSFLPKEVYNIKDQSARNLASRIQRLPV--SFSDFCIMSSCVKPSIQNKDCPVVLLHGF  89

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P CD  SKR HLYQLWKSYIK+P
Sbjct  90    DSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPPCDVTSKRVHLYQLWKSYIKKP  149

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M++VGPSLGAAVAIDFAVN+PEAV +LVLI+ASVY EGTG +  LP+ +AY GV LLKSI
Sbjct  150   MVIVGPSLGAAVAIDFAVNYPEAVDRLVLIDASVYAEGTGNLATLPRSIAYAGVFLLKSI  209

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y  +  F G+  ST+LDW N+GRLHCLLPWWEDA V+FMLSGGY V  QI+KV Q+
Sbjct  210   PLRVYVNVLTFTGIPFSTSLDWANIGRLHCLLPWWEDATVSFMLSGGYKVSSQIEKVKQK  269

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++S +L +RL  ELPNA++  I   GHLPHVE+P+ VAKLI  F   D  
Sbjct  270   TLIIWGEDDQIISYKLGVRLHCELPNAVIRPIAECGHLPHVEKPNLVAKLITQFVHEDSR  329

Query  300   TCVE  289
               V+
Sbjct  330   KEVQ  333



>emb|CDY36414.1| BnaC05g10150D [Brassica napus]
Length=335

 Score =   416 bits (1069),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 232/296 (78%), Gaps = 0/296 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP++V  I+D FA  LA RI+RLPVQV FSE  IMSSC+ P+++ +  PVVLLH F
Sbjct  28    FPKFLPRDVERIRDTFALKLAARIERLPVQVSFSEDRIMSSCVTPLMRKETSPVVLLHGF  87

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA DILGWGFSDLE+ P CD ASKR H Y+ WK++I+RP
Sbjct  88    DSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLEKLPPCDVASKREHFYKFWKTHIERP  147

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKS+
Sbjct  148   VVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYSEGTGNLATLPKAAAYAGVYLLKSV  207

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA   CF+G+SL T  DWT +GRLHCL PWWEDA V+FM SGGYNV   IKKV+Q+
Sbjct  208   PLRLYANFLCFNGVSLETKWDWTKIGRLHCLYPWWEDAAVSFMTSGGYNVTSLIKKVSQK  267

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             TL++ G  D+++SN+LA RL  ELPNA V QI + GHLPHVE+P + AKLI +F R
Sbjct  268   TLIVWGEDDQIISNKLAWRLHGELPNATVKQISDCGHLPHVEKPAAAAKLITEFVR  323



>ref|NP_172837.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAS99680.1| At1g13820 [Arabidopsis thaliana]
 gb|AAT41824.1| At1g13820 [Arabidopsis thaliana]
 dbj|BAF01153.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29072.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=339

 Score =   416 bits (1069),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 197/302 (65%), Positives = 234/302 (77%), Gaps = 3/302 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V +IKD FA  LA RI+RLPV V F E SIMSSC+ P+++ +  PVVLLH F
Sbjct  32    FPTFLPTDVEKIKDTFALKLAARIERLPVSVSFREDSIMSSCVTPLMRNETTPVVLLHGF  91

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA DILGWGFSDL++ P CD ASKR H Y+ WKS+IKRP
Sbjct  92    DSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLDKLPPCDVASKREHFYKFWKSHIKRP  151

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKSI
Sbjct  152   VVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYAEGTGNLATLPKAAAYAGVYLLKSI  211

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y    CF+G+SL T+ DWT +GRLHCL PWWEDA V+FM SGGYNV   IKKV+Q+
Sbjct  212   PLRLYVNFICFNGISLETSWDWTKIGRLHCLYPWWEDATVSFMTSGGYNVTSLIKKVSQK  271

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL++ G  D+++SN+LA RL  EL NA V QI N GHLPHVE+P +V KLIA+F R   +
Sbjct  272   TLILWGEDDQIISNKLAWRLHGELSNARVKQISNCGHLPHVEKPAAVTKLIAEFVR---E  328

Query  300   TC  295
             TC
Sbjct  329   TC  330



>ref|XP_011070944.1| PREDICTED: monoacylglycerol lipase ABHD6 [Sesamum indicum]
Length=347

 Score =   415 bits (1066),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 244/306 (80%), Gaps = 0/306 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP EV +IKDPFAR LA RI+RLPV +  +++ IMSSC+KP  Q DK P+VLLH F
Sbjct  39    FPAFLPSEVEKIKDPFARKLASRIERLPVHLSLAKTCIMSSCVKPKTQLDKSPLVLLHGF  98

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T PLLE+ G+E WAID+LGWGFSDLE+ P+C  ASKR HLYQ WKSYIKRP
Sbjct  99    DSSCLEWRYTLPLLEEEGLETWAIDVLGWGFSDLEKLPSCSVASKRDHLYQFWKSYIKRP  158

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M LVGPSLGAAVAIDF + +PEAV KL+LI+ASVY EGTG + KLPK+VAY GV+LLKS+
Sbjct  159   MTLVGPSLGAAVAIDFVIQYPEAVDKLILIDASVYAEGTGNLAKLPKLVAYAGVNLLKSL  218

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+ LS ST  DW N+GRLHCLLPWWEDA V+FM+SGGYNV   IKKV Q+
Sbjct  219   PLRLYATSLAFNSLSWSTCFDWANIGRLHCLLPWWEDATVDFMISGGYNVSPDIKKVKQK  278

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++ N+LA+RL  ELPNAI+ Q+P+ GH+PHVE+P +V+KLIA+F + +  
Sbjct  279   TLIIWGEDDQIIDNKLAVRLHCELPNAIIRQLPDCGHIPHVEKPAAVSKLIAEFVQAECK  338

Query  300   TCVESY  283
                 S+
Sbjct  339   IATPSF  344



>ref|XP_006348698.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Solanum tuberosum]
Length=351

 Score =   415 bits (1066),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 240/299 (80%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V  IKDP+AR LA RI+R+PV +   +  +MSSC+KP  Q +  PVVLLH F
Sbjct  39    FPDFLPKQVENIKDPYARKLASRIERIPVNL--LKGCVMSSCVKPKEQTEANPVVLLHGF  96

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T P+LED G+E WAIDILGWGFSDL R P+CD ASKR HLYQLW ++IKRP
Sbjct  97    DSSCLEWRYTLPMLEDAGLETWAIDILGWGFSDLGRLPSCDVASKRDHLYQLWSTHIKRP  156

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+V +PEAV +LVLI+ASVY EGTG +  LPK VAY GV LLKS+
Sbjct  157   MVLVGPSLGSAVAIDFSVKYPEAVDRLVLIDASVYAEGTGNLATLPKAVAYAGVYLLKSL  216

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+GL  ST +DWTN+GRLHC LPWWEDA+VNFM+SGGYNV+ QI+ V Q+
Sbjct  217   PLRLYATSLAFNGLPFSTCIDWTNIGRLHCSLPWWEDALVNFMISGGYNVISQIEHVKQK  276

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++  +LA+RL  ELPNAI+ QIP  GH+PHVE+P +V++LIA+FA  D+
Sbjct  277   TLIIWGEDDQIIDYKLAVRLHCELPNAILRQIPQCGHIPHVEKPDAVSRLIANFAHPDQ  335



>ref|XP_008791305.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Phoenix 
dactylifera]
Length=326

 Score =   414 bits (1063),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 237/298 (80%), Gaps = 0/298 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP F+PKEV  I+D  AR LA+RI+RLPV+V F+ SSIMSSC+KP  +  KEP+VLLH F
Sbjct  27    FPSFIPKEVERIRDLAARELAKRIERLPVKVSFTNSSIMSSCVKPSQKRGKEPIVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T PLLED G+E WA+DILGWGFSDLE  P  + A+KR HL+QLW+ YIKRP
Sbjct  87    DSSCLEWRYTLPLLEDAGLETWAVDILGWGFSDLEMLPPSNVAAKREHLFQLWRLYIKRP  146

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAAVAIDFA N PE V KLVLI+ASVY EGTG MTKLP+ +AY GV LLKSI
Sbjct  147   MVLVGPSLGAAVAIDFAANHPEEVSKLVLIDASVYAEGTGTMTKLPRALAYAGVLLLKSI  206

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA    F+ +S  + LDW NVGRLHCLLPWWED  V+FM+SGGYNV  QIK++ Q+
Sbjct  207   PLRFYANTLAFNKVSFGSALDWANVGRLHCLLPWWEDTTVDFMVSGGYNVSSQIKQIKQK  266

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             +L+I G  D+++S+  A+RL +EL N+++H+IP  GH+PHVE+P SVA+ I +F +GD
Sbjct  267   SLIIWGEDDQIISSTNALRLQKELQNSVLHRIPECGHIPHVEKPMSVAESILEFLQGD  324



>gb|KFK33206.1| hypothetical protein AALP_AA6G344600 [Arabis alpina]
Length=333

 Score =   414 bits (1064),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 236/301 (78%), Gaps = 4/301 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQ--GDKEPVVL  1033
             FP FLPKEV  +KDPFAR+LA+RI R+PV  Q+G  +  +MSSCIKP++Q   +  PVVL
Sbjct  30    FPAFLPKEVKNVKDPFARALAQRIVRIPVPLQIGNFKGCVMSSCIKPLVQLHDNSSPVVL  89

Query  1032  LHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSY  853
             LHCFDSSCLEWRRTYPLLE   +E WAID+LGWGFSDL + P CDAASKR+HL++LWK+Y
Sbjct  90    LHCFDSSCLEWRRTYPLLEQASLETWAIDVLGWGFSDLGKLPPCDAASKRHHLFELWKTY  149

Query  852   IKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSL  673
             IKRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG + +LPK +AY GV  
Sbjct  150   IKRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGRLKELPKSIAYAGVKF  209

Query  672   LKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKK  493
             LKS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMV+FM+SGGYNV  +IK 
Sbjct  210   LKSFPLRLLANVLAFSSSPLSENIDWTNIGRLHCQMPWWEDAMVDFMISGGYNVASRIKL  269

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             +N +TLVI    D++VSN+L+++L  EL NA+  ++P+SGHLPHVE P  + KLI+DFA 
Sbjct  270   INHKTLVICSENDQIVSNQLSVKLLCELQNAVFREVPDSGHLPHVENPKQIVKLISDFAN  329

Query  312   G  310
             G
Sbjct  330   G  330



>ref|XP_006348804.1| PREDICTED: epoxide hydrolase 4-like [Solanum tuberosum]
Length=383

 Score =   416 bits (1069),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 241/299 (81%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V +IKDP+AR++A RI+R+PV    S+  +MSSC+KP  Q +  PVVLLH F
Sbjct  43    FPDFLPKQVEKIKDPYARNMASRIERIPVN--LSKDRVMSSCVKPKEQKEANPVVLLHGF  100

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DS+CLEWR T PLLE+ G+E WAIDILGWGFSDLER P+CD ASKR HLYQLW +YIKRP
Sbjct  101   DSTCLEWRYTLPLLEEAGLETWAIDILGWGFSDLERLPSCDVASKRDHLYQLWSTYIKRP  160

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+VN+PEAV +LVLINASVY +GTG +  LPK VAY GV LLKSI
Sbjct  161   MVLVGPSLGSAVAIDFSVNYPEAVDRLVLINASVYAKGTGKLATLPKTVAYAGVYLLKSI  220

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             P+R+YA    F+GL LST+++WTN+GRLHCLLPWWEDA V+FM+SGGYNV+ QI+ V  +
Sbjct  221   PIRLYATSLAFNGLPLSTSIEWTNIGRLHCLLPWWEDATVDFMISGGYNVIDQIEHVKHK  280

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D ++  +L +RL  ELPNA + QIP  GH+PHV++P  V++LIA+F + D+
Sbjct  281   TLIILGEDDHIIDYKLGVRLHCELPNATLRQIPKCGHIPHVQKPDVVSRLIAEFVQSDQ  339



>ref|XP_010939161.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X2 [Elaeis guineensis]
Length=326

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 238/298 (80%), Gaps = 0/298 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  I+DP AR LA+RI+RLPV+V F+ S IMSSC+KP  +  KEP+VLLH F
Sbjct  27    FPSFLPKEVERIRDPAARELAKRIERLPVKVSFTNSPIMSSCVKPSQKRGKEPIVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T PLL+D G+E WA+DILGWGFSDLE  P  + A+KR HL+QLW+ YI+RP
Sbjct  87    DSSCLEWRYTLPLLDDAGLETWAVDILGWGFSDLEMFPPSNVAAKREHLFQLWRLYIQRP  146

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAAVAIDFA N PE V KLVLI+AS+Y EGTG MTKLP+ +AY GV +LKSI
Sbjct  147   MVLVGPSLGAAVAIDFAANHPEEVSKLVLIDASIYAEGTGTMTKLPRALAYAGVFVLKSI  206

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA    F+ +SL + LDWTNVGRLHCLLPWWED  V+FM+SGGYNV  QIK++ Q+
Sbjct  207   PLRFYANTLAFNKVSLGSALDWTNVGRLHCLLPWWEDTTVDFMVSGGYNVSSQIKQIKQK  266

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             +L+I G  D+++ +  A+RL ++L N+++HQIP  GH+PHVE+P SVA+ I +F +GD
Sbjct  267   SLIIWGEDDRIIRSTNALRLQKDLQNSVLHQIPECGHIPHVEKPKSVAESILEFLQGD  324



>ref|XP_009148670.1| PREDICTED: monoacylglycerol lipase abhd6-B [Brassica rapa]
Length=335

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 233/302 (77%), Gaps = 3/302 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V  IKD FA  LA RI+RLPV+V FSE  IMSSC+ P+++ +  PVVLLH F
Sbjct  28    FPTFLPGDVERIKDKFALKLAARIERLPVKVSFSEDRIMSSCVTPLMRKETSPVVLLHGF  87

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA DILGWGFSDLE+ P CD ASKR H Y+ WK++I+RP
Sbjct  88    DSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLEKLPPCDVASKREHFYKFWKTHIERP  147

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKS+
Sbjct  148   VVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYSEGTGNLATLPKAAAYAGVYLLKSV  207

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA   CF G+SL T  DWT +GRLHCL PWWEDA V+FM SGGYNV   IKKV+Q+
Sbjct  208   PLRLYANFLCFKGVSLETKWDWTKIGRLHCLYPWWEDAAVSFMTSGGYNVTSLIKKVSQK  267

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL++ G  D+++SN+LA RL  ELPNA V QI + GHLPHVE+P + AKLI +F R   +
Sbjct  268   TLIVWGEDDQIISNKLAWRLHGELPNASVKQISDCGHLPHVEKPAAAAKLITEFVR---E  324

Query  300   TC  295
             TC
Sbjct  325   TC  326



>emb|CDX98133.1| BnaA06g08840D [Brassica napus]
Length=335

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 235/302 (78%), Gaps = 3/302 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP+++  IKD FA  LA RI+RLPV+V FSE  IMSSC+ P+++ +  PVVLLH F
Sbjct  28    FPTFLPRDIERIKDTFALKLAARIERLPVKVSFSEDRIMSSCVTPLMRKETSPVVLLHGF  87

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLL++ G+E WA DILGWGFSDLE+ P CD ASKR H Y+ WK++I+RP
Sbjct  88    DSSCLEWRYTYPLLDEAGLETWAFDILGWGFSDLEKLPPCDVASKREHFYKFWKTHIERP  147

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKS+
Sbjct  148   VVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYSEGTGNLATLPKAAAYAGVYLLKSV  207

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA   CF+G+SL T  DWT +GRLHCL PWWEDA V+FM SGGYNV   IKKV+Q+
Sbjct  208   PLRLYANFLCFNGVSLETKWDWTKIGRLHCLYPWWEDAAVSFMTSGGYNVTSLIKKVSQK  267

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL++ G  D+++SN+LA RL  ELPNA V QI + GHLPHVE+P + AKLI +F R   +
Sbjct  268   TLIVWGEDDQIISNKLAWRLHGELPNASVKQISDCGHLPHVEKPAAAAKLITEFVR---E  324

Query  300   TC  295
             TC
Sbjct  325   TC  326



>gb|KFK43632.1| hypothetical protein AALP_AA1G151700 [Arabis alpina]
Length=335

 Score =   412 bits (1059),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 231/296 (78%), Gaps = 0/296 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V +IKD FA  LA R++RLPVQV F++  IMSSC+ P+I+ +  PVVLLH F
Sbjct  28    FPTFLPSDVEKIKDSFALKLAARMERLPVQVSFTKDRIMSSCVTPLIRNETSPVVLLHGF  87

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA DILGWGFSDL + P CD ASKR H Y+ WKS+IKRP
Sbjct  88    DSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLVKLPPCDVASKREHFYKFWKSHIKRP  147

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLG+AVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV +LKS+
Sbjct  148   VVLVGPSLGSAVAIDIAVNHPEAVESLVLMDASVYTEGTGNLATLPKAAAYAGVYILKSV  207

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+G+SL T+ DWT +GRLHCL PWWEDAMV+FM SGGYNV   IKKV+Q+
Sbjct  208   PLRLYANFLSFNGISLETSWDWTKIGRLHCLYPWWEDAMVSFMTSGGYNVTSLIKKVSQK  267

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             TL+I G  D+++SN+LA RL  ELPNA V QI N GHLPHVE+P + AKLI  F +
Sbjct  268   TLIIWGEDDQIISNKLAWRLHGELPNARVEQISNCGHLPHVEKPAAAAKLITKFVK  323



>ref|XP_004239058.1| PREDICTED: epoxide hydrolase 4-like [Solanum lycopersicum]
Length=382

 Score =   413 bits (1062),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 241/299 (81%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V +IKDP+AR++A RI+R+PV +  S+  +MSSC+KP  + +  PVVLLH F
Sbjct  42    FPDFLPKQVEKIKDPYARNMASRIERIPVNL--SKDRVMSSCVKPKEKKEANPVVLLHGF  99

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DS+CLEWR T PLLE+ G+E WAIDILGWGFSDLER P+CD ASKR HLYQLW +YIKRP
Sbjct  100   DSTCLEWRYTLPLLEEAGLETWAIDILGWGFSDLERLPSCDVASKRDHLYQLWSTYIKRP  159

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+V++PEAV +LVLINASVY +GTG +  LPK VAY GV LLKS+
Sbjct  160   MVLVGPSLGSAVAIDFSVSYPEAVDRLVLINASVYAKGTGKLATLPKTVAYAGVYLLKSL  219

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             P+R+YA    F+GL LST ++WTN+GRLHCLLPWWEDA VNFM+SGGYNV+ QI+ V  +
Sbjct  220   PIRLYATSLAFNGLPLSTCIEWTNIGRLHCLLPWWEDATVNFMISGGYNVIDQIEHVKHK  279

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D ++  +L +RL  ELPNA + QIP  GH+PHVE+P  V++LIA+F + D+
Sbjct  280   TLIILGEDDHIIDYKLGVRLHCELPNATLRQIPKCGHIPHVEKPEVVSRLIAEFVQSDQ  338



>ref|XP_006285675.1| hypothetical protein CARUB_v10007139mg [Capsella rubella]
 gb|EOA18573.1| hypothetical protein CARUB_v10007139mg [Capsella rubella]
Length=330

 Score =   411 bits (1056),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/300 (64%), Positives = 237/300 (79%), Gaps = 3/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQ-GDKEPVVLL  1030
             FP FLPKEV  I+DPFAR+LA+RI R+PV  Q+G    ++MSSCIKP++Q  D+ PVVLL
Sbjct  28    FPAFLPKEVQNIRDPFARALAQRIVRVPVPLQMGNFRGNVMSSCIKPLVQLHDQSPVVLL  87

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRRTYPLLE   +E WA+D+LGWGFSDLE  P CDAASKR+HL++LWK+YI
Sbjct  88    HCFDSSCLEWRRTYPLLEQACLETWAVDVLGWGFSDLENLPPCDAASKRHHLFELWKTYI  147

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF + +PEAV KLVLINA+ Y EGTG + +LP  VAY GV LL
Sbjct  148   KRPMILVGPSLGATVAVDFTLTYPEAVDKLVLINANAYSEGTGRLKELPIAVAYAGVKLL  207

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMV+FM+SGGYNV   IK +
Sbjct  208   KSFPLRLLANVLAFVSSPLSENIDWTNIGRLHCQMPWWEDAMVDFMISGGYNVASHIKLI  267

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             + +TLV+    D++VSN+L+++L  EL NA+  ++P+SGHLPHVE P  + KLI+DFA G
Sbjct  268   DHKTLVVCSENDQIVSNQLSVKLLCELANAVFREVPDSGHLPHVENPKHIVKLISDFASG  327



>ref|XP_009140214.1| PREDICTED: uncharacterized protein LOC103864211 isoform X1 [Brassica 
rapa]
Length=325

 Score =   411 bits (1056),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/300 (64%), Positives = 234/300 (78%), Gaps = 4/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQ-GDKEPVVLL  1030
             FP FLPKEV +IKDPFAR+LA++I R+PV  Q+      +MSSCIKP +Q  DK PVVLL
Sbjct  24    FPTFLPKEVKDIKDPFARALAQKIVRIPVPLQMENFRGCVMSSCIKPTVQLPDKSPVVLL  83

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRR YPLLE+  +E WAID+LGWGFSDL++ P CDAASKR+HL++LWK+YI
Sbjct  84    HCFDSSCLEWRRAYPLLEEACLETWAIDVLGWGFSDLQKLPPCDAASKRHHLFELWKTYI  143

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG +  LPK +AY GV LL
Sbjct  144   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGALKDLPKSIAYAGVKLL  203

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMVNFM+SGGYNV   IK +
Sbjct  204   KSFPLRLLANVLAFSS-PLSENIDWTNIGRLHCQMPWWEDAMVNFMISGGYNVASHIKLI  262

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             N +TLVI    D++VSN+L+++L  EL NA+  ++P+SGHLPHVE P    KLI+DFA G
Sbjct  263   NHKTLVICSENDQIVSNQLSVKLLCELQNAVFREVPDSGHLPHVENPKQFVKLISDFASG  322



>ref|XP_010476412.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Camelina sativa]
Length=337

 Score =   410 bits (1055),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 233/303 (77%), Gaps = 4/303 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP +V  IKD FA  LA RI+RLPV V F+E SIMSSC+ P+ + +   PVVLLH 
Sbjct  29    FPTFLPSDVERIKDKFALKLAARIERLPVSVSFTEKSIMSSCVTPLTRNETTSPVVLLHG  88

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR TYPLLE+ G+E WA DILGWGFSDL + PTCD  SKR H Y+ WK++IKR
Sbjct  89    FDSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLGKLPTCDVTSKREHFYKFWKTHIKR  148

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P++LVGPSLGAAVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKS
Sbjct  149   PVVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYAEGTGDLATLPKAAAYAGVYLLKS  208

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             IPLR+Y    CF+G++L T+ DWT +GRLHCL PWWEDA V+FM SGGYNV   IKKV+Q
Sbjct  209   IPLRLYVNFICFNGITLETSWDWTKIGRLHCLYPWWEDATVSFMTSGGYNVTSLIKKVSQ  268

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             +TL++ G  D+++SN+LA RL  ELPNA V QI + GHLPHVE+P +VAKLI +F R   
Sbjct  269   KTLILWGEDDQIISNKLAWRLHGELPNARVAQISDCGHLPHVEKPATVAKLITEFVR---  325

Query  303   DTC  295
             +TC
Sbjct  326   ETC  328



>emb|CDP00428.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   410 bits (1054),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 191/294 (65%), Positives = 235/294 (80%), Gaps = 0/294 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP++V  IKDPFAR LA RI+RLPVQV F +S IM+SC+KP     K PV+LLH F
Sbjct  49    FPSFLPEQVENIKDPFARKLASRIERLPVQVSFLDSCIMTSCVKPEGDSKKSPVLLLHGF  108

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T PLLE  G+E WAIDILGWGFSDL+  P CD ASKR HL++ W SYI RP
Sbjct  109   DSSCLEWRYTLPLLEQAGLETWAIDILGWGFSDLKCLPPCDVASKRDHLHKFWSSYINRP  168

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M +VGPSLGAAVAIDFAV +PEAV KL+L++ASVY EGTG + KLPK +AY GVSLLKS+
Sbjct  169   MTIVGPSLGAAVAIDFAVRYPEAVDKLILVDASVYAEGTGDLAKLPKTLAYAGVSLLKSL  228

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA  + F+GL L+T  DWTN+GRLHCLLPWWE+A V+FM+SGGYNVV  I  V Q+
Sbjct  229   PLRLYATSKAFNGLPLNTLFDWTNIGRLHCLLPWWEEATVDFMISGGYNVVAHIGHVKQK  288

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             TL++ G  D+++ ++LA+RL  ELPNAI+ QI + GH+PHVE+P +V++LI +F
Sbjct  289   TLILWGENDQIIDSQLALRLHSELPNAIIRQIQDCGHIPHVEKPAAVSELITEF  342



>ref|XP_009596052.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Nicotiana tomentosiformis]
Length=372

 Score =   411 bits (1057),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 193/305 (63%), Positives = 239/305 (78%), Gaps = 2/305 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V  IKDPFAR LA RI+RLPV +  S+  +MSSC+KP  Q +  P+VLLH F
Sbjct  60    FPDFLPKQVENIKDPFARKLASRIERLPVNL--SKGCVMSSCVKPKEQTEANPIVLLHGF  117

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DS+CLEWR T PLLE+ G+E WA+DILGWGFSDLER P+CD ASKR HLYQLW +YIKRP
Sbjct  118   DSTCLEWRYTLPLLEEAGLETWAVDILGWGFSDLERLPSCDVASKRDHLYQLWCTYIKRP  177

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+VN+PEAV +LVLI+A VY EGTG +  LPK +AY GV LLKSI
Sbjct  178   MVLVGPSLGSAVAIDFSVNYPEAVDRLVLIDACVYAEGTGSLATLPKALAYAGVYLLKSI  237

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+GL LST +DWT++GRLHCLLPWWED  VNFM+SGGYNV+ QI+ V Q+
Sbjct  238   PLRLYATSLTFNGLPLSTCIDWTHIGRLHCLLPWWEDITVNFMISGGYNVIDQIQHVKQK  297

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
              L+I G  D+++  + A+RL  ELPNAI+  IP  GH+PHVE+P +V++LI +F   D+ 
Sbjct  298   ALIIWGEDDQIIDYKFAVRLHSELPNAILRLIPKCGHIPHVEKPDAVSRLIVEFVHSDQS  357

Query  300   TCVES  286
                +S
Sbjct  358   QKAKS  362



>ref|XP_006417085.1| hypothetical protein EUTSA_v10008133mg [Eutrema salsugineum]
 gb|ESQ35438.1| hypothetical protein EUTSA_v10008133mg [Eutrema salsugineum]
Length=338

 Score =   409 bits (1052),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 232/302 (77%), Gaps = 3/302 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V  IKD FA  LA RI+RLPVQV F+E  IMSSC+ P+++ +  PVVLLH F
Sbjct  31    FPTFLPSDVERIKDTFALKLAARIERLPVQVSFAEDRIMSSCVTPLMRNETSPVVLLHGF  90

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA DILGWGFSDL + P CD ASKR H Y+ WKS+IKRP
Sbjct  91    DSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLGKLPPCDVASKREHFYKFWKSHIKRP  150

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVA+D AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKSI
Sbjct  151   VVLVGPSLGAAVAVDIAVNHPEAVESLVLMDASVYAEGTGNLATLPKAAAYAGVYLLKSI  210

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+G+SL T+ DWT +GRLHCL PWWEDA V+FM SGGYNV   IKKV+Q+
Sbjct  211   PLRLYANFLSFNGISLETSWDWTKIGRLHCLYPWWEDAAVSFMTSGGYNVTSLIKKVSQK  270

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL++ G  D+++SN+LA RL  EL  A V QI + GHLPHVE+P +VAKLI +F R   +
Sbjct  271   TLILWGEDDQIISNKLAWRLHGELSKARVEQISDCGHLPHVEKPAAVAKLITEFVR---E  327

Query  300   TC  295
             TC
Sbjct  328   TC  329



>ref|XP_009596053.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Nicotiana 
tomentosiformis]
Length=349

 Score =   410 bits (1053),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 235/299 (79%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V  IKD  AR LA RI+R+PV    S+  ++SSC+KP  Q +  PVVLLH F
Sbjct  37    FPDFLPNQVENIKDSSARKLASRIERVPVN--LSKGCVLSSCVKPKEQTEANPVVLLHGF  94

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T P+LE+ G+E WA+DILGWGFSDLER P+CD ASK  HLYQLW +YIKRP
Sbjct  95    DSSCLEWRYTLPMLEEAGLETWAVDILGWGFSDLERLPSCDVASKHDHLYQLWSTYIKRP  154

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+V +PEAV+KLVLI+ASVY EGTG +  LPK VAY GV LLKS+
Sbjct  155   MVLVGPSLGSAVAIDFSVKYPEAVYKLVLIDASVYAEGTGNLATLPKAVAYAGVYLLKSV  214

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+GL L+T +DWTN+GRLHCLLPWWEDA VNFM+SGGYNVV QI+ V Q+
Sbjct  215   PLRLYATSLSFNGLPLNTCIDWTNIGRLHCLLPWWEDATVNFMISGGYNVVAQIEHVKQK  274

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++  +L +RL  ELPNAI+ QIP  GH+PHVE+P  V++LI +F   D+
Sbjct  275   TLIIWGEDDQIIDYKLGVRLHCELPNAIIRQIPKCGHIPHVEKPDVVSRLIVEFVHSDQ  333



>ref|XP_009139823.1| PREDICTED: uncharacterized protein LOC103863821 isoform X1 [Brassica 
rapa]
Length=344

 Score =   409 bits (1052),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/311 (63%), Positives = 238/311 (77%), Gaps = 15/311 (5%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQG-DKEPVVLL  1030
             FP+FLPKEV +IKDPFAR+LA+RI R+PV  Q+G  +  +MSSCIKP++Q  DK PVVLL
Sbjct  32    FPVFLPKEVKDIKDPFARALAQRIVRIPVPLQMGNFKGCVMSSCIKPIVQQHDKSPVVLL  91

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRRTYPLLE   +E WAID+LGWGFSDL + P CDAASKR+HL++LWK+YI
Sbjct  92    HCFDSSCLEWRRTYPLLEQASLETWAIDVLGWGFSDLGKLPPCDAASKRHHLFELWKTYI  151

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGG----  682
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG +  LPK +AY G    
Sbjct  152   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGALKDLPKSIAYAGVCLK  211

Query  681   -------VSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSG  523
                    V LLKS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMV+FM+SG
Sbjct  212   TLAAFPLVKLLKSFPLRLLANVLAFSS-PLSENIDWTNIGRLHCQMPWWEDAMVDFMISG  270

Query  522   GYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHS  343
             GYNV   IK +NQ+TLV+    D++VSN+L+++L  EL NA+  ++P+SGHLPHVE P  
Sbjct  271   GYNVASHIKHINQKTLVVCSENDQIVSNQLSVKLLCELQNAVFREVPDSGHLPHVENPKQ  330

Query  342   VAKLIADFARG  310
               KLI+DFA G
Sbjct  331   FVKLISDFASG  341



>ref|XP_006348697.1| PREDICTED: epoxide hydrolase 3-like [Solanum tuberosum]
Length=362

 Score =   410 bits (1053),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/299 (64%), Positives = 238/299 (80%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V +IKDP+AR LA RI+R+PV   FS+  +MSSC+KP  Q +  PVVLLH F
Sbjct  36    FPDFLPKQVEKIKDPYARKLASRIERIPVN--FSKGCVMSSCVKPKEQKEANPVVLLHGF  93

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DS+CLEWR T PLLE+ G+E WA+DILGWGFSDL R P+CD ASKR HLYQLW +YIKRP
Sbjct  94    DSTCLEWRYTLPLLEEAGLETWAVDILGWGFSDLGRLPSCDVASKRDHLYQLWSTYIKRP  153

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+V++PEAV +LVLI+ASVY EGTG +  LPK VAY GV LLKSI
Sbjct  154   MVLVGPSLGSAVAIDFSVHYPEAVERLVLIDASVYAEGTGKLATLPKAVAYAGVYLLKSI  213

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F+GL +ST +DWT +GRLHCLLPWWEDA VNFM+SGGYNV+ QIK V  +
Sbjct  214   PLRLYAASLAFNGLPISTCIDWTKIGRLHCLLPWWEDATVNFMISGGYNVIDQIKHVKHK  273

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++  +L +RL  E+P+A + QIP  GH+PHV++P  V++LI +F + D+
Sbjct  274   TLIIWGEDDQIIDYKLGVRLHCEIPSATLRQIPQCGHIPHVQKPDVVSRLITEFVQSDQ  332



>ref|XP_006405655.1| hypothetical protein EUTSA_v10027834mg [Eutrema salsugineum]
 gb|ESQ47108.1| hypothetical protein EUTSA_v10027834mg [Eutrema salsugineum]
Length=331

 Score =   408 bits (1049),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/300 (64%), Positives = 233/300 (78%), Gaps = 4/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQ-GDKEPVVLL  1030
             FP FLPKEV  IKDPFAR+LA+RI R+PV  Q+G     +MSSCIKP +Q  DK PVVLL
Sbjct  30    FPAFLPKEVKNIKDPFARALAQRIVRIPVPLQIGNFRGCVMSSCIKPTVQLHDKSPVVLL  89

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRRTYPLLE   +E WAID+LGWGFSDL++ P CDAASKR+HL++LWK+YI
Sbjct  90    HCFDSSCLEWRRTYPLLEQACLETWAIDVLGWGFSDLQKLPPCDAASKRHHLFELWKTYI  149

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EG G + +LPK +AY GV LL
Sbjct  150   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGIGALKELPKSIAYAGVKLL  209

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMV+FM+SGGYNV   IK +
Sbjct  210   KSFPLRLLANVLAFSS-PLSENIDWTNIGRLHCQMPWWEDAMVDFMISGGYNVASHIKLI  268

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             N +TLV+    D++VSN+L+++L  EL NA+  ++ +SGHLPHVE P    KLI+DFA G
Sbjct  269   NHKTLVVCSENDQIVSNQLSVKLLCELQNAVFREVSDSGHLPHVENPKHFVKLISDFASG  328



>ref|XP_010458848.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Camelina sativa]
Length=334

 Score =   408 bits (1049),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/303 (64%), Positives = 233/303 (77%), Gaps = 4/303 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP +V  IKD FA  LA RI+RLPV V F+E +IMSSC+ P+I+ +   PVVLLH 
Sbjct  26    FPTFLPSDVERIKDKFALKLATRIERLPVSVSFTEKTIMSSCVTPLIRNETTSPVVLLHG  85

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR TYPLLE+ G+E WA DILGWGFSDL + P CD ASKR H Y+ W+++IKR
Sbjct  86    FDSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLGKLPPCDVASKREHFYKFWETHIKR  145

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P++LVGPSLGAAVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKS
Sbjct  146   PVVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYAEGTGDLATLPKAAAYAGVYLLKS  205

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             IPLR+Y    CF+G++L T+ DWT +GRLHCL PWWEDA V+FM SGGYNV   IKKV+Q
Sbjct  206   IPLRLYVNFICFNGITLETSWDWTKIGRLHCLYPWWEDATVSFMTSGGYNVTSLIKKVSQ  265

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             +TL+I G  D+++SN LA RL  ELPNA V QI + GHLPHVE+P +VAKLI +F R   
Sbjct  266   KTLIIWGEDDQIISNTLAWRLHGELPNARVAQISDCGHLPHVEKPATVAKLITEFVR---  322

Query  303   DTC  295
             +TC
Sbjct  323   ETC  325



>ref|XP_004298378.1| PREDICTED: uncharacterized hydrolase YugF-like [Fragaria vesca 
subsp. vesca]
Length=326

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 235/305 (77%), Gaps = 5/305 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+VH IKD  AR LA RI+RLPV   F E  +MSSC+KP++  +  PVVLLH F
Sbjct  19    FPSFLPKQVHHIKDSSARKLAARIERLPV--SFGEDCVMSSCVKPLVHRETSPVVLLHGF  76

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+D+LGWGFSDLER P+C  ASKR HL+QLWKSYIK+P
Sbjct  77    DSSCLEWRYTYPLLEEAGLETWAVDVLGWGFSDLERLPSCSVASKRDHLFQLWKSYIKKP  136

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAAVAIDFA ++PEAV +LVLI+ASVY EGT     L KM+AY G  +LKS 
Sbjct  137   MVLVGPSLGAAVAIDFATSYPEAVERLVLIDASVYTEGTENQPTLSKMLAYFGAFILKSF  196

Query  660   PLRIYAKLQC-FDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             PLR Y    C F  + LST +DWTN+GRLHCL PWWEDA+V+FM+SG YNV  QI++V Q
Sbjct  197   PLRFYVNFLCFFTDIPLSTKVDWTNIGRLHCLFPWWEDALVDFMMSGVYNVSAQIEQVKQ  256

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             RTL+I G  D+++SN+L +RL  ELPNAI+ QIP+ GHLPHVE P SV KLI +F +  E
Sbjct  257   RTLIIWGEEDQIISNKLGVRLHSELPNAIIRQIPDCGHLPHVERPSSVVKLIVEFVQ--E  314

Query  303   DTCVE  289
               C E
Sbjct  315   AKCKE  319



>ref|XP_004239464.1| PREDICTED: epoxide hydrolase 3-like [Solanum lycopersicum]
Length=362

 Score =   409 bits (1051),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 238/299 (80%), Gaps = 2/299 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V  IKDP+AR LA RI+R+PV   FS+  +MSSC+KP  Q +  PVVLLH F
Sbjct  36    FPEFLPKQVENIKDPYARKLASRIERIPVN--FSKGCVMSSCVKPKEQKEANPVVLLHGF  93

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DS+CLEWR T PLLE+ G+E WA+DILGWGFSDL R P+CD ASKR HLYQLW +YIKRP
Sbjct  94    DSTCLEWRYTLPLLEEAGLETWAVDILGWGFSDLGRLPSCDVASKRDHLYQLWSTYIKRP  153

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+V++PEAV +LVLI+ASVY EGTG +  LPK VAY GV LLKSI
Sbjct  154   MVLVGPSLGSAVAIDFSVHYPEAVDRLVLIDASVYAEGTGKLATLPKAVAYAGVYLLKSI  213

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+ A    F+GL LST +DWTN+GRLHCLLPWWEDA VNFM+SGGYNV+ QIK V Q+
Sbjct  214   PLRLCAISLAFNGLPLSTCIDWTNIGRLHCLLPWWEDATVNFMISGGYNVIDQIKHVKQK  273

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++  +L +RL  E+P+A + QIP  GH+PHV++P  V++LI +F + D+
Sbjct  274   TLIIWGEDDQIIDYKLGVRLHCEIPSAKLRQIPQCGHIPHVQKPDVVSRLITEFVQSDQ  332



>ref|XP_010450832.1| PREDICTED: uncharacterized protein LOC104732927 [Camelina sativa]
Length=330

 Score =   406 bits (1044),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 236/300 (79%), Gaps = 3/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQ-GDKEPVVLL  1030
             FP FLPKEV  I+DPFAR+LA+RI R+PV  Q+G    ++MSSCIKP++Q  DK PVVLL
Sbjct  28    FPAFLPKEVQNIRDPFARALAQRIVRVPVPLQMGNFRGNVMSSCIKPLVQLHDKSPVVLL  87

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRRT+PLLE   +E WA+D+LGWGFSDL+  P CDAA+KR+HL++LWK+YI
Sbjct  88    HCFDSSCLEWRRTHPLLEQACLETWAVDVLGWGFSDLQVLPPCDAATKRHHLFELWKTYI  147

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG + +LP  VAY GV LL
Sbjct  148   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGRLKELPISVAYAGVKLL  207

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMV+FM+SGGYNV   IK +
Sbjct  208   KSFPLRLLANVLAFCSSPLSENIDWTNIGRLHCQMPWWEDAMVDFMISGGYNVASHIKLI  267

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             + +TLV+    D++VSN+L+++L  EL NA+  ++P+SGHLPHVE P  + KLI+DFA G
Sbjct  268   DHKTLVVCSENDQIVSNQLSVKLLCELANAVFREVPDSGHLPHVENPKHIVKLISDFASG  327



>ref|XP_010495613.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Camelina sativa]
Length=334

 Score =   406 bits (1044),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 232/305 (76%), Gaps = 3/305 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP +V  IKD FA  LA RI+RLPV V F+E SIMSSC+ P+ + +   PVVLLH 
Sbjct  26    FPTFLPSDVERIKDKFALKLATRIERLPVSVSFTEKSIMSSCVTPLTRIETTSPVVLLHG  85

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR TYPLLE+ G+E WA DILGWGFSDL + P CD  SKR H Y+ WK++IKR
Sbjct  86    FDSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLGKLPPCDVTSKREHFYKFWKTHIKR  145

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P++LVGPSLGAAVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKS
Sbjct  146   PVVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYAEGTGDLATLPKAAAYAGVYLLKS  205

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             IPLR+Y    CF+G+SL T+ DWT +GRLHCL PWWEDA V+FM SGGYNV   IKKV+Q
Sbjct  206   IPLRLYVNFICFNGISLETSWDWTKIGRLHCLYPWWEDATVSFMTSGGYNVTSLIKKVSQ  265

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             +TL++ G  D+++SN+LA RL  ELPNA V QI + GHLPHVE+P +VAKLI +F R  E
Sbjct  266   KTLILWGEDDQIISNKLAWRLHGELPNARVAQISDCGHLPHVEKPATVAKLITEFVR--E  323

Query  303   DTCVE  289
               C E
Sbjct  324   TCCRE  328



>ref|XP_010435823.1| PREDICTED: uncharacterized protein LOC104719577 [Camelina sativa]
Length=330

 Score =   404 bits (1039),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 235/300 (78%), Gaps = 3/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRL--PVQVGFSESSIMSSCIKPVIQ-GDKEPVVLL  1030
             FP FLPKEV  I+DPFAR+LA+RI R+  P+Q+G    ++MSSCIKP++Q  DK PVVLL
Sbjct  28    FPAFLPKEVQNIRDPFARALAQRIVRVLVPLQMGNFRGNVMSSCIKPLVQLHDKSPVVLL  87

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRRTYPLLE   +E WA+D+LGWGFSDL+  P CDAA+KR+HL++LWK+YI
Sbjct  88    HCFDSSCLEWRRTYPLLEQACLETWAVDVLGWGFSDLQVLPPCDAAAKRHHLFELWKTYI  147

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA  A+DF   +PEAV KLVLINA+ Y EGTG + +LP  VAY GV LL
Sbjct  148   KRPMILVGPSLGATEAVDFTATYPEAVDKLVLINANAYSEGTGRLKELPISVAYAGVKLL  207

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMV+FM+SGGYNV   IK +
Sbjct  208   KSFPLRLLANVLAFCSSPLSENIDWTNIGRLHCQMPWWEDAMVDFMISGGYNVASHIKLI  267

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             + +TLV+    D+++SN+L+++L  EL NA+  ++P+SGHLPHVE P  + KLI+DFA G
Sbjct  268   DHKTLVVCSENDQIISNQLSVKLLCELANAVFREVPDSGHLPHVENPKHIVKLISDFASG  327



>ref|XP_010939160.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Elaeis guineensis]
Length=338

 Score =   405 bits (1040),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 191/310 (62%), Positives = 238/310 (77%), Gaps = 12/310 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  I+DP AR LA+RI+RLPV+V F+ S IMSSC+KP  +  KEP+VLLH F
Sbjct  27    FPSFLPKEVERIRDPAARELAKRIERLPVKVSFTNSPIMSSCVKPSQKRGKEPIVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDL------------ERRPTCDAASKRYH  877
             DSSCLEWR T PLL+D G+E WA+DILGWGFSDL            E  P  + A+KR H
Sbjct  87    DSSCLEWRYTLPLLDDAGLETWAVDILGWGFSDLAIIINNVFHHESEMFPPSNVAAKREH  146

Query  876   LYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKM  697
             L+QLW+ YI+RPM+LVGPSLGAAVAIDFA N PE V KLVLI+AS+Y EGTG MTKLP+ 
Sbjct  147   LFQLWRLYIQRPMVLVGPSLGAAVAIDFAANHPEEVSKLVLIDASIYAEGTGTMTKLPRA  206

Query  696   VAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY  517
             +AY GV +LKSIPLR YA    F+ +SL + LDWTNVGRLHCLLPWWED  V+FM+SGGY
Sbjct  207   LAYAGVFVLKSIPLRFYANTLAFNKVSLGSALDWTNVGRLHCLLPWWEDTTVDFMVSGGY  266

Query  516   NVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVA  337
             NV  QIK++ Q++L+I G  D+++ +  A+RL ++L N+++HQIP  GH+PHVE+P SVA
Sbjct  267   NVSSQIKQIKQKSLIIWGEDDRIIRSTNALRLQKDLQNSVLHQIPECGHIPHVEKPKSVA  326

Query  336   KLIADFARGD  307
             + I +F +GD
Sbjct  327   ESILEFLQGD  336



>ref|XP_010680707.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Beta vulgaris 
subsp. vulgaris]
Length=334

 Score =   402 bits (1034),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 234/298 (79%), Gaps = 0/298 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK++H+IKDPFAR+LA RI++LPVQV FS++ IMSSCI+P +QG   PVVLLH F
Sbjct  35    FPSFLPKQIHKIKDPFARNLAIRIEQLPVQVSFSDACIMSSCIRPSVQGKTSPVVLLHGF  94

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE+ G E+WAIDILGWGFS+LE+ P+CD ASKR HLYQ W+ YIKRP
Sbjct  95    DSSCLEWRCVYPLLEEAGTESWAIDILGWGFSNLEQLPSCDVASKRDHLYQFWRLYIKRP  154

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVA+DFAVN PEAV +LVLI+ASVY EG G + +LP ++A  G++LLKSI
Sbjct  155   MILVGPSLGAAVAVDFAVNHPEAVSRLVLIDASVYSEGIGGLAQLPVIIANAGLALLKSI  214

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR++     F  +++ T+LDW N+GRLHCL PWW DA ++FM SGGY V   IK+V QR
Sbjct  215   PLRLFVNKLVFKNITVRTSLDWMNIGRLHCLFPWWRDATLSFMASGGYKVTSLIKQVKQR  274

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              L+I G  D+++S +LA RL  EL +AI+  IP+ GH+PHVE+P  VA LI  F + D
Sbjct  275   ALIIWGEDDQIISYKLAHRLHSELQDAILRPIPDCGHVPHVEKPSIVANLILKFVQDD  332



>ref|XP_002527610.1| alpha/beta hydrolase, putative [Ricinus communis]
 gb|EEF34749.1| alpha/beta hydrolase, putative [Ricinus communis]
Length=282

 Score =   400 bits (1027),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 184/273 (67%), Positives = 225/273 (82%), Gaps = 0/273 (0%)
 Frame = -3

Query  1110  VGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWG  931
             +G SE+ +MSSC+KP++Q    PVVLLHCFDSSCLEWR  YPLLE+ G+EAWA+D+LGWG
Sbjct  1     MGSSENYVMSSCVKPLVQSKNNPVVLLHCFDSSCLEWRCAYPLLEEAGLEAWAVDVLGWG  60

Query  930   FSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLI  751
             FSDLE RP+CDAASKRYHLYQ WK YI+RPMILVGPSLGA+VAIDF+VN+P+AV KLVLI
Sbjct  61    FSDLEIRPSCDAASKRYHLYQFWKEYIRRPMILVGPSLGASVAIDFSVNYPDAVEKLVLI  120

Query  750   NASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHC  571
             N SVY EGT  + KLPKMVAY GVS LKS+PLR+YA    F+G+S  T LDWTNVGRLHC
Sbjct  121   NPSVYAEGTKHLAKLPKMVAYAGVSFLKSLPLRLYANSLAFNGISFFTILDWTNVGRLHC  180

Query  570   LLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVH  391
             LLPWW+DA ++FM SGGYNV+ QIK+V ++TL+ITG  D++VS +LA++L  EL NA + 
Sbjct  181   LLPWWKDATISFMFSGGYNVISQIKQVKKKTLIITGELDQIVSYKLAVQLHCELGNASMR  240

Query  390   QIPNSGHLPHVEEPHSVAKLIADFARGDEDTCV  292
             Q+P+SGHLPHV++P+ VA LI DFA      C+
Sbjct  241   QVPDSGHLPHVDKPNYVANLIVDFALSHPLHCL  273



>ref|XP_002324110.2| hydrolase family protein [Populus trichocarpa]
 gb|EEF04243.2| hydrolase family protein [Populus trichocarpa]
Length=287

 Score =   400 bits (1027),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 224/274 (82%), Gaps = 1/274 (0%)
 Frame = -3

Query  1104  FSESSIMSSCIKPVIQGDK-EPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGF  928
              SES IMSSC+KP+ Q +K  PVVLLHCFDSSCLEWR TYPLLE+ G+EAWA+D+LGWGF
Sbjct  1     MSESCIMSSCVKPLRQSNKTSPVVLLHCFDSSCLEWRCTYPLLEEAGLEAWAVDVLGWGF  60

Query  927   SDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLIN  748
             SDLE RP CD ASKR+HLYQLWKSYIKRPMILVGPSLGA+VAIDF V++PEAV KLVLIN
Sbjct  61    SDLETRPPCDVASKRHHLYQLWKSYIKRPMILVGPSLGASVAIDFTVHYPEAVEKLVLIN  120

Query  747   ASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCL  568
              SVY EGTG + KLP++VAY GVS LKS+PLR YA +  F+G+   T LDWT VGRLHCL
Sbjct  121   PSVYAEGTGNLAKLPELVAYAGVSFLKSLPLRFYANMVAFNGIPFFTILDWTCVGRLHCL  180

Query  567   LPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQ  388
             LPWW+DA V+FMLSGGYNV+ QIK+V  +TL+I G  D++VS +  ++L  EL NAI+ +
Sbjct  181   LPWWKDATVSFMLSGGYNVISQIKQVKHKTLIICGQHDQIVSYQHVVKLHSELSNAIIRE  240

Query  387   IPNSGHLPHVEEPHSVAKLIADFARGDEDTCVES  286
             + +SGHLPHV+ P  VAKLIADFA+GD D   +S
Sbjct  241   VSDSGHLPHVDNPKCVAKLIADFAQGDADVNAKS  274



>gb|EPS71122.1| hypothetical protein M569_03637, partial [Genlisea aurea]
Length=300

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 231/297 (78%), Gaps = 1/297 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHC  1024
             FP FLPKEV  IKDPFAR +A RI+R+PV++  S S IMSSC+KP    +   PVVLLH 
Sbjct  2     FPAFLPKEVENIKDPFARKMAARIERVPVRLTLSNSCIMSSCVKPRSSLNSTIPVVLLHG  61

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR  +PLLE+  +E WA+D+LGWGFSDLE RP+C   SKR HLYQ W S+IKR
Sbjct  62    FDSSCLEWRYAFPLLENAELEPWAVDVLGWGFSDLEIRPSCSVESKRDHLYQFWNSHIKR  121

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PM LVGPSLGAA+AIDFAVN+P AV KLVLI+ASVY EGTG + KLP++ AY GV +LKS
Sbjct  122   PMTLVGPSLGAAIAIDFAVNYPGAVEKLVLIDASVYAEGTGDLAKLPELAAYAGVYVLKS  181

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
              PLR+Y  L  F+GLS+ T LDWTN+G+LHC +PWW DA V+FM SGGYNVV  I +V Q
Sbjct  182   FPLRLYGTLLAFNGLSMETCLDWTNIGKLHCRVPWWADANVDFMTSGGYNVVSAIARVEQ  241

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             +TL+I G  D+++  +  MRL  E+P+AI+ QIP+ GH+PHVE+P +V+KLIADF R
Sbjct  242   KTLIIWGEDDRIIDLKQGMRLHCEMPDAIIKQIPDCGHIPHVEKPAAVSKLIADFVR  298



>ref|XP_009140215.1| PREDICTED: uncharacterized protein LOC103864211 isoform X2 [Brassica 
rapa]
Length=318

 Score =   400 bits (1028),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 231/300 (77%), Gaps = 11/300 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQ-GDKEPVVLL  1030
             FP FLPKEV +IKDPFAR+LA++I R+PV  Q+      +MSSCIKP +Q  DK PVVLL
Sbjct  24    FPTFLPKEVKDIKDPFARALAQKIVRIPVPLQMENFRGCVMSSCIKPTVQLPDKSPVVLL  83

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRR YPLLE+  +E WAID+LGWGFSDL++ P CDAASKR+HL++LWK+YI
Sbjct  84    HCFDSSCLEWRRAYPLLEEACLETWAIDVLGWGFSDLQKLPPCDAASKRHHLFELWKTYI  143

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG +  LPK +AY GV LL
Sbjct  144   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGALKDLPKSIAYAGVKLL  203

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMVNFM+SGGYN       +
Sbjct  204   KSFPLRLLANVLAFSS-PLSENIDWTNIGRLHCQMPWWEDAMVNFMISGGYN-------I  255

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             N +TLVI    D++VSN+L+++L  EL NA+  ++P+SGHLPHVE P    KLI+DFA G
Sbjct  256   NHKTLVICSENDQIVSNQLSVKLLCELQNAVFREVPDSGHLPHVENPKQFVKLISDFASG  315



>ref|XP_011012054.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X5 [Populus 
euphratica]
Length=288

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/272 (68%), Positives = 224/272 (82%), Gaps = 0/272 (0%)
 Frame = -3

Query  1116  VQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILG  937
             +QVGF++ SIMSSC+KP+IQ +  PVVLLH FDSSCLEWR T+PLLE+ G+E WA+D+LG
Sbjct  1     MQVGFADRSIMSSCVKPLIQSEGSPVVLLHGFDSSCLEWRYTFPLLEEAGIETWAVDVLG  60

Query  936   WGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLV  757
             WGFSDLER P+CD ASKR HLYQLWKSYI+RP+IL+GPSLGAAVAIDFAVN PEAV KLV
Sbjct  61    WGFSDLERLPSCDVASKRDHLYQLWKSYIRRPIILIGPSLGAAVAIDFAVNHPEAVEKLV  120

Query  756   LINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRL  577
             LI+ASVY E TG + KLP+ +AY GV LLKS PLR+Y  L  F+ L L+T++DW NVGRL
Sbjct  121   LIDASVYAEDTGNLAKLPRAIAYAGVYLLKSTPLRLYVNLIAFNSLPLNTSIDWMNVGRL  180

Query  576   HCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAI  397
             HCL PWWEDA VNFM  GGYNV  QIKKV Q+TL+I G  D+++SN+LA+RL  ELP+AI
Sbjct  181   HCLYPWWEDATVNFMNCGGYNVSAQIKKVKQKTLIIWGEDDQIISNKLAVRLHCELPDAI  240

Query  396   VHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             + QIP+ GH+PHVE+P+SVA LI DF   D +
Sbjct  241   IRQIPDCGHIPHVEKPNSVANLILDFLGEDSN  272



>ref|XP_010091569.1| putative hydrolase yugF [Morus notabilis]
 gb|EXB44835.1| putative hydrolase yugF [Morus notabilis]
Length=279

 Score =   395 bits (1014),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 185/260 (71%), Positives = 217/260 (83%), Gaps = 0/260 (0%)
 Frame = -3

Query  1086  MSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRP  907
             MSSC+KP+I+  K PVVLLH FDSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P
Sbjct  1     MSSCVKPLIESKKSPVVLLHGFDSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLP  60

Query  906   TCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEG  727
             + D ASKR+H YQLWKSYIK+PMILVGPSLGAAVAIDFAVN+PEAV KLVLI+ASVY EG
Sbjct  61    SVDVASKRHHFYQLWKSYIKKPMILVGPSLGAAVAIDFAVNYPEAVEKLVLIDASVYAEG  120

Query  726   TGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDA  547
             TG +T LPK VAY G SLLKS+PLR+Y  L  F  +S +T+LDW N+GRLHCLLPWWEDA
Sbjct  121   TGNLTSLPKFVAYAGASLLKSVPLRLYVNLLAFTEISFNTSLDWMNIGRLHCLLPWWEDA  180

Query  546   MVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHL  367
              V+FM SGGY V  QI++V Q+TL+I G  D+++SN+LA+RL  ELPNAI+ QIP+ GHL
Sbjct  181   TVDFMRSGGYKVGAQIEQVKQKTLLIWGEDDQIISNKLAVRLHCELPNAIIRQIPDCGHL  240

Query  366   PHVEEPHSVAKLIADFARGD  307
             PHVE P SVAKLI +FA+ D
Sbjct  241   PHVERPSSVAKLIVEFAQRD  260



>ref|XP_006837141.1| hypothetical protein AMTR_s00110p00143020 [Amborella trichopoda]
 gb|ERM99994.1| hypothetical protein AMTR_s00110p00143020 [Amborella trichopoda]
Length=318

 Score =   396 bits (1017),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 183/299 (61%), Positives = 228/299 (76%), Gaps = 0/299 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  I+D  A  +A+RI RLPV+  F+E  IMSSC+KP ++ +  P+VLLH F
Sbjct  13    FPTFLPKEVQTIRDSAAIKMAKRIVRLPVKTSFTEHCIMSSCVKPYLKKESSPIVLLHGF  72

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLED   E WA+DILGWGFSDLE+ P+C+ ASKR HLYQ WKSYIKRP
Sbjct  73    DSSCLEWRYAYPLLEDALFETWAVDILGWGFSDLEKLPSCNVASKREHLYQFWKSYIKRP  132

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAAVAIDFA+N PEAV  LVLI+ASVY EG G + KLP+MVAY  VS+LKS 
Sbjct  133   MVLVGPSLGAAVAIDFAINHPEAVSNLVLIDASVYAEGVGHLIKLPRMVAYAAVSILKST  192

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F  +  S+ LDWT +G LHCL PWW++A ++FMLSGGYNVV QIK++ QR
Sbjct  193   PLRLYANSLIFKKVPWSSLLDWTRIGCLHCLFPWWKEATLDFMLSGGYNVVAQIKQLKQR  252

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G +D ++S++LA  L  E+  ++++ + N GH+PHVE+P   AKLI DF +  E
Sbjct  253   TLIIWGEKDNIISSKLAQTLHDEIQESVLYLMSNCGHIPHVEKPSQAAKLIMDFVKETE  311



>ref|XP_010552541.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Tarenaya 
hassleriana]
Length=332

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 233/301 (77%), Gaps = 3/301 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQGD-KEPVVLL  1030
             FP FLPKEV +I+DPFAR+LA+RI R+PV  Q+      +MSSCIKP+ Q     PVVLL
Sbjct  30    FPAFLPKEVEKIRDPFARALAQRIVRIPVPLQMEKFNGCVMSSCIKPLGQQHCANPVVLL  89

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWR TYPLL+   +E WA+D+LGWGFS+L+  P CDAASKR+HL+QLWK+YI
Sbjct  90    HCFDSSCLEWRCTYPLLDQACLETWALDVLGWGFSELQVLPPCDAASKRHHLFQLWKTYI  149

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA +A+DFA  +PEAV KLVLINA+ Y EGTG + KLPK+VAY GV LL
Sbjct  150   KRPMILVGPSLGATIAVDFAATYPEAVQKLVLINANAYSEGTGQLAKLPKLVAYAGVRLL  209

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F  + L   +DWTNVGRLHC + WWE A V++M+SGGYNV  QIK V
Sbjct  210   KSFPLRLLANVLAFRSVPLPKQIDWTNVGRLHCRMSWWEMATVDYMISGGYNVASQIKLV  269

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
              Q+TLVI    D++V+N+L+++L  EL N++  ++P SGHLPHVE P  VA+LIADFAR 
Sbjct  270   KQKTLVICSENDQIVNNQLSVKLLCELRNSVFREVPGSGHLPHVENPEHVAELIADFARE  329

Query  309   D  307
             D
Sbjct  330   D  330



>ref|XP_008460251.1| PREDICTED: uncharacterized protein LOC103499127 isoform X1 [Cucumis 
melo]
Length=338

 Score =   395 bits (1014),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 230/298 (77%), Gaps = 2/298 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +I DP AR++AR+I+RLP+ +   E+ IMSSC+KP  + +K PVVLLHCF
Sbjct  41    FPSFLPKEVSKINDPLARTMARKIERLPMTL--FETCIMSSCVKPAKRSEKNPVVLLHCF  98

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEW   +PLLE+ G+E WA+D+LGWGFSDL+  P C+  +KR HLYQ WK+YIKRP
Sbjct  99    DSSCLEWSYAFPLLEEAGLETWAVDVLGWGFSDLDSLPPCNVETKRSHLYQFWKTYIKRP  158

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAA+A+DFAVN PEAV KLVLINA VY + TG  TKLP +VAY GVSLLKSI
Sbjct  159   MVLVGPSLGAAIAVDFAVNHPEAVEKLVLINACVYSKCTGHPTKLPNVVAYAGVSLLKSI  218

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+ A    F+ LSL+  L+WTNVGRLHCLLPWWED  V+FM SGGYNV+ QIK+V  R
Sbjct  219   PLRLIANKLTFNRLSLARNLEWTNVGRLHCLLPWWEDTTVSFMNSGGYNVISQIKQVKHR  278

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
              LVI G  D+++  +  +RL  ELPNA++  I +SGHLPHV+ P SV+KLI  F   D
Sbjct  279   ALVIAGEDDRIIRFKDVVRLHCELPNAVMRVITDSGHLPHVDSPASVSKLITHFVLHD  336



>ref|XP_011012045.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X4 [Populus 
euphratica]
Length=313

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/300 (64%), Positives = 224/300 (75%), Gaps = 31/300 (10%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  IKDPFAR LA RI+RLPV VGF++ SIMSSC+KP+IQ +  PVVLLH F
Sbjct  29    FPSFLPKEVENIKDPFARRLATRIERLPVSVGFADRSIMSSCVKPLIQSEGSPVVLLHGF  88

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T+PLLE+ G+E WA+D+LGWGFSDLER P+CD ASKR HLYQLWKSYI+RP
Sbjct  89    DSSCLEWRYTFPLLEEAGIETWAVDVLGWGFSDLERLPSCDVASKRDHLYQLWKSYIRRP  148

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +IL+GPSLGAAVAIDFAVN PEAV KLVLI+ASVY E TG + KLP+ +AY G       
Sbjct  149   IILIGPSLGAAVAIDFAVNHPEAVEKLVLIDASVYAEDTGNLAKLPRAIAYAG-------  201

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
                                     VGRLHCL PWWEDA VNFM  GGYNV  QIKKV Q+
Sbjct  202   ------------------------VGRLHCLYPWWEDATVNFMNCGGYNVSAQIKKVKQK  237

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL+I G  D+++SN+LA+RL  ELP+AI+ QIP+ GH+PHVE+P+SVA LI DF   D +
Sbjct  238   TLIIWGEDDQIISNKLAVRLHCELPDAIIRQIPDCGHIPHVEKPNSVANLILDFLGEDSN  297



>ref|XP_006605541.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Glycine 
max]
Length=309

 Score =   391 bits (1005),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 181/259 (70%), Positives = 210/259 (81%), Gaps = 0/259 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEVH IKDPFAR+LA RI RLPV V FSE+ IMSSC+KP +Q    PVVLLH F
Sbjct  38    FPSFLPKEVHRIKDPFARNLAMRIHRLPVSVRFSENPIMSSCVKPSMQNTANPVVLLHGF  97

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G E WA+DILGWGFSDLE+ P+CD  SKR H YQ WKS+IK+ 
Sbjct  98    DSSCLEWRYTYPLLEEAGFETWAVDILGWGFSDLEKLPSCDVVSKRDHFYQFWKSHIKKA  157

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG+AVAIDFAVN+PEAV KLVLI+ASVY EGTG +  LP+  AY GV +LKSI
Sbjct  158   MILVGPSLGSAVAIDFAVNYPEAVEKLVLIDASVYAEGTGNLATLPRAAAYAGVYVLKSI  217

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F  L+ ST+LDWTN+GRLHCLLPWWEDA V+FM SGGYNV  QI+KV Q+
Sbjct  218   PLRLYANYLSFTSLTFSTSLDWTNIGRLHCLLPWWEDATVDFMTSGGYNVASQIEKVKQK  277

Query  480   TLVITGMRDKLVSNELAMR  424
             TL+I G  D+++SN+LA+ 
Sbjct  278   TLIIWGENDRIISNKLAVE  296



>dbj|BAJ90728.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91531.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   392 bits (1008),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 230/303 (76%), Gaps = 10/303 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP+ V  I+D  A  LA+RI+R+PVQ GFS+S I SSC++P+ Q    +PVVLLH 
Sbjct  46    FPPFLPRAVERIRDGAALRLAKRIERVPVQTGFSKSPIPSSCVRPLKQQQSGDPVVLLHG  105

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR TYPLLED G+E WA+DILGWGFS+LE RP CD  SKR HLYQ W+SYIKR
Sbjct  106   FDSSCLEWRYTYPLLEDAGLETWAVDILGWGFSNLETRPPCDIVSKREHLYQFWRSYIKR  165

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PM+LVGPSLGAAVAIDFAVN+PEAV KL+ I ASVY EGT  MT++PK V Y GV +LKS
Sbjct  166   PMVLVGPSLGAAVAIDFAVNYPEAVSKLIFIGASVYAEGTKDMTRMPKFVPYAGVFVLKS  225

Query  663   IPLRIYAKLQCF----DGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIK  496
             +PLR++A    F    DGL      DW  +GRLHCLLPWWEDA VNFM++GGYNV++QIK
Sbjct  226   LPLRLFATRLAFYKIPDGL-----FDWVQIGRLHCLLPWWEDATVNFMITGGYNVLNQIK  280

Query  495   KVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             +V Q+ LV+ G  D ++SN+ A RL +ELP+AI+ Q+   GH+PHVE+P   AK + DF 
Sbjct  281   QVKQKCLVLWGEDDGIISNKQAYRLQQELPSAILRQVGQCGHIPHVEKPREAAKHVLDFL  340

Query  315   RGD  307
              GD
Sbjct  341   GGD  343



>ref|XP_007032742.1| Alpha/beta-Hydrolases superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY03668.1| Alpha/beta-Hydrolases superfamily protein isoform 3 [Theobroma 
cacao]
Length=291

 Score =   388 bits (997),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/239 (75%), Positives = 209/239 (87%), Gaps = 0/239 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V +IKDPFAR+LARRI+RLPVQ+  S+S IMSSC++P+IQ D  PVVLLHCF
Sbjct  45    FPSFLPKQVEKIKDPFARNLARRIKRLPVQIECSDSFIMSSCVQPLIQRDANPVVLLHCF  104

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWRR YPLLE++G+EAWAID+LGWGFSDL R P C+ ASKRYHLYQLW SYIKRP
Sbjct  105   DSSCLEWRRAYPLLEESGLEAWAIDVLGWGFSDLGRLPPCNVASKRYHLYQLWNSYIKRP  164

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVAIDFAVN+PEAV KLVLIN SVY EGTG + KLP++VAY GVSLLK+ 
Sbjct  165   VVLVGPSLGAAVAIDFAVNYPEAVKKLVLINPSVYAEGTGNLAKLPRVVAYAGVSLLKTF  224

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             PLR+YA L  F+G+SLS +LDWTNVGRLHC +PWW+DA VNFM+SGGYNVV QIK+  +
Sbjct  225   PLRLYANLLAFNGISLSRSLDWTNVGRLHCHMPWWKDATVNFMVSGGYNVVSQIKQAGE  283



>gb|KEH27853.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=293

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/289 (63%), Positives = 223/289 (77%), Gaps = 0/289 (0%)
 Frame = -3

Query  1134  RIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAW  955
             RIQRLPV V F E+ IMSSC+KP++Q  + P+VLLH FDSSCLEWR  YPLLE++G E W
Sbjct  2     RIQRLPVPVSFVENPIMSSCVKPLVQNKEPPIVLLHGFDSSCLEWRYGYPLLEESGFETW  61

Query  954   AIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPE  775
             AIDILGWGFSDLE  P CD  SKR H YQ WKSYI+RPMILVGPSLG+AVAIDFAVN+PE
Sbjct  62    AIDILGWGFSDLENLPPCDVVSKRNHFYQFWKSYIRRPMILVGPSLGSAVAIDFAVNYPE  121

Query  774   AVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDW  595
             AV KL+LI+ASVY EGTG +  LP+ VAY GV LLKS+PLR+YA    F  +SL T LD 
Sbjct  122   AVEKLILIDASVYAEGTGNLATLPRSVAYAGVYLLKSLPLRLYANYLTFTNMSLRTILDG  181

Query  594   TNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCR  415
             TNVGRLHCLLPWW+DA V+FM SGGY +   I+KV Q+TL+I G  D++VSN+LA++L  
Sbjct  182   TNVGRLHCLLPWWDDATVDFMTSGGYKIAPLIRKVKQKTLIIWGENDRIVSNKLAVQLHC  241

Query  414   ELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDEDTCVESYCKIKE  268
             ELP+AI+ QIP+ GH+PH+E P S  KLI +F + ++    +   ++ +
Sbjct  242   ELPDAILRQIPDCGHIPHLERPDSTIKLIVEFIQTEKKKLSQRVSQVSQ  290



>ref|XP_010258065.1| PREDICTED: uncharacterized protein LOC104597956 isoform X2 [Nelumbo 
nucifera]
Length=307

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 229/297 (77%), Gaps = 22/297 (7%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP++V +IKDPFAR LA+RI+RLPVQV FSESSIMSSC++P++Q +  PVVLLH F
Sbjct  30    FPSFLPRQVEKIKDPFARKLAKRIERLPVQVSFSESSIMSSCVRPLLQSETNPVVLLHGF  89

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P+CD  SKR HLYQLW+SYIK+P
Sbjct  90    DSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPSCDVTSKRDHLYQLWRSYIKKP  149

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAVAID AVN PE+V KL+LI+A VY EGTG + KLP+ VAY GVS+LKS+
Sbjct  150   MILVGPSLGAAVAIDIAVNHPESVQKLILIDAGVYAEGTGNLAKLPRTVAYAGVSVLKSM  209

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  F  +S  T LD TNVGRLHCLLPWWEDA V+FM+SGGYNV   I +    
Sbjct  210   PLRLYANLLAFKKISFDTILDQTNVGRLHCLLPWWEDATVDFMISGGYNVSRLIDQ----  265

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
                               RL  +LPNAI+HQ+ + GHLPHV+ P+SVAKLI DF + 
Sbjct  266   ------------------RLHHQLPNAIIHQLSDCGHLPHVDRPNSVAKLIVDFVQA  304



>ref|XP_010939163.1| PREDICTED: uncharacterized protein LOC105058074 isoform X4 [Elaeis 
guineensis]
Length=304

 Score =   385 bits (990),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 185/298 (62%), Positives = 223/298 (75%), Gaps = 22/298 (7%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  I+DP AR LA+RI+RLPV+V F+ S IMSSC+KP  +  KEP+VLLH F
Sbjct  27    FPSFLPKEVERIRDPAARELAKRIERLPVKVSFTNSPIMSSCVKPSQKRGKEPIVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T PLL+D G+E WA+DILGWGFSDLE  P  + A+KR HL+QLW+ YI+RP
Sbjct  87    DSSCLEWRYTLPLLDDAGLETWAVDILGWGFSDLEMFPPSNVAAKREHLFQLWRLYIQRP  146

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAAVAIDFA N PE V KLVLI+AS+Y EGTG MTKLP+ +AY GV +LKSI
Sbjct  147   MVLVGPSLGAAVAIDFAANHPEEVSKLVLIDASIYAEGTGTMTKLPRALAYAGVFVLKSI  206

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA    F+ +SL + LDWTNVGRLHCLLPWWED  V+FM+SGGYNV  QIK+    
Sbjct  207   PLRFYANTLAFNKVSLGSALDWTNVGRLHCLLPWWEDTTVDFMVSGGYNVSSQIKQ----  262

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
                               RL ++L N+++HQIP  GH+PHVE+P SVA+ I +F +GD
Sbjct  263   ------------------RLQKDLQNSVLHQIPECGHIPHVEKPKSVAESILEFLQGD  302



>ref|XP_011085691.1| PREDICTED: uncharacterized protein LOC105167616 isoform X2 [Sesamum 
indicum]
Length=290

 Score =   382 bits (982),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 202/239 (85%), Gaps = 0/239 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEVH I+DP ARSLA+RIQRLPVQVGFSES IMSSC+ P +  D  PVVLLHCF
Sbjct  42    FPSFLPKEVHNIRDPSARSLAQRIQRLPVQVGFSESCIMSSCVTPRVCRDANPVVLLHCF  101

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLED G+EAWAIDILGWGFSDLERRP C+ ASKR HLYQLWKS+I RP
Sbjct  102   DSSCLEWRSAYPLLEDAGLEAWAIDILGWGFSDLERRPPCNVASKRNHLYQLWKSHIGRP  161

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M LVGPSLGAAVAIDF VNFPEAV KLVLINA+VY +GTG ++ LPK +AY   SLLKSI
Sbjct  162   MTLVGPSLGAAVAIDFTVNFPEAVDKLVLINANVYAKGTGVLSNLPKSMAYPMASLLKSI  221

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             P+R YAKL  F+G+SLS  +D+TNVGRLHCLLPWWEDA VNFMLSGGYNV  QIK V +
Sbjct  222   PMRWYAKLLIFNGISLSRIVDYTNVGRLHCLLPWWEDATVNFMLSGGYNVAGQIKHVGE  280



>ref|XP_007045882.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY01714.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=270

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/270 (66%), Positives = 211/270 (78%), Gaps = 8/270 (3%)
 Frame = -3

Query  1086  MSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRP  907
             MSSC+KP++Q ++ P+VLLH FDSSCLEWR TYPLLE+ G+E WA+DILGWGFS+LER  
Sbjct  1     MSSCVKPLVQSEQSPLVLLHGFDSSCLEWRYTYPLLEEAGLETWAVDILGWGFSNLERLG  60

Query  906   TCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEG  727
             +CD  SKR H YQLWKSYIKRPM  VGPSLGAAVA+DFAVN PEAV  LVLI+ASVY EG
Sbjct  61    SCDVQSKREHFYQLWKSYIKRPMTFVGPSLGAAVAVDFAVNHPEAVENLVLIDASVYAEG  120

Query  726   TGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDA  547
             TG +  LP+  AY G SLLKS PLR+Y     F G S ST+LDWTN+GRLHCL PWWEDA
Sbjct  121   TGNLATLPRAAAYAGASLLKSFPLRLYTIFLAFKGTSFSTSLDWTNIGRLHCLYPWWEDA  180

Query  546   MVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHL  367
              VNFM+SGGYNV  QI +V Q+TL+I G  D+++SN+L +RL  ELPNAI+ QIP+ GHL
Sbjct  181   TVNFMISGGYNVSRQIDQVKQKTLIIWGEDDQIISNKLGVRLHCELPNAIIRQIPDCGHL  240

Query  366   PHVEEPHSVAKLIADFARGDEDTCVESYCK  277
             PHVE+P SVA+LI +F        V+ YC+
Sbjct  241   PHVEKPDSVARLILEF--------VQDYCQ  262



>ref|XP_009402991.1| PREDICTED: uncharacterized protein LOC103986654 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=323

 Score =   381 bits (979),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 235/296 (79%), Gaps = 0/296 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +I+DPFAR +A+RI+RLPV++ FS SSIMSSC+KP+ +   EPVVLLH F
Sbjct  26    FPSFLPKEVDKIRDPFARDMAKRIERLPVKISFSTSSIMSSCVKPLQERGTEPVVLLHGF  85

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR +YPLLE  G++ WA+DILGWGFSDL+  P C+ A+KR HLYQLW++YI RP
Sbjct  86    DSSCLEWRYSYPLLEGAGIDTWAVDILGWGFSDLQMLPPCNVAAKREHLYQLWRTYIARP  145

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGA+VA+DF  N PEAV KLV+I+AS+Y EGTG + KLP++VAY GVS+LKSI
Sbjct  146   MVLVGPSLGASVAMDFIANHPEAVSKLVMIDASIYAEGTGNLAKLPRIVAYAGVSVLKSI  205

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA     + +SL ++ D  NVGRLHCL PWWEDA V+FMLSGGY+V + +K++ Q 
Sbjct  206   PLRFYANSLALNKVSLQSSWDSMNVGRLHCLQPWWEDATVDFMLSGGYDVRNHVKQIKQE  265

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             TL+I G  D++VS+++A+RL  ELP++ + QIP  GH+PHVE+P  V + I  F R
Sbjct  266   TLIIWGQDDQIVSSKVALRLHHELPDSTLIQIPGCGHIPHVEKPELVVQYILKFIR  321



>ref|XP_009365974.1| PREDICTED: uncharacterized protein LOC103955800 [Pyrus x bretschneideri]
Length=290

 Score =   380 bits (975),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FPLFLPKEV +IKDP+AR+LARR++RLPV +G  ES IMSSC++P+ Q +  PVVLLHCF
Sbjct  44    FPLFLPKEVEKIKDPYARTLARRMERLPVPIGSLESCIMSSCVRPLKQSEINPVVLLHCF  103

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE+ G+EAWA+D+LGWGFSDLERRP C  ASKR HLYQ WKSYI+RP
Sbjct  104   DSSCLEWRCVYPLLEEAGLEAWAVDVLGWGFSDLERRPPCSVASKRDHLYQFWKSYIRRP  163

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG +VAIDFA ++P AV KLVLINASVY EG G M KLPK VAY GVSLLKS 
Sbjct  164   MILVGPSLGGSVAIDFAYHYPVAVEKLVLINASVYAEGIGDMAKLPKAVAYAGVSLLKST  223

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA +  F+G+SL+TT DWTNVGRLHCL PWW+DA V+FM SGGYNV+ QIK+VN R
Sbjct  224   PLRFYANMLAFNGISLATTFDWTNVGRLHCLQPWWKDATVSFMTSGGYNVISQIKQVNSR  283

Query  480   TL  475
              L
Sbjct  284   HL  285



>ref|XP_008365517.1| PREDICTED: uncharacterized protein LOC103429153 [Malus domestica]
Length=292

 Score =   380 bits (975),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 204/247 (83%), Gaps = 0/247 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDP+AR LA+R++RLPV +G SES IMSSC++P+ Q +  PVVLLHCF
Sbjct  46    FPSFLPKEVEKIKDPYARKLAQRMERLPVSIGSSESCIMSSCVRPLKQSEINPVVLLHCF  105

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR  YPLLE+ G+EAWA+D+LGWGFSDLER P C AA+KR+HLYQ WKSYI+RP
Sbjct  106   DSSCLEWRCAYPLLEEAGLEAWAVDVLGWGFSDLERCPPCSAATKRHHLYQFWKSYIRRP  165

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG +VAIDFA ++P AV KLVLINASVY EGTG M KLPK  AY GVSLLKS 
Sbjct  166   MVLVGPSLGGSVAIDFAYHYPXAVEKLVLINASVYAEGTGDMAKLPKAAAYAGVSLLKST  225

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA +  F+ +SL+TT DWTNVGRLHCLLPWW DA V+FM SGGYNVV QIK+VN R
Sbjct  226   PLRFYANMXAFNDISLATTFDWTNVGRLHCLLPWWXDATVSFMSSGGYNVVSQIKQVNSR  285

Query  480   TLVITGM  460
              L   G+
Sbjct  286   HLXEYGI  292



>ref|XP_002463151.1| hypothetical protein SORBIDRAFT_02g038540 [Sorghum bicolor]
 gb|EER99672.1| hypothetical protein SORBIDRAFT_02g038540 [Sorghum bicolor]
Length=361

 Score =   382 bits (980),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/307 (60%), Positives = 232/307 (76%), Gaps = 3/307 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPV-IQGDKEPVVLLHC  1024
             FP FLP+ V  I+D  A  LA+RI+R+PVQ GFSES+I SSC++P+ +Q D +PVVLLH 
Sbjct  48    FPSFLPQAVERIRDGAAIRLAKRIERVPVQTGFSESAIPSSCVRPLKLQQDGDPVVLLHG  107

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LEWR TYPLLE+ G+EAWA+DILGWGFSDLE RP CD ASKR HLYQ WKSYIKR
Sbjct  108   FDSSVLEWRYTYPLLEEAGLEAWAVDILGWGFSDLEARPPCDVASKREHLYQFWKSYIKR  167

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PM+LVGPSLGAAVAIDF+VN+P+AV KL+ I ASVY EG   MT++PK V+Y GV +LKS
Sbjct  168   PMVLVGPSLGAAVAIDFSVNYPDAVSKLIFIGASVYSEGPKDMTRMPKFVSYAGVFILKS  227

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             +PLR  A    F   + +   DW  +GRLHCLLPWWEDA V+FM+ GGYNV++QIK+V  
Sbjct  228   LPLRFLATNLAFKK-APNEFFDWVQIGRLHCLLPWWEDATVDFMIRGGYNVINQIKQVKH  286

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF-ARGD  307
             + L++ G  D ++S++LA RL +ELP+AI+ Q+   GH+PHVE+P    K + +F AR  
Sbjct  287   KCLIMWGEDDGIISSKLAYRLHQELPDAILRQVQQCGHIPHVEKPREAVKHVIEFLARNT  346

Query  306   EDTCVES  286
              +   +S
Sbjct  347   SNKSDQS  353



>ref|XP_004958222.1| PREDICTED: monoacylglycerol lipase abhd6-B-like isoform X1 [Setaria 
italica]
Length=395

 Score =   382 bits (982),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 227/300 (76%), Gaps = 2/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHC  1024
             FP FLP+ V  I+D  A  LA+RI+R+PVQ GFS S I SSC++P+ Q  D +P+VLLH 
Sbjct  49    FPSFLPRAVERIRDGAAIRLAKRIERVPVQTGFSVSPIQSSCVRPLKQQQDADPIVLLHG  108

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR TYPLLE+ G EAWA+DILGWGFSDL  RP CD ASKR HLYQ WKSYIKR
Sbjct  109   FDSSCLEWRYTYPLLEEAGHEAWAVDILGWGFSDLATRPPCDVASKREHLYQFWKSYIKR  168

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PM+LVGPSLGAAVAIDF++N+PEAV K++ I ASVY EG   MT++PK V+Y GV +LKS
Sbjct  169   PMVLVGPSLGAAVAIDFSINYPEAVSKMIFIGASVYSEGPKDMTRMPKFVSYAGVFILKS  228

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             +PLR  A    F+  + +   DW  +GRLHCLLPWWED+ V+FM+ GGYNV+ QIK+V  
Sbjct  229   LPLRFLATRLAFNN-TPNEFFDWVQIGRLHCLLPWWEDSTVDFMIRGGYNVIKQIKQVKH  287

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             + L++ G  D ++S++LA RL +ELP+AI+ Q+   GH+PHVE+P   AKL+ +F   D+
Sbjct  288   KCLIMWGEDDGIISSKLAYRLHQELPDAILRQVRQCGHIPHVEKPREAAKLVLEFLERDK  347



>ref|XP_004958223.1| PREDICTED: monoacylglycerol lipase abhd6-B-like isoform X2 [Setaria 
italica]
Length=364

 Score =   381 bits (979),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 227/300 (76%), Gaps = 2/300 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHC  1024
             FP FLP+ V  I+D  A  LA+RI+R+PVQ GFS S I SSC++P+ Q  D +P+VLLH 
Sbjct  49    FPSFLPRAVERIRDGAAIRLAKRIERVPVQTGFSVSPIQSSCVRPLKQQQDADPIVLLHG  108

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR TYPLLE+ G EAWA+DILGWGFSDL  RP CD ASKR HLYQ WKSYIKR
Sbjct  109   FDSSCLEWRYTYPLLEEAGHEAWAVDILGWGFSDLATRPPCDVASKREHLYQFWKSYIKR  168

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PM+LVGPSLGAAVAIDF++N+PEAV K++ I ASVY EG   MT++PK V+Y GV +LKS
Sbjct  169   PMVLVGPSLGAAVAIDFSINYPEAVSKMIFIGASVYSEGPKDMTRMPKFVSYAGVFILKS  228

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             +PLR  A    F+  + +   DW  +GRLHCLLPWWED+ V+FM+ GGYNV+ QIK+V  
Sbjct  229   LPLRFLATRLAFNN-TPNEFFDWVQIGRLHCLLPWWEDSTVDFMIRGGYNVIKQIKQVKH  287

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             + L++ G  D ++S++LA RL +ELP+AI+ Q+   GH+PHVE+P   AKL+ +F   D+
Sbjct  288   KCLIMWGEDDGIISSKLAYRLHQELPDAILRQVRQCGHIPHVEKPREAAKLVLEFLERDK  347



>ref|XP_010259725.1| PREDICTED: uncharacterized protein LOC104599022 isoform X3 [Nelumbo 
nucifera]
Length=293

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/258 (69%), Positives = 207/258 (80%), Gaps = 0/258 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDPFAR LA+RI+R+PVQV FSES IMSSC+KP+ QG+  PVVLLH F
Sbjct  31    FPSFLPKEVEKIKDPFARKLAKRIERVPVQVSFSESCIMSSCVKPLFQGETNPVVLLHGF  90

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEW  T+PLLE+  +E W +DILGWGFSDLER P C  A+KR HLYQLW+SYIK+P
Sbjct  91    DSSCLEWSNTHPLLEEARLETWTVDILGWGFSDLERLPACTVATKREHLYQLWRSYIKKP  150

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAV IDF VN P+AV K+VLI A VY EGTG + KLP+  AY GV+LLKSI
Sbjct  151   MILVGPSLGAAVTIDFTVNHPDAVEKVVLIGAGVYTEGTGRLAKLPRATAYAGVALLKSI  210

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  +  +S  T LDWT+VGRLHCLLPWWEDA V+FMLSGGYNV   IK+V Q+
Sbjct  211   PLRLYANLLAYKRISYGTILDWTSVGRLHCLLPWWEDATVDFMLSGGYNVSSHIKQVKQK  270

Query  480   TLVITGMRDKLVSNELAM  427
              L+I G  DK+ S +LA+
Sbjct  271   ALIIWGEDDKIFSRKLAV  288



>ref|XP_010258068.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X4 [Nelumbo 
nucifera]
Length=271

 Score =   376 bits (966),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 174/256 (68%), Positives = 209/256 (82%), Gaps = 0/256 (0%)
 Frame = -3

Query  1077  CIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCD  898
             C++P++Q +  PVVLLH FDSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P+CD
Sbjct  13    CVRPLLQSETNPVVLLHGFDSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPSCD  72

Query  897   AASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGF  718
               SKR HLYQLW+SYIK+PMILVGPSLGAAVAID AVN PE+V KL+LI+A VY EGTG 
Sbjct  73    VTSKRDHLYQLWRSYIKKPMILVGPSLGAAVAIDIAVNHPESVQKLILIDAGVYAEGTGN  132

Query  717   MTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVN  538
             + KLP+ VAY GVS+LKS+PLR+YA L  F  +S  T LD TNVGRLHCLLPWWEDA V+
Sbjct  133   LAKLPRTVAYAGVSVLKSMPLRLYANLLAFKKISFDTILDQTNVGRLHCLLPWWEDATVD  192

Query  537   FMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHV  358
             FM+SGGYNV   I +VNQ+TL+I G  DK+ S+E A+RL  +LPNAI+HQ+ + GHLPHV
Sbjct  193   FMISGGYNVSRLIDQVNQKTLIIWGEDDKIFSSEFAVRLHHQLPNAIIHQLSDCGHLPHV  252

Query  357   EEPHSVAKLIADFARG  310
             + P+SVAKLI DF + 
Sbjct  253   DRPNSVAKLIVDFVQA  268



>ref|XP_010258066.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X3 [Nelumbo 
nucifera]
Length=306

 Score =   378 bits (970),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 222/274 (81%), Gaps = 0/274 (0%)
 Frame = -3

Query  1131  IQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWA  952
             I  + V V FSESSIMSSC++P++Q +  PVVLLH FDSSCLEWR TYPLLE+ G+E WA
Sbjct  30    IGSVVVHVSFSESSIMSSCVRPLLQSETNPVVLLHGFDSSCLEWRYTYPLLEEAGLETWA  89

Query  951   IDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEA  772
             +DILGWGFSDLER P+CD  SKR HLYQLW+SYIK+PMILVGPSLGAAVAID AVN PE+
Sbjct  90    VDILGWGFSDLERLPSCDVTSKRDHLYQLWRSYIKKPMILVGPSLGAAVAIDIAVNHPES  149

Query  771   VHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWT  592
             V KL+LI+A VY EGTG + KLP+ VAY GVS+LKS+PLR+YA L  F  +S  T LD T
Sbjct  150   VQKLILIDAGVYAEGTGNLAKLPRTVAYAGVSVLKSMPLRLYANLLAFKKISFDTILDQT  209

Query  591   NVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRE  412
             NVGRLHCLLPWWEDA V+FM+SGGYNV   I +VNQ+TL+I G  DK+ S+E A+RL  +
Sbjct  210   NVGRLHCLLPWWEDATVDFMISGGYNVSRLIDQVNQKTLIIWGEDDKIFSSEFAVRLHHQ  269

Query  411   LPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             LPNAI+HQ+ + GHLPHV+ P+SVAKLI DF + 
Sbjct  270   LPNAIIHQLSDCGHLPHVDRPNSVAKLIVDFVQA  303



>ref|XP_006573146.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Glycine 
max]
Length=311

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/269 (66%), Positives = 211/269 (78%), Gaps = 0/269 (0%)
 Frame = -3

Query  1104  FSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFS  925
             FSE+ IMSSC+KP++Q  + PVVLLH FDSSCLEWR   PLLE++G+E WAIDILGWGFS
Sbjct  35    FSENPIMSSCVKPLVQTKETPVVLLHGFDSSCLEWRYVLPLLEESGIETWAIDILGWGFS  94

Query  924   DLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINA  745
             DLE+ P CD  SKR H YQ WKSYI+RPMILVGPSLG+AVAIDFAVN+PEAV KLVLI A
Sbjct  95    DLEKLPPCDVVSKRDHFYQFWKSYIRRPMILVGPSLGSAVAIDFAVNYPEAVKKLVLIGA  154

Query  744   SVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLL  565
             SVY EGTG +  LP+ VAY GV+LLKS+PLR+YA    F  +S ST+LDWTNVGRLHC L
Sbjct  155   SVYAEGTGKLATLPRAVAYAGVNLLKSLPLRLYATYLTFTKISFSTSLDWTNVGRLHCFL  214

Query  564   PWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQI  385
             PWW+DA V+FM SGGY+V   I KV Q TL+I G  D+++SN+ A+RL  ELP+AI+ QI
Sbjct  215   PWWDDATVDFMTSGGYSVAPLIGKVKQNTLIIWGENDRIISNKFAVRLHCELPDAIIRQI  274

Query  384   PNSGHLPHVEEPHSVAKLIADFARGDEDT  298
             P  GHLPH+E P S  KLI +F + +  T
Sbjct  275   PYCGHLPHLERPDSTIKLIVEFVQRESKT  303



>ref|XP_010939162.1| PREDICTED: uncharacterized protein LOC105058074 isoform X3 [Elaeis 
guineensis]
Length=316

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/310 (60%), Positives = 223/310 (72%), Gaps = 34/310 (11%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV  I+DP AR LA+RI+RLPV+V F+ S IMSSC+KP  +  KEP+VLLH F
Sbjct  27    FPSFLPKEVERIRDPAARELAKRIERLPVKVSFTNSPIMSSCVKPSQKRGKEPIVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDL------------ERRPTCDAASKRYH  877
             DSSCLEWR T PLL+D G+E WA+DILGWGFSDL            E  P  + A+KR H
Sbjct  87    DSSCLEWRYTLPLLDDAGLETWAVDILGWGFSDLAIIINNVFHHESEMFPPSNVAAKREH  146

Query  876   LYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKM  697
             L+QLW+ YI+RPM+LVGPSLGAAVAIDFA N PE V KLVLI+AS+Y EGTG MTKLP+ 
Sbjct  147   LFQLWRLYIQRPMVLVGPSLGAAVAIDFAANHPEEVSKLVLIDASIYAEGTGTMTKLPRA  206

Query  696   VAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY  517
             +AY GV +LKSIPLR YA    F+ +SL + LDWTNVGRLHCLLPWWED  V+FM+SGGY
Sbjct  207   LAYAGVFVLKSIPLRFYANTLAFNKVSLGSALDWTNVGRLHCLLPWWEDTTVDFMVSGGY  266

Query  516   NVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVA  337
             NV  QIK+                      RL ++L N+++HQIP  GH+PHVE+P SVA
Sbjct  267   NVSSQIKQ----------------------RLQKDLQNSVLHQIPECGHIPHVEKPKSVA  304

Query  336   KLIADFARGD  307
             + I +F +GD
Sbjct  305   ESILEFLQGD  314



>ref|XP_010259714.1| PREDICTED: uncharacterized protein LOC104599022 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010259718.1| PREDICTED: uncharacterized protein LOC104599022 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010259721.1| PREDICTED: uncharacterized protein LOC104599022 isoform X2 [Nelumbo 
nucifera]
Length=308

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/258 (69%), Positives = 207/258 (80%), Gaps = 0/258 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +IKDPFAR LA+RI+R+PVQV FSES IMSSC+KP+ QG+  PVVLLH F
Sbjct  31    FPSFLPKEVEKIKDPFARKLAKRIERVPVQVSFSESCIMSSCVKPLFQGETNPVVLLHGF  90

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEW  T+PLLE+  +E W +DILGWGFSDLER P C  A+KR HLYQLW+SYIK+P
Sbjct  91    DSSCLEWSNTHPLLEEARLETWTVDILGWGFSDLERLPACTVATKREHLYQLWRSYIKKP  150

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAAV IDF VN P+AV K+VLI A VY EGTG + KLP+  AY GV+LLKSI
Sbjct  151   MILVGPSLGAAVTIDFTVNHPDAVEKVVLIGAGVYTEGTGRLAKLPRATAYAGVALLKSI  210

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA L  +  +S  T LDWT+VGRLHCLLPWWEDA V+FMLSGGYNV   IK+V Q+
Sbjct  211   PLRLYANLLAYKRISYGTILDWTSVGRLHCLLPWWEDATVDFMLSGGYNVSSHIKQVKQK  270

Query  480   TLVITGMRDKLVSNELAM  427
              L+I G  DK+ S +LA+
Sbjct  271   ALIIWGEDDKIFSRKLAV  288



>gb|KEH27855.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=292

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/283 (61%), Positives = 217/283 (77%), Gaps = 0/283 (0%)
 Frame = -3

Query  1116  VQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILG  937
             + V F E+ IMSSC+KP++Q  + P+VLLH FDSSCLEWR  YPLLE++G E WAIDILG
Sbjct  7     LMVSFVENPIMSSCVKPLVQNKEPPIVLLHGFDSSCLEWRYGYPLLEESGFETWAIDILG  66

Query  936   WGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLV  757
             WGFSDLE  P CD  SKR H YQ WKSYI+RPMILVGPSLG+AVAIDFAVN+PEAV KL+
Sbjct  67    WGFSDLENLPPCDVVSKRNHFYQFWKSYIRRPMILVGPSLGSAVAIDFAVNYPEAVEKLI  126

Query  756   LINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRL  577
             LI+ASVY EGTG +  LP+ VAY GV LLKS+PLR+YA    F  +SL T LD TNVGRL
Sbjct  127   LIDASVYAEGTGNLATLPRSVAYAGVYLLKSLPLRLYANYLTFTNMSLRTILDGTNVGRL  186

Query  576   HCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAI  397
             HCLLPWW+DA V+FM SGGY +   I+KV Q+TL+I G  D++VSN+LA++L  ELP+AI
Sbjct  187   HCLLPWWDDATVDFMTSGGYKIAPLIRKVKQKTLIIWGENDRIVSNKLAVQLHCELPDAI  246

Query  396   VHQIPNSGHLPHVEEPHSVAKLIADFARGDEDTCVESYCKIKE  268
             + QIP+ GH+PH+E P S  KLI +F + ++    +   ++ +
Sbjct  247   LRQIPDCGHIPHLERPDSTIKLIVEFIQTEKKKLSQRVSQVSQ  289



>ref|XP_010042149.1| PREDICTED: uncharacterized protein LOC104431167 [Eucalyptus grandis]
Length=314

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 228/301 (76%), Gaps = 17/301 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQGDKEPVVLLH  1027
             FP FLPKEV +IKDPFAR LA++I+R+PV  Q+  S+  +MSSC+KP I+ +  PVVLLH
Sbjct  28    FPSFLPKEVEKIKDPFARRLAQKIERVPVPVQIESSDGWVMSSCVKPSIRSNNNPVVLLH  87

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIK  847
             CFDSSCLEWR  YPLLE+ G+E WA+D+LGWGFSDLE+RP C  +SKR+HLYQLWK++I+
Sbjct  88    CFDSSCLEWRHAYPLLEEAGLEVWAVDVLGWGFSDLEKRPPCGVSSKRHHLYQLWKTHIR  147

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             RPM+LVGPSLGAA AIDFAVN  EAV KLVLIN  VY EGTG + K+PK+VAY GV L  
Sbjct  148   RPMVLVGPSLGAAAAIDFAVNHSEAVEKLVLINGCVYEEGTGQLAKVPKLVAYAGVGL--  205

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVN  487
                     KL  F G    T      VGRLHCLLPWW+DA V+FM SGGYNVV QIK+V 
Sbjct  206   --------KLN-FVGHMCQTGY----VGRLHCLLPWWKDASVSFMRSGGYNVVDQIKEVK  252

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             Q+ L++ G  D++++ +L +RL  ELP+AI+ Q+P+ GHL HVE+P+++A LIADF +G 
Sbjct  253   QKVLIVYGEHDRIITKKLQVRLHCELPSAIIRQVPDCGHLLHVEKPNAIANLIADFVQGS  312

Query  306   E  304
              
Sbjct  313   N  313



>ref|XP_007157835.1| hypothetical protein PHAVU_002G102200g, partial [Phaseolus vulgaris]
 gb|ESW29829.1| hypothetical protein PHAVU_002G102200g, partial [Phaseolus vulgaris]
Length=267

 Score =   369 bits (946),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 193/236 (82%), Gaps = 0/236 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEVH IKDPFAR+LA RIQRLPV V FSE  IMSS +KP++Q  + PVVLLH F
Sbjct  32    FPSFLPKEVHRIKDPFARTLANRIQRLPVSVRFSEDPIMSSSVKPMMQNKENPVVLLHGF  91

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G E WA+DILGWGFSDLE+ P+CD  SKR H YQ WKS+I++ 
Sbjct  92    DSSCLEWRYTYPLLEEAGYETWAVDILGWGFSDLEKLPSCDVVSKRDHFYQFWKSHIRKA  151

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG+AVAIDFAVN+PEAV KLVLI+ASVY EGTG +  LP+  AY G  +LKSI
Sbjct  152   MILVGPSLGSAVAIDFAVNYPEAVEKLVLIDASVYAEGTGNLATLPRAAAYAGAYVLKSI  211

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKK  493
             PLR+YA    F  LS ST+LDWTNVGRLHCLLPWWEDA V+FM SGGYNVV QIKK
Sbjct  212   PLRLYANYLSFTNLSFSTSLDWTNVGRLHCLLPWWEDATVDFMTSGGYNVVSQIKK  267



>gb|KEH27854.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=276

 Score =   366 bits (940),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 170/273 (62%), Positives = 211/273 (77%), Gaps = 0/273 (0%)
 Frame = -3

Query  1086  MSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRP  907
             MSSC+KP++Q  + P+VLLH FDSSCLEWR  YPLLE++G E WAIDILGWGFSDLE  P
Sbjct  1     MSSCVKPLVQNKEPPIVLLHGFDSSCLEWRYGYPLLEESGFETWAIDILGWGFSDLENLP  60

Query  906   TCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEG  727
              CD  SKR H YQ WKSYI+RPMILVGPSLG+AVAIDFAVN+PEAV KL+LI+ASVY EG
Sbjct  61    PCDVVSKRNHFYQFWKSYIRRPMILVGPSLGSAVAIDFAVNYPEAVEKLILIDASVYAEG  120

Query  726   TGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDA  547
             TG +  LP+ VAY GV LLKS+PLR+YA    F  +SL T LD TNVGRLHCLLPWW+DA
Sbjct  121   TGNLATLPRSVAYAGVYLLKSLPLRLYANYLTFTNMSLRTILDGTNVGRLHCLLPWWDDA  180

Query  546   MVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHL  367
              V+FM SGGY +   I+KV Q+TL+I G  D++VSN+LA++L  ELP+AI+ QIP+ GH+
Sbjct  181   TVDFMTSGGYKIAPLIRKVKQKTLIIWGENDRIVSNKLAVQLHCELPDAILRQIPDCGHI  240

Query  366   PHVEEPHSVAKLIADFARGDEDTCVESYCKIKE  268
             PH+E P S  KLI +F + ++    +   ++ +
Sbjct  241   PHLERPDSTIKLIVEFIQTEKKKLSQRVSQVSQ  273



>ref|XP_010235921.1| PREDICTED: uncharacterized protein LOC100842211 [Brachypodium 
distachyon]
Length=358

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 225/295 (76%), Gaps = 2/295 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPV-IQGDKEPVVLLHC  1024
             FP FLP+ V  I+D  A  LA+RI+R+PVQ  FS+S I+SSC++P+  Q D +PVVLLH 
Sbjct  50    FPPFLPRAVERIRDGAAIRLAKRIERVPVQTSFSKSPILSSCVRPLRQQQDSDPVVLLHG  109

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR TYPLLE+ G+E WA+DILGWGFS+LE RP CD  SKR HLYQ WKSYI+R
Sbjct  110   FDSSCLEWRYTYPLLEEAGLETWAVDILGWGFSNLETRPPCDVGSKREHLYQFWKSYIRR  169

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PM+LVGPSLGAAVAIDFAV++PEAV KL+ I ASVY EGT  MT+LPK V Y GV LLKS
Sbjct  170   PMVLVGPSLGAAVAIDFAVHYPEAVSKLIFIGASVYAEGTKDMTRLPKFVPYAGVLLLKS  229

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             +PLR+ A    F+ +      DW  +GRLHCLLPWWEDA VNFML+GGYN++ +IK+V  
Sbjct  230   LPLRLLATCLAFNKIP-DGFFDWVQIGRLHCLLPWWEDATVNFMLTGGYNILKEIKQVKH  288

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             R LV+ G  D ++SN+ A RL +ELP+AI+ Q+   GH+PHVE+P   AK + DF
Sbjct  289   RCLVLWGEDDGIISNKQAYRLQQELPSAILRQVGQCGHIPHVEKPREAAKHLLDF  343



>ref|XP_011000104.1| PREDICTED: uncharacterized protein LOC105107762 [Populus euphratica]
Length=310

 Score =   365 bits (937),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 215/296 (73%), Gaps = 28/296 (9%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLPKEV +IKDPFARSL++R++RLPVQ+G SES IMSSC+KP+ Q +K  PVVLLHC
Sbjct  42    FPSFLPKEVEKIKDPFARSLSKRMKRLPVQIGKSESCIMSSCVKPLRQSNKTSPVVLLHC  101

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSSCLEWR TYPLLE+ G+EAWA+D+LGWGFSDLE R  CD ASKR+HLYQ+       
Sbjct  102   FDSSCLEWRCTYPLLEEAGLEAWAVDVLGWGFSDLETRSPCDVASKRHHLYQVCSL----  157

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
                                     V KLVLIN SVY EGTG + KLP++VAY GVS LKS
Sbjct  158   -----------------------QVEKLVLINPSVYAEGTGDLAKLPELVAYAGVSFLKS  194

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             +PLR YA +  F+G+   T LDWTNVGRLHCLLPWW DA V+FMLSGGYNV+ QIK +  
Sbjct  195   LPLRFYANMVAFNGIPFFTILDWTNVGRLHCLLPWWRDATVSFMLSGGYNVISQIKLLKH  254

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             +TL+I G  D++VS +  ++L  EL NAI+ ++ +SGHLPHV+ P  VAKLI DFA
Sbjct  255   KTLIICGQHDQIVSYQHVVKLHSELSNAIIREVSDSGHLPHVDNPKGVAKLIVDFA  310



>ref|XP_009140216.1| PREDICTED: uncharacterized protein LOC103864211 isoform X3 [Brassica 
rapa]
Length=308

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/261 (66%), Positives = 206/261 (79%), Gaps = 4/261 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQ-GDKEPVVLL  1030
             FP FLPKEV +IKDPFAR+LA++I R+PV  Q+      +MSSCIKP +Q  DK PVVLL
Sbjct  24    FPTFLPKEVKDIKDPFARALAQKIVRIPVPLQMENFRGCVMSSCIKPTVQLPDKSPVVLL  83

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRR YPLLE+  +E WAID+LGWGFSDL++ P CDAASKR+HL++LWK+YI
Sbjct  84    HCFDSSCLEWRRAYPLLEEACLETWAIDVLGWGFSDLQKLPPCDAASKRHHLFELWKTYI  143

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG +  LPK +AY GV LL
Sbjct  144   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGALKDLPKSIAYAGVKLL  203

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             KS PLR+ A +  F    LS  +DWTN+GRLHC +PWWEDAMVNFM+SGGYNV   IK +
Sbjct  204   KSFPLRLLANVLAFSS-PLSENIDWTNIGRLHCQMPWWEDAMVNFMISGGYNVASHIKLI  262

Query  489   NQRTLVITGMRDKLVSNELAM  427
             N +TLVI    D++VSN+L++
Sbjct  263   NHKTLVICSENDQIVSNQLSV  283



>ref|XP_008791306.1| PREDICTED: uncharacterized protein LOC103708252 isoform X2 [Phoenix 
dactylifera]
Length=305

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/258 (66%), Positives = 205/258 (79%), Gaps = 0/258 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP F+PKEV  I+D  AR LA+RI+RLPV+V F+ SSIMSSC+KP  +  KEP+VLLH F
Sbjct  27    FPSFIPKEVERIRDLAARELAKRIERLPVKVSFTNSSIMSSCVKPSQKRGKEPIVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T PLLED G+E WA+DILGWGFSDLE  P  + A+KR HL+QLW+ YIKRP
Sbjct  87    DSSCLEWRYTLPLLEDAGLETWAVDILGWGFSDLEMLPPSNVAAKREHLFQLWRLYIKRP  146

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAAVAIDFA N PE V KLVLI+ASVY EGTG MTKLP+ +AY GV LLKSI
Sbjct  147   MVLVGPSLGAAVAIDFAANHPEEVSKLVLIDASVYAEGTGTMTKLPRALAYAGVLLLKSI  206

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA    F+ +S  + LDW NVGRLHCLLPWWED  V+FM+SGGYNV  QIK++ Q+
Sbjct  207   PLRFYANTLAFNKVSFGSALDWANVGRLHCLLPWWEDTTVDFMVSGGYNVSSQIKQIKQK  266

Query  480   TLVITGMRDKLVSNELAM  427
             +L+I G  D+++S+  A+
Sbjct  267   SLIIWGEDDQIISSTNAL  284



>ref|XP_008791309.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X4 [Phoenix 
dactylifera]
Length=295

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/298 (59%), Positives = 217/298 (73%), Gaps = 31/298 (10%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP F+PKEV  I+D  AR LA+RI+RLPV+V F+ SSIMSSC+KP  +  KEP+VLLH F
Sbjct  27    FPSFIPKEVERIRDLAARELAKRIERLPVKVSFTNSSIMSSCVKPSQKRGKEPIVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T PLLED G+E WA+DILGWGFSDLE  P  + A+KR HL+QLW+ YIKRP
Sbjct  87    DSSCLEWRYTLPLLEDAGLETWAVDILGWGFSDLEMLPPSNVAAKREHLFQLWRLYIKRP  146

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAAVAIDFA N PE V KLVLI+ASVY EGTG MTKLP+ +AY G       
Sbjct  147   MVLVGPSLGAAVAIDFAANHPEEVSKLVLIDASVYAEGTGTMTKLPRALAYAG-------  199

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
                                     VGRLHCLLPWWED  V+FM+SGGYNV  QIK++ Q+
Sbjct  200   ------------------------VGRLHCLLPWWEDTTVDFMVSGGYNVSSQIKQIKQK  235

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             +L+I G  D+++S+  A+RL +EL N+++H+IP  GH+PHVE+P SVA+ I +F +GD
Sbjct  236   SLIIWGEDDQIISSTNALRLQKELQNSVLHRIPECGHIPHVEKPMSVAESILEFLQGD  293



>ref|NP_001130641.1| uncharacterized protein LOC100191741 [Zea mays]
 ref|XP_008670543.1| PREDICTED: monoacylglycerol lipase abhd6-B-like isoform X2 [Zea 
mays]
 gb|ACF78941.1| unknown [Zea mays]
 gb|ACN28704.1| unknown [Zea mays]
 tpg|DAA41347.1| TPA: hypothetical protein ZEAMMB73_984560 [Zea mays]
 tpg|DAA41349.1| TPA: hypothetical protein ZEAMMB73_984560 [Zea mays]
 tpg|DAA41353.1| TPA: hypothetical protein ZEAMMB73_984560 [Zea mays]
Length=373

 Score =   365 bits (938),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/307 (60%), Positives = 228/307 (74%), Gaps = 3/307 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHC  1024
             FP FLP  V  I+D  A  LA+RI+R+PVQ  FS S+I SSC++P+ Q  D +PVVLLH 
Sbjct  49    FPSFLPGAVERIRDGAAIRLAKRIERVPVQTSFSGSAISSSCVRPLKQQQDGDPVVLLHG  108

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LEWR TYPLLE+ G+EAWA+DILGWGFSDLE RP CD ASKR H YQ WKSYIKR
Sbjct  109   FDSSVLEWRYTYPLLEEAGLEAWAVDILGWGFSDLETRPPCDVASKREHFYQFWKSYIKR  168

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PM+LVGPSLGAAVAIDF+VN+PEAV KL+ I ASVY EG   MT++PK V+Y GV +LKS
Sbjct  169   PMVLVGPSLGAAVAIDFSVNYPEAVSKLIFIGASVYSEGPKDMTRMPKFVSYAGVFILKS  228

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             +PLR  A    F   + +   DW  +GRLHCLLPWWEDA V+FM+ GGYNV++QIK+V  
Sbjct  229   LPLRFLATRLAFKK-TPNEFFDWVQIGRLHCLLPWWEDATVDFMIRGGYNVINQIKQVKH  287

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF-ARGD  307
             + L++ G  D ++S++LA RL +ELP+AI+ Q+   GH+PHVE+P   AK + +F AR  
Sbjct  288   KCLILWGEDDGIISSKLAYRLHQELPDAILRQVRQCGHIPHVEKPREAAKHVLEFLARNT  347

Query  306   EDTCVES  286
              D   +S
Sbjct  348   SDKSDQS  354



>ref|XP_008667052.1| PREDICTED: uncharacterized protein LOC100191741 isoform X1 [Zea 
mays]
 ref|XP_008670542.1| PREDICTED: monoacylglycerol lipase abhd6-B-like isoform X1 [Zea 
mays]
 gb|ACG43159.1| hypothetical protein [Zea mays]
 tpg|DAA41350.1| TPA: hypothetical protein ZEAMMB73_984560 [Zea mays]
 tpg|DAA41352.1| TPA: hypothetical protein ZEAMMB73_984560 [Zea mays]
Length=375

 Score =   365 bits (938),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/307 (60%), Positives = 228/307 (74%), Gaps = 3/307 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHC  1024
             FP FLP  V  I+D  A  LA+RI+R+PVQ  FS S+I SSC++P+ Q  D +PVVLLH 
Sbjct  49    FPSFLPGAVERIRDGAAIRLAKRIERVPVQTSFSGSAISSSCVRPLKQQQDGDPVVLLHG  108

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LEWR TYPLLE+ G+EAWA+DILGWGFSDLE RP CD ASKR H YQ WKSYIKR
Sbjct  109   FDSSVLEWRYTYPLLEEAGLEAWAVDILGWGFSDLETRPPCDVASKREHFYQFWKSYIKR  168

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PM+LVGPSLGAAVAIDF+VN+PEAV KL+ I ASVY EG   MT++PK V+Y GV +LKS
Sbjct  169   PMVLVGPSLGAAVAIDFSVNYPEAVSKLIFIGASVYSEGPKDMTRMPKFVSYAGVFILKS  228

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             +PLR  A    F   + +   DW  +GRLHCLLPWWEDA V+FM+ GGYNV++QIK+V  
Sbjct  229   LPLRFLATRLAFKK-TPNEFFDWVQIGRLHCLLPWWEDATVDFMIRGGYNVINQIKQVKH  287

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF-ARGD  307
             + L++ G  D ++S++LA RL +ELP+AI+ Q+   GH+PHVE+P   AK + +F AR  
Sbjct  288   KCLILWGEDDGIISSKLAYRLHQELPDAILRQVRQCGHIPHVEKPREAAKHVLEFLARNT  347

Query  306   EDTCVES  286
              D   +S
Sbjct  348   SDKSDQS  354



>ref|XP_009402999.1| PREDICTED: uncharacterized protein LOC103986654 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=310

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 226/296 (76%), Gaps = 13/296 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +I+DPFAR +A+RI+RLPV++ FS SSIMSSC+KP+ +   EPVVLLH F
Sbjct  26    FPSFLPKEVDKIRDPFARDMAKRIERLPVKISFSTSSIMSSCVKPLQERGTEPVVLLHGF  85

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR +YPLLE  G++ WA+DILGWGFSDL+  P C+ A+KR HLYQLW++YI RP
Sbjct  86    DSSCLEWRYSYPLLEGAGIDTWAVDILGWGFSDLQMLPPCNVAAKREHLYQLWRTYIARP  145

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGA+VA+DF  N PEAV KLV+I+AS+Y EGTG + KLP++VAY GVS+LKSI
Sbjct  146   MVLVGPSLGASVAMDFIANHPEAVSKLVMIDASIYAEGTGNLAKLPRIVAYAGVSVLKSI  205

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA     + +SL ++ D  NVGRLHCL PWWEDA V+FMLSGGY+V + +K++ Q 
Sbjct  206   PLRFYANSLALNKVSLQSSWDSMNVGRLHCLQPWWEDATVDFMLSGGYDVRNHVKQIKQE  265

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             TL+I G  D++VS+++A+             IP  GH+PHVE+P  V + I  F R
Sbjct  266   TLIIWGQDDQIVSSKVAL-------------IPGCGHIPHVEKPELVVQYILKFIR  308



>ref|XP_008460252.1| PREDICTED: uncharacterized protein LOC103499127 isoform X2 [Cucumis 
melo]
Length=276

 Score =   358 bits (920),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 169/264 (64%), Positives = 204/264 (77%), Gaps = 0/264 (0%)
 Frame = -3

Query  1098  ESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDL  919
             E+ IMSSC+KP  + +K PVVLLHCFDSSCLEW   +PLLE+ G+E WA+D+LGWGFSDL
Sbjct  11    ETCIMSSCVKPAKRSEKNPVVLLHCFDSSCLEWSYAFPLLEEAGLETWAVDVLGWGFSDL  70

Query  918   ERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASV  739
             +  P C+  +KR HLYQ WK+YIKRPM+LVGPSLGAA+A+DFAVN PEAV KLVLINA V
Sbjct  71    DSLPPCNVETKRSHLYQFWKTYIKRPMVLVGPSLGAAIAVDFAVNHPEAVEKLVLINACV  130

Query  738   YGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPW  559
             Y + TG  TKLP +VAY GVSLLKSIPLR+ A    F+ LSL+  L+WTNVGRLHCLLPW
Sbjct  131   YSKCTGHPTKLPNVVAYAGVSLLKSIPLRLIANKLTFNRLSLARNLEWTNVGRLHCLLPW  190

Query  558   WEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPN  379
             WED  V+FM SGGYNV+ QIK+V  R LVI G  D+++  +  +RL  ELPNA++  I +
Sbjct  191   WEDTTVSFMNSGGYNVISQIKQVKHRALVIAGEDDRIIRFKDVVRLHCELPNAVMRVITD  250

Query  378   SGHLPHVEEPHSVAKLIADFARGD  307
             SGHLPHV+ P SV+KLI  F   D
Sbjct  251   SGHLPHVDSPASVSKLITHFVLHD  274



>ref|XP_010552549.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Tarenaya 
hassleriana]
Length=271

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 205/262 (78%), Gaps = 1/262 (0%)
 Frame = -3

Query  1089  IMSSCIKPVIQGD-KEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLER  913
             +MSSCIKP+ Q     PVVLLHCFDSSCLEWR TYPLL+   +E WA+D+LGWGFS+L+ 
Sbjct  8     VMSSCIKPLGQQHCANPVVLLHCFDSSCLEWRCTYPLLDQACLETWALDVLGWGFSELQV  67

Query  912   RPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYG  733
              P CDAASKR+HL+QLWK+YIKRPMILVGPSLGA +A+DFA  +PEAV KLVLINA+ Y 
Sbjct  68    LPPCDAASKRHHLFQLWKTYIKRPMILVGPSLGATIAVDFAATYPEAVQKLVLINANAYS  127

Query  732   EGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWE  553
             EGTG + KLPK+VAY GV LLKS PLR+ A +  F  + L   +DWTNVGRLHC + WWE
Sbjct  128   EGTGQLAKLPKLVAYAGVRLLKSFPLRLLANVLAFRSVPLPKQIDWTNVGRLHCRMSWWE  187

Query  552   DAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSG  373
              A V++M+SGGYNV  QIK V Q+TLVI    D++V+N+L+++L  EL N++  ++P SG
Sbjct  188   MATVDYMISGGYNVASQIKLVKQKTLVICSENDQIVNNQLSVKLLCELRNSVFREVPGSG  247

Query  372   HLPHVEEPHSVAKLIADFARGD  307
             HLPHVE P  VA+LIADFAR D
Sbjct  248   HLPHVENPEHVAELIADFARED  269



>gb|EMS57377.1| putative hydrolase yugF [Triticum urartu]
Length=298

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/273 (63%), Positives = 207/273 (76%), Gaps = 10/273 (4%)
 Frame = -3

Query  1110  VGFSESSIMSSCIKPVIQGDK-EPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGW  934
              GFS+S I SSC++P+ Q    +PVVLLH FDSSCLEWR TYPLLED G+E WA+DILGW
Sbjct  13    TGFSKSPIPSSCVRPLKQQQSADPVVLLHGFDSSCLEWRYTYPLLEDAGLETWAVDILGW  72

Query  933   GFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVL  754
             GFS+LE RP CD  SKR HLYQ W+SYIKRPM+LVGPSLGAAVAIDFAVN+PEAV KL+ 
Sbjct  73    GFSNLETRPPCDIVSKREHLYQFWRSYIKRPMVLVGPSLGAAVAIDFAVNYPEAVSKLIF  132

Query  753   INASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCF----DGLSLSTTLDWTNV  586
             I ASVY EGT  MT++PK V Y GV +LKS+PLR++A    F    DG       DW  +
Sbjct  133   IGASVYAEGTKDMTRMPKFVPYAGVFVLKSLPLRLFATRLAFYKIPDGF-----FDWVQI  187

Query  585   GRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELP  406
             GRLHCLLPWWEDA VNFM++GGYNV++QIK+V Q+ LV+ G  D ++SN+ A RL +ELP
Sbjct  188   GRLHCLLPWWEDATVNFMITGGYNVINQIKQVKQKCLVLWGEDDGIISNKQAYRLQQELP  247

Query  405   NAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             +AI+ Q+   GH+PHVE+P   AK + DF  GD
Sbjct  248   SAILRQVGQCGHIPHVEKPREAAKHVLDFLGGD  280



>gb|KCW86501.1| hypothetical protein EUGRSUZ_B03156 [Eucalyptus grandis]
Length=266

 Score =   353 bits (906),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 194/241 (80%), Gaps = 2/241 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V  IKD +AR LA RI+RLPV +  S++ IMSSC+KP+++G+  PVVLLH F
Sbjct  22    FPPFLPKQVENIKDSYARKLASRIERLPVNL--SDNCIMSSCVKPLVKGETNPVVLLHGF  79

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLED G+E WA+DILGWGFSDLE+ P C+ A+KR H YQLWKSYIK+P
Sbjct  80    DSSCLEWRYTYPLLEDAGLETWAVDILGWGFSDLEQLPACNVANKRNHFYQLWKSYIKKP  139

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAA+AIDFAV  PEAV KLVLI+ASVY EGTG M  LP+ +AY GVS+LKS 
Sbjct  140   MILVGPSLGAAIAIDFAVIHPEAVEKLVLIDASVYAEGTGDMANLPRAIAYAGVSILKSF  199

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR +  +  F GL LST LDWTNVGRLHC  PWWEDA V+FMLSGGYNV  QI +V + 
Sbjct  200   PLRFWVNVLAFRGLPLSTNLDWTNVGRLHCRYPWWEDASVDFMLSGGYNVTEQINQVCRS  259

Query  480   T  478
             T
Sbjct  260   T  260



>ref|XP_009596055.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X2 [Nicotiana 
tomentosiformis]
Length=318

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 211/299 (71%), Gaps = 33/299 (11%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V  IKD  AR LA RI+R+PV    S+  ++SSC+KP  Q +  PVVLLH F
Sbjct  37    FPDFLPNQVENIKDSSARKLASRIERVPVN--LSKGCVLSSCVKPKEQTEANPVVLLHGF  94

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T P+LE+ G+E WA+DILGWGFSDLER P+CD ASK  HLYQLW +YIKRP
Sbjct  95    DSSCLEWRYTLPMLEEAGLETWAVDILGWGFSDLERLPSCDVASKHDHLYQLWSTYIKRP  154

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLG+AVAIDF+V +PEAV+KLVLI+ASVY EGTG +  LPK VAY G       
Sbjct  155   MVLVGPSLGSAVAIDFSVKYPEAVYKLVLIDASVYAEGTGNLATLPKAVAYAG-------  207

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
                                     +GRLHCLLPWWEDA VNFM+SGGYNVV QI+ V Q+
Sbjct  208   ------------------------IGRLHCLLPWWEDATVNFMISGGYNVVAQIEHVKQK  243

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDE  304
             TL+I G  D+++  +L +RL  ELPNAI+ QIP  GH+PHVE+P  V++LI +F   D+
Sbjct  244   TLIIWGEDDQIIDYKLGVRLHCELPNAIIRQIPKCGHIPHVEKPDVVSRLIVEFVHSDQ  302



>ref|XP_008791308.1| PREDICTED: uncharacterized protein LOC103708252 isoform X3 [Phoenix 
dactylifera]
Length=296

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 212/298 (71%), Gaps = 30/298 (10%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP F+PKEV  I+D  AR LA+RI+RLPV+V F+ SSIMSSC+KP  +  KEP+VLLH F
Sbjct  27    FPSFIPKEVERIRDLAARELAKRIERLPVKVSFTNSSIMSSCVKPSQKRGKEPIVLLHGF  86

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR T PLLED G+E WA+DILGWGFSDLE  P  + A+KR HL+QLW+ YIKRP
Sbjct  87    DSSCLEWRYTLPLLEDAGLETWAVDILGWGFSDLEMLPPSNVAAKREHLFQLWRLYIKRP  146

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGAAVAIDFA N PE                               V LLKSI
Sbjct  147   MVLVGPSLGAAVAIDFAANHPEE------------------------------VLLLKSI  176

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA    F+ +S  + LDW NVGRLHCLLPWWED  V+FM+SGGYNV  QIK++ Q+
Sbjct  177   PLRFYANTLAFNKVSFGSALDWANVGRLHCLLPWWEDTTVDFMVSGGYNVSSQIKQIKQK  236

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             +L+I G  D+++S+  A+RL +EL N+++H+IP  GH+PHVE+P SVA+ I +F +GD
Sbjct  237   SLIIWGEDDQIISSTNALRLQKELQNSVLHRIPECGHIPHVEKPMSVAESILEFLQGD  294



>ref|XP_006658774.1| PREDICTED: uncharacterized protein LOC102720166 [Oryza brachyantha]
Length=409

 Score =   357 bits (916),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 226/324 (70%), Gaps = 30/324 (9%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHC  1024
             FP FLP+ V  I+D  A  LA+RI+R+PVQ GFSES I+SSC++P+ Q    +P+VLLH 
Sbjct  41    FPAFLPRAVERIRDGPAIRLAKRIERVPVQTGFSESPILSSCVRPLEQQRSGDPLVLLHG  100

Query  1023  FD---------------------------SSCLEWRRTYPLLEDTGVEAWAIDILGWGFS  925
             FD                           SSCLEWR TYPLLE+ G+EAWA+DILGWGFS
Sbjct  101   FDRYARVATPQAPEFASVQQPGPFKSIRYSSCLEWRYTYPLLEEAGLEAWAVDILGWGFS  160

Query  924   DLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINA  745
              L  RP  D ASKR HLYQ W+SYI+RPM+LVGPSLGAAVAIDF VN+PEAV KL+ ++A
Sbjct  161   HLGNRPPGDVASKREHLYQFWRSYIRRPMVLVGPSLGAAVAIDFTVNYPEAVSKLIFLSA  220

Query  744   SVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLS--LSTTLDWTNVGRLHC  571
             SVY EG   MT++P+ V Y G  LLKS+PLR +A    F  ++   +   DW  +GRLHC
Sbjct  221   SVYAEGPKDMTRVPRFVPYAGAFLLKSLPLRYFATCLAFYKIAGGPAGIFDWVQIGRLHC  280

Query  570   LLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVH  391
             LLPWWEDA+V+FM++GGYNV++QI KV  + L++ G  D+++SN+ A RL +ELP+AI+ 
Sbjct  281   LLPWWEDALVDFMMNGGYNVLNQIHKVKHKCLILWGEDDEIISNKHAYRLQQELPDAILR  340

Query  390   QIPNSGHLPHVEEPHSVAKLIADF  319
             Q+   GH+PHVE+P  VAK I DF
Sbjct  341   QLRECGHIPHVEKPMEVAKHILDF  364



>gb|EMT01626.1| hypothetical protein F775_13684 [Aegilops tauschii]
Length=396

 Score =   355 bits (912),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 213/304 (70%), Gaps = 34/304 (11%)
 Frame = -3

Query  1131  IQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHCFDSSCLEWRRTYPLLEDTGVEAW  955
             + R P+Q GFS+S I SSC++P+ Q    +PVVLLH FDSSCLEWR TYPLLED G+E W
Sbjct  47    LTRFPLQTGFSKSPIPSSCVRPLKQQQSADPVVLLHGFDSSCLEWRYTYPLLEDAGLETW  106

Query  954   AIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPE  775
             A+DILGWGFS+LE RP CD  SKR HLYQ W+SYIKRPM+LVGPSLGAAVAIDFAVN+PE
Sbjct  107   AVDILGWGFSNLETRPPCDIVSKREHLYQFWRSYIKRPMVLVGPSLGAAVAIDFAVNYPE  166

Query  774   A------------------------VHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             A                        V KL+ I ASVY EGT  MT++PK V Y GV +LK
Sbjct  167   ACMYFSVTGQIRKLCYKKPTSSSSQVSKLIFIGASVYAEGTKDMTRMPKFVPYAGVFVLK  226

Query  666   SIPLRIYAKLQCF----DGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQI  499
             S+PLR++A    F    DGL      DW  +GRLHCLLPWWEDA VNFM++GGYNV++QI
Sbjct  227   SLPLRLFATRLAFYKIPDGL-----FDWVQIGRLHCLLPWWEDATVNFMITGGYNVINQI  281

Query  498   KKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             K+V Q+ LV+ G  D ++SN+ A RL +ELP+AI+ Q+   GH+PHVE+P   AK + DF
Sbjct  282   KQVKQKCLVLWGEDDGIISNKQAYRLQQELPSAILRQVGQCGHIPHVEKPREAAKHVLDF  341

Query  318   ARGD  307
               GD
Sbjct  342   LEGD  345



>ref|XP_002890023.1| F16A14.4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66282.1| F16A14.4 [Arabidopsis lyrata subsp. lyrata]
Length=626

 Score =   357 bits (916),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/302 (60%), Positives = 215/302 (71%), Gaps = 24/302 (8%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V  IKD FA  LA RI+RLPV V F E SIMSSC+ P+I+ +  PVVLLH F
Sbjct  340   FPTFLPSDVERIKDTFALKLAARIERLPVSVSFREDSIMSSCVTPLIRNETTPVVLLHGF  399

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             D      R TYPLLE+ G+E WA DILGWGFSDL                  WKS+I+RP
Sbjct  400   D------RYTYPLLEEAGLETWAFDILGWGFSDLGF---------------FWKSHIERP  438

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVAID A+N PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKSI
Sbjct  439   VVLVGPSLGAAVAIDIAINHPEAVESLVLMDASVYSEGTGNLATLPKAAAYAGVYLLKSI  498

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y    CF+ +SL T+ DWT +GRLHCL PWWEDA V+FM SGGYNV   IKKV+Q+
Sbjct  499   PLRLYVNFICFNDISLETSWDWTKIGRLHCLYPWWEDATVSFMTSGGYNVTSLIKKVSQK  558

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL++ G  D+++SN+LA RL  EL NA V QI N GHLPHVE+P +VAKLIA+F R   +
Sbjct  559   TLILWGEDDQIISNKLAWRLHGELSNARVEQISNCGHLPHVEKPAAVAKLIAEFVR---E  615

Query  300   TC  295
             TC
Sbjct  616   TC  617



>gb|AAF79393.1|AC068197_3 F16A14.4 [Arabidopsis thaliana]
Length=633

 Score =   352 bits (904),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 182/309 (59%), Positives = 216/309 (70%), Gaps = 31/309 (10%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV-------QVGFSESSIMSSCIKPVIQGDKEP  1042
             FP FLP +V +IKD FA  LA RI+RLPV        V F E SIMSSC+ P+++ +  P
Sbjct  340   FPTFLPTDVEKIKDTFALKLAARIERLPVSVSGLRFHVSFREDSIMSSCVTPLMRNETTP  399

Query  1041  VVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLW  862
             VVLLH FD      R TYPLLE+ G+E WA DILGWGFSDL                  W
Sbjct  400   VVLLHGFD------RYTYPLLEEAGLETWAFDILGWGFSDLGF---------------FW  438

Query  861   KSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGG  682
             KS+IKRP++LVGPSLGAAVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY G
Sbjct  439   KSHIKRPVVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYAEGTGNLATLPKAAAYAG  498

Query  681   VSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQ  502
             V LLKSIPLR+Y    CF+G+SL T+ DWT +GRLHCL PWWEDA V+FM SGGYNV   
Sbjct  499   VYLLKSIPLRLYVNFICFNGISLETSWDWTKIGRLHCLYPWWEDATVSFMTSGGYNVTSL  558

Query  501   IKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIAD  322
             IKKV+Q+TL++ G  D+++SN+LA RL  EL NA V QI N GHLPHVE+P +V KLIA+
Sbjct  559   IKKVSQKTLILWGEDDQIISNKLAWRLHGELSNARVKQISNCGHLPHVEKPAAVTKLIAE  618

Query  321   FARGDEDTC  295
             F R   +TC
Sbjct  619   FVR---ETC  624



>ref|XP_006303265.1| hypothetical protein CARUB_v10009998mg [Capsella rubella]
 gb|EOA36163.1| hypothetical protein CARUB_v10009998mg [Capsella rubella]
Length=273

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 189/242 (78%), Gaps = 3/242 (1%)
 Frame = -3

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             +SSCLEWR TYPLLE+ G+E WA DILGWGFSDL + P CD  SKR H Y+ WK++IKRP
Sbjct  26    NSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLGKLPPCDVTSKREHFYKFWKTHIKRP  85

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             ++LVGPSLGAAVAID AVN PEAV  LVL++ASVY EGTG +  LPK  AY GV LLKSI
Sbjct  86    VVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYSEGTGNLATLPKAAAYAGVYLLKSI  145

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+Y    CF+G+SL T+ DWT +GRLHCL PWWEDA V+FM SGGYN+   IKKV+Q+
Sbjct  146   PLRLYVNFICFNGISLETSWDWTKIGRLHCLYPWWEDATVSFMTSGGYNITSLIKKVSQK  205

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
             TL++ G  D+++SN+LA RL  ELPNA V QI N GHLPHVE+P +VAKLI +F R   +
Sbjct  206   TLILWGEDDQIISNKLAWRLHGELPNARVAQISNCGHLPHVEKPATVAKLITEFVR---E  262

Query  300   TC  295
             TC
Sbjct  263   TC  264



>ref|XP_009403015.1| PREDICTED: uncharacterized protein LOC103986654 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=290

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 199/255 (78%), Gaps = 0/255 (0%)
 Frame = -3

Query  1077  CIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCD  898
             C+KP+ +   EPVVLLH FDSSCLEWR +YPLLE  G++ WA+DILGWGFSDL+  P C+
Sbjct  34    CVKPLQERGTEPVVLLHGFDSSCLEWRYSYPLLEGAGIDTWAVDILGWGFSDLQMLPPCN  93

Query  897   AASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGF  718
              A+KR HLYQLW++YI RPM+LVGPSLGA+VA+DF  N PEAV KLV+I+AS+Y EGTG 
Sbjct  94    VAAKREHLYQLWRTYIARPMVLVGPSLGASVAMDFIANHPEAVSKLVMIDASIYAEGTGN  153

Query  717   MTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVN  538
             + KLP++VAY GVS+LKSIPLR YA     + +SL ++ D  NVGRLHCL PWWEDA V+
Sbjct  154   LAKLPRIVAYAGVSVLKSIPLRFYANSLALNKVSLQSSWDSMNVGRLHCLQPWWEDATVD  213

Query  537   FMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHV  358
             FMLSGGY+V + +K++ Q TL+I G  D++VS+++A+RL  ELP++ + QIP  GH+PHV
Sbjct  214   FMLSGGYDVRNHVKQIKQETLIIWGQDDQIVSSKVALRLHHELPDSTLIQIPGCGHIPHV  273

Query  357   EEPHSVAKLIADFAR  313
             E+P  V + I  F R
Sbjct  274   EKPELVVQYILKFIR  288



>gb|KDP27240.1| hypothetical protein JCGZ_19939 [Jatropha curcas]
Length=255

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FPLFLP E+ +IKDPFARSLA+RIQRLPVQVGF    IMSSC+KP+I+    PVVLLHCF
Sbjct  46    FPLFLPNEIEKIKDPFARSLAQRIQRLPVQVGFPGKCIMSSCVKPLIKSQNSPVVLLHCF  105

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLED G+EAWA+D+LGWGFSDLE RP CD ASKRYHLYQ WKSYIKRP
Sbjct  106   DSSCLEWRCTYPLLEDAGLEAWAVDVLGWGFSDLEMRPPCDVASKRYHLYQFWKSYIKRP  165

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGA+VAIDF  N+PEAV KLVLIN S Y EGT  ++KLP+MVAY GVSLLKS+
Sbjct  166   MILVGPSLGASVAIDFTENYPEAVEKLVLINPSAYAEGTKNLSKLPRMVAYAGVSLLKSL  225

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLH  574
             PLR+YA    F+ +S  T LDWTNV   +
Sbjct  226   PLRLYANTLAFNNISFFTILDWTNVSSFY  254



>ref|XP_001755897.1| predicted protein [Physcomitrella patens]
 gb|EDQ79182.1| predicted protein [Physcomitrella patens]
Length=329

 Score =   327 bits (838),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/294 (52%), Positives = 200/294 (68%), Gaps = 0/294 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V  +++P AR +A RIQ +PVQ   + + IM+SC+ P        V+LLH F
Sbjct  16    FPTFLPPDVELLREPVAREMAARIQHVPVQTSLTPNPIMTSCVIPKKTTSSVAVMLLHGF  75

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LEWR +YP+LED GVE WA+DILGWGFS+ E   + + A+KR H+Y+ WK+Y+K+P
Sbjct  76    DSSLLEWRHSYPVLEDAGVETWAMDILGWGFSNAEGVKSYNVAAKREHMYEFWKNYVKKP  135

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLG A AIDFAV  PEAV KLVL++A  Y EG G M  LPK++AY GV+ LKS+
Sbjct  136   MILVGPSLGGAAAIDFAVTHPEAVAKLVLVDAQGYTEGVGEMATLPKLLAYMGVAFLKSV  195

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR+YA    F   S    LD   VGRLHCL+P W DA V+FM+SGGYNV   I +V Q 
Sbjct  196   PLRLYANTLIFTKASFDFLLDSMRVGRLHCLMPGWADATVSFMMSGGYNVTASIPQVQQE  255

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             TL+I G RD +V    A +   +LP A +  I + GH+PHVE+P   + ++ +F
Sbjct  256   TLIIWGERDTIVPKTFAEKFVADLPKASLKFIKDCGHIPHVEKPKEFSSILKEF  309



>ref|XP_009403007.1| PREDICTED: uncharacterized protein LOC103986654 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=293

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 211/298 (71%), Gaps = 30/298 (10%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +I+DPFAR +A+RI+RLPV++ FS SSIMSSC+KP+ +   EPVVLLH F
Sbjct  26    FPSFLPKEVDKIRDPFARDMAKRIERLPVKISFSTSSIMSSCVKPLQERGTEPVVLLHGF  85

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR +YPLLE  G++ WA+DILGWGFSDL+  P C+ A+KR HLYQLW++YI RP
Sbjct  86    DSSCLEWRYSYPLLEGAGIDTWAVDILGWGFSDLQMLPPCNVAAKREHLYQLWRTYIARP  145

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             M+LVGPSLGA+VA+DF  N PEA                              VS+LKSI
Sbjct  146   MVLVGPSLGASVAMDFIANHPEA------------------------------VSVLKSI  175

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             PLR YA     + +SL ++ D  NVGRLHCL PWWEDA V+FMLSGGY+V + +K++ Q 
Sbjct  176   PLRFYANSLALNKVSLQSSWDSMNVGRLHCLQPWWEDATVDFMLSGGYDVRNHVKQIKQE  235

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             TL+I G  D++VS+++A+RL  ELP++ + QIP  GH+PHVE+P  V + I  F R +
Sbjct  236   TLIIWGQDDQIVSSKVALRLHHELPDSTLIQIPGCGHIPHVEKPELVVQYILKFIRHE  293



>ref|XP_002971012.1| hypothetical protein SELMODRAFT_411752 [Selaginella moellendorffii]
 gb|EFJ27610.1| hypothetical protein SELMODRAFT_411752 [Selaginella moellendorffii]
Length=328

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 208/298 (70%), Gaps = 2/298 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKP-VIQGDKEPVVLLHC  1024
             FP FLP E   +K+  AR +A RI+RLPV    S S I++SC+ P VI+ +  P++LLH 
Sbjct  8     FPSFLPPEASHLKEQAARIMASRIKRLPVTTELSASPILTSCVTPGVIRSNASPLLLLHG  67

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERR-PTCDAASKRYHLYQLWKSYIK  847
             FDSSCLEWRR +PLLED G+E WA+DILGWGFS  ER+  +  A +K  HLY  W+S+I+
Sbjct  68    FDSSCLEWRRAFPLLEDAGLEPWAVDILGWGFSSSERKISSYGAKAKTRHLYDFWRSHIR  127

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             RP  +VGPSLG AVAI+ A  +PE V KLVLI+A  Y EG G +T  P+ + Y G ++LK
Sbjct  128   RPATVVGPSLGGAVAIELAATYPEMVSKLVLIDAQGYAEGLGNLTTSPRSLLYAGAAVLK  187

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVN  487
             S+PLR YA L  F GL+ S+ +D   VGRLHCL+P W DA+V+FM+SGGYNVV QI +V+
Sbjct  188   SVPLRAYANLLIFKGLNYSSLMDLIRVGRLHCLMPGWADALVDFMISGGYNVVSQIPQVD  247

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             + TL+I G RD +V    A +   +LPN+ +  I + GH+PHVE+P +VA  ++ F +
Sbjct  248   KETLLIWGERDTIVPTFNAEKFLVDLPNSRLEIISDCGHIPHVEKPTAVADSLSRFLK  305



>ref|XP_002962073.1| hypothetical protein SELMODRAFT_403595 [Selaginella moellendorffii]
 gb|EFJ37333.1| hypothetical protein SELMODRAFT_403595 [Selaginella moellendorffii]
Length=328

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 207/298 (69%), Gaps = 2/298 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKP-VIQGDKEPVVLLHC  1024
             FP FLP E   +K+  AR +A RI+RLPV    S S I++SC+ P VI+ +  P++LLH 
Sbjct  8     FPSFLPPEASHLKEQAARIMASRIKRLPVTTELSASPILTSCVTPGVIRSNASPLLLLHG  67

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERR-PTCDAASKRYHLYQLWKSYIK  847
             FDSSCLEWRR +PLLED G+E WA+DILGWGFS  ER+  +  A +K  HLY  W+S+I+
Sbjct  68    FDSSCLEWRRAFPLLEDAGLEPWAVDILGWGFSSSERKISSYGAKAKTRHLYDFWRSHIR  127

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             RP I+VGPSLG A AI+ A  +PE V KLVLI+A  Y EG G +T  P+ + Y G ++LK
Sbjct  128   RPAIVVGPSLGGAAAIELAATYPEMVSKLVLIDAQGYAEGLGNLTTSPRSLLYAGAAVLK  187

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVN  487
             S+PLR YA L  F GL+ S+ +D   VGRLHCL+P W DA+V+FM+SGGYNVV QI +V+
Sbjct  188   SVPLRAYANLLIFKGLNYSSLMDLIRVGRLHCLMPGWADALVDFMISGGYNVVSQIPQVD  247

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             + TL+I G RD +V    A +   +LPN+ +  I + GH+PHVE P +VA  ++ F +
Sbjct  248   KETLLIWGERDTIVPTFNAEKFLVDLPNSRLEIISDCGHIPHVERPTAVADSLSRFLK  305



>emb|CAN73949.1| hypothetical protein VITISV_027382 [Vitis vinifera]
Length=401

 Score =   322 bits (825),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 175/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  1077  CIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCD  898
             C+KP+      PVVLLH FDSSCLEWR TYPLLE+ G+E WA+DILGWGFSDLER P+CD
Sbjct  171   CVKPLSPSKTSPVVLLHGFDSSCLEWRYTYPLLEEAGLETWAVDILGWGFSDLERLPSCD  230

Query  897   AASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGF  718
              A+KR H YQLWKS+IKRPMILVGPSLGAAVAIDF  N PEAV KLVLI+ASVY EGTG 
Sbjct  231   VATKRDHFYQLWKSHIKRPMILVGPSLGAAVAIDFTANHPEAVDKLVLIDASVYTEGTGN  290

Query  717   MTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVN  538
             + KLP+ VAY GV +LKSIPLR YA +  F  +S + + DWT VGRLHCL PWWEDA VN
Sbjct  291   LMKLPRAVAYAGVYILKSIPLRFYANVLAFKSISFTRSSDWTKVGRLHCLYPWWEDATVN  350

Query  537   FMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAM  427
             FM+SGGYNV  QI++V ++TL+I G  D+++SN+LA+
Sbjct  351   FMISGGYNVSSQIQQVKKKTLIIWGEDDQIISNKLAV  387


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 42/92 (46%), Gaps = 30/92 (33%)
 Frame = -3

Query  1350  GSAEKMISLMLGSAPGG--------GKWGTRSVMDLEIPGSRLPggnvdgvgvagggGFP  1195
             G   +M +L+ GS P G          W  R+  D+                      FP
Sbjct  28    GGVTEMFTLVAGSVPAGLGATAKCGSLWQFRATADV----------------------FP  65

Query  1194  LFLPKEVHEIKDPFARSLARRIQRLPVQVGFS  1099
              F+PKEV  IKDPFAR LA RI+RLPVQV  +
Sbjct  66    SFIPKEVERIKDPFARKLATRIERLPVQVSLN  97



>gb|KDO36350.1| hypothetical protein CISIN_1g027952mg [Citrus sinensis]
Length=216

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 167/209 (80%), Gaps = 0/209 (0%)
 Frame = -3

Query  1116  VQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILG  937
             +QV FSES IMSS +KP+      PVVLLH FDSSCLEWR TYPLLE+ G+E WA+DILG
Sbjct  1     MQVNFSESCIMSSVVKPLKPSKTSPVVLLHGFDSSCLEWRCTYPLLEEAGLETWAVDILG  60

Query  936   WGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLV  757
             WGFSDLER P C+  SKR H YQLWK+YIKRPMILVGPSLGAAVA+DFAVN PEAV  LV
Sbjct  61    WGFSDLERLPPCNVTSKREHFYQLWKTYIKRPMILVGPSLGAAVAVDFAVNHPEAVENLV  120

Query  756   LINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRL  577
              I+ASVY EGTG   KLP ++AY GV LL+SIP+R+YA +   +  S ST +DWTN+GRL
Sbjct  121   FIDASVYAEGTGNSAKLPSIIAYAGVYLLRSIPVRLYASILALNHTSFSTIIDWTNIGRL  180

Query  576   HCLLPWWEDAMVNFMLSGGYNVVHQIKKV  490
             HCL PWWEDA V+FM+SGGYNV  QI++V
Sbjct  181   HCLYPWWEDATVSFMVSGGYNVSTQIEQV  209



>gb|KCW86502.1| hypothetical protein EUGRSUZ_B03156 [Eucalyptus grandis]
Length=240

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V  IKD +AR LA RI+RLPV +  S++ IMSSC+KP+++G+  PVVLLH F
Sbjct  22    FPPFLPKQVENIKDSYARKLASRIERLPVNL--SDNCIMSSCVKPLVKGETNPVVLLHGF  79

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLED G+E WA+DILGWGFSDLE+ P C+ A+KR H YQLWKSYIK+P
Sbjct  80    DSSCLEWRYTYPLLEDAGLETWAVDILGWGFSDLEQLPACNVANKRNHFYQLWKSYIKKP  139

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGPSLGAA+AIDFAV  PEAV KLVLI+ASVY EGTG M  LP+ +AY GVS+LKS 
Sbjct  140   MILVGPSLGAAIAIDFAVIHPEAVEKLVLIDASVYAEGTGDMANLPRAIAYAGVSILKSF  199

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNV  586
             PLR +  +  F GL LST LDWTNV
Sbjct  200   PLRFWVNVLAFRGLPLSTNLDWTNV  224



>ref|XP_008667053.1| PREDICTED: uncharacterized protein LOC100191741 isoform X2 [Zea 
mays]
 ref|XP_008670544.1| PREDICTED: 1-acylglycerol-3-phosphate O-acyltransferase ABHD5-like 
isoform X3 [Zea mays]
 gb|ACN34948.1| unknown [Zea mays]
 tpg|DAA41346.1| TPA: hypothetical protein ZEAMMB73_984560 [Zea mays]
 tpg|DAA41348.1| TPA: hypothetical protein ZEAMMB73_984560 [Zea mays]
 tpg|DAA41351.1| TPA: hypothetical protein ZEAMMB73_984560 [Zea mays]
Length=343

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/307 (53%), Positives = 200/307 (65%), Gaps = 35/307 (11%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHC  1024
             FP FLP  V  I+D  A  LA+RI+R+PVQ  FS S+I SSC++P+ Q  D +PVVLLH 
Sbjct  49    FPSFLPGAVERIRDGAAIRLAKRIERVPVQTSFSGSAISSSCVRPLKQQQDGDPVVLLHG  108

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LEWR TYPLLE+ G+EAWA+DILGWGFSDLE RP CD ASKR H YQ WKSYIKR
Sbjct  109   FDSSVLEWRYTYPLLEEAGLEAWAVDILGWGFSDLETRPPCDVASKREHFYQFWKSYIKR  168

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PM+LVGPSLGAAVAIDF+VN+PEAV KL+ I ASVY EG   MT++PK V+Y GV +LKS
Sbjct  169   PMVLVGPSLGAAVAIDFSVNYPEAVSKLIFIGASVYSEGPKDMTRMPKFVSYAGVFILKS  228

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQ  484
             +PLR  A    F   + +   DW  V +  CL+ W ED                      
Sbjct  229   LPLRFLATRLAFKK-TPNEFFDWVQV-KHKCLILWGED----------------------  264

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF-ARGD  307
                      D ++S++LA RL +ELP+AI+ Q+   GH+PHVE+P   AK + +F AR  
Sbjct  265   ---------DGIISSKLAYRLHQELPDAILRQVRQCGHIPHVEKPREAAKHVLEFLARNT  315

Query  306   EDTCVES  286
              D   +S
Sbjct  316   SDKSDQS  322



>gb|KHN42948.1| hypothetical protein glysoja_007478 [Glycine soja]
Length=285

 Score =   284 bits (727),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 158/304 (52%), Positives = 180/304 (59%), Gaps = 59/304 (19%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEVH I+DPFARSLA RI RL V V FSE+ IMSSC+KP++Q    PVVLLH F
Sbjct  39    FPSFLPKEVHRIEDPFARSLAMRIHRLSVSVRFSENPIMSSCVKPLMQNMVNPVVLLHGF  98

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TY LLE+ G E WA+DILGW FSDL              +YQ WKS+IK  
Sbjct  99    DSSCLEWRYTYSLLEEAGFETWAVDILGWDFSDL---------GLIGFIYQFWKSHIKGA  149

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             MILVGP+L +AVA DFAV       KLVLI+ASVY EGTG +  LP+  AY G       
Sbjct  150   MILVGPNLDSAVASDFAVE------KLVLIDASVYAEGTGNLATLPRAAAYAG-------  196

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
                                     +GRLHCLLPWWEDA V+FM  GGYNV  QIKK+   
Sbjct  197   ------------------------IGRLHCLLPWWEDATVDFMTGGGYNVASQIKKLTYE  232

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGDED  301
              L             L  RL  ELP+AI+ QI + GHLPHVE P SV K I +F +    
Sbjct  233   LL-------------LFQRLHCELPDAIIRQISDCGHLPHVERPDSVVKFIVEFVQSKTK  279

Query  300   TCVE  289
             T  E
Sbjct  280   TGTE  283



>gb|EEE67540.1| hypothetical protein OsJ_25019 [Oryza sativa Japonica Group]
Length=710

 Score =   294 bits (752),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 201/294 (68%), Gaps = 25/294 (9%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHCFDS  1015
             FLP  V  I+D  A  LA+RI+R     GFS+S I+SSC++P+ Q  D++PV+LLH FD 
Sbjct  52    FLPAAVERIRDEPAIRLAKRIER----TGFSQSPILSSCVRPLKQQQDRDPVLLLHGFDR  107

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMI  835
               L+                 +++ G+    +E+RP  D ASKR HLYQ W+SYI+RPM+
Sbjct  108   CKLQH----------------LNVSGYCL--IEKRPPGDVASKREHLYQFWRSYIRRPMV  149

Query  834   LVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPL  655
             LVGPSLGAAVAIDF VN+PEAV KL+ I+ASVY EGT  MT++P+ V Y GV LLKS+PL
Sbjct  150   LVGPSLGAAVAIDFTVNYPEAVSKLIFISASVYAEGTRDMTRMPRFVPYAGVFLLKSLPL  209

Query  654   RIYAKLQCFDGL--SLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             R +A L  F  +    +   DW  +GRLHCLLPWWEDA+V+FM++GGYNV++QI +V  +
Sbjct  210   RYFATLLAFYKIPGGPAGLFDWVQIGRLHCLLPWWEDALVDFMMNGGYNVLNQINQVKHK  269

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              L++ G  D ++SN+ A RL +ELP+AI+ Q+   GH+PHVE+P  V K + DF
Sbjct  270   CLILWGEEDGIISNKQAYRLHQELPDAILRQVRECGHIPHVEKPSEVLKHVLDF  323



>gb|EEC82399.1| hypothetical protein OsI_26767 [Oryza sativa Indica Group]
Length=759

 Score =   294 bits (752),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 201/294 (68%), Gaps = 25/294 (9%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHCFDS  1015
             FLP  V  I+D  A  LA+RI+R     GFS+S I+SSC++P+ Q  D++PV+LLH FD 
Sbjct  52    FLPAAVERIRDEPAIRLAKRIER----TGFSQSPILSSCVRPLKQQQDRDPVLLLHGFDR  107

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMI  835
               L+                 +++ G+    +E+RP  D ASKR HLYQ W+SYI+RPM+
Sbjct  108   CKLQH----------------LNVSGYCL--IEKRPPGDVASKREHLYQFWRSYIRRPMV  149

Query  834   LVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPL  655
             LVGPSLGAAVAIDF VN+PEAV KL+ I+ASVY EGT  MT++P+ V Y GV LLKS+PL
Sbjct  150   LVGPSLGAAVAIDFTVNYPEAVSKLIFISASVYAEGTRDMTRMPRFVPYAGVFLLKSLPL  209

Query  654   RIYAKLQCFDGL--SLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQR  481
             R +A L  F  +    +   DW  +GRLHCLLPWWEDA+V+FM++GGYNV++QI +V  +
Sbjct  210   RYFATLLAFYKIPGGPAGLFDWVQIGRLHCLLPWWEDALVDFMMNGGYNVLNQINQVKHK  269

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              L++ G  D ++SN+ A RL +ELP+AI+ Q+   GH+PHVE+P  V K + DF
Sbjct  270   CLILWGEEDGIISNKQAYRLHQELPDAILRQVRECGHIPHVEKPSEVLKHVLDF  323



>emb|CDY37879.1| BnaC04g31270D [Brassica napus]
Length=221

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 4/184 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPV--QVGFSESSIMSSCIKPVIQG-DKEPVVLL  1030
             FP+FLPKEV +IKDPFAR+LA+RI R+PV  Q+G     +MSSCIKP++Q  DK PVVLL
Sbjct  32    FPVFLPKEVKDIKDPFARALAQRIVRIPVPLQMGNFRGCVMSSCIKPIVQQHDKSPVVLL  91

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             HCFDSSCLEWRRTYPLLE   +E WAID+LGWGFSDL + P CDAASKR+HL++LWK+YI
Sbjct  92    HCFDSSCLEWRRTYPLLEQASLETWAIDVLGWGFSDLGKLPPCDAASKRHHLFELWKTYI  151

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
             KRPMILVGPSLGA VA+DF   +PEAV KLVLINA+ Y EGTG +  LPK +AY GV  L
Sbjct  152   KRPMILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGALKDLPKSIAYAGVR-L  210

Query  669   KSIP  658
             K++P
Sbjct  211   KTLP  214



>gb|KHN29994.1| Abhydrolase domain-containing protein 4 [Glycine soja]
Length=215

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP+E+H I+DPFAR  A RIQRLPV V FSE+ IMSSC+KP++Q  + PVVLLH F
Sbjct  36    FPSFLPRELHTIQDPFARKFALRIQRLPVPVRFSENPIMSSCVKPLVQTKETPVVLLHGF  95

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR   PLLE++G+E WAIDILGWGFSDL + P CD  SKR H YQ WKSYI+RP
Sbjct  96    DSSCLEWRYVLPLLEESGIETWAIDILGWGFSDLGKLPPCDVVSKRDHFYQFWKSYIRRP  155

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSL  673
             +ILVGPSLG+AVA+DFAVN+PEAV KLVLI ASVY EGTG +  LP+ VAY GV++
Sbjct  156   IILVGPSLGSAVAVDFAVNYPEAVEKLVLIGASVYSEGTGKLATLPRAVAYAGVNI  211



>emb|CDP11627.1| unnamed protein product [Coffea canephora]
Length=182

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP F+P EV EIKDPFAR+LA+RIQRLPV+VGFSES IMSSC+KP  Q D  P VLLHCF
Sbjct  25    FPSFIPAEVKEIKDPFARALAQRIQRLPVKVGFSESCIMSSCVKPRFQRDTNPAVLLHCF  84

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEW RTYPLLED  VE WAIDILGWGFSDLER P CDAASKRYHLYQLW+++IKRP
Sbjct  85    DSSCLEWTRTYPLLEDAAVETWAIDILGWGFSDLERLPPCDAASKRYHLYQLWRTHIKRP  144

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLV  757
             MILVGPSLGAAVAIDFAVNFPEAV   +
Sbjct  145   MILVGPSLGAAVAIDFAVNFPEAVSSFL  172



>emb|CBI21218.3| unnamed protein product [Vitis vinifera]
Length=203

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPK+V +IKDPFARSLA+RIQRLPVQ+G S S IMSSC+KPVI+ +  PVVLLHCF
Sbjct  42    FPSFLPKQVEKIKDPFARSLAQRIQRLPVQIGSSGSCIMSSCVKPVIRSNSNPVVLLHCF  101

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEWR TYPLLE+ G+EAWA+D+LGWGFSDLER P CD ASKR+HLYQLWKS+IKRP
Sbjct  102   DSSCLEWRCTYPLLEEAGLEAWAVDVLGWGFSDLERLPPCDVASKRHHLYQLWKSHIKRP  161

Query  840   MILVGPSLGAAVAIDFAVNFPEAV  769
             +ILVGPSLGAAVAIDFAVN+PEAV
Sbjct  162   VILVGPSLGAAVAIDFAVNYPEAV  185



>ref|XP_008379861.1| PREDICTED: uncharacterized protein LOC103442839 [Malus domestica]
Length=187

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = -3

Query  945  ILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVH  766
            I  +  S LER P C  ASKR+HLYQ WKSYI+RPM+LVGPSLG +VAIDFA ++PEAV 
Sbjct  6    IFFYLLSVLERCPPCSPASKRHHLYQFWKSYIRRPMVLVGPSLGGSVAIDFAYHYPEAVE  65

Query  765  KLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNV  586
            KLVLINASVY E TG M KLPK   Y GVSLLKS PLR YA +  F+G+SL+TT DWTNV
Sbjct  66   KLVLINASVYAESTGDMAKLPKAATYAGVSLLKSTPLRFYANMLAFNGISLATTFDWTNV  125

Query  585  GRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVS  442
            GRLHCLLPWW+DA V+FM SGGYNVV QIK+V Q+ LVI   +D ++S
Sbjct  126  GRLHCLLPWWKDATVSFMSSGGYNVVSQIKQVKQKVLVICSEQDNIIS  173



>ref|XP_001419533.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97826.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=348

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 178/299 (60%), Gaps = 5/299 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPV--IQGDKEPVVLLH  1027
             FP F P EV E+++P A ++ARR + + V V     ++++SC         D  P VLLH
Sbjct  43    FPSFFPPEVRELEEPAAIAMARRCRSVSVDVPGRAKAVLTSCAGDAGPAGSDAAPFVLLH  102

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAA--SKRYHLYQLWKSY  853
              FDSSCLE+RR +P L     E WA+D+LGWGF+D +     D +  +KR HLY  WK+ 
Sbjct  103   GFDSSCLEYRRLFPKLA-AKAETWAVDLLGWGFTDAQDGGIGDYSPEAKRAHLYAFWKAN  161

Query  852   IKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSL  673
             + RPM+L G SLG A AIDFA N PEAV KLVLI+A  + EG G M  LP+ VA  GV++
Sbjct  162   VGRPMVLCGASLGGAAAIDFATNHPEAVEKLVLIDAQGFIEGLGPMGALPRPVAKMGVNI  221

Query  672   LKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKK  493
             L++  LR  A    +   +   T D   VGRLH   P W DA ++FM SGG+ V + I K
Sbjct  222   LRTTALRNAANQMAYYDKATFATDDALRVGRLHTFAPQWCDATLSFMQSGGFKVRNSIAK  281

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             V   TLV+ G  DK++    A +  +ELPNA +  +   GH+ H+E+P  + + + DFA
Sbjct  282   VPMETLVLWGREDKILEPSYAEKFMKELPNARLVWVEKCGHVAHLEQPEFMCQTLWDFA  340



>dbj|BAB09377.1| unnamed protein product [Arabidopsis thaliana]
Length=239

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 147/220 (67%), Gaps = 32/220 (15%)
 Frame = -3

Query  873  YQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVH------------------------  766
            +QLWK+YIKRPMILVGPSLGA VA+DF   +PEAV+                        
Sbjct  17   FQLWKTYIKRPMILVGPSLGATVAVDFTATYPEAVNFQFTIIKLFWIKPILIYTSLTKFD  76

Query  765  --------KLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLS  610
                    KLVLINA+ Y EGTG + +LPK +AY GV LLKS PLR+ A +  F    LS
Sbjct  77   YFRGFQVDKLVLINANAYSEGTGRLKELPKSIAYAGVKLLKSFPLRLLANVLAFCSSPLS  136

Query  609  TTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELA  430
              +DWTN+GRLHC +PWWEDAMV+FM+SGGYNV   IK ++ +TLV+    D++VSN+L+
Sbjct  137  ENIDWTNIGRLHCQMPWWEDAMVDFMISGGYNVASHIKHIDHKTLVVCSENDQIVSNQLS  196

Query  429  MRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
            ++L  EL NA++ ++P+SGHLPHVE P  + KLI+DFA G
Sbjct  197  VKLLCELANAVLREVPDSGHLPHVENPKHIVKLISDFASG  236



>ref|XP_003081161.1| Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) 
(ISS) [Ostreococcus tauri]
 emb|CAL55330.1| Alpha/beta hydrolase fold-1 [Ostreococcus tauri]
Length=351

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 179/305 (59%), Gaps = 5/305 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPV--IQGDKEPVVLLH  1027
             FP F P EV E+ +P A  +A+R + + V+V     +I +SC++          P VLLH
Sbjct  43    FPSFFPPEVRELTEPAAIEMAKRCEMVTVRVPGRAVAIETSCVRDEGPDGSSAPPFVLLH  102

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAA--SKRYHLYQLWKSY  853
              FDSSCLE+RR  P L  T  E WAID+LGWGF+D       D +  +KR HLY  WK  
Sbjct  103   GFDSSCLEYRRLLPKLA-TRAETWAIDLLGWGFTDAGDGGVGDYSPEAKRAHLYAFWKEN  161

Query  852   IKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSL  673
             +KRPM+L G SLG A AIDFA N PEAV KLVLI+A  + EG G M  LP+ +A  GV++
Sbjct  162   VKRPMVLCGASLGGAAAIDFATNHPEAVEKLVLIDAQGFIEGLGPMGALPRPIAKVGVNV  221

Query  672   LKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKK  493
             L+++PLR  A    +   +   T D   VGRLH   P W DA ++FM SGG+ V + I K
Sbjct  222   LRTVPLRSAANQLAYYDKATYATDDALRVGRLHTFAPQWCDATLSFMKSGGFKVRNSIPK  281

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             V   TLV+ G  D ++    A +   ELPNA +  + N GH+ H+E+P  + + + DF  
Sbjct  282   VPVETLVVWGRDDNILEPSYADKFMSELPNARMVWVENCGHVAHLEQPDFLCETLFDFVG  341

Query  312   GDEDT  298
               ++T
Sbjct  342   SAKET  346



>ref|XP_007045883.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY01715.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=187

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 147/250 (59%), Gaps = 63/250 (25%)
 Frame = -3

Query  1086  MSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRP  907
             MSSC+KP++Q ++ P+VLLH FDSSCLEWR TYPLLE+ G+E WA+DILGWGFS+LER  
Sbjct  1     MSSCVKPLVQSEQSPLVLLHGFDSSCLEWRYTYPLLEEAGLETWAVDILGWGFSNLERLG  60

Query  906   TCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEG  727
             +CD  SKR H YQLWKSYIKRPM  VGPSLGAAVA+DFAVN PEAV  LVLI+ASVY EG
Sbjct  61    SCDVQSKREHFYQLWKSYIKRPMTFVGPSLGAAVAVDFAVNHPEAVENLVLIDASVYAEG  120

Query  726   TGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDA  547
             TG +  LP+  AY GV   K   L I+ +    D   +S  L      RLHC LP     
Sbjct  121   TGNLATLPRAAAYAGV---KQKTLIIWGE----DDQIISNKLG----VRLHCELP-----  164

Query  546   MVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHL  367
                                                            NAI+ QIP+ GHL
Sbjct  165   -----------------------------------------------NAIIRQIPDCGHL  177

Query  366   PHVEEPHSVA  337
             PHVE+P SVA
Sbjct  178   PHVEKPDSVA  187



>emb|CDP11628.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  771  VHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWT  592
            V KL+LI ASV+ EGTG +TKLPK +AY GVSLLKS+PLR+YA L  FD +SLST  DWT
Sbjct  63   VDKLILIGASVHVEGTGLLTKLPKFLAYAGVSLLKSLPLRLYANLLAFDDISLSTCFDWT  122

Query  591  NVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRE  412
            NVGRLHCLLPWWEDA VN+MLSGGYNVV+QIK+VN+R L+I G  D +VSN+LA+RL  E
Sbjct  123  NVGRLHCLLPWWEDATVNYMLSGGYNVVNQIKQVNKRVLIICGECDNIVSNKLAVRLHSE  182

Query  411  LPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
            LP+A +HQIP+ GHLPHVE+P  VA+LIADFA
Sbjct  183  LPDASIHQIPDCGHLPHVEKPEMVARLIADFA  214



>ref|XP_002506267.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67525.1| predicted protein [Micromonas sp. RCC299]
Length=347

 Score =   231 bits (590),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 128/319 (40%), Positives = 186/319 (58%), Gaps = 6/319 (2%)
 Frame = -3

Query  1257  GSRLPggnvdgvgvagggGFPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSS  1078
             GSR     V  V  A  G F  F P EV  +++P A  +A++ +++ V V   +  +M+S
Sbjct  22    GSRSTRHTVVTVRAAARGEFASFFPDEVTALEEPAAVEMAKKARQVSVAVPGRDKPVMTS  81

Query  1077  CIK-PVIQG--DKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRP  907
             C+  P  +G  D  P VL+H FDSSCLE+RR +PLL +   EA A+D+LGWGF+D     
Sbjct  82    CVSSPAPKGGEDVSPFVLIHGFDSSCLEYRRLFPLLTER-AEAHAVDLLGWGFTDAGDAG  140

Query  906   TCDAA--SKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYG  733
               D +  +KR HLY  WK  I RP+ LVG SLG A +IDFA   PE V +LVL++A  + 
Sbjct  141   IGDYSPEAKRAHLYAFWKQEIGRPITLVGASLGGAASIDFATAHPECVERLVLVDAQGFI  200

Query  732   EGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWE  553
             EG G M   P+ +A  GV++LKS PLR  A    +       T D   VG+LH   P W 
Sbjct  201   EGLGPMGMFPRPIALAGVNILKSRPLRNTANQMAYCDRGTFATEDAMRVGQLHTFQPQWA  260

Query  552   DAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSG  373
             DA ++FM S GY V  +++++ Q+TLV+ G +D ++    A R   E+P++ +  +   G
Sbjct  261   DATLSFMKSDGYKVAKRVREITQKTLVMWGRQDNILDPAYAERFAEEIPDSKLVWVEQCG  320

Query  372   HLPHVEEPHSVAKLIADFA  316
             H+ H+E+P  +A+ + DFA
Sbjct  321   HVAHLEQPKFMAQTLFDFA  339



>ref|XP_005823494.1| hypothetical protein GUITHDRAFT_78864 [Guillardia theta CCMP2712]
 gb|EKX36514.1| hypothetical protein GUITHDRAFT_78864 [Guillardia theta CCMP2712]
Length=290

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 181/280 (65%), Gaps = 6/280 (2%)
 Frame = -3

Query  1143  LARRIQRLPVQV--GFSESSIMSSCIKPVIQGDKE--PVVLLHCFDSSCLEWRRTYPLLE  976
             +AR ++R+PVQ+   F+E ++++S  K  ++  KE  P++LLH FDSSCLEWRR  P LE
Sbjct  1     MARSLRRVPVQMDPSFAERAVLTSYSKTNVEASKEVSPLLLLHGFDSSCLEWRRLQPRLE  60

Query  975   DTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAID  796
             + GVE+WA+D+LGWGF++ E   +   A+K  HL    + ++ RP+ LVG SLG ++AID
Sbjct  61    EKGVESWAVDVLGWGFTEREAVSSFSPAAKLSHLVGFIEQHVARPVTLVGASLGGSIAID  120

Query  795   FAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLS  616
              A+  P+ V KLVL++A  Y +G   MT  P+M+   GV +LKS PLR++A    +    
Sbjct  121   VALQRPDLVDKLVLVDAQGYIDGAA-MTGQPRMLQQLGVQVLKSKPLRMFANKIAYSDPD  179

Query  615   LSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVS-N  439
                T D   +GRLHCL   WE+AM+ FM SGGY++  ++ +V + TLV+ G  DK++  +
Sbjct  180   RWGTEDAMRIGRLHCLTGGWEEAMIGFMNSGGYHLSDKVSQVTKETLVLWGRDDKILEPS  239

Query  438   ELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             + A R   ++P++ +  +   GH+PH+E+P   A+ +A+F
Sbjct  240   KYAERFIADIPSSSLQWVDKCGHVPHLEQPSITAQALAEF  279



>gb|KHG06003.1| AB hydrolase superfamily protein yfhM [Gossypium arboreum]
Length=144

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  1086  MSSCIKPVIQGDKEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRP  907
             MSSC+KP+IQ  + PVVLLH FDSSCLEWR T+PLLE+ G+E WAIDILGWGFS+LER  
Sbjct  1     MSSCVKPLIQSSQNPVVLLHGFDSSCLEWRYTFPLLEEAGLETWAIDILGWGFSNLERIK  60

Query  906   TCDAASKRYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEG  727
             +CD ASKR H YQLWKSYIKRPM L+GPSLGAAVA+DFAVN PEAV  LVLI+ASVY EG
Sbjct  61    SCDVASKREHFYQLWKSYIKRPMTLIGPSLGAAVAVDFAVNNPEAVENLVLIDASVYAEG  120

Query  726   TGFMTKLPKMVAYGGVSL  673
             TG + KLP+  AY G+S+
Sbjct  121   TGNLAKLPRAAAYAGLSV  138



>ref|XP_004154782.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101203865 
[Cucumis sativus]
Length=250

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +I DP AR++AR+I+RLP+ +   E+ IMSSC+KP  + +K PVVLLHCF
Sbjct  41    FPSFLPKEVSKINDPLARTMARKIERLPMTL--FETCIMSSCVKPXKKSEKNPVVLLHCF  98

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEW   +PLLE+ G+E WA+D+LGWGFSDL+  P C+  +KR HLYQ WK+YIKRP
Sbjct  99    DSSCLEWSYAFPLLEEAGLETWAVDVLGWGFSDLDSLPPCNVETKRSHLYQFWKTYIKRP  158

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHK  763
             M+LVGPSLGAA+A+DFAVN PEAV++
Sbjct  159   MVLVGPSLGAAIAVDFAVNHPEAVNR  184



>gb|KGN53683.1| hypothetical protein Csa_4G102320 [Cucumis sativus]
Length=188

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +I DP AR++AR+I+RLP+ +   E+ IMSSC+KP  + +K PVVLLHCF
Sbjct  41    FPSFLPKEVSKINDPLARTMARKIERLPMTLF--ETCIMSSCVKPAKRSEKNPVVLLHCF  98

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEW   +PLLE+ G+E WA+D+LGWGFSDL+  P C+  +KR HLYQ WK+YIKRP
Sbjct  99    DSSCLEWSYAFPLLEEAGLETWAVDVLGWGFSDLDSLPPCNVETKRSHLYQFWKTYIKRP  158

Query  840   MILVGPSLGAAVAIDFAVNFPEAV  769
             ++LVGPSLGAA+A+DFAVN PEAV
Sbjct  159   IVLVGPSLGAAIAVDFAVNHPEAV  182



>ref|XP_004137282.1| PREDICTED: uncharacterized protein LOC101203865 [Cucumis sativus]
Length=250

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLPKEV +I DP AR++AR+I+RLP+ +   E+ IMSSC+KP  + +K PVVLLHCF
Sbjct  41    FPSFLPKEVSKINDPLARTMARKIERLPMTL--FETCIMSSCVKPAKRSEKNPVVLLHCF  98

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSSCLEW   +PLLE+ G+E WA+D+LGWGFSDL+  P C+  +KR HLYQ WK+YIKRP
Sbjct  99    DSSCLEWSYAFPLLEEAGLETWAVDVLGWGFSDLDSLPPCNVETKRSHLYQFWKTYIKRP  158

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHK  763
             ++LVGPSLGAA+A+DFAVN PEAV++
Sbjct  159   IVLVGPSLGAAIAVDFAVNHPEAVNR  184



>ref|XP_003056635.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58280.1| predicted protein [Micromonas pusilla CCMP1545]
Length=728

 Score =   222 bits (566),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/302 (41%), Positives = 178/302 (59%), Gaps = 9/302 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQ--VGFSESSIMSSCI-KPVIQGDK--EPVV  1036
             F   LP EV  +++P A ++A+R +++PV    G    +IM+SC+  P  +G +   P V
Sbjct  420   FDAMLP-EVTALEEPAAVAMAKRCRQVPVADVAGRGARAIMTSCVGAPAPEGGEGNAPFV  478

Query  1035  LLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAA--SKRYHLYQLW  862
             LLH FDSSCLE+RR +PLLE    E WA+D+LGWGF+D +     D +  +KR HL+  W
Sbjct  479   LLHGFDSSCLEYRRLFPLLERR-AETWALDLLGWGFTDADDGGIGDYSPEAKRAHLHAFW  537

Query  861   KSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGG  682
             K  I RP+ LVG SLG A AIDFA   PE V +LVL++A  + EG G M  +P+ +A  G
Sbjct  538   KQEIGRPITLVGASLGGAAAIDFATAHPECVERLVLVDAQGFIEGLGPMGLMPRPIALAG  597

Query  681   VSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQ  502
             V++LK+  LR  A    +   +   T D   VG+LH   P W DA ++FM S GY V  +
Sbjct  598   VNVLKTRILRNTANQMAYCDKATFATEDAMRVGQLHTFQPQWADATLSFMKSDGYKVAKR  657

Query  501   IKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIAD  322
             +  + Q TLV+ G  DK++    A R   E+PN+ +  +   GH+ H+E+P  +   + +
Sbjct  658   VSAITQPTLVMWGREDKILDPAYATRFAEEVPNSKLLWVEKCGHVAHLEQPEVMRDALFE  717

Query  321   FA  316
             FA
Sbjct  718   FA  719



>ref|XP_005646223.1| alpha/beta-hydrolase, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE21679.1| alpha/beta-hydrolase, partial [Coccomyxa subellipsoidea C-169]
Length=309

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 180/310 (58%), Gaps = 27/310 (9%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRL--------PVQVGFSESSIMSSCIKPVIQGD--  1051
             +P F+P++V EI++  A S+   I+R         PV   F E             GD  
Sbjct  1     YPQFVPEQVSEIQEEAALSMIGSIERCRLDVPSLGPVDTAFVEEG----------SGDFL  50

Query  1050  -KEPVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFS--DLERRPTC--DAASK  886
                P+VLLH FDSS LE+RR  PLL + G  A+A+D++GWGFS       P        K
Sbjct  51    FYTPIVLLHGFDSSLLEFRRLVPLLREAGASAYAVDLVGWGFSCGKFHENPNLPLGPQQK  110

Query  885   RYHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKL  706
               HLY  W++ +KRPM+L G SLGAA+A++FA+  PEAV  LVL +  VY +G G M+ +
Sbjct  111   TDHLYAFWQTKVKRPMVLCGVSLGAAIAVEFALQHPEAVAGLVLSSPQVYVDGIGPMSSM  170

Query  705   PKMVAYGGVSLLKSIPLRIYA-KLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFML  529
             P++++Y GV +LKS+PLR  A ++  FD   L+T  D   +GRLH  LP W ++ + FM 
Sbjct  171   PRVLSYLGVQVLKSVPLRNMANQMAYFDKERLATE-DALRIGRLHTFLPGWTNSNIAFMK  229

Query  528   SGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEP  349
             SGGY V  +I ++ Q  LV+ G  D++V  + A ++  +LP++ +  + N GH  H+E+ 
Sbjct  230   SGGYAVSKRIPELKQEVLVLWGRNDEIVDCKNADKIAEDLPHSRLTILENCGHCIHLEKS  289

Query  348   HSVAKLIADF  319
               +A+ + +F
Sbjct  290   DEMARCLTEF  299



>emb|CBI21219.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 124/157 (79%), Gaps = 2/157 (1%)
 Frame = -3

Query  753  INASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLH  574
            +N +V  +GTG ++KL + +AY GVSLLKS PLR+ + L  +  +S +T+ DWTNVG LH
Sbjct  1    MNKNVIYKGTGNLSKLYRPLAYAGVSLLKSFPLRLCSNLLAYKSISFATSFDWTNVGLLH  60

Query  573  CLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIV  394
            CLLPWWEDA VNFM SGGYNV+ QIK+V Q+TLVI G  D++VSN+LAMRL  EL +AI+
Sbjct  61   CLLPWWEDATVNFMKSGGYNVIAQIKQVKQKTLVIWGEHDQIVSNKLAMRLQHELQDAIM  120

Query  393  HQIPNSGHLPHVEEPHSVAKLIADFARGDEDTCVESY  283
            H IP+ GHLPH+E+P+SVAKLIADFA+GD   C E++
Sbjct  121  HHIPDCGHLPHLEKPNSVAKLIADFAQGDR--CQEAH  155



>emb|CBJ26140.1| Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily 
[Ectocarpus siliculosus]
Length=373

 Score =   206 bits (523),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 118/284 (42%), Positives = 169/284 (60%), Gaps = 14/284 (5%)
 Frame = -3

Query  1131  IQRLPVQVGFSESSIMSSCIKPVIQGDK-------EPVVLLHCFDSSCLEWRRTYPLLED  973
             ++R PV+V   ES          +Q D+       +P+++LH FDSS LE+RR  P L +
Sbjct  1     MRRFPVEV--PESVAKGEIGTNFVQTDESTGKQGEDPILMLHGFDSSLLEFRRLLPKLGE  58

Query  972   TGVEAWAIDILGWGFSDLERR--PTCDAASKRYHLYQLWKSYIK-RPMILVGPSLGAAVA  802
              G EA+A+D+LGWGF+DL      +  A +KR HL   W+  +  RPM+LVG SLG A+A
Sbjct  59    LGAEAYAVDVLGWGFTDLASGEIKSFGAEAKRTHLKAFWQQAMGGRPMVLVGASLGGAIA  118

Query  801   IDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKLQCFDG  622
             +DFA  FPEAV KLVLI+A  + +G+G    LP  +A  G+S+L S PLR  A    +  
Sbjct  119   LDFAHEFPEAVKKLVLIDAQGFIDGSGPGASLPGPLAKLGISVLGSKPLRSLANQMSYTD  178

Query  621   LSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLVS  442
              SL+T  D   VGRLH +   W DA + +M SGG+ V  ++  +NQ TLV+ G +DK++ 
Sbjct  179   KSLATE-DAVRVGRLHTMCDGWADASLQYMSSGGFAVSTKVPSINQETLVLWGRQDKILD  237

Query  441   NEL-AMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
              +L A R   E+P+A +  +   GH+PH+E+P   AK I  F +
Sbjct  238   PKLYAERFVDEMPDARLVWVEECGHVPHLEQPDETAKAIVSFVK  281



>ref|XP_007510436.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17969.1| predicted protein [Bathycoccus prasinos]
Length=283

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 119/284 (42%), Positives = 172/284 (61%), Gaps = 9/284 (3%)
 Frame = -3

Query  1143  LARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE----PVVLLHCFDSSCLEWRRTYPLLE  976
             +ARR+Q + V V   E ++M+S ++   + D      P VLLH FDSSCLE+RR +P LE
Sbjct  1     MARRVQVVEVPVEGREKNVMTSLVQSEKREDASDEYHPFVLLHGFDSSCLEYRRLFPKLE  60

Query  975   DTGVEAWAIDILGWGFSDLERRPTCDAA--SKRYHLYQLWKSYIKRPMILVGPSLGAAVA  802
             + G E +A+D+LGWGF+D       D +  +K  HLY  WK  + RP++L G SLG A A
Sbjct  61    ENGAEVYALDLLGWGFTDGLDGGVGDYSPEAKCAHLYAWWKQNVNRPIVLAGASLGGAAA  120

Query  801   IDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYA-KLQCFD  625
             I+FA  +PEAV +LVLI+A  + +G G M  LP  +A  GV +L++  LR  A K+  FD
Sbjct  121   IEFASRYPEAVTRLVLIDAQGFIDGIGPMGMLPTPIAKAGVDILRTRWLRSGANKMAYFD  180

Query  624   GLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQIKKVNQRTLVITGMRDKLV  445
                   T D  NVGRLH LLP W DA ++FM SGG+ VV +I ++  +T+V+ G  DK++
Sbjct  181   --QKYATDDAQNVGRLHTLLPQWNDATLSFMRSGGFRVVEKIPQLTTKTMVLWGRGDKIL  238

Query  444   SNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
               E A R  +E+ +  +  +  SGH+PH+E+P      +  F +
Sbjct  239   EPENAERFEKEIQDCELVWVEESGHVPHLEQPDFTCAQLLRFGK  282



>ref|XP_002950067.1| hypothetical protein VOLCADRAFT_80939 [Volvox carteri f. nagariensis]
 gb|EFJ48735.1| hypothetical protein VOLCADRAFT_80939 [Volvox carteri f. nagariensis]
Length=383

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/314 (36%), Positives = 177/314 (56%), Gaps = 22/314 (7%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESS--IMSSCIKPVIQ------GDKEPVV  1036
             F+P +++EI +P A+++A  ++RLPV +     S  + ++ + P I+       D   ++
Sbjct  45    FIPPQINEIVEPAAQTMAANMRRLPVTIPTMPRSPEVATAFVGPTIEEASRYPKDAPTII  104

Query  1035  LLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSD---LERRPT--CDAASKRYHLY  871
             LLH FDSSC+EWRR YPLL       +A+D++GWGF+D    +  P+       K  HL 
Sbjct  105   LLHGFDSSCMEWRRLYPLLA-AAAPTYALDLVGWGFTDCSLFQSDPSLVIRPEDKTAHLR  163

Query  870   QLWKSYI--KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKM  697
                +++   +RP++LVG SLG A A+DFA  +P+ V  +VLI+   + +G G M+  P+ 
Sbjct  164   AFLEAHTDRERPVVLVGASLGGAKALDFAHTYPQLVRGVVLIDGQGFIDGIGRMSSAPRW  223

Query  696   VAYGGVSLLKSIPLRIYAK-----LQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFM  532
             + + GV +L+S+PLR  A      +  FD    +T  D   +GRLH  LP W DA + FM
Sbjct  224   LLWLGVRVLQSVPLRQAANKASRWMAYFDKERFATE-DAMRIGRLHTHLPGWLDANIAFM  282

Query  531   LSGGYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEE  352
              SGGY +  +I ++ Q  LV+ G  D+++    A R    LP++ +  +   GH  H+E+
Sbjct  283   RSGGYAISSKISQIQQDVLVLWGRNDEILDPSYASRFQDTLPHSRLVWVEQCGHCAHLEQ  342

Query  351   PHSVAKLIADFARG  310
             P   AK I DF +G
Sbjct  343   PQLAAKYILDFVKG  356



>ref|WP_012409274.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Nostoc punctiforme]
 ref|YP_001866223.1| alpha/beta hydrolase fold protein [Nostoc punctiforme PCC 73102]
 gb|ACC81280.1| alpha/beta hydrolase fold protein [Nostoc punctiforme PCC 73102]
Length=295

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 165/296 (56%), Gaps = 6/296 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP+ V ++ +  + +LA+ IQ   +        + ++ +K    G   P++L+H F
Sbjct  2     FPNFLPQAVGQLTESASIALAQNIQTAAIATPLINQPVTTTYVKQGSGG--TPILLIHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR  PLL     E WA+D+LG+GF+D          + + HLY  WKS I +P
Sbjct  60    DSSVLEFRRLLPLLSRDN-ETWAVDLLGFGFTDRLSGIAYSPTAIKTHLYYFWKSLINQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G A AIDF + +PE V KLVLI+++    G+     +   + Y     L ++
Sbjct  119   VILVGASMGGATAIDFTLTYPEVVKKLVLIDSAGLAGGSPLSKFMFPPLDYFATQFLSNL  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKVN  487
              +R       +   SL+ ++D    G LH  +P W  A++ F  SGGY+     +I ++ 
Sbjct  179   KVRDRVSRIGYKNQSLA-SVDALCCGALHLQMPSWNQALIAFTKSGGYSAFRFKKISQIL  237

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             Q+TL++ G  DK++  + AMR  R +P++ +  I + GHLPH+E+P   A+ I DF
Sbjct  238   QQTLILWGDSDKILGTKDAMRFKRAIPHSTLFWIQDCGHLPHLEQPQITAQHILDF  293



>ref|WP_015114334.1| alpha/beta fold family hydrolase [Nostoc sp. PCC 7107]
 ref|YP_007051279.1| alpha/beta fold family hydrolase [Nostoc sp. PCC 7107]
 gb|AFY44129.1| alpha/beta hydrolase fold protein [Nostoc sp. PCC 7107]
Length=297

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 165/297 (56%), Gaps = 8/297 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGD-KEPVVLLHC  1024
             FP FLP  V ++ +P + +LAR IQ   +    S+ +I ++  +   QG    P++L+H 
Sbjct  2     FPSFLPTAVSQLTEPESIALARSIQSHAITTPLSDQAITTTYAQ---QGSGSTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL +   E WA+D+LG+GF+D          + + HLY  WK+ I +
Sbjct  59    FDSSVLEFRRLLPLLAENN-ETWAVDLLGFGFTDRLAGIPFSPVTIKTHLYYFWKTLINQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A A+DF + +PE V KLVLI+++    G+     +   +       L++
Sbjct  118   PVILVGASMGGAAALDFTLTYPEVVKKLVLIDSAGLKAGSPLAKFMFPPLDNWATQFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKV  490
               +R       +   SL  +LD    G LH  +P W  A++ F  SGGY+     Q+ ++
Sbjct  178   PKVRDRISRTAYKNPSL-ISLDAAYCGGLHLEMPSWHLALIAFTKSGGYSAFRFKQLAQI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              Q TL++ G  DK++    A R  R +PN+ +  I NSGH+PH+E+P   AK I +F
Sbjct  237   LQPTLILWGDSDKILGTTDAKRFKRAIPNSKLIWIQNSGHIPHLEQPQVTAKSILEF  293



>ref|WP_039715107.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Scytonema millei]
 gb|KIF17549.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Scytonema millei 
VB511283]
Length=292

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 113/306 (37%), Positives = 170/306 (56%), Gaps = 31/306 (10%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGD-KEPVVLLHC  1024
             FPLFLP +V  ++ P + +LA+RI+R  +       +I +S ++   QG+   P++LLH 
Sbjct  2     FPLFLPSQVQLLQQPESIALAKRIERSAIATPLHSGAIATSFVR---QGEGNTPLLLLHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL     E WA+D+LG+GFSD  R    +  + + HLY  WK+ I +
Sbjct  59    FDSSVLEFRRLIPLLAVQN-ETWAVDLLGFGFSDRSREINYNPETIKTHLYYFWKTLIDK  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDFA+ +P+AV  LVLIN+       GF    P       +     
Sbjct  118   PVILVGASMGGATAIDFALTYPQAVKHLVLINS------VGFSGDFP-------LGQFLF  164

Query  663   IPLRIYA-------KLQCFD-GLSLST----TLDWTNVGRLHCLLPWWEDAMVNFMLSGG  520
              PL  +A       KLQ  + G+SL       +D      LH  +P W +AMV+F  SGG
Sbjct  165   FPLDYFAVEFWRQRKLQALNLGVSLGNLTPFEIDAIRCALLHTEMPSWSEAMVSFTKSGG  224

Query  519   YN-VVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHS  343
             Y  + ++I KV++ T ++ G RD+ +    AM+  + + ++ +  + N GH+P VE+P  
Sbjct  225   YGEIANKIAKVDKPTTILWGDRDETLGVADAMKFQQAIAHSQLIWLKNCGHVPQVEQPEI  284

Query  342   VAKLIA  325
             +A  I 
Sbjct  285   IANYIG  290



>ref|WP_015119251.1| alpha/beta hydrolase [Rivularia sp. PCC 7116]
 ref|YP_007056230.1| alpha/beta hydrolase [Rivularia sp. PCC 7116]
 gb|AFY55683.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Rivularia sp. PCC 7116]
Length=295

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 169/297 (57%), Gaps = 6/297 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP  V ++ +  + +LA++I+++P+    S+  I ++ +     G  +P +L+H F
Sbjct  2     FPKFLPGGVEQLTESASIALAQKIEQIPLTTPLSKQPITTTYVHQGSGG--KPFLLVHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR  PLL +   E WA+D+LG+GF+D       +    + HL+  WK+ I +P
Sbjct  60    DSSVLEYRRLLPLLAEN-RETWAVDLLGFGFTDRLAGIKFNPDQIKTHLHCFWKNLINQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G A AIDF + +PEAV KLVLI+++    G+     +   + Y     LK+ 
Sbjct  119   VILVGASMGGAAAIDFTLTYPEAVEKLVLIDSAGLTGGSPISKIMFPPLDYFATEFLKNR  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYN--VVHQIKKVN  487
              +R       +    L+T  D    G +H  +P W  A++ F  SGGY     +Q+ ++ 
Sbjct  179   KIRQSISRTAYKNKQLATE-DALFCGAMHLEMPDWNKALIAFTKSGGYQPFKANQLVEIE  237

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
               TL++ G  DK++  + A +  R +PN+ +  + +SGH+PH+E+P + AK + DF+
Sbjct  238   PETLILWGDSDKILGTKDAHKFQRAVPNSTLTWVKDSGHVPHLEQPQATAKEMLDFS  294



>ref|WP_017655578.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microchaete sp. 
PCC 7126]
Length=301

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 169/299 (57%), Gaps = 8/299 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHC  1024
             FP FLP  V ++ D  A ++A+ IQ   + +  +   I ++    V QG    P++L+H 
Sbjct  2     FPSFLPAAVAQLTDTDAIAIAQNIQSQAIAIPVTNQPITTTY---VTQGSGGIPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL     E WA+D+LG+GF+D   +        + HLY  W++ IK+
Sbjct  59    FDSSVLEFRRLLPLLA-VSQETWAVDLLGFGFTDRLAKIEFSPNVIKTHLYYFWQNLIKQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDFA+ +PE V KLVLI+++    G+     +   + Y    +L++
Sbjct  118   PVILVGASMGGAAAIDFALTYPEVVQKLVLIDSAGLKGGSPLSKLMFPPLDYLATEVLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV--VHQIKKV  490
             + +R       +   +L+ ++D  N G LH  +P W  A++ F  SGGY    + Q+ ++
Sbjct  178   LKIRDRISRAAYKNQNLA-SIDALNCGALHLQMPSWSQALIAFTKSGGYKAFNIQQLSQI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
               +TL++ G  DK++  + A    R +P++ +  I + GHLPH+E P   A+ I +F++
Sbjct  237   KPQTLILWGDTDKILGTKDAEVFNRAIPHSQLVWIEDCGHLPHLEAPQITAQHILEFSQ  295



>ref|XP_001697563.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP00225.1| predicted protein [Chlamydomonas reinhardtii]
Length=325

 Score =   180 bits (456),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 110/299 (37%), Positives = 166/299 (56%), Gaps = 21/299 (7%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGF--SESSIMSSCIKPVIQG------DKEPVV  1036
             F+P +V EI +P A+++A+ ++R+P+ +     + ++ ++ + P          D   VV
Sbjct  31    FIPAQVSEIVEPAAQAMAKAMKRVPITIPTMPGQPALETAFVGPTASELASYPPDVPAVV  90

Query  1035  LLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLER---------RPTCDAASKR  883
             LLH FDSSC+E+RR YP L  +    +A+D++GWGF+D            RP   AA  R
Sbjct  91    LLHGFDSSCMEFRRLYPKLAASA-PTYALDLVGWGFTDYSLFKSEPGRVIRPEDKAAHLR  149

Query  882   YHLYQLWKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLP  703
               L        +R ++LVG SLG A+A+DFAV +PE V KLVLI+A  + +G G M   P
Sbjct  150   AFLQ---AQCARRRVVLVGASLGGAMALDFAVTYPEVVEKLVLIDAQGFIDGIGPMATAP  206

Query  702   KMVAYGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSG  523
             + + + GV LL+S+PLR  A    +       T D   +GRLH  LP WEDA + +M SG
Sbjct  207   RPLLWLGVKLLQSVPLRQAANKMAYFDKGRYATEDAMRIGRLHTHLPGWEDANIAWMRSG  266

Query  522   GYNVVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPH  346
             GY +  +I +V Q  LV+ G  D+++    A R  + LPN  +  +   GH  H+E+P 
Sbjct  267   GYAISSKIGQVKQEVLVMWGRNDEILEPSYAARFEQTLPNCRLRWVEQCGHCAHLEQPE  325



>ref|WP_015177307.1| alpha/beta hydrolase fold protein [Oscillatoria nigro-viridis]
 ref|YP_007116466.1| alpha/beta hydrolase fold protein [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ08050.1| alpha/beta hydrolase fold protein [Oscillatoria nigro-viridis 
PCC 7112]
Length=315

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/293 (34%), Positives = 166/293 (57%), Gaps = 7/293 (2%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGD-KEPVVLLHCFDS  1015
             FLPK + ++ +  + +LA+ IQR  +    S   I ++ ++   QG  K P++LLH FDS
Sbjct  18    FLPKSIAQLTESTSIALAQSIQREAITTPLSSEPIATTYVR---QGSGKTPILLLHGFDS  74

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMI  835
             S  E+RR  PLL     E WA+D+LG+GF++        A +   HLY  WK+ I +P+I
Sbjct  75    SLFEFRRLLPLLAAEN-ETWAVDLLGFGFTERSAGLAFSARAIESHLYYFWKTLISQPVI  133

Query  834   LVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPL  655
             LVG S+G A AIDF +N+PEAV +LVLI+++ +   +     L   + Y   S L++  +
Sbjct  134   LVGASMGGAAAIDFTLNYPEAVKQLVLIDSAGFAISSNKGKFLIPPLGYLATSFLRNPKI  193

Query  654   RIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKKVNQRT  478
             R    +  +   +L+ ++D      LH  +P W  A++ F  SGGY     ++ ++ Q+T
Sbjct  194   RQRISVNAYFDKNLA-SVDAQTCAALHLEMPNWNQALIAFTKSGGYGGFGEKLSQIQQQT  252

Query  477   LVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             L++ G +D+++    A +  R + N+ +  I + GH+PH+E+P   A+ I +F
Sbjct  253   LILWGKQDRILGTADAEKFARAIANSQLIWISDCGHVPHLEKPQIAAQHILEF  305



>ref|WP_006633653.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcoleus vaginatus]
 gb|EGK87341.1| alpha/beta hydrolase fold-containing protein [Microcoleus vaginatus 
FGP-2]
Length=315

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 165/293 (56%), Gaps = 7/293 (2%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGD-KEPVVLLHCFDS  1015
             FLPK + ++ +  + +LA+ IQR  +    S   I ++ ++   QG    P++L+H FDS
Sbjct  18    FLPKSIAQLTESTSIALAQSIQRQAITTPLSPGPIATTYVR---QGSGNTPILLIHGFDS  74

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMI  835
             S  E+RR  PLL     E WA+D+LG+GF++        A +   HLY  WK+ I +P+I
Sbjct  75    SLFEFRRLLPLLAAEN-ETWAVDLLGFGFTERSAGLAFSARAIESHLYYFWKTLISQPVI  133

Query  834   LVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPL  655
             LVG S+G A AIDF +N+PEAV +LVLI+++ +   +     L   + Y   S L++  +
Sbjct  134   LVGASMGGAAAIDFTLNYPEAVKQLVLIDSAGFAISSNKGKFLIPPLGYLATSFLRNPKI  193

Query  654   RIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKKVNQRT  478
             R    +  +   +L++  D      LH  +P W  A++ F  SGGY     ++ ++ Q T
Sbjct  194   RQRISVNAYFDKNLASQ-DAQTCAALHLEMPNWNQALIAFTKSGGYGGFGEKLSQIQQPT  252

Query  477   LVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             L++ G +D+++    A +  R + N+ +  IP+ GH+PH+E+P + A+ I +F
Sbjct  253   LILWGKQDRILGTADAEKFARAIANSQLIWIPDCGHVPHLEKPQTTAQHILEF  305



>ref|XP_005851190.1| hypothetical protein CHLNCDRAFT_56722 [Chlorella variabilis]
 gb|EFN59088.1| hypothetical protein CHLNCDRAFT_56722 [Chlorella variabilis]
Length=516

 Score =   183 bits (464),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/275 (39%), Positives = 151/275 (55%), Gaps = 11/275 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQV-GFSESSIMSSCIKPVIQGDKEPV-VLLH  1027
             +P F P E  +I++P A+ +   ++R P+QV G  E  + ++ + P       P  VLLH
Sbjct  61    YPDFFPPEAADIEEPAAQQMMAAMRRTPLQVAGLGE--VQTAYVGPAAPDTSRPAFVLLH  118

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDA------ASKRYHLYQL  865
              FDSS LE+RR  PLL     + +A+D+ GWGF+D        A      A KR HL   
Sbjct  119   GFDSSSLEFRRFLPLLSQA-ADVYAVDLAGWGFTDCGFGGGQGADIKLGPAQKRAHLRAF  177

Query  864   WKSYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYG  685
              +  + RP  LVG SLG  VAID+A + PE + +LVLI+A  + +G G +  +P+ ++  
Sbjct  178   LREVVGRPATLVGTSLGGTVAIDYATSHPEDLARLVLIDAQGFIDGIGPLATMPRFLSQL  237

Query  684   GVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH  505
             GV +L+S+PLR  A    +       T D   VGRLH  LP W DA V FM SGGY +  
Sbjct  238   GVKVLRSVPLRQVANQMAYHDRRRYATDDAMRVGRLHTNLPGWTDANVAFMQSGGYAISS  297

Query  504   QIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNA  400
              IK V   TLV+ G  D+++S + A +    LP+A
Sbjct  298   AIKDVQLPTLVVWGRNDEILSPDNAQKFMDTLPDA  332



>ref|WP_015205999.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Cylindrospermum stagnale]
 ref|YP_007145422.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Cylindrospermum stagnale PCC 7417]
 gb|AFZ22742.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Cylindrospermum stagnale PCC 7417]
Length=295

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 172/302 (57%), Gaps = 18/302 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP  V ++ +P + SLA+ I+   +    +  SI ++ I    QG    P++L+H 
Sbjct  2     FPRFLPAAVGQLTEPASVSLAQSIESQAIATSLTTESITTTYIH---QGSGVTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLL-EDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSY  853
             FDSS LE+RR  PLL ED   E WA+D+LG+GF+  ER P    +S   + HLY  WK+ 
Sbjct  59    FDSSVLEFRRLIPLLGEDN--ETWAVDLLGFGFT--ERLPGIAYSSNAIKTHLYYFWKTL  114

Query  852   IKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKL--PKMVAYGGV  679
             I +P+ILVG S+G A AIDF + +P  V KLVLI+++    G+  ++KL  P + ++   
Sbjct  115   INQPVILVGASMGGATAIDFTLTYPSVVQKLVLIDSAGLKGGSP-LSKLMFPPLDSF-AT  172

Query  678   SLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV--VH  505
              +L++  +R       +   SL  +LD    G LH  +P W  A++ F  SGGY    + 
Sbjct  173   GILRNPKIRDRISRTAYKNPSL-VSLDALYCGALHLQMPNWGQALIAFTKSGGYGAFRLD  231

Query  504   QIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIA  325
             Q+ ++ Q TL++ G  DK++    A +  + +P + +  I  SGH+PH+E+P   A+ I 
Sbjct  232   QLARIKQPTLILWGDADKILGTGDAQKFQKAIPQSKLIWIQESGHVPHLEQPQITAQHIL  291

Query  324   DF  319
             +F
Sbjct  292   EF  293



>ref|WP_015150232.1| alpha/beta hydrolase [Oscillatoria acuminata]
 ref|YP_007087528.1| alpha/beta hydrolase [Oscillatoria acuminata PCC 6304]
 gb|AFY83608.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Oscillatoria acuminata PCC 6304]
Length=295

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/298 (35%), Positives = 171/298 (57%), Gaps = 7/298 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V  + +  + +LA+ I+   V    S+  I +S ++    G   P++LLH F
Sbjct  2     FPSFLPSDVEFLTESTSIALAQSIECQDVLTSLSDRPIPTSFVREGRGG--PPILLLHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSD-LERRPTCDAASKRYHLYQLWKSYIKR  844
             DSS LE+RR  PLL  T  E WA+D+LG+GF+  L   P   AA K  HLY+ W   I++
Sbjct  60    DSSVLEFRRLLPLLA-THHETWAMDLLGFGFTHRLPEIPITPAAIKT-HLYEFWTQLIQQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PMILVG S+G A A+DF +++P AV KLVLI+++ + +G      +   + Y     L++
Sbjct  118   PMILVGVSMGGAAALDFTLSYPNAVQKLVLIDSAGFAKGPAMGKMMFPPLGYLATQFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYN-VVHQIKKVN  487
               +R    L+ +   +L++  D +   RLH  +P W+   + F  SGGYN +  +I++V 
Sbjct  178   PRIRQQISLKAYRDRALASE-DASACARLHLQMPGWDQGTIAFTKSGGYNFLADKIEQVK  236

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             + TL++ G  D+++    A +    + ++ +  IPN GH+PH+E+P   A  I ++++
Sbjct  237   KPTLILWGENDQILGTADADKFAEAIASSKLIWIPNCGHVPHLEQPQISADHILEWSK  294



>ref|WP_015187486.1| alpha/beta hydrolase fold protein [Gloeocapsa sp. PCC 7428]
 ref|YP_007126770.1| alpha/beta hydrolase fold protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ29610.1| alpha/beta hydrolase fold protein [Gloeocapsa sp. PCC 7428]
Length=297

 Score =   177 bits (448),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 165/302 (55%), Gaps = 17/302 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVI------QGDKEPV  1039
             FP FLP +V  +K+  A  LA+ I+R  +    S+ +I  S     I      QG  +P+
Sbjct  2     FPAFLPPQVQLLKEDAAIVLAQSIKRELIVTSLSQQAIRRSAAPEAIATAYVRQGTGKPI  61

Query  1038  VLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWK  859
             +LLH FDSS LE+R   PLL     E W +D+LG+GF++  R    + AS + HLY  WK
Sbjct  62    LLLHGFDSSVLEFRYLLPLLAKK-YETWGVDLLGFGFTERIRGIDYNPASIKAHLYSFWK  120

Query  858   SYIKRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGV  679
               I RP+IL+G S+G A AIDF +++P+AV KL+LIN+  +         L     Y  V
Sbjct  121   -LINRPLILIGTSMGGATAIDFVLDYPQAVEKLILINSVGFSGDFPVGKFLFPPFDYLAV  179

Query  678   SLLKSIPLRIYAKLQC--FDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVV  508
                +        KLQ   +D  + S  +D      LH  +P+W +AM++FM SGGY ++ 
Sbjct  180   EYWRQ------RKLQALFWDNFNPSQLIDAIRCASLHLDMPYWYEAMLSFMKSGGYGHLA  233

Query  507   HQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLI  328
              +I K+N+ TL++ G RD  +S   A +  R + ++ +  + N GH+P +E+P  +A  I
Sbjct  234   DKIPKINKPTLILWGDRDDTLSVNDATKFQRAIADSQLIWLKNCGHVPQLEQPEVLAGYI  293

Query  327   AD  322
              D
Sbjct  294   QD  295



>ref|WP_013192311.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Trichormus azollae]
 ref|YP_003722420.1| alpha/beta hydrolase fold-containing protein ['Nostoc azollae' 
0708]
 gb|ADI65297.1| alpha/beta hydrolase fold protein ['Nostoc azollae' 0708]
Length=295

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 166/298 (56%), Gaps = 10/298 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP  V ++ +P + +LA+ IQ   +    S   I ++ +    QG    P++L+H 
Sbjct  4     FPSFLPAAVGQLSEPTSIALAQSIQSQAIATPLSPEPITTTYVH---QGSGGTPILLVHG  60

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL     E WA+D+LG+GF+D +          + HLY  WK+ I +
Sbjct  61    FDSSILEFRRLLPLLARKN-ETWAMDLLGFGFTDRQPDIAYSPVGIKTHLYFFWKTLINQ  119

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYG-GVSLLK  667
             P+ILVG S+G A AIDFA+ +P+ V KLVLI+++   +G   ++KL     Y      L+
Sbjct  120   PVILVGASMGGAAAIDFALTYPQVVQKLVLIDSAGL-KGASALSKLTFAPLYSLAAEFLR  178

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV--VHQIKK  493
             +  +R       +   SL ++ D  + G LH  +P W  A++ F  SGGY+    +Q+ +
Sbjct  179   NAQVRNRICRTAYKNPSLISS-DALHCGDLHVKMPNWNQALIAFTKSGGYSAFKFNQLAQ  237

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             + Q TL++ G  DK++    A +  + +P +    I +SGH+PH+E+P   A+ I DF
Sbjct  238   IRQPTLILWGDTDKILGTGDAQKFKKAIPQSQQIWIKDSGHIPHLEQPEITAQHILDF  295



>ref|WP_015195239.1| alpha/beta hydrolase fold protein [Stanieria cyanosphaera]
 ref|YP_007134551.1| alpha/beta hydrolase fold protein [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ37585.1| alpha/beta hydrolase fold protein [Stanieria cyanosphaera PCC 
7437]
Length=293

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/295 (35%), Positives = 163/295 (55%), Gaps = 5/295 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP +V+ + +  +   A++IQ+  +    S   I ++ ++    G   P+VLLH F
Sbjct  2     FPDFLPTQVNHLTEASSIEFAKQIQQHSILTPLSPLKIPTAYVQAGNGG--TPIVLLHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR +PLL       WA+D+LG+GF++        +   R HLY  WK+ I++P
Sbjct  60    DSSLLEFRRLFPLLAQQQT-TWAVDLLGFGFTERPIDLNFSSTQIRTHLYYFWKTLIEQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G AVAIDF +N+PE V KL+LI+++           +   + Y     L++ 
Sbjct  119   IILVGASMGGAVAIDFTLNYPEIVSKLILIDSAGLTNPPAIGKFMFSPLDYFAAEFLRNP  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKKVNQ  484
              +R       +   S + +LD      LH     W  A++ F  SGGY +   Q+ ++ Q
Sbjct  179   KIRQNISRSAYYDKSYA-SLDAQICAALHLQSVNWHQALIKFTKSGGYGSFATQLNQLEQ  237

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              TL+I G  D+++  + A R  + LPN+ +  IPN GH+PH+E+P   A+ IA+F
Sbjct  238   PTLIIWGENDRILGTKDAPRFKQLLPNSELVWIPNCGHVPHLEQPKITAEAIANF  292



>ref|WP_015127998.1| alpha/beta fold family hydrolase [Calothrix sp. PCC 7507]
 ref|YP_007065015.1| alpha/beta fold family hydrolase [Calothrix sp. PCC 7507]
 gb|AFY32181.1| alpha/beta hydrolase fold protein [Calothrix sp. PCC 7507]
Length=297

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 160/299 (54%), Gaps = 8/299 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP  V ++ DP + +LA+ +Q   +    +   I ++    V QG    P++L+H 
Sbjct  2     FPSFLPSAVGQLTDPASIALAQSVQSQAIATPLTNQPITTTY---VTQGSGGTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL     E W +D+LG+GF+D            + HLY  WK+ I +
Sbjct  59    FDSSVLEFRRILPLLA-VDHETWGVDLLGFGFTDRLAGIKFSPDVIKTHLYHFWKTLINQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+IL+G S+G A AIDF + +P+ V KLVLI+++    G+     +   + Y    +L++
Sbjct  118   PVILIGASMGGAAAIDFTLTYPKVVQKLVLIDSAGLQRGSPLSKLMFPPLDYLATEILRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYN--VVHQIKKV  490
               +R       +   SL  +LD    G LH  +P W  A++ F  SGGY    + ++ ++
Sbjct  178   PKIRSSISRAAYKNPSL-VSLDALCCGALHLQMPSWSQALIAFTKSGGYRSFSMQKLSQI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
              Q TL++ G  DK++    A +  R +P++ +  I N GHLPH+E P   A+ I +  +
Sbjct  237   VQPTLILWGDDDKILGTADAQKFNRAIPHSTLIWIQNCGHLPHLENPQVTAQHILELCK  295



>ref|XP_002294669.1| hypothetical protein THAPSDRAFT_38512 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED88029.1| hypothetical protein THAPSDRAFT_38512, partial [Thalassiosira 
pseudonana CCMP1335]
Length=255

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 140/247 (57%), Gaps = 3/247 (1%)
 Frame = -3

Query  1044  PVVLLHCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQL  865
             P++L+H FDSS LE+RR  P L   GV+ + +D+LGWG++ L+   +  A +K   L   
Sbjct  9     PLLLVHGFDSSALEYRRLGPQLAKLGVDVYCVDLLGWGYTQLDDVNSFSAKAKVEALKGF  68

Query  864   WKSYIKRPMILVG-PSLGAAVAIDFAV-NFPEAVHKLVLINASVYGEGTGFMTKLPKMVA  691
             WK+      ++VG  SLG A  I+FA  NF   V   VLI+A  + +G G M+ LP  +A
Sbjct  69    WKTVGSNGEVVVGGASLGGAATIEFAAENFEGFVRGTVLIDAQGFVDGIGPMSFLPAPLA  128

Query  690   YGGVSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV  511
               G+ +L+S+PLR  A    +       T D   VGRLHCL   WED M++FM SGG+  
Sbjct  129   RAGIKVLQSVPLRNSANQMSYHNPETYATEDALKVGRLHCLREGWEDGMLSFMQSGGFRP  188

Query  510   VHQIKKVNQRTLVITGMRDKLV-SNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAK  334
               ++ ++N  +LV+ G +D ++   E A +    +P+A +  I   GH+PH+E+P   A 
Sbjct  189   KEKVSQINVPSLVLWGRQDGILEGKEFAQKFIDTMPDAQLQWIEECGHVPHLEQPEVTAS  248

Query  333   LIADFAR  313
              I DF R
Sbjct  249   CILDFLR  255



>ref|WP_028089867.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Dolichospermum circinale]
Length=295

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 101/299 (34%), Positives = 165/299 (55%), Gaps = 8/299 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP  V ++    + +LA+ IQR  + V    ++I ++ +    QG    P++L+H 
Sbjct  2     FPSFLPPAVGQLTQTTSIALAQNIQRQAIAVPCINATIDTTYVH---QGQGGTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+R+  PLL +   + WA+D+LG+GF+D     T    S + HL+  W++ I R
Sbjct  59    FDSSVLEYRQILPLLAENN-QVWAVDLLGFGFTDRLPVITYSPESIKTHLFSFWQTLINR  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +PEAV +LVLI+++     +     +   + Y     L++
Sbjct  118   PVILVGASMGGATAIDFTLTYPEAVKQLVLIDSAGLKANSPLSKYIFPPLDYWATEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKV  490
               +R       +   SL  + D    G LH  +P W  A++ F  SGGY      Q+ K+
Sbjct  178   PKVRDRICRTAYKNPSL-ISADTLCCGALHLQMPNWTQALIAFTKSGGYGAFKFPQLAKI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
              Q TL++ G  DK++    A +  + +P + +  I N GH+PH+E+P  V++L+ +F +
Sbjct  237   AQPTLILWGDSDKILGTGDANKFTKAIPQSQLIWIKNCGHIPHLEQPEIVSQLMLEFRK  295



>ref|WP_015139157.1| alpha/beta hydrolase [Nostoc sp. PCC 7524]
 ref|YP_007076318.1| alpha/beta hydrolase [Nostoc sp. PCC 7524]
 gb|AFY48721.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Nostoc sp. PCC 7524]
Length=299

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 165/303 (54%), Gaps = 10/303 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP  V ++ +P + ++A+ IQ   +        I ++ ++   QG    P++L+H 
Sbjct  2     FPNFLPATVGQLTEPSSIAIAQSIQTQAIATPLLNQPINTTYVR---QGSGGTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL     E WA+D+LG+GF+D          + + HLY  WK+ I +
Sbjct  59    FDSSVLEFRRLLPLLAKKN-ETWAVDLLGFGFTDRLSGIQFSPIAIKTHLYYFWKTLINQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMT-KLPKMVAYGGVSLLK  667
             P+ILVG S+G A A+DF + +PEAV KLVLI+++    G+  +    P + A+   S L+
Sbjct  118   PVILVGASMGGAAALDFTLTYPEAVQKLVLIDSAGLKGGSPLVKFMFPPLDAF-ATSFLR  176

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKK  493
             S  +R       +   S + +LD      LH  +  W  A++ F  SGGY+     ++ +
Sbjct  177   SPKVRDRISRTAYKNPSFA-SLDALCCAALHLEMANWSQALIAFTKSGGYSAFRFKKLAE  235

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             +NQ TL++ G  DK++  E A R    +P++ +  I N GH+PH+E+P   A  I +F  
Sbjct  236   INQPTLILWGDSDKILGTEDAKRFKLAIPHSQLIWIANCGHVPHLEQPEMTAHHILEFGI  295

Query  312   GDE  304
              D 
Sbjct  296   SDH  298



>ref|WP_015152588.1| alpha/beta fold family hydrolase [Chroococcidiopsis thermalis]
 ref|YP_007089906.1| alpha/beta fold family hydrolase [Chroococcidiopsis thermalis 
PCC 7203]
 gb|AFY86037.1| alpha/beta hydrolase fold protein [Chroococcidiopsis thermalis 
PCC 7203]
Length=292

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 167/306 (55%), Gaps = 31/306 (10%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHC  1024
             FP FLP +V  ++ P + +LA++I+R  +       +I++S ++   QG+   P++LLH 
Sbjct  2     FPSFLPSQVQLLQQPESIALAQKIERHAIATPIYSQAIVTSFVR---QGEGNIPILLLHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL     E WA+D+LG+GFSD  R    +  + + HLY  WK  I +
Sbjct  59    FDSSVLEFRRLIPLLAAQH-ETWAVDLLGFGFSDRPRGIHYNPETIKTHLYYFWKILIDK  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +P+AV  LVLIN+       GF    P       +     
Sbjct  118   PVILVGASMGGATAIDFTLTYPQAVKHLVLINS------VGFSGDFP-------LGQFLF  164

Query  663   IPLRIYA----KLQCFDGLSLSTTL--------DWTNVGRLHCLLPWWEDAMVNFMLSGG  520
              PL   A    + +    L+L T+L        D      LH  +P W +AMV+F  SGG
Sbjct  165   FPLDYLAVEFWRQRKIQALNLGTSLGNLTPFEIDAIRCALLHTEMPRWSEAMVSFTKSGG  224

Query  519   YN-VVHQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHS  343
             Y  +V++I KV++ T ++ G RD+ +    AM+  + + ++ +  + N GH+P +E+P  
Sbjct  225   YGEIVNKIAKVDKPTTILWGDRDETLGVADAMKFKQAIAHSQLIWLKNCGHVPQIEQPEI  284

Query  342   VAKLIA  325
             +A  I 
Sbjct  285   IANYIG  290



>ref|WP_028083076.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Dolichospermum circinale]
Length=295

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 163/297 (55%), Gaps = 8/297 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP  V ++    + +LA+ IQR  + V    ++I ++ +    QG    P++L+H 
Sbjct  2     FPSFLPPAVGQLTQTTSIALAQNIQRQAIAVPCINATIDTTYVH---QGQGGTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+R+  PLL +   + WA+D+LG+GF+D     T    S + HL+  W++ I R
Sbjct  59    FDSSVLEYRQILPLLAENN-QVWAVDLLGFGFTDRLPGITYSPESIKTHLFSFWQTLINR  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +PEAV +L+LI+++     +     +   + Y     L++
Sbjct  118   PVILVGASMGGATAIDFTLTYPEAVKQLILIDSAGLKANSPLSKYIFPPLDYWATEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKV  490
               +R       +   SL  + D    G LH  +P W  A++ F  SGGY      Q+ K+
Sbjct  178   PKVRDRICKTAYKNPSL-ISADTLCCGALHLQMPNWTQALIAFTKSGGYGAFKFPQLAKI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              Q TL++ G  DK++    A +  + +P + +  I N GH+PH+E+P  VA+ I +F
Sbjct  237   AQPTLILWGDSDKILGTGDANKFAKAIPQSQLIWIKNCGHIPHLEQPQIVAQHILEF  293



>ref|WP_010994492.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Nostoc sp. PCC 7120]
 ref|NP_484360.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Nostoc sp. PCC 7120]
 dbj|BAB72274.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Nostoc sp. PCC 7120]
Length=295

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 164/298 (55%), Gaps = 10/298 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP  V ++ +  + +LA+ I    +    S   I ++ ++    G   P++L+H F
Sbjct  2     FPSFLPAAVGQLTESESIALAKSIHTQAIATPLSNQPITTAYVRQ--GGGGTPILLIHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAA--SKRYHLYQLWKSYIK  847
             DSS LE+RR  PLL     E WA+D+LG+GF+  +R P    +  + R HL+  WK+ I 
Sbjct  60    DSSVLEFRRLLPLLGKEN-ETWAVDLLGFGFT--QRLPGIKFSPIAIRTHLHSFWKTLIN  116

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             +P+ILVG S+G A AIDF + +PEAV KLVLI+++    G+     +   + Y     L+
Sbjct  117   QPVILVGASMGGAAAIDFTLTYPEAVQKLVLIDSAGLRGGSPLSKFMFPPLDYLAAQFLR  176

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKK  493
             S  +R       +   +L+ T+D    G LH  +P W +A++ F  SGGY      Q+ +
Sbjct  177   SPKVRDRVSRAAYKNQNLA-TVDALYCGALHLEMPSWPEALIAFTKSGGYTAFRFKQLAE  235

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             +   TL++ G  DK++  E   R  R +P++ +  I + GH+PH+E+P   A+ I +F
Sbjct  236   IMSPTLILWGDTDKILGTEDGKRFKRAIPHSQLIWIEDCGHIPHLEQPEITAQHILNF  293



>ref|WP_015201848.1| alpha/beta fold family hydrolase [Crinalium epipsammum]
 ref|YP_007141236.1| alpha/beta fold family hydrolase [Crinalium epipsammum PCC 9333]
 gb|AFZ11726.1| alpha/beta hydrolase fold protein [Crinalium epipsammum PCC 9333]
Length=301

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/298 (35%), Positives = 168/298 (56%), Gaps = 7/298 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             F  FLP  V ++ +P + +LA+ IQR  +    S + I ++ ++    G   P+VLLH F
Sbjct  9     FANFLPALVEQLTEPTSIALAQGIQREAIATSLSLTPIPTTYVRQGSGGT--PIVLLHGF  66

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSD-LERRPTCDAASKRYHLYQLWKSYIKR  844
             DSS  E+RR  PLL +   E WA+D+LG+GF++ L   P    A K  HLY  WK+ I++
Sbjct  67    DSSLFEFRRLLPLLANHN-ETWALDLLGFGFTERLAGIPFSPTAIKT-HLYYFWKTLIQQ  124

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +PEAV KLVLI+++ +  G+     L   + +   S L+S
Sbjct  125   PVILVGASMGGAAAIDFTLAYPEAVQKLVLIDSAGFKGGSALSKFLFPPLGHLATSFLRS  184

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKKVN  487
               +R       +   S   +LD      LH  +  W  A++ F  SGGY +  +++  ++
Sbjct  185   PKVRKKVSETAYHDQSF-VSLDAQICAALHLEMSNWNQALIAFTKSGGYSSFANKLAHIS  243

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             Q T+++ G RD+++    A +  + + N+ +  I + GH+PH+E+P   A+ +  FA+
Sbjct  244   QDTMILWGERDRILGIADAYKFQQAISNSQLIWIKDCGHVPHLEKPQITAEHLKQFAK  301



>ref|WP_011321370.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Anabaena variabilis]
 ref|YP_325200.1| alpha/beta hydrolase fold protein [Anabaena variabilis ATCC 29413]
 gb|ABA24305.1| Alpha/beta hydrolase fold protein [Anabaena variabilis ATCC 29413]
Length=295

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 161/297 (54%), Gaps = 8/297 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP  V ++ +  + +LA+ IQ   +    S   I ++ ++   QG    P++L+H 
Sbjct  2     FPSFLPAAVGQLTESESIALAKTIQTQAIATPLSNQPITTAYVR---QGSGGTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL     E WA+D+LG+GF+           + R HLY  WK+ I +
Sbjct  59    FDSSVLEFRRLLPLLGKEN-ETWAVDLLGFGFTQRLAGIKFSPVAIRTHLYSFWKTLINQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +PEAV KLVLI+++    G+     +   + Y     L+S
Sbjct  118   PVILVGASMGGAAAIDFTLTYPEAVQKLVLIDSAGLRGGSPLSKFMFPPLDYLAAQFLRS  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKV  490
               +R       +   +L+ T+D    G LH  +P W +A++ F  SGGY      Q+ ++
Sbjct  178   PKVRDRVSRAAYKNPNLA-TVDALCCGALHLEMPSWPEALIAFTKSGGYTAFRFKQLAEI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
                TL++ G  D+++  E   R  R +P++ +  I + GH+PH+E+P   A+ I  F
Sbjct  237   ISPTLILWGDADRILGTEDGKRFKRAIPHSQLIWIQDCGHIPHLEQPGITAQHILSF  293



>ref|WP_027403060.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Aphanizomenon flos-aquae]
Length=295

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 165/297 (56%), Gaps = 8/297 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHC  1024
             FP FLP  V ++ +P + +LA+ IQ   +    +  SI ++ I+   QG    P++L+H 
Sbjct  2     FPSFLPAAVGQLTEPTSIALAQNIQSQAISTFLANESINTTYIQ---QGHGGTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL +     WA+D+LG+GF+D        A + + HL+  W++ I +
Sbjct  59    FDSSVLEYRRLLPLLAEKNA-VWAVDLLGFGFTDRLPGIAYSAIAIKTHLHSFWQTLINQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +PEAV +LVLI+++     +     +   + Y     L++
Sbjct  118   PVILVGASMGGAAAIDFTLTYPEAVKQLVLIDSAGLKGNSPLSKYIFPPLDYWATEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKV  490
               +R       +   +L +  D  + G LH  +P W  A++ F  SGGY+     Q+ ++
Sbjct  178   PKVRKSICRTAYKNPNLISE-DALSCGELHLQMPNWTQALIAFTKSGGYSAFKFPQLAQI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              Q TL++ G  DK++    A +  + +P + +  I + GH+PH+E+P  VA+ I +F
Sbjct  237   EQPTLILWGDSDKILGTGDAPKFAKAIPQSKLIWIKDCGHIPHLEQPQIVAQHILEF  293



>ref|WP_015171176.1| alpha/beta fold family hydrolase [Geitlerinema sp. PCC 7407]
 ref|YP_007108661.1| alpha/beta fold family hydrolase [Geitlerinema sp. PCC 7407]
 gb|AFY65609.1| alpha/beta hydrolase fold protein [Geitlerinema sp. PCC 7407]
Length=296

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 162/296 (55%), Gaps = 7/296 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             F  FLP  V E+ +  + +LA+ +QR  +    +   I+++ ++   QG   P +VLLH 
Sbjct  2     FADFLPLTVRELTEETSIALAQGMQRRAIATSLATEPILTNYVQ---QGSGGPAIVLLHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL   G E WAID+LG+GF+D          S + HL+  W++ I+R
Sbjct  59    FDSSVLEFRRLIPLLAPYG-EVWAIDLLGFGFTDRAAGVVPSPESIKAHLHGCWQTLIRR  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             PMILVG S+G A AIDF + +PEAV +LVL++++ Y  G      +   + +     L++
Sbjct  118   PMILVGASMGGAAAIDFTLTYPEAVEQLVLLDSAGYTAGPSASKMMFPPMGFLATEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKKVN  487
             + +R       +     ++  D    G LH   P W  A++ F  SGGY +   ++ ++ 
Sbjct  178   LKVRDRISRSAYHDAQWASA-DALRCGALHLEAPGWRQALIAFTKSGGYGSFAERLGRLE  236

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             Q TL++ G  D+++    A +    + ++ +  IPN GH+PH+E+P   A+ +  F
Sbjct  237   QPTLILWGENDRILGTADAEKFQGAIADSKLIWIPNCGHVPHLEQPELTAQHMRAF  292



>ref|WP_019495697.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Calothrix sp. PCC 
7103]
Length=302

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/297 (34%), Positives = 162/297 (55%), Gaps = 8/297 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP  V ++ +  + ++A++I++  +    S   I ++ +     G   P +L+H F
Sbjct  9     FPKFLPATVEQLVESASIAIAQKIEQAEIITPLSNQPITTAYVHQGSGGT--PFLLIHGF  66

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR  P + +   E WA+D+LG+GF+D          + + HLY  WKS I +P
Sbjct  67    DSSALEFRRLLPKISENK-ETWAVDLLGFGFTDRLSGVKFSQVAIKTHLYHFWKSLINKP  125

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLIN-ASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             +ILVG S+G A A+DF + +PEAV KLVLI+ A + G         P +      + L+S
Sbjct  126   VILVGASMGGAAALDFTLTYPEAVEKLVLIDSAGLVGNSPLVKFMFPPLDTLAA-NFLRS  184

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKV  490
               +R       +    L+ T+D      LH  +P W  A++ F  SGGY      ++ ++
Sbjct  185   PKVRQSISRAAYKNKELA-TIDAQLCATLHLEMPNWNTALIAFTKSGGYGAFRFTKLSEI  243

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              Q TL++ G  DK++  + A R  R +PN+ +  I +SGH+PH+E+P  VA+ + +F
Sbjct  244   KQPTLILWGDDDKILGTKDAKRFKRAIPNSKLIWIQDSGHVPHLEQPQIVAQHLLEF  300



>ref|WP_039739843.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Hassallia byssoidea]
 gb|KIF37110.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Hassallia byssoidea 
VB512170]
Length=300

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/296 (34%), Positives = 162/296 (55%), Gaps = 6/296 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             F  FLP  V ++++  A +LA+ I+++ +    S  SI +S +     G   P++L+H F
Sbjct  2     FASFLPAAVGQLREASAIALAQSIEQIAISTPLSTQSITTSYVHKGSGG--TPILLIHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR  P L +   + WA+D+LG+GF+           + + HLY  WK+ I +P
Sbjct  60    DSSLLEFRRLLPFLAENN-DTWAVDLLGFGFTHRVSGIQFSPTAIKTHLYCFWKTLINQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G A AIDF + +PE V KLVLI+++  G  +     +   + Y     L++ 
Sbjct  119   VILVGASMGGAAAIDFTLTYPEVVQKLVLIDSAGLGGSSPLSKLMFPPLDYLATQFLRNP  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKVN  487
              +R       +   SL+ + D      LH  +P WE A++ F  SGGY      ++ ++ 
Sbjct  179   KIRQSISRAAYKNKSLADS-DAQICAALHLEMPSWELALIAFTKSGGYGGFRFKKLSEIV  237

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             Q TL++ G  DK++  E A R  R +PN+ +  I + GH+PH+E+P   A+ I +F
Sbjct  238   QPTLILWGDSDKILGIEDAKRFKRAIPNSKLIWIKDCGHVPHLEQPQITAQHILEF  293



>ref|WP_026734344.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Fischerella sp. 
PCC 9605]
Length=297

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 166/300 (55%), Gaps = 7/300 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FL   V ++ +  + +LA+ I+++ +    S   I+++ ++    G   P++L+H F
Sbjct  2     FPSFLSAAVGQLTESTSVALAQSIEQIAIATPLSSEPILTTYVRRGSGG--TPLLLIHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR  PLL +   E WA+D+LG+GF+   +      A  + HLY  WK+ I +P
Sbjct  60    DSSVLEYRRLLPLLAEHN-ETWAVDLLGFGFTSRPKGIKFRTAEIKTHLYYFWKTLINQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G A AIDF + +PE V KLVLI+++     + F+  +   + Y     L++ 
Sbjct  119   VILVGASMGGAAAIDFTLTYPELVKKLVLIDSAGLVGSSPFIKLMFPPLDYFAAQFLRNP  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKVN  487
              +R       +   SL+ ++D      LH   P W  A++ F  SGGY      ++ ++ 
Sbjct  179   KVRQSIIRAAYKNKSLA-SIDAQLCAGLHLECPDWHQALIAFTKSGGYTAFRFKKLGEIQ  237

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             Q TL++ G  DK++    A R  R +PN+ +  I + GH+PH+E+P  +A+ I +F R D
Sbjct  238   QPTLILWGDSDKILGTTDAKRFKRAIPNSKLIWIQDCGHVPHLEQPQIIAQHILEF-RSD  296



>ref|WP_015215498.1| alpha/beta hydrolase fold protein [Anabaena cylindrica]
 ref|YP_007157785.1| alpha/beta hydrolase fold protein [Anabaena cylindrica PCC 7122]
 gb|AFZ58875.1| alpha/beta hydrolase fold protein [Anabaena cylindrica PCC 7122]
Length=296

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 106/302 (35%), Positives = 168/302 (56%), Gaps = 12/302 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQ-RLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLH  1027
             FP FLP  V ++ +P + +LA+ IQ +  +       SI ++ I+   QG    P++L+H
Sbjct  2     FPSFLPAAVGQLSEPTSIALAKNIQSQAIIATSVDNESIATTYIQ---QGSGGIPILLIH  58

Query  1026  CFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIK  847
              FDSS LE+RR  PLL +   E WA+D+LG+GF+D          + + HLY  WK+ I 
Sbjct  59    GFDSSILEFRRLLPLLAEEN-ETWAVDLLGFGFTDRLAGIDYSPIAIKTHLYSFWKTLIN  117

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYG-GVSLL  670
             +P+ILVG S+G A AIDF + +PE V KLVLI+++    G+  ++KL     Y      L
Sbjct  118   QPVILVGASMGGAAAIDFTLTYPEVVQKLVLIDSAGLKGGSA-LSKLMFAPLYSLAAEFL  176

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV--VHQIK  496
             ++  +R       ++  SL  + D    G LH  +P W  A++ F  SGGY    + Q+ 
Sbjct  177   RNPKVRDRICRTAYNNPSL-ISADALCCGDLHLKMPNWNQALIAFTKSGGYTAFKLQQLA  235

Query  495   KVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             ++ Q TL++ G  DK++    A +  + +P + +  I + GH+PH+E+P   A+ I +F 
Sbjct  236   QIGQPTLILWGDNDKILGTGDAKKFQKAIPESQLIWIQDCGHIPHLEKPQITAQHILEF-  294

Query  315   RG  310
             RG
Sbjct  295   RG  296



>ref|WP_038088965.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Tolypothrix bouteillei]
 gb|KIE09288.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Tolypothrix bouteillei 
VB521301]
Length=294

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 159/297 (54%), Gaps = 8/297 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHC  1024
             FP FLP  V ++ +P + +LA+ IQ+  +    +   I ++ ++   QG    P++L+H 
Sbjct  2     FPNFLPTTVTQLTEPASIALAQSIQQTAIATPLTTQPITTTYVQ---QGSGGVPLLLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FD S  E+RR  P L     E WA+D+LG+GF+D         ++ + HLY  WK+ I +
Sbjct  59    FDGSVFEFRRLIPPLAGQN-ETWAVDLLGFGFTDRPAGIKFSPSAIKTHLYYFWKTLINK  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF +++PE VHKLVLI+++    G      +   + Y     L++
Sbjct  118   PVILVGASMGGAAAIDFTLSYPEVVHKLVLIDSTGLVGGPPISKFMFPPLDYLATEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKV  490
               +R       +    L+ TLD      LH     W  A++ F  SGGY+      + ++
Sbjct  178   PKVRQSITRTAYKNKQLA-TLDSQLCASLHLECSDWNKALIAFTKSGGYSAFRFTTLSQI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              Q TL++ G  DK+V    A R    +PN+ +  I + GH+PHVE+PH  A+ I +F
Sbjct  237   VQPTLILWGDSDKIVGTRDAKRFKLAIPNSKLIWIKDCGHVPHVEQPHMTAQNILEF  293



>ref|WP_039199653.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Aphanizomenon flos-aquae]
 gb|KHG43040.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Aphanizomenon flos-aquae 
2012/KM/D3]
Length=295

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 162/297 (55%), Gaps = 8/297 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQG-DKEPVVLLHC  1024
             FP FLP  V ++ +P + +LA+ IQ   +    S  SI ++ I+   QG    P++L+H 
Sbjct  2     FPSFLPAAVGQLTEPTSIALAQNIQSQAISTFLSNESINTTYIQ---QGHGGTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL +     WA+D+LG+GF+D        A + + HL+  W++ I +
Sbjct  59    FDSSVLEYRRLLPLLAEKNA-VWAVDLLGFGFTDRLPGIAYSAIAIKTHLHSFWQTLINQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +PEAV +LVLI+++     +     +   + Y     L++
Sbjct  118   PVILVGASMGGAAAIDFTLTYPEAVKQLVLIDSAGLKGNSPLSKYIFPPLDYWATEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKV  490
               +R       +    L +  D    G LH  +P W  A++ F  SGGY      Q+ ++
Sbjct  178   PKVRKSICRTAYKNPDLISE-DALCCGELHLQMPNWTQALIAFTKSGGYGAFKFPQLAQI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              Q TL++ G  DK++    A +  + +P + +  I + GH+PH+E+P  +A+ I +F
Sbjct  237   EQPTLILWGDSDKILGTGDAPKFAKAIPQSKLIWIKDCGHIPHLEQPQIIAQNILEF  293



>ref|WP_017288461.1| hypothetical protein [Leptolyngbya boryana]
Length=294

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 161/296 (54%), Gaps = 7/296 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHC  1024
             F  FLP EV ++ +  + +LAR+I+R P+    S  SI ++ +    QG+   P++LLH 
Sbjct  2     FESFLPSEVSQLTEETSIALARQIRRAPIPTSISLESIETAYVH---QGEGGIPILLLHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS  E+RR  P L  +  + W +D+LG+GF+D          + + HLY  WK  I R
Sbjct  59    FDSSVFEFRRLLPRLA-SHHDTWMVDLLGFGFTDRPINTPFSPEAIKTHLYDFWKEKIAR  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P++LVG S+G A AIDFA+ +PE V KLVL++++ +  G      L   + Y     L+ 
Sbjct  118   PVVLVGASMGGAAAIDFALTYPETVAKLVLLDSAGFAAGPAIGKFLIPPLGYLATEFLRK  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVV-HQIKKVN  487
               +R    L+ +   S  T  D      LH  L  W +A++ F  SGGYN + ++I ++ 
Sbjct  178   PNVRRSVSLKAYCDASFVTE-DAELCAALHLKLSRWNEALIAFTKSGGYNFLSNKISQIA  236

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
               TL++ G  D+++  + A +    + N+ +  I   GH+PH+E+P   A+ I DF
Sbjct  237   CPTLILWGDSDQILGTKDAKKFESAIANSQLIWIEQCGHVPHLEKPEITAQHILDF  292



>ref|WP_027843092.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Mastigocoleus testarum]
Length=296

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/302 (34%), Positives = 164/302 (54%), Gaps = 11/302 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHC  1024
             FP FLP    ++ +  + +LA+ I+++ V    SE SI++S I    QG    P++L+H 
Sbjct  2     FPSFLPPNTEQLTESTSIALAQNIKQIRVPTPLSEESILTSYI---CQGSGGIPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS  E+RR  P L     E WA+DILG+GF+   R P    + K  + HLY  WK+ I
Sbjct  59    FDSSIFEFRRLLPKL-SLEYETWAVDILGFGFTS--RIPNIKFSPKTIKVHLYHFWKTLI  115

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
              +P+ILVG S+G A AIDF + +PE V KLVLI+++    G+     +   + Y     L
Sbjct  116   NQPVILVGASMGGAAAIDFTLTYPEVVKKLVLIDSAGIAGGSPLSKLMFPPLGYLATEFL  175

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH-QIKK  493
             ++  +R       +   S ++         LH  +P W  A+++F  SGGY+    ++ K
Sbjct  176   RNPKVRQNISRAAYKNKSFASADA-QACAALHLGMPNWSQALISFTKSGGYSSFRKELSK  234

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             + Q TL++ G  D+++    A +    + N  +  I +SGH+PH+E+P + A+ I ++  
Sbjct  235   IEQPTLILWGDSDQILGTADAKKFQTSIKNNQLVWIEDSGHVPHLEQPETTARCILEWIT  294

Query  312   GD  307
             GD
Sbjct  295   GD  296



>ref|WP_006511278.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Xenococcus sp. PCC 7305]
 gb|ELS01600.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Xenococcus sp. PCC 7305]
Length=293

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 164/293 (56%), Gaps = 7/293 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP ++P E +++ +  + +LA+ I+   +   FS  +I ++ +K   QG+   P++LLH 
Sbjct  2     FPEYIPVEANQLTENTSIALAKEIKISAIATDFSPEAIPTTYVK---QGNGGTPILLLHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR +P L +   E WA+D+LG+GFSD        AA  + HLY  WK+ IK+
Sbjct  59    FDSSLLEFRRLFPQLAEQQ-ETWAVDLLGFGFSDRVPNLPYSAAGIKAHLYYFWKTLIKK  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +PE V KLVL++++   +       +   + Y     L++
Sbjct  118   PVILVGASMGGAAAIDFTLEYPETVEKLVLLDSAGLAKQPMIGKFMFPPLDYWATEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKKVN  487
               +R       +   S ++  D      LH     W  A+++F  SGGY +   +   + 
Sbjct  178   PKVRHNISKAAYYDKSFASQ-DAQVCASLHLKCRNWNQALIDFTKSGGYGSFTKKASNIA  236

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLI  328
             Q TL++ G +DK++  + A +  + +PN  +  I N+GH+PH+E+  +VA+ I
Sbjct  237   QETLILWGKQDKILGTKDAHKFAKLIPNNQLVWIDNAGHVPHLEKSQAVAQKI  289



>ref|WP_029632482.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [[Scytonema hofmanni] 
UTEX B 1581]
Length=297

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/298 (32%), Positives = 168/298 (56%), Gaps = 6/298 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             F  FLP  V ++++  A +LA+ I+++ +    S   I ++ +     G   P++L+H F
Sbjct  2     FASFLPAGVGQLREADAIALAQSIEQIAISTPLSTQPITTTYVHKGSGG--TPILLIHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR  PLL +   + +A+D+LG+GF+D   +      + + HLY  WK+ I +P
Sbjct  60    DSSLLEFRRLLPLLAENN-DTFAVDLLGFGFTDRVSQIQFSPTAIKTHLYSFWKTVINQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G A AIDF + +PE V KLVLI+++    G+     +   + Y     L++ 
Sbjct  119   VILVGASMGGAAAIDFTLTYPEVVQKLVLIDSAGLTAGSPLSKLMFPPLDYLATQFLRNP  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYN--VVHQIKKVN  487
              +R       +   SL+++ D      LH  +P W  A++ F  SGGY+   ++Q+ ++ 
Sbjct  179   KIRQSISRAAYKNKSLASS-DAQLCAALHLEMPSWHLALIAFTKSGGYSGFKLNQLSQIK  237

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             Q TL++ G  D+++    A R  + +P++ +  I + GH+PH+E+P   A+ I++F+ 
Sbjct  238   QPTLILWGDFDRILGTVDAERFNKAIPHSKLIWISDCGHVPHLEQPQITAQHISEFSH  295



>ref|WP_016876396.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Chlorogloeopsis 
fritschii]
Length=295

 Score =   168 bits (425),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 159/298 (53%), Gaps = 6/298 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP F+P     + +  + +LA+ I+++ +    S   ++++ +         P +L+H F
Sbjct  2     FPSFIPTAAQRLTESTSIALAQSIEQIAITTPLSPQPVLTTYVNK--GSGTTPFLLIHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR  PLL +   E WA+D+LG+GF+D  +         + HLY  WK+ IK+P
Sbjct  60    DSSVLEYRRLLPLLAEHN-ETWAVDLLGFGFTDRPKGIKFGITDIKTHLYYFWKTLIKQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G A AIDF + +PE V KLVLI+++    G+     +   + Y     L++ 
Sbjct  119   VILVGASMGGAAAIDFTLTYPEIVKKLVLIDSAGLASGSVLSKFMFPPLDYLASQFLRNP  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKVN  487
              +R       F   SL+ +LD      LH     W  A++ F  SGGY      ++  + 
Sbjct  179   KVRKSIIRSTFKNKSLA-SLDAELCAGLHLECSNWNKAVIAFTKSGGYTAFRFKKLGDIQ  237

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             Q TL++ G RD+++    A R  R +PN+ +  I + GH+PH+E+P   A+ I + ++
Sbjct  238   QPTLILWGDRDQILGTVDAKRFKRAIPNSKLIWIQDCGHVPHLEQPQITARYILENSK  295



>ref|WP_017299876.1| hypothetical protein [Nodosilinea nodulosa]
Length=297

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/291 (33%), Positives = 156/291 (54%), Gaps = 5/291 (2%)
 Frame = -3

Query  1188  LPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSC  1009
             LP    ++ +P +  LA R++   +Q    E++I ++ +       + P++L+H FDSS 
Sbjct  6     LPTAAAKLSEPPSIDLAARVRVAMIQTSLLEAAIPTAYVAASDVASEPPLLLIHGFDSSL  65

Query  1008  LEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILV  829
             LE+RR  PLL       WA+D+LG+GFSD    P     + + HL+  W+  I RPM+LV
Sbjct  66    LEFRRLLPLLAP---RTWAVDLLGFGFSDRALYPDLSPGAIKLHLHSFWQQMIARPMVLV  122

Query  828   GPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRI  649
             G S+G A AIDFA+ +PEAV  LVL++A+ +  G      +   +     + L++  +R 
Sbjct  123   GASMGGAAAIDFALTYPEAVAGLVLLDAAGFAAGPAMGNLMVPPLDSWATAFLRNPRVRR  182

Query  648   YAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH-QIKKVNQRTLV  472
                 Q +   +L T  D      LH   P W++A++ F  SGGYN +  +I ++   TLV
Sbjct  183   SISRQAYFDKTLVTP-DAELCAALHLQCPGWKEALIAFTKSGGYNFLGPKIAQIACPTLV  241

Query  471   ITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             + G +DK++  + A R    +  + +  IP  GH+PH+E+P   A  +  F
Sbjct  242   VWGEQDKILGTKDARRFEGAIAGSQLVWIPQCGHVPHLEKPQDTAAAMLAF  292



>ref|WP_002769309.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa]
 emb|CCI03356.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa 
PCC 9443]
Length=307

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 165/299 (55%), Gaps = 11/299 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L   IQ++ +       SI+++  +   QG  +P  +LLH 
Sbjct  15    YPNFLPTVSEGLSEDTSLALLENIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFLLLHG  71

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  PLL     E WAIDILG+GF+  ER P  + + K  + HLY  W++ I
Sbjct  72    FDSSLLEFRRLLPLLAQNR-ETWAIDILGFGFT--EREPDLEVSPKTIKSHLYHFWQTAI  128

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
              +P+ILVG S+G AVA+DFA+++PE V KLVLI+++           +   +     + L
Sbjct  129   AKPLILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKWATNFL  188

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VHQIKK  493
              +  +R       +   +L+ T+D      LH   P W +A+++F  SGGY   + ++ +
Sbjct  189   ANPRVRQNISRTAYFDQTLA-TVDACTCANLHLNCPHWSEALISFTKSGGYGAFLPKLSQ  247

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             +N+ TL+I G  D+++  + A +  + LPN  +  IP  GH+PH+E+P   A  I  FA
Sbjct  248   INRETLIIWGENDQILGTKDAKKFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIVKFA  306



>ref|WP_015199657.1| alpha/beta fold family hydrolase [Calothrix parietina]
 ref|YP_007139005.1| alpha/beta fold family hydrolase [Calothrix sp. PCC 6303]
 gb|AFZ03033.1| alpha/beta hydrolase fold protein [Calothrix sp. PCC 6303]
Length=313

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/301 (31%), Positives = 167/301 (55%), Gaps = 10/301 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP    ++ +  + ++A+ IQ+  + +      I ++ I+       +  +L+H F
Sbjct  15    FPNFLPSTATKLTEESSIAIAQNIQQAKITIESISQVISTTYIEQKSGNSDKCFLLIHGF  74

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPT---CDAASKRYHLYQLWKSYI  850
             DSS LE+RR  PLL       WA+D+LG+GF++   RPT    D  + + HLY+ WK++I
Sbjct  75    DSSVLEFRRLLPLLA-INHHVWAVDLLGFGFTE---RPTGIKYDVNAIKTHLYEFWKTHI  130

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
              +P+ILVG S+G A A+DF + +PE V KL+LI+++     +  +  +   + Y     L
Sbjct  131   NQPIILVGASMGGAAALDFTLTYPEVVEKLILIDSAGLVASSPLVKFMFPPLGYFATEFL  190

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVV--HQIK  496
             ++  +R       +    L+ +LD      LH  LP W  A++ F  SGGYN     ++ 
Sbjct  191   RNPKIRQSISSAAYKNKELA-SLDAQICAALHLQLPNWSQALIAFTKSGGYNAFKGERLS  249

Query  495   KVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             ++ Q+TL++ G  D+++  +   +  + +PN+ +  IP+ GH+PH+E+P   ++ I +F+
Sbjct  250   QIKQQTLILWGDSDRILGIKDGEKFQQAIPNSKLIWIPDCGHVPHLEQPQITSQHILEFS  309

Query  315   R  313
             +
Sbjct  310   Q  310



>ref|WP_023174970.1| alpha/beta hydrolase fold protein [Gloeobacter kilaueensis]
 ref|YP_008713382.1| alpha/beta hydrolase fold protein [Gloeobacter kilaueensis JS1]
 gb|AGY59675.1| alpha/beta hydrolase fold protein [Gloeobacter kilaueensis JS1]
Length=302

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/301 (37%), Positives = 166/301 (55%), Gaps = 25/301 (8%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHCFDS  1015
             FLP    E+ +P A ++  RI+ +PV    ++ ++ ++ ++   QG+ EP ++LLH FDS
Sbjct  5     FLPAAARELGEPAALAVLERIESVPV--ALAQGTVRTTYVR---QGEGEPPLLLLHGFDS  59

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRY---HLYQLWKSYIKR  844
             S LE+RR  PLL  T    WAID+LG+GF +   RP   A + +    HL   W+  I R
Sbjct  60    SVLEFRRLLPLLARTSA-VWAIDLLGFGFGE---RPATLAYTPQTICAHLKSFWQQQIAR  115

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGE-----GTGFMTKLPKMVAYGGV  679
             P++LVG S+G A AIDFA+  PEAV  LVLI+ SV G      G      +  + A    
Sbjct  116   PVVLVGASMGGAAAIDFALAQPEAVAGLVLID-SVGGSPAPNPGRFLFPPVDALAA----  170

Query  678   SLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVV-HQ  502
               L+S  +R       +  LSL+T  D    G LH  +P W  A+V F  SGGY  +  +
Sbjct  171   EFLRSRFVRSRVSANAYADLSLATP-DAQRCGALHLTMPNWRRAIVAFTRSGGYGYLGER  229

Query  501   IKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIAD  322
             + ++   TL+I G RD+++  E A    +++P++ +  IP  GH+PH+E+    A+LI  
Sbjct  230   LAQLAAPTLIIWGERDRILGTEAAGHFQQKIPHSQLVWIPECGHVPHLEKAERTAQLIGQ  289

Query  321   F  319
             F
Sbjct  290   F  290



>ref|WP_023069724.1| alpha/beta hydrolase fold family protein [Lyngbya aestuarii]
 gb|ERT04000.1| alpha/beta hydrolase fold family protein [Lyngbya aestuarii BL 
J]
Length=296

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/307 (33%), Positives = 162/307 (53%), Gaps = 21/307 (7%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP  V ++ +  + +LA++I+  P+     +  I++S +    QG    P++LLH 
Sbjct  2     FPSFLPATVQKLTESTSINLAKQIEHQPISTPLRKQPIVTSYVH---QGQGGTPILLLHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  P L     E WA+D+LG+GF++ +        +   HLY  W+S I++
Sbjct  59    FDSSVLEFRRLLPRLAPQN-ETWAVDLLGFGFTERDVNVQISPRAIGTHLYGFWRSLIQQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AI+F +N PEAV  LVLI ++    G  F   +           L++
Sbjct  118   PVILVGTSMGGAAAINFTLNHPEAVQSLVLIGSAGMSAGPIFGKFIFPPFDSLAAEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGR-------LHCLLPWWEDAMVNFMLSGGYNVVH  505
               +R         G+S +   D T   R       LH  +P W  A+++F  SGGY    
Sbjct  178   PKVR--------QGISETAYFDKTFASRDAQICAALHLEMPLWNRALISFTKSGGYGSFR  229

Query  504   QI-KKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLI  328
             +I  K+ Q+TL++ G  D+++    A +  + + N+ +  I N GH+PH+E+P    + I
Sbjct  230   KILSKIQQQTLILWGENDRILGTADAQKFKQAIVNSQLIWIKNCGHVPHLEQPQLTTQYI  289

Query  327   ADFARGD  307
              +F + +
Sbjct  290   LNFIQSN  296



>ref|WP_002785603.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa]
 emb|CCI20333.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa 
PCC 9807]
Length=307

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 165/299 (55%), Gaps = 11/299 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L   IQ++ +       SI+++  +   QG  +P  +LLH 
Sbjct  15    YPNFLPTVREGLSEDTSLALLENIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFLLLHG  71

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  PLL     E WAID+LG+GF+  ER P  + + K  + HLY  W++ I
Sbjct  72    FDSSLLEFRRLLPLLAQNR-ETWAIDLLGFGFT--ERYPDLEVSPKTIKSHLYHFWQTAI  128

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
              +PMILVG S+G AVA+DFA+++PE V KLVLI+++           +   +     + L
Sbjct  129   AKPMILVGASMGGAVALDFALSYPEIVTKLVLIDSAGLANPPVLGKLMFSPLDKWATNFL  188

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VHQIKK  493
              +  +R       +   +L+ T+D      LH   P W +A+++F  SGGY   + ++ +
Sbjct  189   ANPRVRQNISRTAYFDQTLA-TVDACTCANLHLNCPHWSEALISFTKSGGYGAFLPKLSQ  247

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             +N+ TL+I G  D+++  + A +  + LPN  +  IP  GH+PH+E+P   A  I  FA
Sbjct  248   INRETLIIWGENDQILGTKDAKKFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIVKFA  306



>ref|WP_002782224.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa]
 emb|CCI12016.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa 
PCC 9806]
Length=295

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 165/299 (55%), Gaps = 11/299 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L + IQ++ +       SI+++  +   QG  +P  +LLH 
Sbjct  3     YPNFLPSVREGLSEDTSLALLQNIQQIAIDSPIYPCSILTTYSQ---QGQGQPPFLLLHG  59

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  PLL     E WAID+LG+GF+  ER P    + K  + HLY  W++ I
Sbjct  60    FDSSLLEFRRLLPLLAQNR-ETWAIDLLGFGFT--ERYPDLQVSPKTIKSHLYHFWQTAI  116

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
              +PMILVG S+G AVA+DFA+++PE V KLVLI+++           +   +     + L
Sbjct  117   AKPMILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKWATNFL  176

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VHQIKK  493
              +  +R       +   +L+ T+D      LH   P W +A+++F  SGGY   + ++ +
Sbjct  177   ANPRVRQNISRTAYFDQTLA-TVDACTCANLHLNCPHWSEALISFTKSGGYGAFLPKLSQ  235

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             +N+ TL+I G  D+++  + A +  + LPN  +  IP  GH+PH+E+P   A  I  FA
Sbjct  236   INRETLIIWGENDQILGTKDAKKFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIVKFA  294



>ref|WP_008235829.1| Possible alpha/beta hydrolase superfamily,sll1129 homolog [Richelia 
intracellularis]
 emb|CCH68304.1| Possible alpha/beta hydrolase superfamily,sll1129 homolog [Richelia 
intracellularis HH01]
Length=295

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 163/303 (54%), Gaps = 18/303 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQR--LPVQVGFSESSIMSSCIKPVIQGD-KEPVVLL  1030
             FP FLP+    IKDP   SL + +QR  +P+    S+  I ++ I    QG  K P++LL
Sbjct  2     FPPFLPQTAANIKDPATISLLQDLQRTVIPMHSYSSQQDIATTYIH---QGSGKIPILLL  58

Query  1029  HCFDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYI  850
             H FDSS LE+R   PLL     E WA+D+LG+GF+         A + + HLY  W++ I
Sbjct  59    HGFDSSVLEFRHLLPLLAKNQ-EVWAVDLLGFGFTQRVLGMKLSAVAIKTHLYYFWQNLI  117

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINAS----VYGEGTGFMTKLPKMVAYGG  682
              +PMILVG S+G A AIDFA+ +P+ V KLVL++++     +  G    + L    A   
Sbjct  118   NQPMILVGASMGGATAIDFALTYPDVVKKLVLVDSAGLTGSFPLGKFMFSPLDNWAA---  174

Query  681   VSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVV--  508
               LL++  +R       +   S ++  D      LH  +P W  A++NF  SGGY     
Sbjct  175   -QLLRNPKVRQNISRTAYYDKSFASE-DALLCSTLHLDMPGWSQALINFTKSGGYKAFKP  232

Query  507   HQIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLI  328
              Q+ K++Q TL++ G  DK++  + A +L   +P + +  + N GH+PH+E+P   A  I
Sbjct  233   KQLGKISQPTLILWGDNDKILGIKDAPKLQSAVPISQLLWMKNCGHVPHLEQPQITASRI  292

Query  327   ADF  319
               F
Sbjct  293   LSF  295



>ref|WP_035986471.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Leptolyngbya sp. 
KIOST-1]
Length=298

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 155/292 (53%), Gaps = 6/292 (2%)
 Frame = -3

Query  1188  LPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPV-IQGDKEPVVLLHCFDSS  1012
             LP     + DP +  LA R+Q  P+     E +I ++ +     Q  + P++L+H FDSS
Sbjct  6     LPAAATGLSDPTSIQLAARVQVAPIATPLGEVAIPTAHVPAENDQASQPPMLLIHGFDSS  65

Query  1011  CLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMIL  832
               E+RR  PLL       WA+D+LG+GFSD    P     + + HL+  W+  I RP++L
Sbjct  66    LFEFRRLLPLLT---TPTWAVDLLGFGFSDRALCPKLSPGAIKLHLHSFWQQLIDRPVVL  122

Query  831   VGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLR  652
             VG S+G A AIDFA+ +PEAV  LVLI+A+ +  G      +   +     + L++  +R
Sbjct  123   VGASMGGAAAIDFALTYPEAVAGLVLIDAAGFAAGPAMGNLMVPPLDSWATAFLRNPRVR  182

Query  651   IYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH-QIKKVNQRTL  475
                  Q +   +L T  D      LH   P W++A++ F  SGGYN +  +I +++  TL
Sbjct  183   RSISRQAYFDKTLVTP-DAELCAALHLDCPRWKEALIAFTKSGGYNFLSAKIDQISCPTL  241

Query  474   VITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             ++ G +DK++  + A R    +  + +  IP  GH+PH+E P + A  +  F
Sbjct  242   IVWGEQDKILGTKDAHRFEAAIAASKLVWIPQCGHVPHLENPQATAAALLPF  293



>ref|WP_009782335.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Lyngbya sp. PCC 
8106]
 gb|EAW38880.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Lyngbya sp. PCC 
8106]
Length=296

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 163/306 (53%), Gaps = 19/306 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP  V ++ +  + +LA++I+  P+     +  I++S I    +G   P++LLH F
Sbjct  2     FPSFLPAPVQKLTESTSINLAQKIEYQPISTPLRKKPILTSYIHQGSEGT--PILLLHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR  P L     E WA+D+LG+GF++ +        +   HLY  W+S I++P
Sbjct  60    DSSVLEFRRLLPRLAPQN-ETWAVDLLGFGFTERDVNIQISPRTISTHLYCFWQSLIQQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G A A+DF +N PEAV  LVLI ++    G      L   +       L++ 
Sbjct  119   VILVGTSMGGAAALDFTLNHPEAVKSLVLIGSAGMSPGPILGKFLFPPLDTLATGFLRNP  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGR-------LHCLLPWWEDAMVNFMLSGGYNVVHQ  502
              +R         G+S +   D T   R       LH  +P W  A+++F  +GGY    +
Sbjct  179   KIR--------QGISETAYFDKTFASRDAQICAALHLEMPLWNRALISFTKNGGYGSFRK  230

Query  501   -IKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIA  325
              + K+ Q+TL++ G  D+++    A +  + + N+ +  I N GH+PH+E+P   A+ I 
Sbjct  231   MLHKIQQQTLILWGENDRILGTADAQKFQQAIVNSQLIWIKNCGHVPHLEQPQLTAQYIL  290

Query  324   DFARGD  307
             +F + +
Sbjct  291   NFLQSN  296



>ref|WP_023075561.1| alpha beta hydrolase fold protein [Leptolyngbya sp. Heron Island 
J]
 gb|ESA33593.1| alpha beta hydrolase fold protein [Leptolyngbya sp. Heron Island 
J]
Length=293

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 167/296 (56%), Gaps = 10/296 (3%)
 Frame = -3

Query  1188  LPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSC  1009
             LP +V  + +  + +LAR IQ  P+    ++  I +S +     G  +P++L+H FDSS 
Sbjct  5     LPADVQHLTEDTSVALARHIQFAPISTPLTQMPIATSYVS---VGVGKPILLIHGFDSSI  61

Query  1008  LEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILV  829
              E+RR  P L  +  + WA+D+LG+GF+D         A+ + HLY  W+  I +PMIL 
Sbjct  62    FEFRRLVPQLS-SQAQVWAVDMLGFGFTDRTTAAPITPAAIKQHLYSFWQQQIGQPMILA  120

Query  828   GPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKL--PKMVAYGGVSLLKSIPL  655
             G S+G A AIDF ++FPEAV KLVL++ + +  G   M KL  P + ++   S LK+  +
Sbjct  121   GASMGGAAAIDFTLDFPEAVEKLVLLDGAGFAAGPA-MGKLMVPPLDSW-ATSFLKNPGV  178

Query  654   RIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVV-HQIKKVNQRT  478
             R     Q +   +L T  D      LH  +P W++A++ F  SGGYN + + I+K+   T
Sbjct  179   RRRISQQAYCDRTLVTP-DAELCAALHLQMPRWKEALIAFTKSGGYNFLGNYIQKIEPPT  237

Query  477   LVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARG  310
             L++ G +DK++  + A R  + +P   +  I N GH+PH+E+P + A+ I  F  G
Sbjct  238   LIVWGEQDKILGTKDAQRFQQTIPKNQLVWIENCGHVPHLEKPRNTAQAIMSFFVG  293



>ref|WP_015083686.1| alpha/beta hydrolase [Anabaena sp. 90]
 ref|YP_007001191.1| alpha/beta hydrolase [Anabaena sp. 90]
 gb|AFW97134.1| alpha/beta hydrolase [Anabaena sp. 90]
Length=293

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 160/296 (54%), Gaps = 6/296 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP  V ++ +P + +LA+ IQ   +    +   I ++ ++    G   P++L+H F
Sbjct  2     FPSFLPAAVGQLTEPTSIALAQNIQSQAIITHAANEPINTTYVQQGYGG--TPILLIHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+RR  PLL +     WA+D+LG+GF+D        + + + HLY  W++ I +P
Sbjct  60    DSSVLEYRRLLPLLAEKNA-VWAVDLLGFGFTDRLPGIAYSSVTIKNHLYSFWQTLINQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G A AIDF + +PEAV +LVLI+++     +     +   + Y     L++ 
Sbjct  119   VILVGASMGGAAAIDFTLTYPEAVKQLVLIDSAGLKGNSPLSKYIFSPLDYWATEFLRNP  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKVN  487
              +R       +   +L +  D    G LH  +P W  A++ F  SGGY      Q+ K+ 
Sbjct  179   KVRKSICRTAYKNPNLISE-DALCCGELHLQMPNWTQALIAFTKSGGYGAFKFPQLAKIA  237

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             Q TL++ G  DK++    A +  + +P + +  I + GH+PH+E+   VA+ I +F
Sbjct  238   QPTLILWGDSDKILGTGDAPKFAKAIPQSQLIWIKDCGHIPHLEQSQIVAEHILEF  293



>ref|WP_026719732.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Fischerella sp. 
PCC 9431]
Length=302

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 158/290 (54%), Gaps = 6/290 (2%)
 Frame = -3

Query  1176  VHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWR  997
             + E+ +  + +LA  I+++ +    S   I+++ ++    G   P++L+H FDSS LE+R
Sbjct  15    IRELTESTSITLAESIKQIAIATPLSSQPILTTYVQSGTGGT--PLLLIHGFDSSVLEYR  72

Query  996   RTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMILVGPSL  817
             R  PLL +   + WA+D+LG+GF+D         A  + HLY  WK+ I +P+ILVG S+
Sbjct  73    RLLPLLAEKH-QTWAVDLLGFGFTDRPAGIKFSTAEIKTHLYHFWKTLIDQPIILVGASM  131

Query  816   GAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIYAKL  637
             G A AIDF + +PE V KLVLI+++    G+     +   + Y     L+   +R     
Sbjct  132   GGAAAIDFTLTYPEIVKKLVLIDSAGLIGGSPLAKYMFPPLDYLAAQFLRHPKVRQSISR  191

Query  636   QCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKVNQRTLVITG  463
               +   SL+ T+D      LH   P W+ A++ F  SGGY      ++ ++   TL++ G
Sbjct  192   AAYKNKSLA-TIDAQLCATLHLECPNWQQALIAFTKSGGYTAFRFKKLGEIQPPTLILWG  250

Query  462   MRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
               D+++  + A R  R +PN+ +  I + GH+PH+E+P   A+ I +F+ 
Sbjct  251   DSDRILGTKDAQRFNRAIPNSKLIWIQDCGHIPHLEQPQVTAQHILEFSN  300



>ref|WP_036031001.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Leptolyngbya sp. 
PCC 6406]
Length=293

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/293 (31%), Positives = 163/293 (56%), Gaps = 7/293 (2%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGD-KEPVVLLHCFDS  1015
             +LP E   + + F+++L  ++QR+ V    + + I ++ ++   QG    P++L+H FDS
Sbjct  4     WLPPEAAALTESFSQTLDTQVQRVAVPTPLAAAPIPTTYVR---QGTGTPPILLIHGFDS  60

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMI  835
             S +E+RR  P L     E WA+D+LG+GF+D    PT   A+ + HL++ W+  I++PM+
Sbjct  61    SLVEFRRLLPALT-AHRETWAVDLLGFGFTDRTVTPTVSPATIKQHLHRFWRQQIQQPMV  119

Query  834   LVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPL  655
             LVG S+G A A+DFA+ +P+AV +LVL++++ +         +   +     + L++  +
Sbjct  120   LVGASMGGAAALDFALTYPQAVAQLVLLDSAGFAAAPAMGRLMVPPLDRWATAFLRNPGV  179

Query  654   RIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH-QIKKVNQRT  478
             R       +   +L  T D      LH   P W +A++ F  SGGYN +  +I  +N  T
Sbjct  180   RRRISQNAYCDRTL-VTADADLCAALHLTCPRWSEALITFTKSGGYNFLRDKIPLLNLPT  238

Query  477   LVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             L++ G +D+++  + A+R    +P + +  I   GH+PH+E+P   A  I  F
Sbjct  239   LIVWGRQDRILGIKDAIRFATAIPQSKLAWIDACGHVPHLEKPAETAAAILTF  291



>ref|WP_024544649.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Synechococcus sp. 
NKBG15041c]
Length=301

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 166/300 (55%), Gaps = 11/300 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP  V ++ +  A  LA+ +QR+ +        I+++ +    QG  +P ++L+H 
Sbjct  2     YPSFLPPLVQQLTESEAIHLAQSMQRVAIATPLQADPILTNFVH---QGGGKPDILLIHG  58

Query  1023  FDSSCLEWRRTYP-LLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIK  847
             FDSS LE+R   P L +D  V  WA+D+L +GF++          + + HLY  W+  I 
Sbjct  59    FDSSVLEYRYLIPELAKDHTV--WAVDLLSFGFTERPENLAFTPETLKTHLYHFWQQQIN  116

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLIN-ASVYGEGTGFMTKLPKMVAYGGVSLL  670
             RP+++VG S+G AVA+DFA+++P+ V ++VL++ A +  +       +P +  +    L 
Sbjct  117   RPVVVVGASMGGAVALDFALSYPDVVKQIVLLDSAGLAPKPFSRFAMVPPLDRWATQFLG  176

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH-QIKK  493
                  R   +   FD      T D    G +H     W++A++NF   GGY   + ++K+
Sbjct  177   SMNVRRKICQSAYFD--KARVTEDAVLCGAMHLQCDRWQEALINFTKGGGYGSFYPKLKQ  234

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             + QRTL++ G +D+++  + A R  R LPN+ +H IPN GHLPHVE+   V++ I  F R
Sbjct  235   IQQRTLILWGEQDRILGTKAAHRFQRGLPNSSLHWIPNCGHLPHVEQTALVSEKILAFCR  294



>ref|WP_002758663.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa]
 emb|CCH96494.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa 
PCC 9717]
Length=295

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/297 (34%), Positives = 161/297 (54%), Gaps = 7/297 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L   IQ++ +       SI+++  +   QG  +P  VLLH 
Sbjct  3     YPNFLPTVSEGLSEDTSLALLENIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFVLLHG  59

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL     E WAID+LG+GF++ E        + + HLY  W++ I  
Sbjct  60    FDSSLLEFRRLLPLLAQNR-ETWAIDLLGFGFTEREPDLEVSPETIKSHLYHFWRTAIAE  118

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G AVA+DFA+++PE V KLVLI+++           +   +     + L +
Sbjct  119   PIILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKWATNFLAN  178

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VHQIKKVN  487
               +R       +   +L+ ++D      LH   P W +A+++F  SGGY   + ++ ++N
Sbjct  179   PRVRQNISRTAYFDQTLA-SVDACTCASLHLNCPHWSEALISFTKSGGYGAFLPKLSQIN  237

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             + TL+I G  D+++  E A +  + LPN  +  IP  GH+PH+E+P   A  I  FA
Sbjct  238   RETLIIWGENDRILGTEDAKKFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIVKFA  294



>ref|WP_006275693.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Cylindrospermopsis 
raciborskii]
 gb|EFA71454.1| Alpha/beta hydrolase fold protein [Cylindrospermopsis raciborskii 
CS-505]
Length=296

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 163/296 (55%), Gaps = 8/296 (3%)
 Frame = -3

Query  1194  LFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGD-KEPVVLLHCFD  1018
             +FLP  + ++ +P + +LA+ IQ   +    S   I +S    VIQG    P++L+H FD
Sbjct  2     IFLPSAIEQLSEPTSVALAQSIQIEEMITPLSPQPIRTSY---VIQGSGNTPILLIHGFD  58

Query  1017  SSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPM  838
             SS LE+RR  PLL  T    WA+D+LG+GF++ +R      A+ + HLY  WK+ I +P+
Sbjct  59    SSVLEFRRLLPLLAPTH-PTWAVDLLGFGFTERQRDIGYSPAAIKTHLYHFWKTLIGQPV  117

Query  837   ILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIP  658
             IL+G S+G A AIDFA+ +PE V KL+LI+++    G+     +   +       L++  
Sbjct  118   ILLGASMGGAAAIDFALTYPELVQKLILIDSAGLKGGSALSKLMFPQLYSLAAEFLRNSQ  177

Query  657   LRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV--VHQIKKVNQ  484
             +R       +   +L    D      LH  +  W+++++ F  SGGY    + ++ K+ Q
Sbjct  178   VRDRICRSAYKNPNLIND-DTLCCRDLHIEMANWKESLITFTQSGGYQAFKLEELGKIGQ  236

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
              TL++ G  D+++  +   +  + +P + +  IP+ GH+PHVE+P   A+ I DF 
Sbjct  237   PTLILWGDSDRILGTKDGDKFRQAIPQSQLIWIPDCGHIPHVEKPEITAQHILDFT  292



>ref|WP_015229468.1| alpha/beta hydrolase [Dactylococcopsis salina]
 ref|YP_007171828.1| alpha/beta hydrolase [Dactylococcopsis salina PCC 8305]
 gb|AFZ50471.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Dactylococcopsis salina PCC 8305]
Length=298

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 161/293 (55%), Gaps = 7/293 (2%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHCFDS  1015
             F+P    ++ +  +  L R+IQ+ P++   S + + ++ ++    G+ E P++LLH FDS
Sbjct  9     FIPPLAEKLTEETSTDLIRKIQQTPLETSLSSTPVKTTYVQ---GGEGELPILLLHGFDS  65

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMI  835
             S +E+RR +P L     E  A+D LG+G +D          + + HLY  W+ +I+RPM+
Sbjct  66    SLMEFRRLFPKLSSV-TETIALDFLGFGLTDRVPEIAITPDTIKTHLYAFWQQFIQRPMV  124

Query  834   LVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPL  655
             L+G S+G AVAIDF + +PE V KLVL++++ +  G      +   +       L +  +
Sbjct  125   LLGASMGGAVAIDFTLTYPETVAKLVLLDSAGFAGGPAMGKLMIPPLDRLAAGFLSNTKV  184

Query  654   RIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVHQ-IKKVNQRT  478
             R       +   + ++  D      LH   P W  A+++F  SGGYN + Q IK++ Q +
Sbjct  185   RQKISENAYYDRTFASE-DALICSMLHLTHPNWSKALISFTKSGGYNFLSQRIKEITQPS  243

Query  477   LVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             L++ G +DK++  + A R    + ++ +  IP SGH+PH+E+P+   + I +F
Sbjct  244   LILWGEQDKILGTKDAQRFKDTIADSQLVWIPESGHVPHLEKPNLTREAIENF  296



>ref|WP_009455245.1| MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Fischerella]
 gb|EHC17903.1| alpha/beta hydrolase fold protein [Fischerella sp. JSC-11]
Length=302

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 163/295 (55%), Gaps = 12/295 (4%)
 Frame = -3

Query  1176  VHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWR  997
             + ++ +  + +LA+ I+++ +    S   I+++ ++    G   P++L+H FDSS LE+R
Sbjct  15    IRQLTESTSVTLAQSIKQIAIATPLSTQPIVTTYVQKGNSGT--PLLLIHGFDSSVLEYR  72

Query  996   RTYPLLEDTGVEAWAIDILGWGFSDLERRPT---CDAASKRYHLYQLWKSYIKRPMILVG  826
             R  PL+ +   + WAID+LG+GF++   RPT      A  + HLY  WK+ I +PMILVG
Sbjct  73    RLLPLVAEKH-QTWAIDLLGFGFTN---RPTGIRFSTAEIKTHLYHFWKTLINQPMILVG  128

Query  825   PSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIY  646
              S+G A AIDF + +PE V KLVLI+++     +     +     Y     L++  +R  
Sbjct  129   ASMGGAAAIDFTLTYPEIVKKLVLIDSAGLIGSSPLAKYMFPPFDYLAAQFLRNPRVRQS  188

Query  645   AKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKVNQRTLV  472
                  +   SL+ T+D      LH   P W+ A++ F  SGGY      ++ ++ Q TL+
Sbjct  189   ISRAAYKNKSLA-TIDAQLCAALHLECPNWQQALIAFTKSGGYTAFRFKKLGEIQQPTLI  247

Query  471   ITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             + G  D+++  + A R  R +PN+ +  I + GH+PH+E+P   A+ I +F+  D
Sbjct  248   LWGDSDRILGTKDAKRFNRAIPNSQLIWIQDCGHIPHLEQPQITAQHILEFSEKD  302



>ref|WP_015160153.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Chamaesiphon minutus]
 ref|YP_007097537.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Chamaesiphon minutus PCC 6605]
 gb|AFY94010.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Chamaesiphon minutus PCC 6605]
Length=294

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/299 (34%), Positives = 159/299 (53%), Gaps = 9/299 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP  V  +  P +   A +IQR  +        I +S  +  + G   P+V LH F
Sbjct  2     FPSFLPSSVARLTQPESIEFASQIQRTGIITSLLLEQIATSYTRQGVGGI--PIVFLHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTC--DAASKRYHLYQLWKSYIK  847
             DSS LE+RR  P++     E WAID+LG+GF+  ER P C   + S R HL   W+  I+
Sbjct  60    DSSILEFRRIIPIIA-AHREVWAIDLLGFGFT--ERLPDCPFSSTSIRTHLEAFWQVKIQ  116

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLK  667
             +P+ILVG S+G A AI+F +N P AV +L+LI+++ + +       L + +     + L 
Sbjct  117   QPIILVGVSMGGAAAIEFTLNHPTAVDRLILIDSAGFTQPPAMGKFLIQPLGNLATNFLS  176

Query  666   SIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYN-VVHQIKKV  490
             S  +R     + +   S  T  D      LH  +P W +A++ F  SGGY  ++ ++  +
Sbjct  177   SPKVRRSVSEKAYFDRSFVTE-DAQLCAALHLEMPNWSEALIAFTRSGGYGYLLDRLSAI  235

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
              Q TL++ G +D+++  + A    + LPN+ +  I N GH+PH+E     A+ I DF +
Sbjct  236   EQETLILWGKQDRILGIKAAELFKKRLPNSQLKWIDNCGHVPHLEMAQITAEYILDFIK  294



>ref|WP_015144885.1| alpha/beta hydrolase [Pleurocapsa minor]
 ref|YP_007082143.1| alpha/beta hydrolase [Pleurocapsa sp. PCC 7327]
 gb|AFY78586.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Pleurocapsa sp. PCC 7327]
Length=296

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 160/296 (54%), Gaps = 7/296 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHC  1024
             FP F+P E   + +  + +L R+I+   +    S  SI  +  +   QG  E P +LLH 
Sbjct  2     FPSFIPSEAENLTESTSIALIRQIESHALSTPLSPQSITMTYTR---QGRGETPFLLLHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL     E WA+D+LG+GF+      +  +A  + HLY  WK+ I++
Sbjct  59    FDSSLLEFRRLMPLLVQ-ARETWAVDLLGFGFTQRLPGLSFSSAEIKAHLYYFWKTLIQQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +PEAV KL+L++++           +   + Y     L++
Sbjct  118   PVILVGASMGGATAIDFTLAYPEAVKKLILLDSAGLSNSPMAGKLMFPPLDYWATEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKKVN  487
               +R       +   S ++  D      LH   P W +A++ F  SGGY N   Q+ ++ 
Sbjct  178   PRVRQNISRAAYYDKSFASR-DAQLCAALHLNCPGWREALIAFTKSGGYGNFSTQLSQIQ  236

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             Q +L++ G  D+++  + AM+  + LP++ +  I N GH+PH+E+P   A  I +F
Sbjct  237   QSSLILWGKCDRILGTKAAMQFEQLLPDSQLVWIENCGHVPHLEQPQITADRILEF  292



>ref|WP_006197036.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Nodularia spumigena]
 gb|EAW44793.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Nodularia spumigena 
CCY9414]
 gb|AHJ31315.1| putative alpha/beta hydrolase superfamily, sll1129-like protein 
[Nodularia spumigena CCY9414]
Length=295

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/300 (35%), Positives = 166/300 (55%), Gaps = 14/300 (5%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP FLP  V ++ +  + +LA  IQ   +        I ++ ++   QG    P++L+H 
Sbjct  2     FPSFLPTSVGQLTESTSIALAENIQSQAIATPLISQPITTTYVQ---QGSGGTPILLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSD-LERRPTCDAASKRYHLYQLWKSYIK  847
             FDSS LE+RR  PLL     + WA+D+LG+GF+D +E  P    A K  HLY  WK+ I 
Sbjct  59    FDSSVLEFRRLLPLLARDN-QTWAVDLLGFGFTDRIEGLPFSPIAIKT-HLYHFWKTLIN  116

Query  846   RPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKL--PKMVAYGGVSL  673
             +P+ILVG S+G A AIDF   +PE V KLVLI+++    G+  ++KL  P + A+   + 
Sbjct  117   QPVILVGASMGGAAAIDFTFTYPEVVEKLVLIDSAGLKGGSP-LSKLMFPPLDAFAA-NF  174

Query  672   LKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV--VHQI  499
             L++  +R       +    L  ++D    G LH  +P W  A++ F  SGGY+     Q+
Sbjct  175   LRNPKIRDRISRTAYKN-QLLASIDAQLCGALHLEMPNWTQALIAFTKSGGYSAFKAKQL  233

Query  498   KKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
              ++ Q TL++ G  DK++      +  + +P++ +  I +SGH+PH+E+P   A+ I  F
Sbjct  234   SEIVQPTLILWGDTDKILGTVDGKKFQQAIPHSKLIWIEDSGHVPHLEQPEVTAQHILAF  293



>ref|WP_002779013.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa]
 emb|CCI09039.1| Genome sequencing data, contig C328 [Microcystis aeruginosa PCC 
7941]
Length=307

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 165/304 (54%), Gaps = 19/304 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L   IQ++ +       SI+++  +   QG  +P  VLLH 
Sbjct  15    YPNFLPTVREGLSEDTSLALLENIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFVLLHG  71

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  PLL     E WAID+LG+GF+  ER P  + + K  + HLY  W++ I
Sbjct  72    FDSSLLEFRRLLPLLAQNR-ETWAIDLLGFGFT--ERYPDLEVSPKTIKSHLYHFWQTAI  128

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGE----GTGFMTKLPKMVAYGG  682
              +PMILVG S+G AVA+DFA+++PE V KLVLI+++        G    + L K      
Sbjct  129   AKPMILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKW----A  184

Query  681   VSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VH  505
              + L +  +R       +   +L+ T+D      LH   P W  A+++F  SGGY   + 
Sbjct  185   TNFLANPRVRQNISRTAYFDATLA-TVDACTCANLHLNCPHWSAALISFTKSGGYGAFLP  243

Query  504   QIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIA  325
             ++ ++N+ TL+I G  D+++  + A    + LPN  +  IP  GH+PH+E+P   A  I 
Sbjct  244   KLSQINRETLIIWGENDQILGTKDAKIFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIV  303

Query  324   DFAR  313
              FA 
Sbjct  304   KFAN  307



>ref|WP_036484443.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Myxosarcina sp. 
GI1]
Length=293

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 159/296 (54%), Gaps = 7/296 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
              P F+    +++ +  + +L ++I+   +    S  SI ++ +K   QG  EP ++LLH 
Sbjct  2     LPSFISPAANKLTEATSIALTKQIESAAIATPLSSESIPTTYVK---QGSGEPPILLLHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL ++    W +D+LG+GFSD       +  + + HLY  WK+ I++
Sbjct  59    FDSSLLEFRRLIPLLAESKA-TWGVDLLGFGFSDRNPDIALNPETIKVHLYYFWKTLIQQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P++LVG S+G A AIDF + +PEAV KLVL++++   +       +   + Y     L+ 
Sbjct  118   PVVLVGASMGGAAAIDFTLTYPEAVAKLVLLDSAGLAKQPAIGKFMFPPLDYLATEFLRQ  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKKVN  487
               +R       +   SL+   D      LH     W  A++ F  SGGY +    I ++ 
Sbjct  178   PKVRQNISRAAYYDKSLANA-DAQLCAALHLQCQNWNKALIAFTKSGGYGSFTRAIAQIQ  236

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             Q TL++ G +DK++  + A +  R +PN+ +  I   GH+PH+E+P +VA  I  F
Sbjct  237   QPTLILWGRQDKILGTKDAAKFDRAIPNSKLVWIERCGHVPHLEKPQTVATEILQF  292



>ref|WP_009341995.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Raphidiopsis brookii]
 gb|EFA73897.1| Alpha/beta hydrolase fold protein [Raphidiopsis brookii D9]
Length=346

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/295 (34%), Positives = 161/295 (55%), Gaps = 8/295 (3%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGD-KEPVVLLHCFDS  1015
             FLP  V ++ +P + +LA+ IQ   +    S   I +S    V+QG    P++L+H FDS
Sbjct  53    FLPSAVEQLSEPTSVALAQSIQIEEMITPLSPQPIRTSY---VLQGSGNTPILLIHGFDS  109

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMI  835
             S LE+RR  PLL  T    WA+D+LG+GF++ +R      A+ + HLY  WK+ I +P+I
Sbjct  110   SVLEFRRLLPLLALTH-PTWAVDLLGFGFTERQRDIGYSPAAIKTHLYHFWKTLIGQPVI  168

Query  834   LVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPL  655
             L+G S+G A AIDFA+ +PE V KL+LI+++    G+     +   +       L++  +
Sbjct  169   LLGASMGGAAAIDFALTYPELVQKLILIDSAGLKGGSALSKLMFPQLYSLAAEFLRNSQV  228

Query  654   RIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV--VHQIKKVNQR  481
             R       +   SL    D      LH  +  W+++++ F  SGGY    + Q+ K+ Q 
Sbjct  229   RDRICRSAYKNPSLIND-DTLCCRDLHIEMANWKESLITFTQSGGYQAFKLQQLGKIGQP  287

Query  480   TLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             TL++ G  D+++  +   +  + +P + +  IP+ GH+PHVE+P   A  I DF 
Sbjct  288   TLILWGDSDRILGTKDGEKFRQAIPQSQLIWIPDCGHIPHVEKPEITAHHILDFT  342



>ref|WP_039729299.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Lyngbya confervoides]
 gb|KIF16585.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Aphanocapsa montana 
BDHKU210001]
 gb|KIF41597.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Lyngbya confervoides 
BDU141951]
Length=291

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/292 (33%), Positives = 159/292 (54%), Gaps = 7/292 (2%)
 Frame = -3

Query  1188  LPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHCFDSS  1012
             +P +  ++ +P + ++A+++Q++ V    +E S +      V QG  +P V+LLH FDSS
Sbjct  1     MPADAAQLTEPTSIAIAQQMQQVEVA---TELSYLPVPTTYVCQGTGQPPVLLLHGFDSS  57

Query  1011  CLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMIL  832
               E+RR  P +  T  + WA+D+LG+GF+D     T   A+ + HL+  W+  I++PM+L
Sbjct  58    LFEFRRLLPHVA-TFRQTWAVDLLGFGFTDRTVTTTFSPAAIKQHLHAFWQQLIQQPMVL  116

Query  831   VGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLR  652
             VG S+G A AIDFA+ +P+AV +LVL++++    G      +   +     + LK+  +R
Sbjct  117   VGASMGGAAAIDFALTYPDAVSQLVLLDSAGLAAGPAMGRLMFPPLDRWATAFLKNPGVR  176

Query  651   IYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH-QIKKVNQRTL  475
                  Q +   S   T D      LH   P W +A++ F  SGGYN +  +I  +   TL
Sbjct  177   RRISQQAYADKSW-VTADAELCAALHLACPHWSEALIAFTKSGGYNFLSDRIADITSETL  235

Query  474   VITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             ++ G +DK++    A R    LP A +  I   GH+PH+E+  + A+ I  F
Sbjct  236   IVWGRQDKILGIRDATRFTELLPQATLSWIDQCGHVPHLEQAATTAQTIQQF  287



>ref|WP_015205233.1| alpha/beta fold family hydrolase [Crinalium epipsammum]
 ref|YP_007144649.1| alpha/beta fold family hydrolase [Crinalium epipsammum PCC 9333]
 gb|AFZ15139.1| alpha/beta hydrolase fold protein [Crinalium epipsammum PCC 9333]
Length=292

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/300 (35%), Positives = 168/300 (56%), Gaps = 19/300 (6%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGD-KEPVVLLHCFDS  1015
             FLPK+V ++++  A +LA   +R  +     +  I+++ +K   QGD  +P++LLH FDS
Sbjct  5     FLPKQVADLREEAAIALAYSTKRDAIATPLHQQPILTAFVK---QGDVGKPILLLHGFDS  61

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMI  835
             S LE+ R +PLL  T  + WAID+LG+GF+D       + A+ + HLY  WK+ I +P+I
Sbjct  62    SLLEFCRLFPLLA-THHQTWAIDLLGFGFTDRMAGLNFNPAAIKTHLYSCWKTLINQPVI  120

Query  834   LVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPL  655
             LVG S+G A AIDFA ++P+AV KL+LIN+  Y         L   + +  V   +    
Sbjct  121   LVGTSMGGAAAIDFAQSYPQAVEKLILINSMGYLSALSLGQLLFPPLDFWAVEYWRQ---  177

Query  654   RIYAKLQCFDGLSLSTTLDWTNVGRLHCL-----LPWWEDAMVNFMLSGGYNVV-HQIKK  493
                 KLQ  + L++ +  D   +  L C+     +P W +AM+ F  SGGY  +  +I  
Sbjct  178   ---RKLQALN-LAILSGWDARQIDALRCVNLHIDMPSWSEAMIAFTKSGGYGCLGDKISL  233

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             ++Q+TL++ G  D +   E A +  R++ ++ +  + N GH P +E+P   A+ I  F R
Sbjct  234   IHQQTLILWGELDDM-GTEDAYKFRRDISDSKLVWVRNCGHSPQLEQPEFTAEQILAFGR  292



>ref|WP_030007549.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase, partial [Synechococcus 
sp. NKBG042902]
Length=292

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/301 (32%), Positives = 173/301 (57%), Gaps = 17/301 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             +P FLP  V+++ +  A  LA+++Q++ +      + I++S ++    GD++ ++L+H F
Sbjct  2     YPSFLPPLVNQLTELDAIRLAQQLQQVAIATPLQTNPILTSFVQQG-SGDQD-ILLIHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS LE+R   P L       WA+D+L +GF++   +      + + HLYQ W+  I RP
Sbjct  60    DSSVLEYRYLLPKLAQQH-PVWAVDLLSFGFTERPEQLPFTPETIKTHLYQFWQQQINRP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLIN-ASVYGEGTGFMTKLPKMVAY-----GGV  679
             +++VG S+G AVA+DFA+++P+AV ++VL++ A +  +       +P +  +     G +
Sbjct  119   VVIVGASMGGAVALDFALSYPDAVKQIVLLDSAGLAPKPLSRFAMVPPLDRWATQFLGSM  178

Query  678   SLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH-Q  502
             ++ + I    Y     FD   ++T  D    G +H     W++A++ F   GGY   + +
Sbjct  179   NIRRKICQNAY-----FDKTKVTT--DAVLCGAMHVQCDRWQEALIQFTKGGGYGSFYPK  231

Query  501   IKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIAD  322
             +K++ Q TL++ G +D+++  + A R  + LPN+ +H IPN GHLPHVE+   VA+ I  
Sbjct  232   LKQIQQPTLILWGEQDRILGTKAAHRFQQGLPNSTLHWIPNCGHLPHVEQTTLVAEHILR  291

Query  321   F  319
             F
Sbjct  292   F  292



>ref|WP_019507262.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=294

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/296 (31%), Positives = 161/296 (54%), Gaps = 7/296 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDK-EPVVLLHC  1024
             FP  +P E   + +  + +LA++I+   +    +E  I ++ +    QG+   P+ L+H 
Sbjct  2     FPSCIPPEASNLTESTSIALAQKIKLEFISTTLTEDGIATTYVN---QGNGGTPIFLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FDSS LE+RR  PLL +     WA+D+LG+GF+        +  + + HLY  WK+ IK+
Sbjct  59    FDSSLLEFRRLLPLLAEKQ-STWAVDLLGFGFTQRNLDIPLNPENIKTHLYYFWKTLIKQ  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+IL G S+G A AIDFA+ +PEAV KLVLI+++   +       +   + Y     L++
Sbjct  118   PVILTGASMGGATAIDFALTYPEAVEKLVLIDSAGLAKPPAIGKFMFPPLDYFATEFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKKVN  487
               +R       +   S + ++D  +   +H   P W+ +++ F  SGGY +   QI  + 
Sbjct  178   PKVRQNISRSAYFDKSFA-SIDAQDCAAMHLKCPNWDKSLIAFTKSGGYGSFAKQISTLQ  236

Query  486   QRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             Q TL++ G +DK++  + A +  + +P+  +  I N GH+PH+E+  + A  I +F
Sbjct  237   QPTLILWGKQDKILGTKDAAKFAQGIPDNKLVWIENCGHVPHLEKSQATANEIINF  292



>ref|WP_012268327.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa]
 ref|YP_001661228.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa 
NIES-843]
 dbj|BAG06036.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa 
NIES-843]
Length=295

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/299 (34%), Positives = 165/299 (55%), Gaps = 11/299 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L   IQ++ +       SI+++  +   QG  +P  VLLH 
Sbjct  3     YPNFLPTVREGLSEDTSLALLENIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFVLLHG  59

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  PLL     E WAID+LG+GF+  ER P  + + K  + HLY  W++ I
Sbjct  60    FDSSLLEFRRLLPLLAQNR-ETWAIDLLGFGFT--ERYPDLEVSPKTIKSHLYHFWRTAI  116

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
               P+ILVG S+G AVA+DFA+++PE V KLVLI+++           +   +     + L
Sbjct  117   AEPIILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKWATNFL  176

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGY-NVVHQIKK  493
              +  +R       +   +L+ ++D      LH   P W +A+++F  SGGY + + Q+ +
Sbjct  177   ANPRVRQNISRTAYFDPTLA-SVDACTCASLHLNCPHWSEALISFTKSGGYGSFLPQLSQ  235

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
             +++ TL+I G  D+++  + A +  + LPN  +  IP  GH+PH+E+P   A  I  FA
Sbjct  236   IDRETLIIWGENDQILGTKDAKKFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIVKFA  294



>ref|WP_016867408.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Fischerella muscicola]
Length=302

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 162/295 (55%), Gaps = 12/295 (4%)
 Frame = -3

Query  1176  VHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCFDSSCLEWR  997
             + ++ +  + +LA+ I+++ +    S   I+++ ++    G   P++L+H FDSS LE+R
Sbjct  15    IRQLTESTSVTLAQSIKQIAIATPLSAQPILTTYVQKGNSGT--PLLLIHGFDSSVLEYR  72

Query  996   RTYPLLEDTGVEAWAIDILGWGFSDLERRPT---CDAASKRYHLYQLWKSYIKRPMILVG  826
             R  PL+ +   + WA+D+LG+GF++   RPT      A  + HLY  WK+ I +PMILVG
Sbjct  73    RLLPLVAEQH-QTWAVDLLGFGFTN---RPTGIKFGTAEIKTHLYHFWKTLIDQPMILVG  128

Query  825   PSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPLRIY  646
              S+G A AIDF + +PE V KLVLI+++     +     +     Y     L+   +R  
Sbjct  129   ASMGGAAAIDFTLTYPEIVKKLVLIDSAGLIGSSPLAKYMFPPFDYLAAQFLRHPRVRQS  188

Query  645   AKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKVNQRTLV  472
                  +   SL+ T+D      LH   P W+ A++ F  SGGY      ++ ++ Q TL+
Sbjct  189   ISRAAYKNKSLA-TIDAQLCAALHLECPNWQQALIAFTKSGGYTAFRFKKLGEIQQPTLI  247

Query  471   ITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFARGD  307
             + G  D+++  + A R  R +PN+ +  I + GH+PH+E+P   A+ I +F+  D
Sbjct  248   LWGDFDRILGTKDAKRFNRAIPNSKLIWIQDCGHIPHLEQPQVTAQHILEFSEKD  302



>ref|WP_015225519.1| alpha/beta fold family hydrolase [Halothece sp. PCC 7418]
 ref|YP_007167857.1| alpha/beta fold family hydrolase [Halothece sp. PCC 7418]
 gb|AFZ43643.1| alpha/beta hydrolase fold protein [Halothece sp. PCC 7418]
Length=300

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 157/293 (54%), Gaps = 7/293 (2%)
 Frame = -3

Query  1191  FLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHCFDS  1015
             F+P    ++ +  + +L   IQ++ +    +   I ++ ++   QG+ E P++ LH FDS
Sbjct  9     FIPSLAEKLTEDTSSNLVANIQQIALDTDLAYHPIQTTYVR---QGEGELPLLFLHGFDS  65

Query  1014  SCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRPMI  835
             S +E+RR    +  T  E WA+D  G+G +D  +       + + HLY  WK  I+RPM+
Sbjct  66    SLMEFRRILLQVSPT-TETWAVDFFGFGLTDRPQEIAVTPEAIKSHLYAFWKQVIQRPMV  124

Query  834   LVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSIPL  655
             L G S+G AVAIDFA+ +PE V +L+L++++ +  G      +   +       L +  +
Sbjct  125   LSGASMGGAVAIDFALTYPETVEQLILLDSAGFAGGPAMGKLMIPPLDRLATGFLSNTTV  184

Query  654   RIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVV-HQIKKVNQRT  478
             R       +   S ++  D      LH   P W  A+++F  SGGYN + ++IK++ Q T
Sbjct  185   RQKISENAYYDRSFASE-DALTCSMLHLAHPNWSRALISFTKSGGYNFLSNRIKEIRQPT  243

Query  477   LVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADF  319
             L+I G +DK++  + A R    + N+ +  IP SGH+PH+E+P    + I +F
Sbjct  244   LIIWGEQDKILGTKDAKRFEETIENSQLVWIPESGHVPHLEKPELTGEAIRNF  296



>ref|WP_024969304.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa]
Length=295

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 106/304 (35%), Positives = 164/304 (54%), Gaps = 19/304 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L   IQ++ +       SI+++  +   QG  +P  +LLH 
Sbjct  3     YPNFLPTVREGLSEDTSLALLENIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFLLLHG  59

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  PLL     E WAID+LG+GF+  ER P    + K  + HLY  W++ I
Sbjct  60    FDSSLLEFRRLLPLLAQNR-ETWAIDLLGFGFT--ERYPDLQVSPKTIKSHLYHFWQTAI  116

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGE----GTGFMTKLPKMVAYGG  682
              +PMILVG S+G AVA+DFA+++PE V KLVLI+++        G    + L K      
Sbjct  117   AKPMILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKW----A  172

Query  681   VSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VH  505
              + L +  +R       +   +L+ T+D      LH   P W  A+++F  SGGY   + 
Sbjct  173   TNFLANPRVRQNISRTAYFDATLA-TVDACTCANLHLNCPHWSAALISFTKSGGYGAFLP  231

Query  504   QIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIA  325
             ++ ++N+ TL+I G  D+++  + A    + LPN  +  IP  GH+PH+E+P   A  I 
Sbjct  232   KLSQINRETLIIWGENDQILGTKDAKIFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIV  291

Query  324   DFAR  313
              FA 
Sbjct  292   KFAN  295



>dbj|GAL91400.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase [Microcystis 
aeruginosa NIES-44]
Length=295

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 166/303 (55%), Gaps = 19/303 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L + IQ++ +       SI+++  +   QG  +P  VLLH 
Sbjct  3     YPNFLPTVSEGLSEDTSLALLQNIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFVLLHG  59

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  P L     E WAID+LG+GF+  ER P  + + +  + HLY  W++ I
Sbjct  60    FDSSLLEFRRLLPFLAQNR-ETWAIDLLGFGFT--ERYPDLEVSPETIKSHLYHFWRTAI  116

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGE----GTGFMTKLPKMVAYGG  682
              +P+ILVG S+G AVA+DFA+++PE V KLVLI+++        G    + L K      
Sbjct  117   AKPIILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKW----A  172

Query  681   VSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VH  505
              + L +  +R       +   +L+ T+D      LH   P W +A+++F  SGGY   + 
Sbjct  173   TNFLANPRVRQNISRTAYFDATLA-TVDACTCANLHLNCPHWSEALISFTKSGGYGAFLP  231

Query  504   QIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIA  325
             ++ ++N+ TL+I G  D+++  + A    + LPN  +  IP  GH+PH+E+P   A  I 
Sbjct  232   KLSQINRETLIIWGENDQILGTKDAKIFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIV  291

Query  324   DFA  316
              FA
Sbjct  292   KFA  294



>ref|WP_026082547.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Mastigocladopsis 
repens]
Length=294

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 98/298 (33%), Positives = 157/298 (53%), Gaps = 8/298 (3%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKE-PVVLLHC  1024
             FP FLP  V  + +  + +LA+ I+++ +    S   I ++ ++   QG  + P++L+H 
Sbjct  2     FPSFLPTTVGGLTETASMTLAQSIEQIAIATPLSTQPITTTYVR---QGSGDVPLLLIHG  58

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKR  844
             FD S LE+RR  PLL     E WA+D+LG+GF+D         ++ + HLY  WK+ I R
Sbjct  59    FDGSVLEFRRLVPLLAVQN-ETWAVDLLGFGFTDRPMGVKFSPSAIKTHLYYFWKTLINR  117

Query  843   PMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKS  664
             P+ILVG S+G A AIDF + +PE V KLVLI+++    G      +   + Y     L++
Sbjct  118   PVILVGASMGGAAAIDFTLTYPEVVQKLVLIDSAGLAGGPPLSKFMFPPLDYWATQFLRN  177

Query  663   IPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVVH--QIKKV  490
               +R       +    L+ +LD      LH     W  A++ F  SGGY+      I ++
Sbjct  178   PKVRASISRAAYKNKELA-SLDAQLCAALHLECSDWHKALIAFTKSGGYSAFRFKNIGQI  236

Query  489   NQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFA  316
              Q TL++ G  DK++    A R    +PN+ +  I + GH+PH+E+P   A+ I +  
Sbjct  237   VQPTLILWGDSDKILGIRDAKRFKLAIPNSKLIWIKDCGHVPHLEQPQMTAQHILELG  294



>ref|WP_002752793.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa]
 emb|CCH91525.1| Genome sequencing data, contig C328 [Microcystis aeruginosa PCC 
9432]
Length=307

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/300 (34%), Positives = 162/300 (54%), Gaps = 11/300 (4%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L   IQ++ +       SI+++  +   QG  +P  +LLH 
Sbjct  15    YPNFLPTVREGLSEDTSLALLENIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFLLLHG  71

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  PLL     E WAID+LG+GF+  ER P    + K  + HLY  W++ I
Sbjct  72    FDSSLLEFRRLLPLLAQNR-ETWAIDLLGFGFT--ERYPDLQVSPKTIKSHLYHFWQTAI  128

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLL  670
              +PMILVG S+G AVA+DFA+++PE V KLVLI+++           +   +     + L
Sbjct  129   AKPMILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKWATNFL  188

Query  669   KSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VHQIKK  493
              +  +R       +   +L+ T+D      LH   P W  A+++F  SGGY   + ++ +
Sbjct  189   ANPRVRQNISRTAYFDATLA-TVDACTCANLHLNCPHWSAALISFTKSGGYGAFLPKLSQ  247

Query  492   VNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             +N+ TL+I G  D+++  + A    + LPN  +  IP  GH+PH+E+P   A  I  FA 
Sbjct  248   INRETLIIWGENDQILGTKDAKIFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIVKFAN  307



>gb|KEI66482.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Planktothrix agardhii 
NIVA-CYA 126/8]
Length=299

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/297 (31%), Positives = 160/297 (54%), Gaps = 5/297 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP+ V ++ +  + + A+ ++  P+     E  I ++ I+    G   P++L+H F
Sbjct  6     FPSFLPESVQKLTEATSIAFAQNLRCEPISTPLREQPIQTTYIRQGQGGT--PILLIHGF  63

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS  E+RR  PLL  T  E +A+DILG+GF++       + +    HLY  W+  I +P
Sbjct  64    DSSVFEYRRLLPLLA-TENETFAVDILGFGFTERGTEFKLNRSEIATHLYSFWQDLINQP  122

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G AVA+DF + +PEAV  LVL++++    G      L     Y     L++ 
Sbjct  123   VILVGASMGGAVALDFTLLYPEAVKSLVLLDSAGMKPGPVMGKFLLPPFDYLATEFLRNP  182

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVV-HQIKKVNQ  484
              +R       +   + + ++D      LH  +  W   ++ F  +GGY     Q+  + Q
Sbjct  183   KVRQAISESAYFDKTFA-SVDAQICASLHLEVMGWNQGLIRFSKTGGYGKFGKQLNNIQQ  241

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             +TL++ G  DK++  + A +  + +P++ +  + NSGH+PH+E+P + A+ I DF +
Sbjct  242   QTLILWGDHDKILGTKDAYKFEKAIPHSQLIWVKNSGHVPHLEQPQTTAQYILDFVK  298



>ref|WP_026794503.1| MULTISPECIES: 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Planktothrix]
Length=295

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/297 (31%), Positives = 161/297 (54%), Gaps = 5/297 (2%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEPVVLLHCF  1021
             FP FLP+ V ++ +  + + A+ ++  P+     +  I ++ I+    G   P++L+H F
Sbjct  2     FPSFLPESVQKLTEATSIAFAQNLRCEPISTPLRKQPIQTTYIRQGQGGT--PILLIHGF  59

Query  1020  DSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASKRYHLYQLWKSYIKRP  841
             DSS  E+RR  PLL  T  E +A+DILG+GF++       + +    HLY  WK+ I +P
Sbjct  60    DSSVFEYRRLLPLLA-TENETFAVDILGFGFTERGTEFKLNRSEIATHLYSFWKTLINQP  118

Query  840   MILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGEGTGFMTKLPKMVAYGGVSLLKSI  661
             +ILVG S+G AVA+DF + +PEAV  LVL++++    G      L     Y     L++ 
Sbjct  119   VILVGASMGGAVALDFTLLYPEAVKSLVLLDSAGMKPGPIMGKFLLPPFDYLATEFLRNP  178

Query  660   PLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNVV-HQIKKVNQ  484
              +R       +   + + ++D      LH  +  W   ++ F  +GGY     Q+  + Q
Sbjct  179   KVRQAISESAYFDKTFA-SVDAQICAALHLEVMGWNQGLIRFSKTGGYGKFGKQLNNIQQ  237

Query  483   RTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIADFAR  313
             +TL++ G  DK++  + A +  + +P++ +  + NSGH+PH+E+P + A+ I DF +
Sbjct  238   QTLILWGDHDKILGTKDAYKFEKAIPHSQLIWVKNSGHVPHLEQPQTTAQYILDFVK  294



>ref|WP_008207219.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis sp. 
T1-4]
 emb|CCI34599.1| Genome sequencing data, contig C328 [Microcystis sp. T1-4]
Length=295

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 106/304 (35%), Positives = 164/304 (54%), Gaps = 19/304 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L   IQ++ +       SI+++  +   QG  +P  VLLH 
Sbjct  3     YPNFLPTVREGLSEDTSLALLENIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFVLLHG  59

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  PLL     E WAID+LG+GF+  ER P    + K  + HLY  W++ I
Sbjct  60    FDSSLLEFRRLLPLLARNR-ETWAIDLLGFGFT--ERYPDLQVSPKTIKSHLYHFWRTAI  116

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGE----GTGFMTKLPKMVAYGG  682
               P+ILVG S+G AVA+DFA+++PE V KLVLI+++        G    + L K      
Sbjct  117   AEPIILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKW----A  172

Query  681   VSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VH  505
              + L +  +R       +   +L+ T+D      LH   P W +A+++F  SGGY   + 
Sbjct  173   TNFLANPRVRQNISRTAYFDATLA-TVDACTCANLHLNCPHWSEALISFTKSGGYGAFLP  231

Query  504   QIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIA  325
             ++ ++N+ TL+I G  D+++  + A    + LPN  +  IP  GH+PH+E+P   A  I 
Sbjct  232   KLSQINRETLIIWGENDQILGTKDAKIFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIV  291

Query  324   DFAR  313
              FA 
Sbjct  292   KFAN  295



>ref|WP_036396441.1| 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [Microcystis aeruginosa]
Length=295

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 105/304 (35%), Positives = 166/304 (55%), Gaps = 19/304 (6%)
 Frame = -3

Query  1200  FPLFLPKEVHEIKDPFARSLARRIQRLPVQVGFSESSIMSSCIKPVIQGDKEP-VVLLHC  1024
             +P FLP     + +  + +L + IQ++ +       SI+++  +   QG  +P  +LLH 
Sbjct  3     YPNFLPTVREGLSEDTSLALLQNIQQIAIDSPIYPRSILTTYSQ---QGQGQPPFLLLHG  59

Query  1023  FDSSCLEWRRTYPLLEDTGVEAWAIDILGWGFSDLERRPTCDAASK--RYHLYQLWKSYI  850
             FDSS LE+RR  PLL     E WAID+LG+GF+  ER P  + + K  + HLY  W++ I
Sbjct  60    FDSSLLEFRRLLPLLAQNR-ETWAIDLLGFGFT--ERYPDLEVSPKTIKSHLYHFWQTAI  116

Query  849   KRPMILVGPSLGAAVAIDFAVNFPEAVHKLVLINASVYGE----GTGFMTKLPKMVAYGG  682
              +P+ILVG S+G AVA+DFA+++PE V KLVLI+++        G    + L K      
Sbjct  117   AKPIILVGASMGGAVALDFALSYPEIVAKLVLIDSAGLANPPVLGKLMFSPLDKW----A  172

Query  681   VSLLKSIPLRIYAKLQCFDGLSLSTTLDWTNVGRLHCLLPWWEDAMVNFMLSGGYNV-VH  505
              + L +  +R       +   +L+ T+D      LH   P W  A+++F  SGGY   + 
Sbjct  173   TNFLANPRVRQNISRTAYFDATLA-TVDACTCANLHLNCPHWSAALISFTKSGGYGAFLP  231

Query  504   QIKKVNQRTLVITGMRDKLVSNELAMRLCRELPNAIVHQIPNSGHLPHVEEPHSVAKLIA  325
             ++ ++N+ TL+I G  D+++  + A    + LPN  +  IP  GH+PH+E+P   A  I 
Sbjct  232   KLSQINRETLIIWGENDQILGTKDAKIFQQALPNNQLVWIPRCGHVPHLEKPELTAAAIV  291

Query  324   DFAR  313
              FA 
Sbjct  292   KFAN  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4531252235272