BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18625_g2_i2 len=2092 path=[2070:0-147 2218:148-2091]

Length=2092
                                                                      Score     E

ref|XP_010320465.1|  PREDICTED: protein NLP4 isoform X2                 746   0.0      
ref|XP_004238434.1|  PREDICTED: protein NLP4 isoform X1                 748   0.0      
ref|XP_006342136.1|  PREDICTED: protein NLP4-like isoform X1            744   0.0      
ref|XP_009773664.1|  PREDICTED: protein NLP5-like                       735   0.0      
ref|XP_009622679.1|  PREDICTED: protein NLP5-like                       734   0.0      
ref|XP_009600534.1|  PREDICTED: protein NLP5-like                       734   0.0      
ref|XP_009759077.1|  PREDICTED: protein NLP4-like                       729   0.0      
ref|XP_011074088.1|  PREDICTED: protein NLP5-like                       692   0.0      
emb|CDP07286.1|  unnamed protein product                                674   0.0      
ref|XP_010663967.1|  PREDICTED: protein NLP4-like                       649   0.0      
emb|CAN75893.1|  hypothetical protein VITISV_009390                     646   0.0      Vitis vinifera
ref|XP_002510678.1|  conserved hypothetical protein                     637   0.0      Ricinus communis
ref|XP_002301919.2|  NIN-like protein 1                                 635   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007018035.1|  Plant regulator RWP-RK family protein, putative    635   0.0      
gb|EYU36567.1|  hypothetical protein MIMGU_mgv1a022035mg                631   0.0      
ref|XP_011034870.1|  PREDICTED: protein NLP4-like                       629   0.0      
ref|XP_011041223.1|  PREDICTED: protein NLP4-like                       627   0.0      
emb|CBI40717.3|  unnamed protein product                                617   0.0      
ref|XP_006473795.1|  PREDICTED: protein NLP4-like                       618   0.0      
ref|XP_006435364.1|  hypothetical protein CICLE_v10000188mg             618   0.0      
gb|KHG28051.1|  Protein NLP4 -like protein                              616   0.0      
ref|XP_004301980.1|  PREDICTED: protein NLP5-like                       603   0.0      
ref|XP_010692542.1|  PREDICTED: protein NLP4-like                       601   0.0      
ref|XP_008237986.1|  PREDICTED: protein NLP5-like isoform X2            587   0.0      
ref|XP_010061177.1|  PREDICTED: protein NLP4-like                       593   0.0      
ref|XP_002306977.2|  NIN-like protein 1                                 588   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010266179.1|  PREDICTED: protein NLP4                            590   0.0      
ref|XP_008237985.1|  PREDICTED: protein NLP4-like isoform X1            587   0.0      
ref|XP_007210497.1|  hypothetical protein PRUPE_ppa001086mg             584   0.0      
gb|KHG12417.1|  Protein NLP4 -like protein                              581   0.0      
ref|XP_008373422.1|  PREDICTED: protein NLP5-like                       567   0.0      
ref|XP_009369835.1|  PREDICTED: protein NLP5-like                       564   0.0      
ref|XP_006581139.1|  PREDICTED: protein NLP4-like isoform X3            564   0.0      
ref|XP_010242905.1|  PREDICTED: protein NLP4-like                       573   0.0      
ref|XP_010645880.1|  PREDICTED: protein NLP2-like                       564   0.0      
ref|XP_009362861.1|  PREDICTED: protein NLP5-like                       562   0.0      
ref|XP_003527641.2|  PREDICTED: protein NLP4-like isoform X1            560   0.0      
emb|CAN59896.1|  hypothetical protein VITISV_002883                     560   0.0      Vitis vinifera
gb|KHN20112.1|  Protein NLP4                                            558   0.0      
ref|XP_008452963.1|  PREDICTED: protein NLP4 isoform X4                 549   0.0      
gb|KHN33800.1|  Protein NLP4                                            551   0.0      
ref|XP_006577940.1|  PREDICTED: protein NLP4-like isoform X7            552   0.0      
ref|XP_008452961.1|  PREDICTED: protein NLP4 isoform X2                 550   3e-180   
ref|XP_008452959.1|  PREDICTED: protein NLP4 isoform X1                 550   6e-180   
ref|XP_004145599.1|  PREDICTED: protein NLP5-like                       550   7e-180   
ref|XP_004157118.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP5...    549   8e-180   
ref|XP_003523077.1|  PREDICTED: protein NLP4-like isoform X1            547   2e-179   
ref|XP_008452962.1|  PREDICTED: protein NLP4 isoform X3                 547   3e-179   
ref|XP_007136019.1|  hypothetical protein PHAVU_009G011200g             545   2e-178   
ref|XP_010536471.1|  PREDICTED: protein NLP4-like                       541   3e-177   
gb|AHI17473.1|  nodule inception protein                                542   6e-177   
emb|CBI37748.3|  unnamed protein product                                536   5e-176   
ref|XP_006390206.1|  hypothetical protein EUTSA_v10018128mg             535   5e-176   
ref|XP_004500875.1|  PREDICTED: protein NLP4-like isoform X3            531   3e-173   
ref|NP_177761.1|  nodule inception protein-like protein 5               528   5e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306759.1|  hypothetical protein CARUB_v10008300mg             528   7e-173   
ref|XP_002887634.1|  RWP-RK domain-containing protein                   525   8e-172   
ref|XP_006300747.1|  hypothetical protein CARUB_v100198120mg            524   1e-171   
ref|XP_007041614.1|  Plant regulator RWP-RK family protein, putat...    518   7e-171   
gb|KEH36316.1|  plant regulator RWP-RK family protein                   525   7e-171   
ref|XP_010918251.1|  PREDICTED: protein NLP1-like isoform X2            521   2e-170   
ref|XP_010416548.1|  PREDICTED: protein NLP5-like                       521   3e-170   
ref|XP_011088705.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP2...    524   4e-170   
gb|KHF97712.1|  Protein NLP2 -like protein                              523   8e-170   
ref|XP_004500873.1|  PREDICTED: protein NLP4-like isoform X1            521   8e-169   
ref|XP_007041613.1|  Plant regulator RWP-RK family protein, putat...    520   3e-168   
ref|XP_008812750.1|  PREDICTED: protein NLP1-like                       519   4e-168   
ref|XP_010428689.1|  PREDICTED: protein NLP5-like                       515   5e-168   
ref|XP_010918248.1|  PREDICTED: protein NLP1-like isoform X1            519   5e-168   
ref|XP_011092933.1|  PREDICTED: protein NLP2                            517   2e-167   
ref|XP_010471784.1|  PREDICTED: protein NLP5                            513   3e-167   
ref|XP_010477309.1|  PREDICTED: protein NLP4-like                       513   6e-167   
ref|XP_010459756.1|  PREDICTED: protein NLP4 isoform X3                 513   6e-167   
ref|XP_010459755.1|  PREDICTED: protein NLP4 isoform X2                 514   6e-167   
ref|XP_006416377.1|  hypothetical protein EUTSA_v10006790mg             513   7e-167   
ref|XP_010459754.1|  PREDICTED: protein NLP4 isoform X1                 514   9e-167   
ref|XP_010498501.1|  PREDICTED: protein NLP4-like isoform X3            511   6e-166   
ref|XP_010498500.1|  PREDICTED: protein NLP4-like isoform X2            511   6e-166   
ref|XP_010498499.1|  PREDICTED: protein NLP4-like isoform X1            511   1e-165   
ref|NP_173488.1|  nodule inception protein-like protein 4               509   2e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623517.1|  PREDICTED: protein NLP2-like                       510   5e-165   
emb|CAE30324.1|  NIN-like protein 1                                     509   1e-164   Lotus japonicus
ref|XP_009766436.1|  PREDICTED: protein NLP2-like                       509   1e-164   
emb|CDY31491.1|  BnaC05g16000D                                          502   2e-164   
ref|XP_002890396.1|  RWP-RK domain-containing protein                   506   4e-164   
gb|EPS69544.1|  hypothetical protein M569_05222                         498   1e-163   
ref|XP_009149543.1|  PREDICTED: protein NLP4                            502   5e-163   
emb|CDY29516.1|  BnaA06g14540D                                          502   5e-163   
ref|XP_009392335.1|  PREDICTED: protein NLP1-like                       504   3e-162   
emb|CDY31876.1|  BnaC07g15260D                                          498   7e-162   
ref|XP_008235979.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP2...    501   2e-161   
gb|KDO68320.1|  hypothetical protein CISIN_1g004975mg                   493   1e-160   
ref|XP_009106295.1|  PREDICTED: protein NLP5 isoform X2                 494   2e-160   
ref|XP_009106294.1|  PREDICTED: protein NLP5 isoform X1                 495   2e-160   
emb|CDX87610.1|  BnaA07g32630D                                          494   3e-160   
gb|KHG15132.1|  Protein NLP5 -like protein                              493   6e-159   
emb|CDP14498.1|  unnamed protein product                                491   1e-158   
emb|CDX88264.1|  BnaC06g37080D                                          489   3e-158   
ref|XP_010534200.1|  PREDICTED: protein NLP4-like                       489   4e-158   
ref|XP_006422434.1|  hypothetical protein CICLE_v10027765mg             493   4e-158   
ref|XP_010028835.1|  PREDICTED: protein NLP2-like                       493   5e-158   
ref|XP_006486601.1|  PREDICTED: protein NLP2-like isoform X1            493   6e-158   
emb|CDY01361.1|  BnaA07g11340D                                          484   1e-156   
ref|XP_009103332.1|  PREDICTED: protein NLP4-like                       483   4e-156   
ref|XP_007199040.1|  hypothetical protein PRUPE_ppa018195mg             484   2e-155   
ref|XP_010530951.1|  PREDICTED: protein NLP2-like isoform X1            483   7e-154   
gb|KDP42031.1|  hypothetical protein JCGZ_03094                         481   1e-153   
gb|EEC85004.1|  hypothetical protein OsI_32291                          479   2e-153   Oryza sativa Indica Group [Indian rice]
ref|XP_010935286.1|  PREDICTED: protein NLP1-like                       479   7e-153   
gb|EEE70166.1|  hypothetical protein OsJ_30240                          476   1e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008781315.1|  PREDICTED: protein NLP1-like                       478   1e-152   
ref|XP_004231096.1|  PREDICTED: protein NLP2                            476   2e-152   
ref|XP_002313580.2|  RWP-RK domain-containing family protein            477   3e-152   Populus trichocarpa [western balsam poplar]
ref|XP_010548150.1|  PREDICTED: protein NLP2-like                       478   7e-152   
dbj|BAD33743.1|  putative nodule inception protein                      474   1e-151   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006364357.1|  PREDICTED: protein NLP2-like isoform X1            474   1e-151   
ref|XP_009384610.1|  PREDICTED: protein NLP1-like                       474   5e-151   
ref|XP_002527149.1|  hypothetical protein RCOM_0512940                  473   4e-150   Ricinus communis
emb|CDX96629.1|  BnaA08g21720D                                          466   7e-150   
ref|XP_006661509.1|  PREDICTED: protein NLP1-like                       467   9e-150   
ref|XP_004957563.1|  PREDICTED: protein NLP1-like isoform X2            469   9e-150   
ref|XP_011000886.1|  PREDICTED: protein NLP2-like                       471   2e-149   
ref|XP_010066333.1|  PREDICTED: protein NLP2-like                       470   2e-149   
ref|XP_004957562.1|  PREDICTED: protein NLP1-like isoform X1            468   6e-149   
ref|XP_008653047.1|  PREDICTED: protein NLP1-like isoform X2            465   3e-148   
ref|XP_009401874.1|  PREDICTED: protein NLP1-like isoform X2            465   4e-148   
ref|XP_008653046.1|  PREDICTED: protein NLP1-like isoform X1            464   5e-148   
ref|XP_009401873.1|  PREDICTED: protein NLP1-like isoform X1            465   8e-148   
emb|CDY33637.1|  BnaC08g19370D                                          461   1e-147   
ref|XP_010530953.1|  PREDICTED: protein NLP2-like isoform X3            460   1e-146   
ref|XP_011040794.1|  PREDICTED: protein NLP2-like isoform X2            461   6e-146   
ref|XP_011040792.1|  PREDICTED: protein NLP1-like isoform X1            460   3e-145   
ref|NP_001151571.1|  NIN-like protein 1                                 457   4e-145   Zea mays [maize]
ref|XP_003578585.1|  PREDICTED: protein NLP1 isoform X2                 456   6e-145   
ref|XP_006384842.1|  nodule inception family protein                    457   1e-144   
ref|XP_008668121.1|  PREDICTED: NIN-like protein 1 isoform X2           456   1e-144   
ref|XP_010238468.1|  PREDICTED: protein NLP1 isoform X1                 456   3e-144   
ref|XP_009413456.1|  PREDICTED: protein NLP1-like isoform X2            454   4e-143   
ref|XP_006828708.1|  hypothetical protein AMTR_s00001p00009420          444   4e-143   
ref|XP_009413450.1|  PREDICTED: protein NLP1-like isoform X1            454   1e-142   
gb|EMS65172.1|  hypothetical protein TRIUR3_11978                       447   3e-142   
dbj|BAJ89813.1|  predicted protein                                      448   5e-142   
emb|CDY40642.1|  BnaA03g53210D                                          449   1e-141   
ref|XP_009138351.1|  PREDICTED: protein NLP2-like                       447   4e-141   
gb|EYU38032.1|  hypothetical protein MIMGU_mgv1a000964mg                447   2e-140   
gb|EMT31467.1|  hypothetical protein F775_17765                         442   7e-140   
ref|XP_006412126.1|  hypothetical protein EUTSA_v10024319mg             444   4e-139   
ref|XP_010690230.1|  PREDICTED: protein NLP2                            441   5e-138   
emb|CDX72528.1|  BnaC07g45500D                                          439   9e-138   
ref|XP_010432303.1|  PREDICTED: protein NLP2                            438   1e-136   
ref|XP_010437496.1|  PREDICTED: protein NLP2-like                       437   2e-136   
ref|XP_010446946.1|  PREDICTED: protein NLP2-like                       435   2e-135   
tpg|DAA43174.1|  TPA: putative plant regulator RWP-RK family protein    432   3e-135   
emb|CDX75487.1|  BnaA01g02150D                                          431   1e-134   
emb|CDX69125.1|  BnaC01g03280D                                          432   1e-134   
ref|XP_009103570.1|  PREDICTED: protein NLP2                            432   2e-134   
ref|XP_006283075.1|  hypothetical protein CARUB_v10004068mg             431   4e-134   
ref|XP_006296933.1|  hypothetical protein CARUB_v10012927mg             422   5e-134   
emb|CDY07871.1|  BnaC03g47510D                                          428   5e-134   
emb|CDX88002.1|  BnaA06g25930D                                          427   1e-133   
emb|CCI55432.1|  PH01B031C15.15                                         429   1e-133   
ref|XP_002532423.1|  transcription factor, putative                     427   2e-133   Ricinus communis
ref|XP_009150852.1|  PREDICTED: protein NLP1-like                       426   3e-133   
ref|NP_195253.4|  plant regulator RWP-RK family protein                 428   6e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409346.1|  hypothetical protein EUTSA_v10022536mg             425   2e-132   
ref|XP_010229247.1|  PREDICTED: protein NLP1-like                       425   3e-132   
ref|XP_009121157.1|  PREDICTED: protein NLP1 isoform X2                 424   5e-132   
emb|CDX71338.1|  BnaC07g06170D                                          424   5e-132   
emb|CDY31378.1|  BnaA07g03130D                                          423   6e-132   
ref|XP_009121154.1|  PREDICTED: protein NLP1 isoform X1                 423   9e-132   
ref|XP_006296934.1|  hypothetical protein CARUB_v10012927mg             423   1e-131   
ref|XP_011000890.1|  PREDICTED: protein NLP2-like isoform X1            423   2e-131   
ref|XP_002886100.1|  predicted protein                                  422   4e-131   
ref|XP_010467467.1|  PREDICTED: protein NLP1                            420   1e-130   
ref|XP_002465923.1|  hypothetical protein SORBIDRAFT_01g048290          420   2e-130   Sorghum bicolor [broomcorn]
ref|NP_179306.2|  nodule inception like protein 1                       417   2e-129   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001048860.1|  Os03g0131100                                       418   2e-129   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ25469.1|  hypothetical protein OsJ_09292                          418   2e-129   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88394.1|  hypothetical protein OsI_09856                          417   4e-129   Oryza sativa Indica Group [Indian rice]
ref|XP_011000891.1|  PREDICTED: protein NLP2-like isoform X2            416   5e-129   
ref|XP_010515531.1|  PREDICTED: protein NLP1-like                       416   5e-129   
ref|XP_002322654.2|  hypothetical protein POPTR_0016s04220g             416   7e-129   Populus trichocarpa [western balsam poplar]
ref|XP_010489333.1|  PREDICTED: protein NLP1-like                       416   7e-129   
ref|XP_002867080.1|  RWP-RK domain-containing protein                   417   1e-128   
tpg|DAA43175.1|  TPA: putative plant regulator RWP-RK family protein    415   4e-128   
ref|XP_002313583.2|  hypothetical protein POPTR_0009s16790g             412   2e-127   Populus trichocarpa [western balsam poplar]
gb|EMT04155.1|  hypothetical protein F775_24227                         405   9e-127   
emb|CAA18742.1|  putative protein                                       412   2e-126   Arabidopsis thaliana [mouse-ear cress]
gb|KDP44508.1|  hypothetical protein JCGZ_16341                         405   5e-126   
ref|XP_002313581.2|  hypothetical protein POPTR_0009s16820g             407   1e-125   Populus trichocarpa [western balsam poplar]
pir||F84548  hypothetical protein At2g17150 [imported] - Arabidop...    402   4e-124
ref|XP_002525797.1|  transcription factor, putative                     399   1e-122   Ricinus communis
ref|NP_001031361.2|  nodule inception like protein 1                    382   5e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033170.1|  PREDICTED: protein NLP2-like                       388   3e-118   
gb|AGR88904.1|  nodule inception protein 1                              387   4e-118   
ref|XP_006651009.1|  PREDICTED: protein NLP1-like                       373   3e-114   
ref|XP_008783158.1|  PREDICTED: protein NLP3-like isoform X2            377   4e-114   
ref|XP_008783157.1|  PREDICTED: protein NLP3-like isoform X1            376   2e-113   
gb|AFW71652.1|  hypothetical protein ZEAMMB73_806651                    363   6e-113   
ref|XP_010915986.1|  PREDICTED: protein NLP3-like                       371   1e-111   
ref|XP_010267559.1|  PREDICTED: protein NLP7-like isoform X3            365   4e-110   
ref|XP_010267557.1|  PREDICTED: protein NLP6-like isoform X1            369   5e-110   
ref|XP_010267558.1|  PREDICTED: protein NLP6-like isoform X2            368   5e-110   
ref|XP_008777047.1|  PREDICTED: protein NLP3-like                       366   1e-109   
ref|XP_009412372.1|  PREDICTED: protein NLP3-like isoform X2            362   4e-109   
gb|EYU33493.1|  hypothetical protein MIMGU_mgv1a000862mg                363   1e-108   
ref|XP_009412368.1|  PREDICTED: protein NLP3-like isoform X1            362   2e-108   
ref|XP_006343818.1|  PREDICTED: protein NLP7-like isoform X2            354   1e-107   
gb|KCW68097.1|  hypothetical protein EUGRSUZ_F01779                     353   1e-107   
ref|XP_002303671.1|  RWP-RK domain-containing family protein            359   5e-107   Populus trichocarpa [western balsam poplar]
emb|CDP12190.1|  unnamed protein product                                360   5e-107   
ref|XP_010912370.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP3...    358   1e-106   
ref|XP_009803235.1|  PREDICTED: protein NLP7-like isoform X2            358   2e-106   
ref|XP_001770664.1|  predicted protein                                  353   2e-106   
ref|XP_009605047.1|  PREDICTED: protein NLP7                            358   3e-106   
ref|XP_009599821.1|  PREDICTED: protein NLP6-like isoform X2            357   4e-106   
ref|XP_011022461.1|  PREDICTED: protein NLP7-like isoform X2            354   6e-106   
emb|CDY17536.1|  BnaC03g65270D                                          347   9e-106   
ref|XP_002299449.1|  RWP-RK domain-containing family protein            353   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_011022460.1|  PREDICTED: protein NLP7-like isoform X1            355   3e-105   
ref|XP_009773779.1|  PREDICTED: protein NLP7                            355   6e-105   
ref|XP_006476342.1|  PREDICTED: protein NLP7-like                       354   8e-105   
gb|KDO76615.1|  hypothetical protein CISIN_1g0021441mg                  351   1e-104   
ref|XP_004244640.1|  PREDICTED: protein NLP6-like isoform X1            353   1e-104   
ref|XP_006343817.1|  PREDICTED: protein NLP7-like isoform X1            355   1e-104   
ref|XP_004301816.1|  PREDICTED: protein NLP7-like                       352   1e-104   
ref|XP_009393072.1|  PREDICTED: protein NLP3-like                       352   1e-104   
ref|XP_006439289.1|  hypothetical protein CICLE_v10018744mg             351   2e-104   
ref|XP_010233295.1|  PREDICTED: protein NLP3-like                       351   2e-104   
ref|XP_002518861.1|  transcription factor, putative                     353   2e-104   Ricinus communis
ref|XP_006439290.1|  hypothetical protein CICLE_v10018744mg             351   2e-104   
ref|XP_010324647.1|  PREDICTED: protein NLP7-like isoform X2            349   4e-104   
gb|KFK32160.1|  hypothetical protein AALP_AA6G205600                    348   4e-104   
ref|XP_007040589.1|  Transcription factor, putative                     352   4e-104   
ref|XP_008806288.1|  PREDICTED: protein NLP3                            351   6e-104   
ref|XP_004967359.1|  PREDICTED: protein NLP3-like                       350   9e-104   
ref|XP_009803234.1|  PREDICTED: protein NLP7-like isoform X1            351   1e-103   
ref|XP_008673472.1|  PREDICTED: protein NLP3                            348   2e-103   
ref|XP_004165968.1|  PREDICTED: protein NLP6-like                       350   2e-103   
ref|XP_004149006.1|  PREDICTED: protein NLP6-like                       350   2e-103   
gb|KGN53434.1|  hypothetical protein Csa_4G054800                       350   2e-103   
ref|XP_011026836.1|  PREDICTED: protein NLP7-like isoform X2            350   2e-103   
ref|XP_008451916.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP7...    350   2e-103   
ref|XP_011026835.1|  PREDICTED: protein NLP7-like isoform X1            350   3e-103   
ref|XP_009599820.1|  PREDICTED: protein NLP6-like isoform X1            350   3e-103   
ref|XP_006606126.1|  PREDICTED: protein NLP7-like isoform X2            348   3e-103   
ref|XP_009599822.1|  PREDICTED: protein NLP6-like isoform X3            349   3e-103   
ref|XP_010473720.1|  PREDICTED: protein NLP6                            346   4e-103   
ref|XP_010695590.1|  PREDICTED: protein NLP7                            349   5e-103   
ref|XP_010107269.1|  Protein NLP7                                       349   1e-102   
ref|XP_006352238.1|  PREDICTED: protein NLP7-like isoform X1            348   2e-102   
ref|XP_006606125.1|  PREDICTED: protein NLP7-like isoform X1            347   2e-102   
ref|XP_010538845.1|  PREDICTED: protein NLP7-like isoform X2            345   2e-102   
gb|KHN12143.1|  Protein NLP7                                            347   2e-102   
ref|XP_010430590.1|  PREDICTED: protein NLP6-like                       344   2e-102   
ref|XP_010659716.1|  PREDICTED: protein NLP6-like                       347   2e-102   
ref|XP_010538846.1|  PREDICTED: protein NLP7-like isoform X3            345   3e-102   
ref|XP_008655807.1|  PREDICTED: protein NLP3-like                       345   3e-102   
ref|XP_009137410.1|  PREDICTED: protein NLP7-like                       346   3e-102   
ref|XP_006300704.1|  hypothetical protein CARUB_v10019754mg             345   4e-102   
emb|CDY10982.1|  BnaA03g46410D                                          345   4e-102   
ref|XP_010538844.1|  PREDICTED: protein NLP7-like isoform X1            345   5e-102   
ref|XP_002457049.1|  hypothetical protein SORBIDRAFT_03g000490          345   6e-102   Sorghum bicolor [broomcorn]
ref|XP_010541791.1|  PREDICTED: protein NLP7-like                       344   8e-102   
gb|KHG29007.1|  Protein NLP7 -like protein                              345   1e-101   
ref|XP_002887879.1|  RWP-RK domain-containing protein                   342   2e-101   
gb|EAY73195.1|  hypothetical protein OsI_01067                          342   2e-101   Oryza sativa Indica Group [Indian rice]
emb|CDY47839.1|  BnaA09g12180D                                          340   3e-101   
ref|XP_006391609.1|  hypothetical protein EUTSA_v10023271mg             340   5e-101   
ref|NP_176634.1|  nodule inception protein-like protein 6               340   6e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003536463.2|  PREDICTED: protein NLP6-like                       343   7e-101   
ref|XP_010529654.1|  PREDICTED: protein NLP7-like isoform X2            341   9e-101   
ref|XP_009124666.1|  PREDICTED: protein NLP6                            339   1e-100   
gb|AAM13850.1|  unknown protein                                         339   1e-100   Arabidopsis thaliana [mouse-ear cress]
emb|CDM82543.1|  unnamed protein product                                341   1e-100   
emb|CDY62019.1|  BnaCnng38990D                                          338   1e-100   
gb|KDP25261.1|  hypothetical protein JCGZ_20417                         343   1e-100   
gb|EMS59307.1|  Protein NLP3                                            340   2e-100   
ref|NP_194133.1|  NIN like protein 7                                    341   2e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AAO64180.1|  unknown protein                                         341   2e-100   
ref|XP_002869745.1|  RWP-RK domain-containing protein                   341   2e-100   
ref|XP_006413484.1|  hypothetical protein EUTSA_v10024328mg             341   2e-100   
ref|XP_010529652.1|  PREDICTED: protein NLP7-like isoform X1            340   3e-100   
emb|CDY03497.1|  BnaC01g15850D                                          341   3e-100   
ref|XP_009137614.1|  PREDICTED: protein NLP7                            341   3e-100   
emb|CDY66677.1|  BnaA01g35090D                                          339   6e-100   
ref|XP_002460618.1|  hypothetical protein SORBIDRAFT_02g031970          332   6e-100   
ref|XP_003565547.1|  PREDICTED: protein NLP3                            340   6e-100   
ref|XP_008239166.1|  PREDICTED: protein NLP6-like                       327   7e-100   
emb|CDY50437.1|  BnaC07g38670D                                          339   8e-100   
ref|XP_006844913.1|  hypothetical protein AMTR_s00058p00147810          340   9e-100   
ref|XP_006282537.1|  hypothetical protein CARUB_v10004076mg             339   1e-99    
gb|EMT25190.1|  hypothetical protein F775_13111                         339   1e-99    
emb|CBI34539.3|  unnamed protein product                                337   2e-99    
ref|XP_010433823.1|  PREDICTED: protein NLP7-like                       338   2e-99    
gb|KEH43696.1|  plant regulator RWP-RK family protein                   337   2e-99    
ref|XP_003533182.2|  PREDICTED: protein NLP7-like                       338   3e-99    
ref|XP_007143431.1|  hypothetical protein PHAVU_007G071900g             338   7e-99    
gb|AAF19672.1|AC009519_6  F1N19.10                                      335   7e-99    
ref|XP_007209022.1|  hypothetical protein PRUPE_ppa024146mg             323   9e-99    
ref|XP_003592270.1|  hypothetical protein MTR_1g100970                  337   1e-98    
ref|XP_009390721.1|  PREDICTED: protein NLP3-like                       337   1e-98    
gb|KFK28956.1|  hypothetical protein AALP_AA7G070500                    336   1e-98    
ref|XP_003548181.1|  PREDICTED: protein NLP7-like                       337   2e-98    
gb|KHN09331.1|  Protein NLP7                                            335   5e-98    
ref|XP_004960684.1|  PREDICTED: protein NLP3-like isoform X3            328   6e-98    
ref|XP_004496554.1|  PREDICTED: protein NLP6-like                       335   8e-98    
ref|XP_009347913.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP6...    332   1e-97    
ref|XP_011070354.1|  PREDICTED: protein NLP7 isoform X2                 332   3e-97    
ref|XP_011070353.1|  PREDICTED: protein NLP7 isoform X1                 333   5e-97    
ref|XP_007152252.1|  hypothetical protein PHAVU_004G114100g             332   8e-97    
ref|XP_001779081.1|  predicted protein                                  325   1e-96    
ref|XP_006843278.1|  hypothetical protein AMTR_s00080p00150020          330   2e-96    
ref|XP_004960682.1|  PREDICTED: protein NLP3-like isoform X1            328   4e-96    
ref|XP_010448625.1|  PREDICTED: protein NLP7 isoform X3                 324   1e-95    
ref|XP_010533566.1|  PREDICTED: protein NLP6                            325   2e-95    
ref|XP_001757159.1|  predicted protein                                  321   4e-95    
gb|KHG23727.1|  Protein NLP7 -like protein                              327   7e-95    
ref|XP_009358643.1|  PREDICTED: protein NLP6-like                       327   8e-95    
ref|XP_010325347.1|  PREDICTED: protein NLP6-like isoform X2            319   9e-95    
ref|XP_010439097.1|  PREDICTED: protein NLP7-like                       325   2e-94    
ref|XP_008239167.1|  PREDICTED: protein NLP7-like                       325   2e-94    
gb|KEH17340.1|  plant regulator RWP-RK family protein                   322   3e-94    
ref|XP_010448622.1|  PREDICTED: protein NLP7 isoform X1                 324   4e-94    
ref|XP_010448623.1|  PREDICTED: protein NLP7 isoform X2                 324   5e-94    
gb|KEH17341.1|  plant regulator RWP-RK family protein                   318   8e-94    
gb|KFK30440.1|  hypothetical protein AALP_AA7G261400                    316   4e-93    
ref|XP_010930267.1|  PREDICTED: protein NLP2-like                       320   9e-93    
ref|XP_004245486.1|  PREDICTED: protein NLP7-like isoform X1            320   4e-92    
ref|NP_001042530.1|  Os01g0236700                                       318   5e-92    
ref|XP_004960683.1|  PREDICTED: protein NLP3-like isoform X2            316   6e-92    
ref|XP_006352239.1|  PREDICTED: protein NLP7-like isoform X2            316   9e-91    
gb|KHG18650.1|  Protein NLP7 -like protein                              315   1e-90    
ref|XP_006652467.1|  PREDICTED: protein NLP2-like                       312   5e-90    
ref|XP_010242719.1|  PREDICTED: protein NLP9-like                       313   6e-90    
ref|XP_010112531.1|  Protein NLP8                                       312   8e-90    
ref|NP_001168027.1|  uncharacterized protein LOC100381753               310   1e-89    
emb|CAB61243.1|  nodule inception protein                               310   1e-89    
ref|XP_008337558.1|  PREDICTED: protein NLP6                            312   1e-89    
ref|XP_008648031.1|  PREDICTED: uncharacterized protein LOC100381...    310   2e-89    
gb|KDP36789.1|  hypothetical protein JCGZ_08080                         303   2e-89    
gb|EMT32794.1|  hypothetical protein F775_09781                         305   3e-89    
ref|XP_010908915.1|  PREDICTED: protein NLP2                            310   3e-89    
ref|XP_011043578.1|  PREDICTED: protein NLP8-like                       311   5e-89    
gb|EEE61255.1|  hypothetical protein OsJ_15319                          308   1e-88    
sp|Q0JC27.2|NLP2_ORYSJ  RecName: Full=Protein NLP2; Short=OsNLP2;...    308   2e-88    
emb|CAH67387.1|  OSIGBa0159F11.11                                       308   2e-88    
ref|XP_008791813.1|  PREDICTED: protein NLP2-like isoform X2            308   4e-88    
ref|NP_001053196.1|  Os04g0495800                                       307   5e-88    
ref|XP_006411620.1|  hypothetical protein EUTSA_v10024524mg             301   2e-87    
ref|XP_009104212.1|  PREDICTED: protein NLP9                            304   2e-87    
ref|XP_010240492.1|  PREDICTED: protein NLP2-like                       305   3e-87    
ref|XP_008791812.1|  PREDICTED: protein NLP2-like isoform X1            305   3e-87    
ref|XP_008788345.1|  PREDICTED: protein NLP2                            304   5e-87    
ref|XP_010258489.1|  PREDICTED: protein NLP9                            305   5e-87    
emb|CDX67803.1|  BnaA07g18430D                                          302   7e-87    
ref|XP_006858767.1|  hypothetical protein AMTR_s00066p00148680          305   7e-87    
ref|XP_003576097.2|  PREDICTED: protein NLP2-like                       302   1e-86    
ref|XP_006372780.1|  hypothetical protein POPTR_0017s04980g             304   2e-86    
ref|XP_008800674.1|  PREDICTED: protein NLP2-like                       303   2e-86    
gb|EMT06934.1|  hypothetical protein F775_07477                         305   2e-86    
emb|CAO02974.1|  nodule inception protein                               289   2e-86    
ref|XP_008669225.1|  PREDICTED: protein NLP2-like                       303   2e-86    
ref|XP_004289276.1|  PREDICTED: protein NLP8-like                       303   3e-86    
gb|KHF99462.1|  Protein NLP8                                            303   3e-86    
ref|XP_006413485.1|  hypothetical protein EUTSA_v10024328mg             298   3e-86    
ref|XP_010418526.1|  PREDICTED: protein NLP6-like                       304   4e-86    
gb|EMS47665.1|  Protein NLP2                                            303   6e-86    
ref|XP_007033850.1|  Plant regulator RWP-RK family protein, putat...    300   7e-86    
ref|XP_010682023.1|  PREDICTED: protein NLP9-like                       301   9e-86    
ref|XP_006643969.1|  PREDICTED: protein NLP3-like                       297   9e-86    
ref|XP_011091611.1|  PREDICTED: protein NLP9-like isoform X2            295   9e-86    
ref|XP_007033849.1|  Plant regulator RWP-RK family protein, putat...    300   1e-85    
emb|CAE30325.1|  NIN-like protein 2                                     301   1e-85    
ref|XP_010650669.1|  PREDICTED: protein NLP9 isoform X4                 300   1e-85    
ref|XP_010650667.1|  PREDICTED: protein NLP9 isoform X2                 300   2e-85    
gb|KHN33645.1|  Protein NLP2                                            295   2e-85    
ref|XP_007033851.1|  Plant regulator RWP-RK family protein, putat...    300   2e-85    
ref|XP_007033848.1|  Plant regulator RWP-RK family protein, putat...    301   2e-85    
emb|CAO03018.1|  nodule inception protein                               292   3e-85    
emb|CBI24631.3|  unnamed protein product                                298   3e-85    
ref|XP_008369827.1|  PREDICTED: protein NLP9-like isoform X2            299   4e-85    
ref|XP_008237190.1|  PREDICTED: protein NLP9-like                       299   5e-85    
ref|XP_008369825.1|  PREDICTED: protein NLP9-like isoform X1            299   6e-85    
ref|XP_006290578.1|  hypothetical protein CARUB_v10016665mg             298   6e-85    
ref|XP_010650668.1|  PREDICTED: protein NLP9 isoform X3                 298   8e-85    
ref|XP_010650662.1|  PREDICTED: protein NLP9 isoform X1                 298   9e-85    
emb|CAO02999.1|  nodule inception protein                               291   9e-85    
ref|XP_010517922.1|  PREDICTED: protein NLP8-like isoform X3            295   1e-84    
ref|XP_011073897.1|  PREDICTED: protein NLP9                            299   1e-84    
ref|XP_001769027.1|  predicted protein                                  292   1e-84    
emb|CAO02983.1|  nodule inception protein                               291   1e-84    
gb|KDP43908.1|  hypothetical protein JCGZ_20918                         298   1e-84    
ref|XP_006293639.1|  hypothetical protein CARUB_v10022595mg             297   2e-84    
emb|CDX98383.1|  BnaC06g17440D                                          295   2e-84    
ref|XP_011011865.1|  PREDICTED: protein NLP8-like                       298   2e-84    
emb|CAO03029.1|  nodule inception protein                               290   3e-84    
ref|XP_008359698.1|  PREDICTED: protein NLP9-like                       296   3e-84    
ref|XP_011047733.1|  PREDICTED: protein NLP8-like                       297   4e-84    
ref|XP_010469302.1|  PREDICTED: protein NLP9-like                       296   4e-84    
emb|CAO03002.1|  nodule inception protein                               290   5e-84    
emb|CDP03445.1|  unnamed protein product                                297   6e-84    
ref|XP_004250776.1|  PREDICTED: protein NLP9                            296   7e-84    
ref|XP_008366708.1|  PREDICTED: protein NLP9-like                       296   7e-84    
ref|XP_008661302.1|  PREDICTED: uncharacterized protein LOC100191...    296   8e-84    
ref|XP_009795771.1|  PREDICTED: protein NLP9-like                       296   9e-84    
ref|XP_010517916.1|  PREDICTED: protein NLP8-like isoform X1            295   1e-83    
ref|XP_010517920.1|  PREDICTED: protein NLP8-like isoform X2            295   1e-83    
ref|XP_006372779.1|  hypothetical protein POPTR_0017s04980g             296   1e-83    
ref|XP_004486873.1|  PREDICTED: protein NLP8-like isoform X2            295   1e-83    
ref|XP_009588830.1|  PREDICTED: protein NLP9-like                       296   1e-83    
ref|XP_011091607.1|  PREDICTED: protein NLP9-like isoform X1            295   1e-83    
ref|XP_004152313.1|  PREDICTED: protein NLP8-like                       296   1e-83    
ref|XP_008454098.1|  PREDICTED: protein NLP9                            296   1e-83    
ref|XP_010413675.1|  PREDICTED: protein NLP9-like                       295   2e-83    
ref|XP_009341785.1|  PREDICTED: protein NLP9-like                       295   2e-83    
gb|KDO50764.1|  hypothetical protein CISIN_1g001774mg                   295   3e-83    
emb|CAN71840.1|  hypothetical protein VITISV_040692                     297   3e-83    
gb|EYU36732.1|  hypothetical protein MIMGU_mgv1a000887mg                294   3e-83    
ref|XP_010055983.1|  PREDICTED: protein NLP6 isoform X2                 295   3e-83    
emb|CDX83480.1|  BnaA03g20260D                                          293   3e-83    
ref|XP_006442936.1|  hypothetical protein CICLE_v10018669mg             295   4e-83    
ref|XP_010512222.1|  PREDICTED: protein NLP9-like                       293   5e-83    
ref|XP_006362300.1|  PREDICTED: protein NLP8-like isoform X1            294   5e-83    
ref|XP_004978948.1|  PREDICTED: protein NLP2-like                       292   7e-83    
ref|XP_004507430.1|  PREDICTED: protein NLP8-like                       293   8e-83    
emb|CAO02982.1|  nodule inception protein                               291   8e-83    
ref|XP_010508418.1|  PREDICTED: protein NLP8-like                       293   8e-83    
ref|XP_006581076.1|  PREDICTED: protein NLP2-like                       288   1e-82    
gb|ABA92485.2|  RWP-RK domain containing protein, expressed             291   1e-82    
ref|XP_009385750.1|  PREDICTED: protein NLP2-like                       292   1e-82    
emb|CAP60700.1|  nodule inception protein                               291   1e-82    
gb|KHN19963.1|  Protein NLP1                                            287   2e-82    
ref|XP_002530298.1|  transcription factor, putative                     293   2e-82    
gb|KDO50765.1|  hypothetical protein CISIN_1g001774mg                   293   2e-82    
emb|CAO03025.1|  nodule inception protein                               290   2e-82    
ref|XP_006442937.1|  hypothetical protein CICLE_v10018669mg             293   2e-82    
ref|XP_009340892.1|  PREDICTED: protein NLP9-like                       292   2e-82    
emb|CAO03004.1|  nodule inception protein                               291   2e-82    
ref|XP_007225355.1|  hypothetical protein PRUPE_ppa000933mg             292   2e-82    
emb|CAP60701.1|  nodule inception protein                               290   2e-82    
emb|CAO03005.1|  nodule inception protein                               291   2e-82    
gb|AES67789.2|  plant regulator RWP-RK family protein                   292   2e-82    
emb|CAO03001.1|  nodule inception protein                               290   2e-82    
gb|ABA92484.2|  RWP-RK domain containing protein, expressed             291   2e-82    
ref|XP_003618108.1|  Nodule inception protein                           291   4e-82    
ref|XP_009406431.1|  PREDICTED: protein NLP2-like                       291   5e-82    
ref|XP_002880049.1|  RWP-RK domain-containing protein                   290   7e-82    
ref|XP_010055982.1|  PREDICTED: protein NLP6 isoform X1                 291   9e-82    
ref|XP_007137300.1|  hypothetical protein PHAVU_009G115800g             287   1e-81    
ref|XP_007150469.1|  hypothetical protein PHAVU_005G155100g             290   2e-81    
ref|XP_009133611.1|  PREDICTED: protein NLP8-like isoform X3            288   2e-81    
ref|XP_006592131.1|  PREDICTED: protein NLP8-like                       289   4e-81    
ref|XP_006397520.1|  hypothetical protein EUTSA_v10001299mg             288   4e-81    
ref|NP_181878.1|  nodule inception protein-like protein 8               288   4e-81    
ref|XP_006402676.1|  hypothetical protein EUTSA_v10005779mg             286   8e-81    
ref|XP_003539038.1|  PREDICTED: protein NLP8-like                       288   8e-81    
emb|CDY44231.1|  BnaC03g24230D                                          286   8e-81    
ref|XP_009133610.1|  PREDICTED: protein NLP8-like isoform X2            287   9e-81    
gb|EMT20012.1|  hypothetical protein F775_15797                         287   9e-81    
ref|XP_009133606.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP8...    286   1e-80    
ref|XP_002310422.2|  hypothetical protein POPTR_0007s01530g             287   1e-80    
ref|XP_010506231.1|  PREDICTED: protein NLP8                            286   1e-80    
ref|XP_010912769.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP2...    287   1e-80    
ref|XP_003546980.1|  PREDICTED: protein NLP8-like isoform X1            287   1e-80    
ref|XP_009133609.1|  PREDICTED: protein NLP8-like isoform X1            286   1e-80    
gb|KHG19701.1|  Protein NLP9 -like protein                              286   1e-80    
tpg|DAA37138.1|  TPA: hypothetical protein ZEAMMB73_593515              288   2e-80    
ref|XP_003523488.1|  PREDICTED: protein NLP2-like                       284   2e-80    
gb|AAV64196.1|  unknown                                                 288   3e-80    
ref|XP_009142947.1|  PREDICTED: protein NLP8-like isoform X2            283   5e-80    
ref|XP_007131923.1|  hypothetical protein PHAVU_011G052100g             285   7e-80    
emb|CDX79818.1|  BnaA05g03380D                                          282   7e-80    
emb|CAO02980.1|  nodule inception protein                               278   8e-80    
ref|NP_191517.1|  nodule inception protein-like protein 9               283   2e-79    
ref|XP_004486872.1|  PREDICTED: protein NLP8-like isoform X1            284   2e-79    
ref|XP_003597538.1|  Beta-galactosidase                                 284   2e-79    
gb|AFW58707.1|  hypothetical protein ZEAMMB73_961517                    283   2e-79    
ref|XP_009142946.1|  PREDICTED: protein NLP8-like isoform X1            281   3e-79    
gb|AAQ62879.1|  At3g59580                                               280   1e-78    
ref|NP_195547.1|  nodule inception protein-like protein 3               278   2e-78    
ref|XP_003606812.1|  Nodule inception protein                           280   2e-78    
ref|XP_009385448.1|  PREDICTED: protein NLP2-like isoform X2            280   2e-78    
ref|XP_002866792.1|  RWP-RK domain-containing protein                   275   4e-78    
gb|EPS63477.1|  hypothetical protein M569_11304                         269   5e-78    
ref|XP_010026047.1|  PREDICTED: protein NLP8-like                       279   7e-78    
gb|EEE51939.1|  hypothetical protein OsJ_33567                          278   1e-77    
ref|XP_009385447.1|  PREDICTED: protein NLP2-like isoform X1            278   1e-77    
ref|XP_010431765.1|  PREDICTED: protein NLP3-like                       273   2e-77    
ref|XP_006595080.1|  PREDICTED: protein NLP8-like isoform X5            277   3e-77    
ref|XP_010436926.1|  PREDICTED: protein NLP3-like                       273   3e-77    
gb|EMS47666.1|  Protein NLP2                                            276   5e-77    
gb|KHN25315.1|  Protein NLP8                                            276   1e-76    
emb|CAD37947.1|  nodule inception protein                               275   1e-76    
emb|CAD37949.1|  nodule inception protein                               275   1e-76    
emb|CAD37946.1|  nodule inception protein                               275   2e-76    
emb|CAD37948.1|  nodule inception protein                               275   2e-76    
ref|XP_004244743.1|  PREDICTED: protein NLP9-like                       275   2e-76    
gb|EEC67971.1|  hypothetical protein OsI_35726                          275   3e-76    
gb|KHN29879.1|  Protein NLP2                                            270   3e-76    



>ref|XP_010320465.1| PREDICTED: protein NLP4 isoform X2 [Solanum lycopersicum]
Length=647

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/629 (62%), Positives = 484/629 (77%), Gaps = 31/629 (5%)
 Frame = +2

Query  254   MDESVFPSSIVLNTTsdssfmdlddllf--EGCWLETTDGSEFFQHSPFNANALFEPSYV  427
             MDE V PS+ +L T SD             EGCWLETTDG+EF QHSP   NA F+ S++
Sbjct  1     MDERVIPSNPLLTTPSDYLMDLDYMDGLFLEGCWLETTDGNEFLQHSPGIFNAPFDSSFM  60

Query  428   LPD-LEPNNGEL----MKESEVERKKSSLPENLSAS---QFHTERVQCFGQNGSNAVCSS  583
              P  ++ NN E      K+++ E+++ SL ENLS +   + +  +VQ FG+N +NA+C+S
Sbjct  61    WPTTIDANNVEFNGISSKDAQQEKQRPSLTENLSINHCQELNYAKVQSFGENMNNAMCTS  120

Query  584   GLAE-----SSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGR  748
              L+E     + EL++RWWIGP A++SVMDRLI ALGYI+D SRDKD+L+Q+WVP+NRDGR
Sbjct  121   SLSENHLVEAHELNKRWWIGPKASSSVMDRLIWALGYIRDCSRDKDILLQLWVPINRDGR  180

Query  749   RVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQ  928
             RVL T +QPF LDL CP+LA+YR++S+NY+FP  EDS+E VGLPGRVF  KVPEWTPDV+
Sbjct  181   RVLSTTNQPFLLDLNCPQLANYREVSVNYQFPANEDSKEIVGLPGRVFADKVPEWTPDVR  240

Query  929   LFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKAL  1108
              F+ EEYPRV HAQ+YDVRGT AVPVF+QGSR CLGVIEVV+TTQK+KYR+EL+SVCKAL
Sbjct  241   FFRSEEYPRVEHAQQYDVRGTLAVPVFEQGSRNCLGVIEVVMTTQKIKYRSELESVCKAL  300

Query  1109  EEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGL  1285
             E VDL  S++S  ++ K C  SYQ  LPE+LEVLKSAC TH LPLAQTWVPC+QQGK G 
Sbjct  301   EAVDLSTSEVSTTQDAKVCDLSYQAALPEVLEVLKSACETHGLPLAQTWVPCIQQGKGGC  360

Query  1286  RHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADIT  1465
             RHS ENL+ CVST DSACY+ADPR+QGFH+ACSEHHLLKG GVVGRAF TNQPCFSAD+T
Sbjct  361   RHSQENLIHCVSTEDSACYVADPRVQGFHDACSEHHLLKGQGVVGRAFNTNQPCFSADLT  420

Query  1466  SFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLS  1645
             S+SK+EYPLSHYA++F LQAAVAIRLRS  TGS+DFVLEFFLP DC++PE+H++MLTSLS
Sbjct  421   SYSKSEYPLSHYAKMFGLQAAVAIRLRSISTGSSDFVLEFFLPSDCRNPEDHRKMLTSLS  480

Query  1646  IIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWT  1825
             IIIQNVC+TLRVVT++EL+EET S   ++A H+ +  HKE             +E  SWT
Sbjct  481   IIIQNVCRTLRVVTDKELQEETIS-VGEMANHT-VEQHKE--------HTETSQERTSWT  530

Query  1826  SSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKR  2005
             S     QES + S+ FQ+EKP E+L K   EF      +++    EG ++N+ + GD++R
Sbjct  531   SCDAEFQESSVMST-FQDEKPDEMLRKDSVEFRHRKNSAYE----EGVSRNLGKTGDRRR  585

Query  2006  MKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              KAEKTITLQ+LQQYFAGSLKDAAKS+GV
Sbjct  586   AKAEKTITLQVLQQYFAGSLKDAAKSIGV  614



>ref|XP_004238434.1| PREDICTED: protein NLP4 isoform X1 [Solanum lycopersicum]
 ref|XP_010320461.1| PREDICTED: protein NLP4 isoform X1 [Solanum lycopersicum]
 ref|XP_010320462.1| PREDICTED: protein NLP4 isoform X1 [Solanum lycopersicum]
 ref|XP_010320463.1| PREDICTED: protein NLP4 isoform X1 [Solanum lycopersicum]
 ref|XP_010320464.1| PREDICTED: protein NLP4 isoform X1 [Solanum lycopersicum]
Length=912

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/629 (62%), Positives = 484/629 (77%), Gaps = 31/629 (5%)
 Frame = +2

Query  254   MDESVFPSSIVLNTTsdssfmdlddllf--EGCWLETTDGSEFFQHSPFNANALFEPSYV  427
             MDE V PS+ +L T SD             EGCWLETTDG+EF QHSP   NA F+ S++
Sbjct  1     MDERVIPSNPLLTTPSDYLMDLDYMDGLFLEGCWLETTDGNEFLQHSPGIFNAPFDSSFM  60

Query  428   LPD-LEPNNGEL----MKESEVERKKSSLPENLSAS---QFHTERVQCFGQNGSNAVCSS  583
              P  ++ NN E      K+++ E+++ SL ENLS +   + +  +VQ FG+N +NA+C+S
Sbjct  61    WPTTIDANNVEFNGISSKDAQQEKQRPSLTENLSINHCQELNYAKVQSFGENMNNAMCTS  120

Query  584   GLAE-----SSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGR  748
              L+E     + EL++RWWIGP A++SVMDRLI ALGYI+D SRDKD+L+Q+WVP+NRDGR
Sbjct  121   SLSENHLVEAHELNKRWWIGPKASSSVMDRLIWALGYIRDCSRDKDILLQLWVPINRDGR  180

Query  749   RVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQ  928
             RVL T +QPF LDL CP+LA+YR++S+NY+FP  EDS+E VGLPGRVF  KVPEWTPDV+
Sbjct  181   RVLSTTNQPFLLDLNCPQLANYREVSVNYQFPANEDSKEIVGLPGRVFADKVPEWTPDVR  240

Query  929   LFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKAL  1108
              F+ EEYPRV HAQ+YDVRGT AVPVF+QGSR CLGVIEVV+TTQK+KYR+EL+SVCKAL
Sbjct  241   FFRSEEYPRVEHAQQYDVRGTLAVPVFEQGSRNCLGVIEVVMTTQKIKYRSELESVCKAL  300

Query  1109  EEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGL  1285
             E VDL  S++S  ++ K C  SYQ  LPE+LEVLKSAC TH LPLAQTWVPC+QQGK G 
Sbjct  301   EAVDLSTSEVSTTQDAKVCDLSYQAALPEVLEVLKSACETHGLPLAQTWVPCIQQGKGGC  360

Query  1286  RHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADIT  1465
             RHS ENL+ CVST DSACY+ADPR+QGFH+ACSEHHLLKG GVVGRAF TNQPCFSAD+T
Sbjct  361   RHSQENLIHCVSTEDSACYVADPRVQGFHDACSEHHLLKGQGVVGRAFNTNQPCFSADLT  420

Query  1466  SFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLS  1645
             S+SK+EYPLSHYA++F LQAAVAIRLRS  TGS+DFVLEFFLP DC++PE+H++MLTSLS
Sbjct  421   SYSKSEYPLSHYAKMFGLQAAVAIRLRSISTGSSDFVLEFFLPSDCRNPEDHRKMLTSLS  480

Query  1646  IIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWT  1825
             IIIQNVC+TLRVVT++EL+EET S   ++A H+ +  HKE             +E  SWT
Sbjct  481   IIIQNVCRTLRVVTDKELQEETIS-VGEMANHT-VEQHKE--------HTETSQERTSWT  530

Query  1826  SSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKR  2005
             S     QES + S+ FQ+EKP E+L K   EF      +++    EG ++N+ + GD++R
Sbjct  531   SCDAEFQESSVMST-FQDEKPDEMLRKDSVEFRHRKNSAYE----EGVSRNLGKTGDRRR  585

Query  2006  MKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              KAEKTITLQ+LQQYFAGSLKDAAKS+GV
Sbjct  586   AKAEKTITLQVLQQYFAGSLKDAAKSIGV  614



>ref|XP_006342136.1| PREDICTED: protein NLP4-like isoform X1 [Solanum tuberosum]
 ref|XP_006342137.1| PREDICTED: protein NLP4-like isoform X2 [Solanum tuberosum]
 ref|XP_006342138.1| PREDICTED: protein NLP4-like isoform X3 [Solanum tuberosum]
 ref|XP_006342139.1| PREDICTED: protein NLP4-like isoform X4 [Solanum tuberosum]
Length=913

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/629 (62%), Positives = 484/629 (77%), Gaps = 31/629 (5%)
 Frame = +2

Query  254   MDESVFPSSIVLNTTsdssfmdlddllf--EGCWLETTDGSEFFQHSPFNANALFEPSYV  427
             MDE V PS+ +L T SD             EGCWLE+TDG+EF QHSP   NA F+ S++
Sbjct  1     MDERVIPSNPLLTTPSDYLMDLDYMDGLFLEGCWLESTDGNEFLQHSPGIFNAPFDSSFM  60

Query  428   LPD-LEPNNGEL----MKESEVERKKSSLPENLSAS---QFHTERVQCFGQNGSNAVCSS  583
              P  ++ NN E      K+++ E+++ SL ENLS +   + +  +VQ FG+N +NA+C+S
Sbjct  61    WPTTIDANNVEFNGISSKDAQQEKQRPSLTENLSINHCQEINYAKVQSFGENMNNAMCTS  120

Query  584   GLAE-----SSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGR  748
              L+E     + EL++RWWIGP A++SVMDRLI ALGYI+D SRDKD+L+Q+WVP+NRDGR
Sbjct  121   SLSENHLVEAPELNKRWWIGPKASSSVMDRLIWALGYIRDCSRDKDILLQLWVPINRDGR  180

Query  749   RVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQ  928
             RVL T +QPF LDL CP+LA+YR++S+ Y+FP  EDS++ VGLPGRVF  KVPEWTPDV+
Sbjct  181   RVLSTTNQPFLLDLNCPQLANYREVSVKYQFPANEDSKDIVGLPGRVFADKVPEWTPDVR  240

Query  929   LFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKAL  1108
              F+ EEYPRV HAQ+YDVRGT AVPVF+QGSR CLGVIEVV+TTQK+KYR+EL+SVCKAL
Sbjct  241   FFRSEEYPRVEHAQQYDVRGTLAVPVFEQGSRNCLGVIEVVMTTQKIKYRSELESVCKAL  300

Query  1109  EEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGL  1285
             E VDL  S++S  ++ K C  SYQ  LPE+LEVLKSAC TH LPLAQTWVPC+QQGK G 
Sbjct  301   EAVDLSTSEVSTTQDAKVCDLSYQAALPEVLEVLKSACETHGLPLAQTWVPCIQQGKGGC  360

Query  1286  RHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADIT  1465
             RHS+ENL+ CVST DSACY+ADPR+QGFH+ACSEHHLLKG GVVGRAF TNQPCFSAD+T
Sbjct  361   RHSEENLIHCVSTEDSACYVADPRVQGFHDACSEHHLLKGKGVVGRAFNTNQPCFSADLT  420

Query  1466  SFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLS  1645
             S+SK+EYPLSHYA++F LQAAVAIRLRS  TGS+DFVLEFFLP DC++PE+H++MLTSLS
Sbjct  421   SYSKSEYPLSHYAKMFGLQAAVAIRLRSISTGSSDFVLEFFLPSDCRNPEDHRKMLTSLS  480

Query  1646  IIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWT  1825
             IIIQNVC+TLRVVT++EL+EET S   +VA H+ +  HKE             +E  SWT
Sbjct  481   IIIQNVCRTLRVVTDKELQEETVS-MGEVANHT-VEPHKE--------HTETSQERTSWT  530

Query  1826  SSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKR  2005
             S     QES + S+ FQ+EKP E+L K   EF      +++    EG ++N+ + GD++R
Sbjct  531   SCDAEFQESSVMST-FQDEKPDEMLRKDSVEFRHRKNSAYE----EGVSRNLGKTGDRRR  585

Query  2006  MKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              KAEKTITLQ+LQQYFAGSLKDAAKS+GV
Sbjct  586   AKAEKTITLQVLQQYFAGSLKDAAKSIGV  614



>ref|XP_009773664.1| PREDICTED: protein NLP5-like [Nicotiana sylvestris]
 ref|XP_009773735.1| PREDICTED: protein NLP5-like [Nicotiana sylvestris]
 ref|XP_009773797.1| PREDICTED: protein NLP5-like [Nicotiana sylvestris]
Length=922

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/608 (63%), Positives = 462/608 (76%), Gaps = 24/608 (4%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNG-----ELMKESEVERKKSSLP  502
             EGC+LET D  +F  H P  +N  F+ S+V P L   NG        K+ + ER++SS  
Sbjct  33    EGCFLETIDDRDFVHHRPSISNMPFDSSFVWPTLLDTNGFEFSGSPSKDGQQERQRSSFS  92

Query  503   ENLSASQF---HTERVQCFGQNGSNAVCSSG-----LAESSELSRRWWIGPMATTSVMDR  658
             +NLS SQF   ++ +VQ FG N  NA+CSSG     L ++ ELSRRWWIGP A++SVMDR
Sbjct  93    KNLSISQFQELNSAKVQSFGDNSINAMCSSGQSENCLFDAPELSRRWWIGPNASSSVMDR  152

Query  659   LIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             LIQALGYIK+FS+DKD+LIQIWVP+ RDG+RVL T DQPF LDL CPRLAHYR  S++Y+
Sbjct  153   LIQALGYIKNFSKDKDILIQIWVPIYRDGKRVLSTNDQPFSLDLNCPRLAHYRQASLSYQ  212

Query  839   FPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
             FP  +DS+E VGLPGRVFL KVPEW+PDVQ F+ EEYPRVGHAQ+++VRGTFAVPVF+QG
Sbjct  213   FPANDDSKEIVGLPGRVFLDKVPEWSPDVQFFQMEEYPRVGHAQQHNVRGTFAVPVFEQG  272

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEI  1195
             S  CL VIEVV+TTQK+KY +EL+SVCKALE VDLR S++S+  + K C  +YQ  L EI
Sbjct  273   SHNCLSVIEVVMTTQKIKYGSELESVCKALEAVDLRSSEVSSTLSAKACDLTYQAALSEI  332

Query  1196  LEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHE  1375
             LEVLKSAC TH LPLAQTWVPC+Q GK G RHS+ENL+RCVST DSACY+ADPR+QGFHE
Sbjct  333   LEVLKSACKTHGLPLAQTWVPCIQHGKGGSRHSNENLVRCVSTEDSACYVADPRVQGFHE  392

Query  1376  ACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTC  1555
             ACSEHHLLKG GVVG AFMTNQPCF++D+TS+SK EYPLSHYAR+F L AAVAI LRS  
Sbjct  393   ACSEHHLLKGQGVVGSAFMTNQPCFTSDLTSYSKAEYPLSHYARMFGLHAAVAIPLRSMS  452

Query  1556  TGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVA  1735
             TGS+DFVLEF LP +C++PEEHK MLTSLSIIIQNVCQT RVV+E+EL+EET S   +V 
Sbjct  453   TGSSDFVLEFLLPPNCRNPEEHKSMLTSLSIIIQNVCQTYRVVSEKELQEETVS-LGEVT  511

Query  1736  KHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLP  1915
               +     +EV   +   SI   +E  SWTSS + VQ++    SAFQ+EKP E+L +   
Sbjct  512   SLAASEYTEEVREKERKGSIVSSQERTSWTSSHIEVQQTSSVISAFQDEKPVEVLTEEPV  571

Query  1916  EFV----SGSGLSFD-----STSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLK  2068
              F     SGS  +F       TSGEG +   R+A D++R+KAEK ITLQILQQYFAGSLK
Sbjct  572   TFRNQTNSGSATTFAFSRNYRTSGEGISHTWRKARDRRRLKAEKNITLQILQQYFAGSLK  631

Query  2069  DAAKSLGV  2092
             DAAKS+GV
Sbjct  632   DAAKSIGV  639



>ref|XP_009622679.1| PREDICTED: protein NLP5-like [Nicotiana tomentosiformis]
 ref|XP_009622680.1| PREDICTED: protein NLP5-like [Nicotiana tomentosiformis]
Length=903

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/630 (63%), Positives = 471/630 (75%), Gaps = 39/630 (6%)
 Frame = +2

Query  254   MDESVFPSSIVLNTTsdssfmdlddl--lfEGCWLETTDGSEFFQHSPFNANALFEPSYV  427
             MDESV PS+ +L   SD           L EGCWLETTDG+EF Q+SP   NA F+ S++
Sbjct  1     MDESVIPSNPLLTNQSDYLMDLDYMDGLLLEGCWLETTDGNEFMQNSPATFNAPFDSSFM  60

Query  428   LPDLEPNNGELMKESEVERKKSSLPENLSASQFHTERVQCFGQNGSNAVCSSG-----LA  592
              P+    N   +  SE+  K +             +++Q FG+N +NA+C+SG     L 
Sbjct  61    WPNTIDTNS--VDFSEIPSKDNQ----------QEKQIQLFGENVNNAMCTSGQSENHLV  108

Query  593   ESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQ  772
             E+ EL+RRWWIGP A++SVMDRLI ALG+I+D SRDKD+L+Q+WVP+NRDGRRVL T DQ
Sbjct  109   EAPELNRRWWIGPKASSSVMDRLIWALGHIRDCSRDKDILLQLWVPINRDGRRVLSTTDQ  168

Query  773   PFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYP  952
             PF LDL CPRLA+YR +S+NY+FP  EDS+E VGLPGRVF  KVPEW+PDV+ F+ EEYP
Sbjct  169   PFLLDLNCPRLANYRQVSVNYQFPANEDSKEIVGLPGRVFADKVPEWSPDVRFFRSEEYP  228

Query  953   RVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGS  1132
             RV HAQ+YDVRGT AVPVF+QGSR CLGVIEVV+TTQK+KYR EL+SVC+ALE V+LR S
Sbjct  229   RVEHAQQYDVRGTLAVPVFEQGSRNCLGVIEVVMTTQKIKYRPELESVCEALEAVNLRTS  288

Query  1133  KISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLL  1309
             ++S  +N K C  SYQ  L EILEVLKSAC TH LPLAQTWVPCVQQGK G RHS+ENL+
Sbjct  289   EVSTTQNAKECDLSYQPALSEILEVLKSACETHGLPLAQTWVPCVQQGKGGCRHSEENLI  348

Query  1310  RCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYP  1489
              CVST DSACY+ADP ++GFHEACSEHHLLKG GVVGRAFMTNQPCFSAD+TS+SKTEYP
Sbjct  349   HCVSTEDSACYVADPHVRGFHEACSEHHLLKGQGVVGRAFMTNQPCFSADLTSYSKTEYP  408

Query  1490  LSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQ  1669
             LSH+A++F LQAAVAIRLRS  TGS DFVLEFFLP DC++PEEH+RMLTSLSIIIQNVC+
Sbjct  409   LSHHAQMFGLQAAVAIRLRSISTGSCDFVLEFFLPSDCRNPEEHRRMLTSLSIIIQNVCR  468

Query  1670  tlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQE  1849
             TLRVVT++EL+EE  S   + A  S IR +KE             +E  SWTS     QE
Sbjct  469   TLRVVTDKELQEEAVS-IGEAANPSFIRSNKE--------HTETSQERTSWTSCDAEFQE  519

Query  1850  SCMSSSAFQNEKPSELLYKRLPEFV----SGSGLSF-----DSTSGEGSAQNVRRAGDKK  2002
             S    SAFQ+EKP E L K   EF     SG G++F        SGEG ++N ++ GD++
Sbjct  520   SSTVVSAFQDEKPDETLRKEPVEFRHHNDSGYGMNFALNENRCASGEGVSRNGKK-GDRR  578

Query  2003  RMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R KAEKTITL+ILQQYFAGSLKDAAKS+GV
Sbjct  579   RTKAEKTITLEILQQYFAGSLKDAAKSIGV  608



>ref|XP_009600534.1| PREDICTED: protein NLP5-like [Nicotiana tomentosiformis]
 ref|XP_009600535.1| PREDICTED: protein NLP5-like [Nicotiana tomentosiformis]
Length=924

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/603 (64%), Positives = 456/603 (76%), Gaps = 19/603 (3%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNN-----GELMKESEVERKKSSLP  502
             EGC+LET D  EF  H P  +N  F+ S+V P L   N     G   K+ + ER++ S  
Sbjct  33    EGCFLETIDDREFAHHRPSISNMPFDSSFVWPTLLDTNDVEFSGSPSKDGQQERQRLSFS  92

Query  503   ENLSASQF---HTERVQCFGQNGSNAVCSSG----LAESSELSRRWWIGPMATTSVMDRL  661
             +NLS SQF   ++ +VQ FG+N  NA+CSSG    L ++ ELSRRWWIGP  ++SVMDRL
Sbjct  93    KNLSVSQFQELNSVKVQSFGENSINAMCSSGQSDCLFDAPELSRRWWIGPNDSSSVMDRL  152

Query  662   IQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEF  841
             IQALGYIK+ S+DKD+LIQIWVP+ RDG+RVL T DQPF LDL CPRLAHYR  S+NY+F
Sbjct  153   IQALGYIKNCSKDKDILIQIWVPIYRDGKRVLSTNDQPFSLDLNCPRLAHYRQASLNYQF  212

Query  842   PVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
             P  +DS+E VGLPGRVFL KVPEWTPDVQ F+ EEYPRVGHAQ+Y+VRGT AVPVF+QGS
Sbjct  213   PANDDSKEMVGLPGRVFLDKVPEWTPDVQFFQMEEYPRVGHAQQYNVRGTLAVPVFEQGS  272

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEIL  1198
             R CL VIEVV TTQK+KY +EL+SVCKALE VDLR S++S+    K C  +YQ  L EIL
Sbjct  273   RNCLSVIEVVRTTQKIKYSSELESVCKALEAVDLRSSEVSSTLTAKACDLTYQAALSEIL  332

Query  1199  EVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEA  1378
             EVLKSAC TH LPLAQTWVPC+Q GK G RHS+ENL+ CVST DSACY+ADPR+QGFHEA
Sbjct  333   EVLKSACKTHGLPLAQTWVPCIQHGKGGSRHSNENLIHCVSTEDSACYVADPRVQGFHEA  392

Query  1379  CSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCT  1558
             CSEHHLLKG GVVG AFMTNQPCF+AD+TS+SK EYPLSHYAR+F L AAVAIRLRS  T
Sbjct  393   CSEHHLLKGQGVVGSAFMTNQPCFTADLTSYSKAEYPLSHYARMFGLHAAVAIRLRSMST  452

Query  1559  GSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAK  1738
             GS+DFVLEFFLP +C++PEEHKRMLTSLSIIIQNVCQT RVV+++EL++ET S   +V  
Sbjct  453   GSSDFVLEFFLPPNCRNPEEHKRMLTSLSIIIQNVCQTFRVVSDKELQDETVS-LGEVTS  511

Query  1739  HSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPE  1918
              +     +EV   +   SI   +E  SWTSS   VQE+    SAFQ+E  +E       +
Sbjct  512   VAASEYSEEVREQERKGSIVSSQERTSWTSSHEEVQETSSVVSAFQDELLTEEPVALRNQ  571

Query  1919  FVSGSGLSFD-----STSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKS  2083
               SGS  +F       T+GEG + N R+A D++R+KAEK ITLQILQQYFAGSLKDAAKS
Sbjct  572   TNSGSATAFAFSRNYRTAGEGISHNWRKARDRRRLKAEKNITLQILQQYFAGSLKDAAKS  631

Query  2084  LGV  2092
             +GV
Sbjct  632   IGV  634



>ref|XP_009759077.1| PREDICTED: protein NLP4-like [Nicotiana sylvestris]
 ref|XP_009759078.1| PREDICTED: protein NLP4-like [Nicotiana sylvestris]
Length=903

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/632 (62%), Positives = 473/632 (75%), Gaps = 43/632 (7%)
 Frame = +2

Query  254   MDESVFPSSIVLNTTsd--ssfmdlddllfEGCWLETTDGSEFFQHSPFNANALFEPSYV  427
             MDE+V PS+ +L   SD       +D LL EGCWLETTDG+EF Q+SP N NA F+ S++
Sbjct  1     MDETVIPSNPLLTNQSDYFMDLDYVDGLLLEGCWLETTDGNEFLQNSPANFNAPFDSSFM  60

Query  428   LPD-LEPNNGELMKESEVERKKSSLPENLSASQFHTER-VQCFGQNGSNAVCSSGLAESS  601
              P+ ++ NN E                 + +  F  E+ +Q FG+N +NA+C+SG +ES 
Sbjct  61    WPNTIDTNNVEF--------------NGIPSKDFQEEKQIQPFGENVNNAMCTSGQSESH  106

Query  602   -----ELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTG  766
                  EL+RRWW GP A++SVMDRLI ALG+I+D SRDKD+L+Q+WVP+NRDGR VL T 
Sbjct  107   FVEAPELNRRWWFGPKASSSVMDRLIWALGHIRDCSRDKDILLQLWVPINRDGRHVLSTT  166

Query  767   DQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREE  946
             DQPF LDL CPRLA+YR +S+NY+FP  EDS+E VGLPGRVF  KVPEW+PDV+ F+ EE
Sbjct  167   DQPFLLDLNCPRLANYRQVSVNYQFPANEDSKEIVGLPGRVFADKVPEWSPDVRFFRSEE  226

Query  947   YPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLR  1126
             YPRV HAQ+YDVRGT AVPVF+QGSR CLGVIEVV+TTQK+KYR EL+SVC+AL+ V+LR
Sbjct  227   YPRVEHAQQYDVRGTLAVPVFEQGSRNCLGVIEVVMTTQKIKYRPELESVCEALKAVNLR  286

Query  1127  GSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDEN  1303
              S++S  +N K C  SYQ  LPEILEVLKSAC TH LPLAQTWVPCVQQGK G RHS+EN
Sbjct  287   TSEVSTTQNAKVCDLSYQAALPEILEVLKSACETHGLPLAQTWVPCVQQGKGGCRHSEEN  346

Query  1304  LLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTE  1483
             L+ CVST DSACY+ADP ++GFHEACSEHHLLKG GVVGRAFMTNQPCFSAD+TS+SKTE
Sbjct  347   LIHCVSTEDSACYVADPHVRGFHEACSEHHLLKGQGVVGRAFMTNQPCFSADLTSYSKTE  406

Query  1484  YPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNV  1663
             YPLSH+A++F LQAAVAIRLRS  TGS DFVLEFFLP DC++PEEH++MLTSLSIIIQNV
Sbjct  407   YPLSHHAQMFGLQAAVAIRLRSISTGSCDFVLEFFLPSDCRNPEEHRKMLTSLSIIIQNV  466

Query  1664  CQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLV  1843
             C+TLRVVT++EL+EE  S   + A  S IR +KE             +E  SWTS     
Sbjct  467   CRTLRVVTDKELQEEAVS-IGEAANPSFIRSNKE--------QTETSQERTSWTSCDAEF  517

Query  1844  QESCMSSSAFQNEKPSELLYKRLPEFV----SGSGLSF-----DSTSGEGSAQNVRRAGD  1996
             QES    SAF +EKP E+L K   EF     S  G+ F        SGEG ++N ++ GD
Sbjct  518   QESSTVVSAFHDEKPDEMLRKEPVEFRHHNDSDYGMDFALNENHCASGEGVSRNGKK-GD  576

Query  1997  KKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             ++R KAEKTITL+ILQQYFAGSLKDAAKS+GV
Sbjct  577   RRRTKAEKTITLEILQQYFAGSLKDAAKSIGV  608



>ref|XP_011074088.1| PREDICTED: protein NLP5-like [Sesamum indicum]
 ref|XP_011074089.1| PREDICTED: protein NLP5-like [Sesamum indicum]
Length=928

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/640 (59%), Positives = 456/640 (71%), Gaps = 36/640 (6%)
 Frame = +2

Query  254   MDESVFPSSIVLNTTsdssfmdlddll--fEGCWLETTDGSEFFQHSPFNANALFEPSYV  427
             M+E V P S VL T SD+            EGCWLE  +GSEF Q       + FEPS+ 
Sbjct  1     MEEGVLPLSTVLGTPSDTFMDLDYMDELLMEGCWLEA-NGSEFSQFDCSTPISPFEPSFA  59

Query  428   --LPDLEPNNGEL----MKESEVERKKSSLPENLSASQF----HTERVQCFGQNGSNAVC  577
               +P LE NNGE      K+   ER++SS PENLS SQ     H ++     +N  NA  
Sbjct  60    WPVPVLEANNGESGGSPSKDGHEERQRSSFPENLSISQSQGPQHYKKPVSHVENICNAFG  119

Query  578   SSG-----LAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRD  742
             SS      L E SEL++RWWIGP A+T VMDRLIQALGYIKD SRDKDVLIQ+WVPV R 
Sbjct  120   SSAQSENYLLEVSELTKRWWIGPRASTPVMDRLIQALGYIKDRSRDKDVLIQVWVPVIRG  179

Query  743   GRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPD  922
             G+RVL T +QPF L++ CPRLAHYR+IS+N++FP EEDS+E VGLPGRVF  KVPEWTPD
Sbjct  180   GKRVLTTSNQPFSLEVNCPRLAHYREISVNFQFPAEEDSKEVVGLPGRVFRSKVPEWTPD  239

Query  923   VQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCK  1102
             V+ F R+EYPRVGHAQ+YDVRGT AVPV +QGSR+CLGVIEVVLTTQK++YR EL+SVCK
Sbjct  240   VRFFTRDEYPRVGHAQQYDVRGTLAVPVLEQGSRSCLGVIEVVLTTQKIQYRPELESVCK  299

Query  1103  ALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKE  1279
             ALE VDLR +++S+ +NVKT   SYQ  LPEILEVL+SAC TH LPLAQTWV C  QG  
Sbjct  300   ALEAVDLRIAEVSSTQNVKTTDLSYQAALPEILEVLRSACGTHGLPLAQTWVQCTLQGNG  359

Query  1280  GLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSAD  1459
             G RHSDENL  CVS VDSACYI D RIQGFH+ACSE+HLLKG G+VGRAF TNQPCFS D
Sbjct  360   GCRHSDENLRNCVSPVDSACYIGDSRIQGFHDACSEYHLLKGQGIVGRAFRTNQPCFSPD  419

Query  1460  ITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTS  1639
             IT+++KTEYPLSH+AR+F L+AAVAIRLRS CTGS DFVLEFFLP +CK PEE K++LTS
Sbjct  420   ITAYNKTEYPLSHHARMFGLKAAVAIRLRSICTGSADFVLEFFLPMNCKDPEEQKKLLTS  479

Query  1640  LSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLS  1819
             LS IIQNVC+    V  ++   E +  + + A    + I KEV  + +   + P    ++
Sbjct  480   LSTIIQNVCR-TLRVVSEKELLEESGLADEAANTPVMSISKEVHKVDHAQFLQPFPSQVN  538

Query  1820  WTSSPMLVQESCMSSSAFQNEKPSELLYK----RL--PEFVSGSGLSFD---STSGEGSA  1972
                     QES  + S FQN K  E+L +    RL  P+     G++FD   STSG+GS+
Sbjct  539   H-------QESGSAVSPFQNGKSGEVLAESSDVRLAQPDSNPREGVTFDTNTSTSGDGSS  591

Query  1973  QNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                 + G+K+R+K EKTITLQ+L+Q+FAGSLKDAA++LGV
Sbjct  592   LYTNKTGEKRRIKGEKTITLQVLRQHFAGSLKDAARNLGV  631



>emb|CDP07286.1| unnamed protein product [Coffea canephora]
Length=898

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/595 (59%), Positives = 431/595 (72%), Gaps = 36/595 (6%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLETT+G E     P + NALF+ S+  P LE  NGE       E ++ SL  N SA
Sbjct  34    EGCWLETTEGPELLSDGPSDFNALFDASFTWPILEAINGESNPLKSTEEERQSLSGNFSA  93

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSR  697
                                      ESS LSRR WIGP A+TSVMDRLI+ALGY+KD++ 
Sbjct  94    -------------------------ESSALSRRLWIGPRASTSVMDRLIKALGYMKDWAG  128

Query  698   DKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGL  877
             DK+ LIQIWVPVN+ GRRVL T DQPF LDL CPRLA YR++S+NY+F  EED +E+VGL
Sbjct  129   DKNALIQIWVPVNKGGRRVLTTNDQPFSLDLNCPRLASYRNVSVNYQFSTEEDLKESVGL  188

Query  878   PGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLT  1057
             PGRVF+G+VPEWTPDVQ F+ +EYPRVGHAQ+YDVRGT AVP+F+QGSR CLGVIEVVLT
Sbjct  189   PGRVFMGRVPEWTPDVQFFRTDEYPRVGHAQQYDVRGTLAVPIFEQGSRNCLGVIEVVLT  248

Query  1058  TQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKL  1234
             TQK+ YR EL+SVC+AL+ V+LR S +S  +N K C  SYQ  LPEI E+L++AC T+ L
Sbjct  249   TQKINYRPELESVCRALQAVNLRSSDVSGAQNSKACDFSYQSALPEIQEILRAACGTYSL  308

Query  1235  PLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGV  1414
             PLAQTWVPC++QGK G RHSDENL+RCVSTVDSACYIAD  +QGF +ACSEHHLLKG G+
Sbjct  309   PLAQTWVPCIKQGKGGCRHSDENLVRCVSTVDSACYIADSHVQGFSDACSEHHLLKGQGI  368

Query  1415  VGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLP  1594
             VGRAF TNQPCFS DIT+F+KT+YPLSH+ARIF L AAVAIRLRS  +GSTDFVLEFFLP
Sbjct  369   VGRAFTTNQPCFSPDITTFTKTDYPLSHHARIFGLCAAVAIRLRSIYSGSTDFVLEFFLP  428

Query  1595  RDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPN  1774
              DCK  EEH++ML+SLS+IIQ  C+ LRV+T++EL EE + PS  V+  S I+  +E+  
Sbjct  429   VDCKDAEEHQKMLSSLSLIIQKFCRGLRVITDKELLEENSVPSGGVSIPSYIKFGEEMSK  488

Query  1775  LKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKR-------LPEFVS-G  1930
              +   S    +    WTS    V+E+ + +S  QN KP E+L  +       LP+  S  
Sbjct  489   TERRHSAMASQRSF-WTSRHAEVEETAVVASKIQNAKPVEMLSGKFSAVRQSLPDISSRK  547

Query  1931  SGLSFDS-TSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               +  DS T G+ S  +V +  +K+  KAEKTITLQ+L+QYFAGSLKDAA+++GV
Sbjct  548   ERMCGDSLTRGQCSLLDVSKTAEKRGAKAEKTITLQMLRQYFAGSLKDAARNIGV  602



>ref|XP_010663967.1| PREDICTED: protein NLP4-like [Vitis vinifera]
 ref|XP_010663968.1| PREDICTED: protein NLP4-like [Vitis vinifera]
 ref|XP_010663969.1| PREDICTED: protein NLP4-like [Vitis vinifera]
Length=930

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/609 (58%), Positives = 433/609 (71%), Gaps = 28/609 (5%)
 Frame = +2

Query  341   GCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGEL-----MKESEVERKKSSLPE  505
             GCWLETTDGSEF   SP N+ ++F+PS + P    NN +L         + E ++S+ P 
Sbjct  32    GCWLETTDGSEFLLQSPSNSGSVFDPSSLWPTFGSNNVDLSANLSANNIQEETQRSNFPG  91

Query  506   NLSASQFHTERVQCFGQNGSNAV-----CSSGLAESSELSRRWWIGPMAT----TSVMDR  658
             N   S   T++ Q   Q+ +N         + L +  +LSRRWWI P ++    ++VM+R
Sbjct  92    NAVES---TDKTQSLSQSMTNVAGYPVQSENYLMDDFDLSRRWWIRPKSSPGPSSTVMER  148

Query  659   LIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             LI+AL YI+  +++KD LIQIWVPVNR GRRVL T DQPF LD  CPRLA YRDIS++Y+
Sbjct  149   LIRALSYIRGSTKNKDALIQIWVPVNRGGRRVLTTNDQPFSLDPSCPRLARYRDISVSYQ  208

Query  839   FPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
             F  EEDS E  GLPGRVFLGKVPEWTPDV+ F+ EEYPRV +AQ +DVRGT A+PVF+QG
Sbjct  209   FSAEEDSNELAGLPGRVFLGKVPEWTPDVRFFRSEEYPRVDYAQHFDVRGTLALPVFEQG  268

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEI  1195
             S+TCLGVIEVV+TTQK  YR EL+SVCKALE VDLR S++ + RNVK C+  YQ  LPEI
Sbjct  269   SQTCLGVIEVVMTTQKSNYRPELESVCKALEAVDLRSSEVLSTRNVKACNKFYQAALPEI  328

Query  1196  LEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHE  1375
             LEVL SAC TH LPLAQTWVPC+QQGK G RH+D N + CVSTVDSAC +ADPR QGFHE
Sbjct  329   LEVLTSACGTHGLPLAQTWVPCIQQGKWGSRHTDGNYIHCVSTVDSACCVADPRTQGFHE  388

Query  1376  ACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTC  1555
             ACSEHHLLKG G+ GRAF TN+PCFSADITSFSKT+YPLSH+AR+F L AAVAIRLRS  
Sbjct  389   ACSEHHLLKGQGIAGRAFTTNEPCFSADITSFSKTQYPLSHHARMFGLCAAVAIRLRSIH  448

Query  1556  TGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVA  1735
                +DFVLEFFLP DC+ PEE K ML SLSIIIQ VC++LRVVT++ELE ET S  S++ 
Sbjct  449   VPVSDFVLEFFLPVDCRDPEEQKGMLCSLSIIIQKVCRSLRVVTDKELEGETPSLVSELT  508

Query  1736  KHSDIRIHK-EVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRL  1912
               SD    + E   +++  +    +E  SW +S    Q+S   +   Q EK  E L ++ 
Sbjct  509   VLSDGSPGREETQKVQHTPTEKISQEQSSWMASLKEAQQSIDITPPSQKEKVRERLSEKS  568

Query  1913  PEFV-----SGSGLSF----DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSL  2065
              EF      S    SF    DST G+ S  +V + G+++R KAE+TITLQ+LQQYFAGSL
Sbjct  569   LEFRQHQQDSSQQGSFDCRDDSTFGKSSLSSVGKTGERRRSKAEQTITLQVLQQYFAGSL  628

Query  2066  KDAAKSLGV  2092
             KDAAKS+GV
Sbjct  629   KDAAKSIGV  637



>emb|CAN75893.1| hypothetical protein VITISV_009390 [Vitis vinifera]
Length=931

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/610 (58%), Positives = 433/610 (71%), Gaps = 29/610 (5%)
 Frame = +2

Query  341   GCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGEL-----MKESEVERKKSSLPE  505
             GCWLETTDGSEF   SP N+ ++F+PS + P    NN +L         + E ++S+ P 
Sbjct  32    GCWLETTDGSEFLLQSPSNSGSVFDPSSLWPTFGSNNVDLSANLSANNIQEETQRSNFPG  91

Query  506   NLSASQFHTERVQCFGQNGSNAV-----CSSGLAESSELSRRWWIGPMAT----TSVMDR  658
             N   S   T++ Q   Q+ +N         + L +  +LSRRWWI P ++    ++VM+R
Sbjct  92    NAVES---TDKTQSLSQSMTNVAGXPVQSENYLMDDFDLSRRWWIRPKSSPGPSSTVMER  148

Query  659   LIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             LI+AL YI+  +++KD LIQIWVPVNR GRRVL T DQPF LD  CPRLA YRDIS+NY+
Sbjct  149   LIRALSYIRGSTKNKDALIQIWVPVNRGGRRVLTTNDQPFSLDPSCPRLARYRDISVNYQ  208

Query  839   FPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
             F  EEDS E  GLPGRVFLGKVPEWTPDV+ F+ EEYPRV +AQ +DVRGT A+PVF+QG
Sbjct  209   FSAEEDSXELAGLPGRVFLGKVPEWTPDVRFFRSEEYPRVDYAQHFDVRGTLALPVFEQG  268

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEI  1195
             S+TCLGVIEVV+TTQK  YR EL+SVCKALE VDLR S++ + RNVK C+  YQ  LPEI
Sbjct  269   SQTCLGVIEVVMTTQKSNYRPELESVCKALEAVDLRSSEVLSTRNVKACNKFYQAALPEI  328

Query  1196  LEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHE  1375
             LEVL SAC TH LPLAQTWVPC+QQGK G RH+D N + CVSTVDSAC +ADPR QGFHE
Sbjct  329   LEVLTSACGTHGLPLAQTWVPCIQQGKWGSRHTDGNYIHCVSTVDSACCVADPRTQGFHE  388

Query  1376  ACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTC  1555
             ACSEHHLLKG G+ GRAF TN+PCFSADITSFSKT+YPLSH+AR+F L AAVAIRLRS  
Sbjct  389   ACSEHHLLKGQGIAGRAFTTNEPCFSADITSFSKTQYPLSHHARMFGLCAAVAIRLRSIH  448

Query  1556  TGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVA  1735
                +DFVLEFFLP DC+ PEE K ML SLSIIIQ VC++LRVVT++ELE ET S  S++ 
Sbjct  449   VPVSDFVLEFFLPVDCRDPEEQKGMLCSLSIIIQKVCRSLRVVTDKELEGETPSLVSELT  508

Query  1736  KHSDIRIHK-EVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRL  1912
               SD    + E   +++  +    +E  SW +S    Q+S   +   Q EK  E L ++ 
Sbjct  509   VLSDGSPGREETQKVQHTPTEKISQEQSSWMASLKEAQQSIDITPPSQKEKVRERLSEKS  568

Query  1913  PEFV-----SGSGLSF----DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSL  2065
              EF      S    SF    DST G+ S  +V + G+++R KAE+TITLQ+LQQYFAGSL
Sbjct  569   LEFRQHQQDSSQQGSFDCRDDSTFGKSSLSSVGKTGERRRSKAEQTITLQVLQQYFAGSL  628

Query  2066  KDAA-KSLGV  2092
             KDAA KS+GV
Sbjct  629   KDAAIKSIGV  638



>ref|XP_002510678.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52865.1| conserved hypothetical protein [Ricinus communis]
Length=949

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/647 (56%), Positives = 450/647 (70%), Gaps = 42/647 (6%)
 Frame = +2

Query  254   MDESVFPSSIVLNTTsdssfm--dlddllfEGCWLETTDGSEFFQHSPFNANALFEPSYV  427
             M+E VF    +L T  DS+     +D LL EGCWLET DGSEFF  SP +++A F  S++
Sbjct  1     MEEGVFSPGTMLGTRVDSAMDFDYMDKLLLEGCWLETIDGSEFFNPSP-SSSAAFIDSFL  59

Query  428   LPDLEPNNGELM----KESEVERKKSSLP-------ENLSASQFHTERVQCFGQN-GSNA  571
              P  E NN +L     ++S  E ++ +LP       E    S  +TE +   GQ+ GS  
Sbjct  60    WPIPEVNNDDLASTPSQKSNPEEEQIALPHRNSLLNETQDGSPLNTEAI---GQDMGSVV  116

Query  572   VCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNR  739
                +  AE+SE+SRRWWIGP A     TSV DRLI AL YIKDF++DKDVLIQIWVPVN 
Sbjct  117   TLGNNAAEASEVSRRWWIGPSAIPGPKTSVRDRLITALSYIKDFTKDKDVLIQIWVPVNS  176

Query  740   DGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTP  919
              GRR LVT DQ F +   C RLA+YRDISINY F  +E+S++ VGLPGRVFLGKVPEWTP
Sbjct  177   GGRRFLVTHDQHFAVVPNCERLANYRDISINYHFSADENSKDMVGLPGRVFLGKVPEWTP  236

Query  920   DVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVC  1099
             DV+ F+ +EYPRV HAQ+Y VRGT A+PVF+QGSRTCLGVIEVV T  K+ Y  EL+SVC
Sbjct  237   DVRFFRSDEYPRVDHAQQYGVRGTLALPVFEQGSRTCLGVIEVVTTAHKIIYHPELESVC  296

Query  1100  KALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGK  1276
             +ALE VDL+ S I  ++NVK C  SYQ VLPEI E+L+SAC TH+LPLAQTWVPC+QQGK
Sbjct  297   RALEAVDLQSSGIPGMQNVKVCDMSYQSVLPEIHELLRSACETHQLPLAQTWVPCIQQGK  356

Query  1277  EGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSA  1456
              G RHSDEN +RCVSTVD ACY+ D  IQ FHEACSEHHLLKG GV G AF+TNQPCF++
Sbjct  357   GGCRHSDENYIRCVSTVDRACYVRDTSIQVFHEACSEHHLLKGQGVAGEAFLTNQPCFTS  416

Query  1457  DITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLT  1636
             DITS++KTEYPLSH+AR+F L+AAVAIRLRS  TG+ DFVLEFFLP DC  P++ K+MLT
Sbjct  417   DITSYAKTEYPLSHHARMFGLRAAVAIRLRSVHTGTADFVLEFFLPVDCTDPDKQKKMLT  476

Query  1637  SLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE----VPNLKYNSSIGPC  1804
             SLSIIIQ VC++LRVVT++ELEEE     S+V   SD R+ ++    V ++   S  G  
Sbjct  477   SLSIIIQQVCRSLRVVTDKELEEENYFLVSEVVDPSDGRLTRDEMLRVGHMYSESYAG--  534

Query  1805  EEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGS---------GLSFDSTS  1957
                +SWTS   + ++S    S  Q EK    + ++  +                  DS+ 
Sbjct  535   --DISWTSCLTVARQSGNDGSLCQIEKQKVPMGEKFMQHKKNQEDNSLKRNIECGGDSSV  592

Query  1958  GEGSAQNV--RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              EGS  +V   +  +K+R KAEKTITLQ+L+QYFAGSLKDAAKS+GV
Sbjct  593   AEGSFSSVCMGKTAEKRRTKAEKTITLQVLRQYFAGSLKDAAKSIGV  639



>ref|XP_002301919.2| NIN-like protein 1 [Populus trichocarpa]
 gb|EEE81192.2| NIN-like protein 1 [Populus trichocarpa]
Length=912

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/611 (57%), Positives = 427/611 (70%), Gaps = 31/611 (5%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGEL-----MKESEVERKKSSLP  502
             EGCWLETTDGSEF   S  N+ A F+ S++ P  E N+G+       K ++ + + S  P
Sbjct  23    EGCWLETTDGSEFLNPSLSNSAAFFDSSFMWPTPEINHGDSASSPSQKGNQEDNQISMFP  82

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSG----LAESSELSRRWWIGPMAT----TSVMDR  658
              N + S      +Q     G  AV  +G      + SEL +RWWIGP       TSV  R
Sbjct  83    GNSTLSD-----IQARSPAGETAVSVAGWDDNATDGSELGKRWWIGPTPNPSVETSVKRR  137

Query  659   LIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             LI+AL  IKD +++KDVLIQIWVPVNR GRRVL T DQPF LD    +LA YRDIS+ Y+
Sbjct  138   LIKALECIKDLTKNKDVLIQIWVPVNRGGRRVLTTHDQPFSLDPSSEKLASYRDISVKYQ  197

Query  839   FPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
             F  EEDS+++VGLPGRVFLGKVPEWTPDV+ F+ +EYPRV HAQ YDVRGT A+PVF+QG
Sbjct  198   FSAEEDSKDSVGLPGRVFLGKVPEWTPDVRFFRSDEYPRVNHAQLYDVRGTLALPVFEQG  257

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEI  1195
             SRTCLGVIEVV T+QK+KYR EL+SVCKALE VDLR S++ +++N++ C+ SYQ  LPEI
Sbjct  258   SRTCLGVIEVVTTSQKIKYRPELESVCKALETVDLRSSEVPSIQNLQACNMSYQAALPEI  317

Query  1196  LEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHE  1375
              ++L++AC TH+LPLAQTWVPC QQGK G RHS+EN  RCVSTVD AC +AD  IQGF E
Sbjct  318   QKLLRAACETHRLPLAQTWVPCTQQGKGGCRHSNENYYRCVSTVDDACCVADSAIQGFQE  377

Query  1376  ACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTC  1555
             ACSEHHLLKG GV G+AFMTNQPCFS D+TS+ KTEYPLSH+AR+F L AAVAIRLRS  
Sbjct  378   ACSEHHLLKGQGVAGQAFMTNQPCFSGDVTSYGKTEYPLSHHARMFGLCAAVAIRLRSIY  437

Query  1556  TGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVA  1735
              G+TDFVLEFFLP +C+ P+E K+ML SLS IIQ+V QTLRVVT++EL EET  P S+V 
Sbjct  438   IGTTDFVLEFFLPVNCRDPQEQKKMLNSLSAIIQHVSQTLRVVTDKELVEETDLPFSEVL  497

Query  1736  KHSDIRIH-KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRL  1912
               SD R   +E   +K + S     +   WT+    VQ S  + S  Q +K   +L ++ 
Sbjct  498   VPSDGRSSGEETSTVKQSCSERHSRDNSPWTACLSEVQPSGSNISLSQKDKQKVMLREKS  557

Query  1913  PE---------FVSGSGLSFDSTSGEG--SAQNVRRAGDKKRMKAEKTITLQILQQYFAG  2059
              E                  DSTS EG  S+    + G+K+R KAEKTITLQ+L+QYFAG
Sbjct  558   SENRENQEDCSLRESIKCGRDSTSAEGSFSSAGTSKTGEKRRAKAEKTITLQVLRQYFAG  617

Query  2060  SLKDAAKSLGV  2092
             SLKDAAKS+GV
Sbjct  618   SLKDAAKSIGV  628



>ref|XP_007018035.1| Plant regulator RWP-RK family protein, putative [Theobroma cacao]
 gb|EOY15260.1| Plant regulator RWP-RK family protein, putative [Theobroma cacao]
Length=952

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/622 (54%), Positives = 420/622 (68%), Gaps = 46/622 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMK-----ESEVERKKSSLP  502
             +GCWLET +GSEF   SP ++NA F+P+++ P  E N G+L        ++ E ++S LP
Sbjct  48    DGCWLETAEGSEFLTLSPSSSNAFFDPAFMWPTSESNTGDLGAGLSQIHNQGENQRSLLP  107

Query  503   ----------ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----  640
                       E+L + QF +        +  +  C   + E SELS+RWWIGP  +    
Sbjct  108   GNSHMNGTQAESLVSPQF-SHMADVDKSHSPHGYC---ITEGSELSKRWWIGPRTSPGPA  163

Query  641   TSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRD  820
             TSVM RLIQAL YIKDF+++KDVL+Q+WVPVNR GRRVL T +QPF LD    RLA YR+
Sbjct  164   TSVMQRLIQALDYIKDFAKEKDVLVQLWVPVNRGGRRVLTTSEQPFSLDPNSQRLASYRN  223

Query  821   ISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAV  1000
             IS+ Y+FP EEDS++  GLPGRVFL KVPEWTPDV+ F+ +EYPR+GHAQ++DVRGTFA+
Sbjct  224   ISVKYQFPAEEDSKDAAGLPGRVFLSKVPEWTPDVRFFRSDEYPRLGHAQQHDVRGTFAL  283

Query  1001  PVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQ  1177
             PVF+QGSRTCLGVIEVV+TT+K+K R EL+SVCKALE V+LR S  S+ +NVK C+ SYQ
Sbjct  284   PVFEQGSRTCLGVIEVVMTTEKIKIRPELESVCKALEAVNLRSSIASSTQNVKACNKSYQ  343

Query  1178  VVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPR  1357
               L EI EVL+ AC TH LPLAQTWV C++QGKEG RHS +N + CVSTVD AC+I DP 
Sbjct  344   AGLHEIKEVLRCACDTHGLPLAQTWVSCIEQGKEGCRHSTDNYVHCVSTVDDACHIGDPN  403

Query  1358  IQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAI  1537
             I GFHEACSEHHLLKG GV GRAFMTNQPCFSADITSF +TEYPL+H+A +F+L AAV+I
Sbjct  404   ILGFHEACSEHHLLKGQGVAGRAFMTNQPCFSADITSFKRTEYPLAHHAMMFNLHAAVSI  463

Query  1538  RLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVC-------Qtlrvvteqe  1696
             RLR   TG+ DFVLEFFLP DC+ PE  K+ML SLSIIIQ VC                 
Sbjct  464   RLRCIHTGNADFVLEFFLPTDCRDPEGQKKMLNSLSIIIQQVCCSLRVVTDKELDEETDL  523

Query  1697  leeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQ  1876
                E  +PS  +     +   +     +  SS     E  SWT+S   VQ+S  ++    
Sbjct  524   ALSEVIAPSDGIPSRDQLSKEQCTHRSQKRSS-----ENSSWTASLTEVQQSTNAALGLG  578

Query  1877  NEKPSELLYKRLPEF--------VSGSGLSFDSTSGEGSAQNVR--RAGDKKRMKAEKTI  2026
              EKP  +L + L E         +  S    DST  E S  ++   + G+K+R KAEKTI
Sbjct  579   KEKPRAMLDEELSELKQHHEQVGLRESVECGDSTFNEISFTSLAMGKTGEKRRTKAEKTI  638

Query  2027  TLQILQQYFAGSLKDAAKSLGV  2092
             TLQ+L+Q+FAGSLKDAAKS+GV
Sbjct  639   TLQVLRQHFAGSLKDAAKSIGV  660



>gb|EYU36567.1| hypothetical protein MIMGU_mgv1a022035mg, partial [Erythranthe 
guttata]
Length=855

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/594 (58%), Positives = 416/594 (70%), Gaps = 53/594 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNN------GELMKESEVERKKSSL  499
             EGCWLE  +GSEF         + F+PS+  P LEP N          K  + E +KS  
Sbjct  12    EGCWLEA-NGSEFSNFDSSAPFSPFQPSFPWPALEPANHNTESSASPSKYGQHEGQKSYF  70

Query  500   PENLSASQ--FHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTSVMDRLIQAL  673
             P+NLS SQ  F +E                 L ES EL++RWWIGP  + SV+DRLIQAL
Sbjct  71    PDNLSISQSRFSSENY---------------LLESCELNKRWWIGPRPSLSVIDRLIQAL  115

Query  674   GYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEE  853
              YIKD SRDK+VLIQ+WVPVN  G+RVL T +QPF LDL CP LAHYR+IS+NY+FP EE
Sbjct  116   AYIKDCSRDKNVLIQVWVPVNGGGKRVLTTNNQPFSLDLNCPSLAHYREISVNYQFPAEE  175

Query  854   DSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCL  1033
             DS+E VGLPGRVF  KVPEWTPDV+ F R+EYPRV HA +YDVRGT AVPV +QGS  CL
Sbjct  176   DSKEVVGLPGRVFRNKVPEWTPDVRFFTRDEYPRVDHALQYDVRGTLAVPVLEQGSGNCL  235

Query  1034  GVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLK  1210
             GVIEVVLTTQK++YR EL+SVCKALE VDLR ++++  + VKT   SYQ  LPEIL+VL+
Sbjct  236   GVIEVVLTTQKIQYRPELESVCKALEAVDLRSAEVACTQAVKTPDFSYQAALPEILDVLR  295

Query  1211  SACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEH  1390
             SAC TH LPLAQTWVPC  QGK G  HSD+NL  C+S VDSAC+I +P IQGFHEACSE+
Sbjct  296   SACETHGLPLAQTWVPCSLQGKGGYWHSDDNLKNCISPVDSACHIGNPHIQGFHEACSEY  355

Query  1391  HLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTD  1570
             HLL+G G+VGRAF TNQPCF  D+++ SKTEYPLSH+AR+F L+AAVAIRLRS CTGSTD
Sbjct  356   HLLRGQGIVGRAFGTNQPCFLPDVSACSKTEYPLSHHARMFGLKAAVAIRLRSICTGSTD  415

Query  1571  FVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDI  1750
             FVLEFFLP +C  PEE K+MLTSLS IIQNVC+TLRVVT++EL               + 
Sbjct  416   FVLEFFLPINCTEPEEQKKMLTSLSAIIQNVCRTLRVVTDKEL-------------QEES  462

Query  1751  RIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSG  1930
             R+  +VPN++    +GP              Q +C    +   EK  E     L E V+ 
Sbjct  463   RLPDQVPNIESKEFLGPYSS-----------QVNCQKGKS--REKLVESSKASLKEGVAL  509

Query  1931  SGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             +  +  STSG+ S+    + G+KKR+KAEKTITLQ+L+Q+FAGSLKDAAKSLGV
Sbjct  510   TANA--STSGDCSSLYTSKTGEKKRIKAEKTITLQVLRQHFAGSLKDAAKSLGV  561



>ref|XP_011034870.1| PREDICTED: protein NLP4-like [Populus euphratica]
 ref|XP_011034871.1| PREDICTED: protein NLP4-like [Populus euphratica]
Length=922

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/615 (57%), Positives = 425/615 (69%), Gaps = 39/615 (6%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGEL-----MKESEVERKKSSLP  502
             EGCWLETTDGSEF   S  N+ A F+ S++ P  E N G+       K ++ + + S LP
Sbjct  33    EGCWLETTDGSEFLNPSLSNSAAFFDSSFMWPTPEINQGDSASSPSQKGNQEDNQISMLP  92

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSG----LAESSELSRRWWIGPMAT----TSVMDR  658
              N + S      +Q     G  A   +G      + SEL +RWWIGP       TSV  R
Sbjct  93    GNSTLSD-----IQARSPAGETAFSVAGRDDNATDGSELGKRWWIGPSPNPSVETSVKRR  147

Query  659   LIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             LI+AL  IKD +++KDVLIQIWVPVNR GRRVL T DQPF LD    +LA YRDIS+ Y+
Sbjct  148   LIKALECIKDLTKNKDVLIQIWVPVNRGGRRVLTTHDQPFSLDPSSEKLASYRDISVKYQ  207

Query  839   FPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
             F  EEDS+++VGLPGRVFLGKVPEWTPDV+ F+ +EYPRV HAQ YDVRGT A+PVF+QG
Sbjct  208   FSAEEDSKDSVGLPGRVFLGKVPEWTPDVRFFRSDEYPRVNHAQLYDVRGTLALPVFEQG  267

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEI  1195
             SRTCLGVIEVV T+QK+KYR EL+SVCKALE VDLR S++ +++N++ C+ SYQ  LPEI
Sbjct  268   SRTCLGVIEVVTTSQKIKYRPELESVCKALETVDLRSSEVPSIQNLQACNMSYQAALPEI  327

Query  1196  LEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHE  1375
              ++L++AC TH LPLAQTWVPC QQGK G RHS+EN  RCVSTVD AC +AD  IQGF E
Sbjct  328   QKLLRAACETHGLPLAQTWVPCTQQGKGGCRHSNENYYRCVSTVDDACCVADSAIQGFQE  387

Query  1376  ACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTC  1555
             ACSEHHLLKG GV G+AFMTNQPCFS D+TS+  TEYPLSH+AR+F L AAVAIRLRS  
Sbjct  388   ACSEHHLLKGQGVAGQAFMTNQPCFSGDVTSYGNTEYPLSHHARMFGLCAAVAIRLRSIY  447

Query  1556  TGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVA  1735
             TG+TDFVLEFFLP +C+ P+E K+ML SLS IIQ V  TLRVVT++EL EET  P S+V 
Sbjct  448   TGTTDFVLEFFLPVNCRDPQEQKKMLNSLSAIIQRVSHTLRVVTDKELVEETDLPFSEVL  507

Query  1736  KHSDIRIHKEVPNLKYNSSIGPCEE-----GLSWTSSPMLVQESCMSSSAFQNEKPSELL  1900
               SD R   E    + ++   PC E        WT+    VQ S  ++S  Q +K   +L
Sbjct  508   VPSDGRSSGE----EASTVKEPCSERHGRDNSPWTACLSEVQPSGSNNSLSQKDKQKVML  563

Query  1901  YKRLPE---------FVSGSGLSFDSTSGEG--SAQNVRRAGDKKRMKAEKTITLQILQQ  2047
              ++  E         F        +STS EG  S+    + G+K+R KAEKTITLQ+L+Q
Sbjct  564   REKSNENRENREDYSFRESIKCGRESTSAEGSFSSAGTSKTGEKRRAKAEKTITLQVLRQ  623

Query  2048  YFAGSLKDAAKSLGV  2092
             YFAGSLKDAAKS+GV
Sbjct  624   YFAGSLKDAAKSIGV  638



>ref|XP_011041223.1| PREDICTED: protein NLP4-like [Populus euphratica]
 ref|XP_011041224.1| PREDICTED: protein NLP4-like [Populus euphratica]
Length=917

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/611 (58%), Positives = 424/611 (69%), Gaps = 32/611 (5%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGE------LMKESEVERKKSSL  499
             EGCWLETTDGSEF   S  N+ ALF+PS++ P  E   G        M   EV    + L
Sbjct  32    EGCWLETTDGSEFLNPSLSNSAALFDPSFMWPSPEMKYGNPASILSQMGSQEVSHL-TLL  90

Query  500   PENLSASQFHTERVQCFGQNGSNAVCSSG----LAESSELSRRWWIGPMAT----TSVMD  655
             P N   S      +Q     G  AV ++G      E SEL +RWWIGP       T+V  
Sbjct  91    PGNSPLSD-----IQSRSPVGEIAVSAAGWEYNATEGSELGKRWWIGPAPNPSPGTTVKR  145

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             RLI+A+  IKD +++KDVLIQIWVPVNR GRRVL T DQPF  D    RLA YRDIS+ Y
Sbjct  146   RLIKAVECIKDLTKNKDVLIQIWVPVNRGGRRVLTTHDQPFAFDPSSERLASYRDISVKY  205

Query  836   EFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQ  1015
             +F  EEDS+++ G+PGRVFLGKVPEWTPDV+ F+ +EYPRV HAQ+ DVRGT A+PVF+Q
Sbjct  206   QFSAEEDSKDSFGMPGRVFLGKVPEWTPDVRFFRNDEYPRVNHAQQCDVRGTLALPVFEQ  265

Query  1016  GSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPE  1192
             GSRTCLGVIEVV T+QK+KY  EL+SVCKALE VDLR S++ +++N K C  SYQ  LPE
Sbjct  266   GSRTCLGVIEVVTTSQKIKYLPELESVCKALEAVDLRSSEVPSIQNQKACDMSYQAALPE  325

Query  1193  ILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFH  1372
             I +VL++AC TH+LPLAQTWVPC+QQGK G RHS+EN   CVSTVD AC + DP  QGF 
Sbjct  326   IQKVLRAACETHRLPLAQTWVPCIQQGKGGCRHSNENYYHCVSTVDDACCVGDPAFQGFL  385

Query  1373  EACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRST  1552
             EACSEHHLLKG GVVG+AFMTNQPCFS D+T + KTEYPLSH+ARIF L AAVAIRLRS 
Sbjct  386   EACSEHHLLKGQGVVGKAFMTNQPCFSGDVTLYGKTEYPLSHHARIFGLCAAVAIRLRSM  445

Query  1553  CTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKV  1732
              TG+ DFVLEFFLP DC+ P+E K MLTSLSIIIQ VCQTLRVVT +ELEEET  P S+V
Sbjct  446   YTGTADFVLEFFLPVDCRDPQEQKTMLTSLSIIIQRVCQTLRVVTVKELEEETDLPVSEV  505

Query  1733  AKHSDIRIH-KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKR  1909
                SD R   +E   +K + S     +   WT+    V +S  ++S  + +K   +  K 
Sbjct  506   LVPSDGRSSGEETLTVKESYSERHARDNSPWTACVQKVLQSGSNASLSEKDKEKVMCEKS  565

Query  1910  LP-----EFVSGSG---LSFDSTSGEGSAQNV--RRAGDKKRMKAEKTITLQILQQYFAG  2059
             +      E  S SG      DSTS EGS  +V   + G+K+R KAEKTITLQ+L+QYFAG
Sbjct  566   IESRHNQEDYSLSGSTKYGGDSTSAEGSFSSVCKTKPGEKRRAKAEKTITLQVLRQYFAG  625

Query  2060  SLKDAAKSLGV  2092
             SLKDAAKS+GV
Sbjct  626   SLKDAAKSIGV  636



>emb|CBI40717.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/589 (55%), Positives = 395/589 (67%), Gaps = 72/589 (12%)
 Frame = +2

Query  341   GCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSAS  520
             GCWLETTDGSEF   SP N+ ++F+PS + P    NN              SL ++++  
Sbjct  13    GCWLETTDGSEFLLQSPSNSGSVFDPSSLWPTFGSNN--------------SLSQSMTNV  58

Query  521   QFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGYIKD  688
               +  + + +            L +  +LSRRWWI P ++    ++VM+RLI+AL YI+ 
Sbjct  59    AGYPVQSENY------------LMDDFDLSRRWWIRPKSSPGPSSTVMERLIRALSYIRG  106

Query  689   FSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQEN  868
              +++KD LIQIWVPVNR GRRVL T DQPF LD  CPRLA YRDIS++Y+F  EEDS E 
Sbjct  107   STKNKDALIQIWVPVNRGGRRVLTTNDQPFSLDPSCPRLARYRDISVSYQFSAEEDSNEL  166

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
              GLPGRVFLGKVPEWTPDV+ F+ EEYPRV +AQ +DVRGT A+PVF+QGS+TCLGVIEV
Sbjct  167   AGLPGRVFLGKVPEWTPDVRFFRSEEYPRVDYAQHFDVRGTLALPVFEQGSQTCLGVIEV  226

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILEVLKSACAT  1225
             V+TTQK  YR EL+SVCKALE VDLR S++ + RNVK C+  YQ  LPEILEVL SAC T
Sbjct  227   VMTTQKSNYRPELESVCKALEAVDLRSSEVLSTRNVKACNKFYQAALPEILEVLTSACGT  286

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             H LPLAQTWVPC+QQGK G RH+D N + CVSTVDSAC +ADPR QGFHEACSEHHLLKG
Sbjct  287   HGLPLAQTWVPCIQQGKWGSRHTDGNYIHCVSTVDSACCVADPRTQGFHEACSEHHLLKG  346

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              G+ GRAF TN+PCFSADITSFSKT+YPLSH+AR+F L AAVAIRLRS     +DFVLEF
Sbjct  347   QGIAGRAFTTNEPCFSADITSFSKTQYPLSHHARMFGLCAAVAIRLRSIHVPVSDFVLEF  406

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP DC+ PEE K ML SLSIIIQ VC+                 S +V   +D  +  E
Sbjct  407   FLPVDCRDPEEQKGMLCSLSIIIQKVCR-----------------SLRVV--TDKELEGE  447

Query  1766  VPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSF  1945
              P+L   S +    +G          Q++     +F                        
Sbjct  448   TPSLV--SELTVLSDGSPGREETQKAQQNSSQQGSFDCRD--------------------  485

Query  1946  DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             DST G+ S  +V + G+++R KAE+TITLQ+LQQYFAGSLKDAAKS+GV
Sbjct  486   DSTFGKSSLSSVGKTGERRRSKAEQTITLQVLQQYFAGSLKDAAKSIGV  534



>ref|XP_006473795.1| PREDICTED: protein NLP4-like [Citrus sinensis]
Length=936

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/618 (57%), Positives = 427/618 (69%), Gaps = 38/618 (6%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLET DGSEF   SP  + ALF+ S+V P  E  NG+  +    + K+  + ++   
Sbjct  31    EGCWLETIDGSEFPHPSPSTSTALFDSSFVWPASEITNGDTGRNPSQQGKQDDMQQSFF-  89

Query  518   SQFHTERVQCFGQNG--SNAVCSSGL--------------AESSELSRRWWIGPMAT---  640
                 T  +    QNG  S    S G+              AE SELS+R WIGP A    
Sbjct  90    --LQTSSMNDPQQNGPLSTPSLSQGMVNVDEDDGQLDDNIAEGSELSKRRWIGPRANLGP  147

Query  641   -TSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYR  817
              TSV+ RL  A+GYIKDFS +KDVLIQ+WVPV R GR+VL T DQPF LDLKC RLA+YR
Sbjct  148   ATSVIQRLGWAVGYIKDFSINKDVLIQLWVPVIRAGRQVLTTYDQPFSLDLKCQRLANYR  207

Query  818   DISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFA  997
              ISI Y F  EEDS++  GLPGRVFLGK PEWTPDVQ F+ +EYPRV HAQ+YDVRGT A
Sbjct  208   AISIKYYFSAEEDSKDVAGLPGRVFLGKAPEWTPDVQFFRSDEYPRVDHAQQYDVRGTLA  267

Query  998   VPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SY  1174
             VPVF+QGSRTCLGVIEVV+ TQK+KYR+EL+SVCKALE VDLR S++ + +N+K  + SY
Sbjct  268   VPVFEQGSRTCLGVIEVVMMTQKLKYRSELESVCKALEAVDLRSSEVPSTKNMKAWNTSY  327

Query  1175  QVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADP  1354
             Q  LPEI EVL+ AC TH+LPLAQTWV C+QQGK G  HSD+N   CVSTVD ACYIADP
Sbjct  328   QAALPEIREVLRCACETHRLPLAQTWVSCIQQGKVGCWHSDKNNNHCVSTVDDACYIADP  387

Query  1355  RIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVA  1534
              + GF EACSEHHLLKG  V G AF+TNQPCFS DITS  KTEYPLSH+AR+F L  AVA
Sbjct  388   DMWGFQEACSEHHLLKGQRVAGEAFLTNQPCFSNDITSLKKTEYPLSHHARMFGLCGAVA  447

Query  1535  IRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeett  1714
             IRLRS  TG++DFVLEFFLP+ C+ PEE K+ML+SLSI+IQ V ++LRVVT++E+EEET+
Sbjct  448   IRLRSILTGNSDFVLEFFLPKGCRDPEEQKKMLSSLSIVIQQVSRSLRVVTDKEMEEETS  507

Query  1715  SPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPML-VQESCMSSSAFQNEKPS  1891
              P S+V   SD R  +E   LK +S         S+ S+ +  VQ  C   S  QN KP 
Sbjct  508   LPVSEVIFPSDGRPSRE-KILKVDSHSEKYSHDNSFQSACLTKVQRDC-DVSLNQNGKPR  565

Query  1892  ELLYKRLPE--------FVSGSG-LSFDSTSGEGSAQNVR--RAGDKKRMKAEKTITLQI  2038
             ++  KR  E         + GS     DS S EGS  +V   + G+K+R K +KTITLQ+
Sbjct  566   KVSGKRFLEGGHRKEDFSLKGSAEYCDDSNSVEGSFSSVALGKTGEKRRTKVDKTITLQV  625

Query  2039  LQQYFAGSLKDAAKSLGV  2092
             LQQYF+GSLKDAAKS+GV
Sbjct  626   LQQYFSGSLKDAAKSIGV  643



>ref|XP_006435364.1| hypothetical protein CICLE_v10000188mg [Citrus clementina]
 ref|XP_006435365.1| hypothetical protein CICLE_v10000188mg [Citrus clementina]
 ref|XP_006435366.1| hypothetical protein CICLE_v10000188mg [Citrus clementina]
 gb|ESR48604.1| hypothetical protein CICLE_v10000188mg [Citrus clementina]
 gb|ESR48605.1| hypothetical protein CICLE_v10000188mg [Citrus clementina]
 gb|ESR48606.1| hypothetical protein CICLE_v10000188mg [Citrus clementina]
 gb|KDO85097.1| hypothetical protein CISIN_1g002317mg [Citrus sinensis]
 gb|KDO85098.1| hypothetical protein CISIN_1g002317mg [Citrus sinensis]
 gb|KDO85099.1| hypothetical protein CISIN_1g002317mg [Citrus sinensis]
Length=936

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/618 (57%), Positives = 427/618 (69%), Gaps = 38/618 (6%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLET DGSEF   SP  + ALF+ S+V P  E  NG+  +    + K+  + ++   
Sbjct  31    EGCWLETIDGSEFPHPSPSTSTALFDSSFVWPASEITNGDTGRNPSQQGKQDDMQQSFF-  89

Query  518   SQFHTERVQCFGQNG--SNAVCSSGL--------------AESSELSRRWWIGPMAT---  640
                 T  +    QNG  S    S G+              AE SELS+R WIGP A    
Sbjct  90    --LQTSSMNDPQQNGPLSTPSLSQGMVNVDEDDGQLDDNIAEGSELSKRRWIGPRANLGP  147

Query  641   -TSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYR  817
              TSV+ RL  A+GYIKDFS +KDVLIQ+WVPV R GR+VL T DQPF LDLKC RLA+YR
Sbjct  148   ATSVIQRLGWAVGYIKDFSINKDVLIQLWVPVIRAGRQVLTTYDQPFSLDLKCQRLANYR  207

Query  818   DISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFA  997
              ISI Y F  EEDS++  GLPGRVFLGK PEWTPDVQ F+ +EYPRV HAQ+YDVRGT A
Sbjct  208   AISIKYYFSAEEDSKDVAGLPGRVFLGKAPEWTPDVQFFRSDEYPRVDHAQQYDVRGTLA  267

Query  998   VPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SY  1174
             VPVF+QGSRTCLGVIEVV+ TQK+KYR+EL+SVCKALE VDLR S++ + +N+K  + SY
Sbjct  268   VPVFEQGSRTCLGVIEVVMMTQKLKYRSELESVCKALEAVDLRSSEVPSTKNMKAWNTSY  327

Query  1175  QVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADP  1354
             Q  LPEI EVL+ AC TH+LPLAQTWV C+QQGK G  HSD+N   CVSTVD ACYIADP
Sbjct  328   QAALPEIREVLRCACETHRLPLAQTWVSCIQQGKVGCWHSDKNNNHCVSTVDDACYIADP  387

Query  1355  RIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVA  1534
              + GF EACSEHHLLKG  V G AF+TNQPCFS DITS  KTEYPLSH+AR+F L  AVA
Sbjct  388   DMWGFQEACSEHHLLKGQRVAGEAFLTNQPCFSNDITSLKKTEYPLSHHARMFGLCGAVA  447

Query  1535  IRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeett  1714
             IRLRS  TG++DFVLEFFLP+ C+ PEE K+ML+SLSI+IQ V ++LRVVT++E+EEET+
Sbjct  448   IRLRSILTGNSDFVLEFFLPKGCRDPEEQKKMLSSLSIVIQQVSRSLRVVTDKEMEEETS  507

Query  1715  SPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPML-VQESCMSSSAFQNEKPS  1891
              P S+V   SD R  +E   LK +S         S+ S+ +  VQ  C   S  QN KP 
Sbjct  508   LPVSEVIFPSDGRPSRE-KILKVDSHSEKYSHDNSFQSACLTKVQRDC-DVSLNQNGKPR  565

Query  1892  ELLYKRLPE--------FVSGSG-LSFDSTSGEGSAQNVR--RAGDKKRMKAEKTITLQI  2038
             ++  KR  E         + GS     DS S EGS  +V   + G+K+R K +KTITLQ+
Sbjct  566   KVSGKRFLEGGHRKEDFSLKGSAEYCDDSNSVEGSFSSVALGKTGEKRRTKVDKTITLQV  625

Query  2039  LQQYFAGSLKDAAKSLGV  2092
             LQQYF+GSLKDAAKS+GV
Sbjct  626   LQQYFSGSLKDAAKSIGV  643



>gb|KHG28051.1| Protein NLP4 -like protein [Gossypium arboreum]
Length=925

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/606 (57%), Positives = 428/606 (71%), Gaps = 25/606 (4%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHS-PFNANALFEPSYVLPDLEPNNGELMK--ESEVERKKSSLPEN  508
             +GCWLETT GS+F   + PF +N  F+P++  P  E N G+L      + E ++S L  N
Sbjct  31    DGCWLETTQGSDFLNPTLPF-SNNFFDPAFAWPTTESNAGDLGGGLSHQGENQRSLLSGN  89

Query  509   LSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALG  676
                ++   E +     + S+++ S  + + SE +RRWWI P       T+VM RLIQALG
Sbjct  90    SHWNEAQGESLVSPHFSQSHSLDSDCVTDGSEPNRRWWIRPSVNSGPATTVMQRLIQALG  149

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
             YIK F ++KDVL+Q+W+PVNR GRR L T +QPF LD K  +LA YR+IS+ Y FP EED
Sbjct  150   YIKAFGKEKDVLVQLWLPVNRGGRRFLTTSEQPFSLDSKSQKLASYRNISVKYNFPAEED  209

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
             S++  GLPGRVFL KVPEWTPDV+ FKR+EYPRVGHAQ +DVRGTFA+PVF+QGS TCLG
Sbjct  210   SKDMAGLPGRVFLSKVPEWTPDVRFFKRDEYPRVGHAQEHDVRGTFALPVFEQGSGTCLG  269

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT-CHSYQVVLPEILEVLKS  1213
             VIEVV+TT+K+K + EL+SVCKALE V+LR S  S+ +N+K   + YQ  LPEI E+L+ 
Sbjct  270   VIEVVMTTEKIKIQPELESVCKALEAVNLRSSITSSTQNIKAYSNCYQAALPEIKELLRC  329

Query  1214  ACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHH  1393
             AC TH+LPLAQ WVPC+QQGKEG RHS EN + CVSTVD AC IADP IQGFHEACSEHH
Sbjct  330   ACETHRLPLAQAWVPCIQQGKEGCRHSSENYVHCVSTVDDACCIADPSIQGFHEACSEHH  389

Query  1394  LLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDF  1573
             LLKG GVVGRAFMTNQPCF  DITSF KTEYPL+H+A +F+L AAVAIR RS  TG  DF
Sbjct  390   LLKGQGVVGRAFMTNQPCFMTDITSFKKTEYPLAHHAMMFNLHAAVAIRFRSIHTGKADF  449

Query  1574  VLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD-I  1750
             VLEFFLP  C+ PE  ++ML SLSIIIQ VC +LRVVT++EL EET    S+V   SD +
Sbjct  450   VLEFFLPAHCRDPEGQRKMLNSLSIIIQQVCCSLRVVTDKELVEETDLAVSEVVAPSDGL  509

Query  1751  RIHKEVPNLKYNSSIGPCEEGLSWTSSPML--VQESCMSSSAFQNEKPSELLYKRLPEF-  1921
              I +E  +LK   +    ++ LS  SS  L  VQ+S  ++   + EKP  +L +++PE  
Sbjct  510   PIREE--SLKQQCTRHHSKK-LSGESSSCLTKVQQSSNTALVLEKEKPRPMLDEKIPEVE  566

Query  1922  -------VSGSGLSFDSTSGEGSAQNVR--RAGDKKRMKAEKTITLQILQQYFAGSLKDA  2074
                    +  S    DST  E S  +V   +  +K+R KAEKTITLQ+L+QYFAGSLKDA
Sbjct  567   QHQQHISLQESVECGDSTFNEISFSSVTMGKTSEKRRSKAEKTITLQVLRQYFAGSLKDA  626

Query  2075  AKSLGV  2092
             AKSLGV
Sbjct  627   AKSLGV  632



>ref|XP_004301980.1| PREDICTED: protein NLP5-like [Fragaria vesca subsp. vesca]
Length=882

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/612 (54%), Positives = 413/612 (67%), Gaps = 54/612 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSS-----LP  502
             +GCWLETT+G  F   SP ++ A+ + S+  P    N    M   ++  +  +     L 
Sbjct  31    DGCWLETTEGPGFPNQSPLSSGAIMDSSFFWPTSGTNGNFGMNPFQISNQAQTPLFNELQ  90

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAES-----SELSRRWWIGPM----ATTSVMD  655
             E   AS      +Q   QN ++ V  SG +E+      E SR  WIGP+    +  SVM+
Sbjct  91    EEAPAS------MQSPNQNMTDVVGFSGQSENPIIQGHEFSRGIWIGPIENRISAPSVME  144

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             RL +AL Y+KD  RDK+VL+Q+W+PVNR GRRVL T D    LD  CPRLA Y DIS+NY
Sbjct  145   RLKRALVYMKDVMRDKNVLVQVWLPVNRGGRRVLTTNDLLSSLDSSCPRLAKYHDISVNY  204

Query  836   EFPVEEDSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             +F   EDS+E V GLPGRVF  KVPEWTPDV+ F+ +EYPRV  AQRYDVRGT A+P+F+
Sbjct  205   QFSTGEDSKELVKGLPGRVFSAKVPEWTPDVRFFRNDEYPRVDDAQRYDVRGTLALPIFE  264

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS--YQVVL  1186
             QGSRTCLGVIEVV TTQKV+Y+ EL+SVCKALE VDLR S+  N  N+K  +   YQ VL
Sbjct  265   QGSRTCLGVIEVVTTTQKVQYQPELESVCKALEAVDLRSSENLNTHNIKQVNGKPYQAVL  324

Query  1187  PEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQG  1366
             PEI EVL+SAC TH LPLAQTWV C+QQ K+G RHSD+N + CVSTVD AC++ DP I+G
Sbjct  325   PEIREVLRSACETHNLPLAQTWVSCIQQAKDGCRHSDDNYVHCVSTVDQACHVTDPHIRG  384

Query  1367  FHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLR  1546
             FHEACSEHHLLKG G+VGRAFMTNQPCFS DITS +KTEYPLSH+AR+F L AAVAIRLR
Sbjct  385   FHEACSEHHLLKGQGIVGRAFMTNQPCFSNDITSLAKTEYPLSHHARMFGLHAAVAIRLR  444

Query  1547  STCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSS  1726
             S  TGSTDFVLEFFLP DC+ PEEHK+MLTSLS+IIQN+C+                 S 
Sbjct  445   SIDTGSTDFVLEFFLPVDCRDPEEHKKMLTSLSLIIQNICR-----------------SL  487

Query  1727  KVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEK----PSE  1894
             +V   +D  + +E+ +L  +  I P +   S  +S   VQ++    S F  EK    PS 
Sbjct  488   RVV--TDKELEEEI-DLPVSEVIVPSDPRPSGIASFAEVQQTDNDVSIFPKEKARKMPSA  544

Query  1895  LLYKRLPEFVSGSGLS----FDSTSGEGSAQNV--RRAGDKKRMKAEKTITLQILQQYFA  2056
                K +P+ ++  G+     F ST  EGS  +V   + G+K+R KAEK ITL++L++YF+
Sbjct  545   KSSKLMPQDLNVKGVDCVGEF-STIVEGSFSSVGASKTGEKRRTKAEKAITLEVLRKYFS  603

Query  2057  GSLKDAAKSLGV  2092
             GSLKDAAKSLGV
Sbjct  604   GSLKDAAKSLGV  615



>ref|XP_010692542.1| PREDICTED: protein NLP4-like [Beta vulgaris subsp. vulgaris]
Length=914

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/637 (53%), Positives = 431/637 (68%), Gaps = 38/637 (6%)
 Frame = +2

Query  254   MDESVFPSSIVLN--TTsdssfmdlddllfEGCWLETTDGSEFFQHSPFNANALFEPSYV  427
             MD++ F SS+     + S      +D+LL EGCWLE+ DGS FF  SP  + A F+ SY+
Sbjct  1     MDDAAFHSSVAFGVPSNSAMELDYMDELLLEGCWLESVDGSNFFHQSPSTSGAFFDSSYL  60

Query  428   LPDLEPNNGELMKESEVERKKSSLPENLSASQFHTERVQCFGQNGSNAVCSSG-------  586
              P LE  N    ++S +   +    +    S+     VQ   Q G+    S+G       
Sbjct  61    WPMLEVTN----EKSSMNMSQKCGQQVRETSELAENPVQVDTQLGNRVSMSNGQSLVTIA  116

Query  587   ---------LAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNR  739
                       AE SEL++  W  P   ++VM+RL++AL YIKD ++  D+L+QIWVPV+R
Sbjct  117   TDSDQFDKFCAEGSELNKLLWFKPKPASTVMERLLKALNYIKDSAKGNDLLVQIWVPVSR  176

Query  740   DGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTP  919
              G R+L T DQPF ++    +LA+YR+IS+NYEF  EE++  +VGLPGRVFLG+VPEWTP
Sbjct  177   GGTRILTTVDQPFSVNSSGSQLANYRNISMNYEFAAEENAAVSVGLPGRVFLGQVPEWTP  236

Query  920   DVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVC  1099
             DV+ F+ +EYPRV +AQ+ DVRG+ A+PVFDQGSR CLGV+EVV+TTQKV YR EL+SVC
Sbjct  237   DVRFFRIDEYPRVPYAQQCDVRGSLALPVFDQGSRNCLGVLEVVMTTQKVNYRPELESVC  296

Query  1100  KALEEVDLRG-SKISNVRNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQG  1273
             +ALE VDLR  S+I   +  K  C SYQ  LPE+LEV+KSAC++H LPLAQTWVPC+QQG
Sbjct  297   RALEAVDLRSCSEIPGPQKTKECCSSYQAALPEVLEVIKSACSSHGLPLAQTWVPCIQQG  356

Query  1274  KEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFS  1453
             KEG RHSDEN+ RCVSTVDSAC+IA+P +Q F+EACSEHHL +G GV G+AFMTNQPCFS
Sbjct  357   KEGCRHSDENVSRCVSTVDSACFIANPYMQEFYEACSEHHLFRGQGVAGKAFMTNQPCFS  416

Query  1454  ADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRML  1633
             ADIT++SKTEYPLSH+AR+F L AAVAIRLR   TG+ DFVLEFFLP DC+ PEE K+ML
Sbjct  417   ADITTYSKTEYPLSHHARMFGLCAAVAIRLRCIYTGNADFVLEFFLPTDCRDPEEQKKML  476

Query  1634  TSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEG  1813
             TSLSIIIQ VC++LRVV+++ELE+ET+  S+ + K  +      V N     S G   + 
Sbjct  477   TSLSIIIQRVCRSLRVVSDKELEQETSMLSNNMLKGENT-----VSNSSQEESCGTAFQE  531

Query  1814  LSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTS----GEGSAQNV  1981
                TS   + Q+        +     +LL +  P         F S      GEGS    
Sbjct  532   RDRTSGLPVPQD-----DQTRENFAGKLLSQHSPRANMKGSPGFSSLDCSAVGEGSFSTS  586

Query  1982  RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              ++GDKKR KAEKTITL++L+Q+FAGSLKDAAKS+GV
Sbjct  587   GKSGDKKRAKAEKTITLEVLRQHFAGSLKDAAKSIGV  623



>ref|XP_008237986.1| PREDICTED: protein NLP5-like isoform X2 [Prunus mume]
Length=643

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/610 (53%), Positives = 398/610 (65%), Gaps = 47/610 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKK-------SS  496
             EGCWLETTDG EF   S  N+ A    S     LE N    M  SE   ++         
Sbjct  31    EGCWLETTDGPEFPNQSHANSGAHLNSSVFWHTLEANGNLTMNPSENSNQEVIQTPFFKQ  90

Query  497   LPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLI  664
             L E     QF ++ +     +G +   +    +S EL+RRWWIGP+      +SVM+RL 
Sbjct  91    LHEGPVNPQFPSQNM--IDVDGYSGHSADPTIKSYELNRRWWIGPLGNQGPASSVMERLT  148

Query  665   QALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFP  844
             +AL  I+D  RDK+VL+Q+WVPVN+ GR VL T D  F LD  CPRL+ YRDIS+NY+F 
Sbjct  149   RALVCIRDVMRDKNVLVQVWVPVNKGGRNVLTTNDDLFSLDSSCPRLSKYRDISVNYQFS  208

Query  845   VEEDSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
               EDS E V GLPGRVF G+VPEWTPDV+ F+ +EYPRV +AQRYDVRGT A+P+F+QGS
Sbjct  209   TGEDSTELVKGLPGRVFSGQVPEWTPDVRFFRSDEYPRVDYAQRYDVRGTLALPIFEQGS  268

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC-HSYQVVLPEIL  1198
              TCLGVIEVV TTQK+KY+ EL+SVCKALE VDL+ S+  + +NVK C   YQ  LPEI 
Sbjct  269   STCLGVIEVVTTTQKIKYQLELESVCKALEAVDLQSSRNWSTQNVKGCVKPYQAALPEIR  328

Query  1199  EVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEA  1378
             EVL+SAC THKLPLAQTWV C+QQGK+G RHSD+N + CVSTVD A ++ DP I+GFHEA
Sbjct  329   EVLRSACETHKLPLAQTWVSCIQQGKDGCRHSDDNYVHCVSTVDHAFHVTDPYIEGFHEA  388

Query  1379  CSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCT  1558
             CSEHHLLKG G+VG+AFMTNQPCFS DITS  KTEYPLSH+AR+F L AAVAIRLRS  T
Sbjct  389   CSEHHLLKGQGIVGKAFMTNQPCFSDDITSCVKTEYPLSHHARMFGLHAAVAIRLRSMKT  448

Query  1559  GSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAK  1738
             GSTDFVLEFFLP +C+ PEE K+ML SLSIIIQ +C+                 S +V  
Sbjct  449   GSTDFVLEFFLPVECRDPEEQKKMLNSLSIIIQQICR-----------------SLRVVT  491

Query  1739  HSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELL---YKR  1909
               ++    + P  +   S  P   G+   +S   VQ S    S F  E P E+L     +
Sbjct  492   DKELEEESDFPVSEMIVSSDPRPSGI---ASFTEVQLSGNDVSIFPMENPREVLGVKSSK  548

Query  1910  LPEFVSGSGLSFD-------STSGEG--SAQNVRRAGDKKRMKAEKTITLQILQQYFAGS  2062
             L +    S L          S  GEG  S+  V +  +K+R +AEK ITL++L++YF+GS
Sbjct  549   LRQHQPDSNLKVGVKCGRECSALGEGSFSSVGVSKTREKRRTRAEKAITLEVLRKYFSGS  608

Query  2063  LKDAAKSLGV  2092
             LKDAA S+GV
Sbjct  609   LKDAANSIGV  618



>ref|XP_010061177.1| PREDICTED: protein NLP4-like [Eucalyptus grandis]
 ref|XP_010061178.1| PREDICTED: protein NLP4-like [Eucalyptus grandis]
Length=938

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/619 (54%), Positives = 415/619 (67%), Gaps = 49/619 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLE------------PNNGELMKE----  469
             EGCWLET +GSEF Q SP +  A F+       LE             NN ELM+     
Sbjct  31    EGCWLETVNGSEFLQQSPPSFGAFFDSPCQWSALENIECNSSPNQLQKNNQELMQTPLHP  90

Query  470   -----SEVERKKSSLPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM  634
                   E + K    P++LS        V+C  ++  +      + E S+L RRWWIGP 
Sbjct  91    GDSPMEEGQTKPLDNPQSLSV-------VECSSRSDKH------VNEGSDLRRRWWIGPR  137

Query  635   ----ATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPR  802
                 +T+SVM+RLI +L  I+D ++DKDVLIQ+WVPVNR  R  L T DQPF L+    R
Sbjct  138   VSSGSTSSVMNRLIHSLDQIRDLTKDKDVLIQVWVPVNRGDRHFLTTNDQPFSLNPSSKR  197

Query  803   LAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDV  982
             L+ YR+IS+NY+F  +EDS+E +GLP RVFLGK+PEWTPDV+ F+ +EY RV HAQ +DV
Sbjct  198   LSKYREISVNYQFSAKEDSKELMGLPSRVFLGKIPEWTPDVRFFRSDEYARVDHAQHFDV  257

Query  983   RGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKI-SNVRNVK  1159
             RGT A+P+F+QGSRTCLGVIEVV+TTQK++YR E+ SVCKALE  DLR S++  N+    
Sbjct  258   RGTLALPIFEQGSRTCLGVIEVVMTTQKIQYRPEIQSVCKALEAFDLRSSEVFGNLSEES  317

Query  1160  TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSAC  1339
                SY+  +PEI EVL+SAC TH LPLAQTWVPC QQGK G RHS+EN + CVST+D AC
Sbjct  318   HWKSYEAAIPEIREVLRSACETHGLPLAQTWVPCSQQGKGGCRHSNENYVHCVSTIDHAC  377

Query  1340  YIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSL  1519
             ++ADP +Q FHEACSEHHLLKG GVVGRAF TNQPCFS+DITS  +TEYPLSH+AR+F L
Sbjct  378   HVADPLLQPFHEACSEHHLLKGQGVVGRAFQTNQPCFSSDITSSGRTEYPLSHHARMFGL  437

Query  1520  QAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqel  1699
              AAVAIRLRS  TG+ DFVLEFFLP DCK  ++ K+ML SLSIIIQ VCQ+LRV+T +EL
Sbjct  438   CAAVAIRLRSIHTGTADFVLEFFLPMDCKDHDKQKKMLGSLSIIIQQVCQSLRVITNEEL  497

Query  1700  eeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPC-EEGLSWTSSPMLVQESCMSSSAFQ  1876
             EEET  P   V   S+ R   E      ++ +  C EE LSW++    VQ+S   +SA Q
Sbjct  498   EEETVLPEIPVP--SEGRPQGEWSLEVESNYLERCSEEDLSWSAHVEKVQQSDTVASATQ  555

Query  1877  NEKPSELLYKRLPEFVSGSGLSFD-----STSGEGSAQNVRR--AGDKKRMKAEKTITLQ  2035
               +  E   ++  +F      S +     S  GEG   +  R   GDKKR KAEK ITLQ
Sbjct  556   KARAGESFVEKSLDFGQFQDSSTERGEDCSFYGEGRCSDAAREKTGDKKRTKAEKAITLQ  615

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +L+QYFAGSLKDAAKSLGV
Sbjct  616   VLRQYFAGSLKDAAKSLGV  634



>ref|XP_002306977.2| NIN-like protein 1 [Populus trichocarpa]
 gb|EEE93973.2| NIN-like protein 1 [Populus trichocarpa]
Length=865

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/604 (55%), Positives = 401/604 (66%), Gaps = 60/604 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCW+ETTDGSEF                    L P +    K S+       LP N  +
Sbjct  22    EGCWVETTDGSEF--------------------LNPTSSLSQKGSQEVSHIPLLPGNSPS  61

Query  518   SQFHTERVQCFGQNGSNAVCSSG----LAESSELSRRWWIGPMAT----TSVMDRLIQAL  673
                    +Q     G  AV ++G      E SEL +RWWIGP       T+V  RLI+A+
Sbjct  62    D------IQSRSPVGEIAVSAAGWEYNATEGSELGKRWWIGPAPNPSPGTTVKRRLIKAV  115

Query  674   GYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEE  853
               IKD +++KDVLIQIWVPVNR GRRVL T DQPF LD    RLA YRDIS+ Y+F  E+
Sbjct  116   ECIKDLTKNKDVLIQIWVPVNRGGRRVLTTHDQPFALDPSSERLASYRDISVKYQFSAEK  175

Query  854   DSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCL  1033
             DS+++VG+PGRVFLGKVPEWTPDV+ F+ +EYPRV HAQ+ DVRGT A+PVF+QGSRTCL
Sbjct  176   DSKDSVGMPGRVFLGKVPEWTPDVRFFRNDEYPRVNHAQQCDVRGTLALPVFEQGSRTCL  235

Query  1034  GVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQVVLPEILEVLKS  1213
             GVIEVV T+QK+KY  EL+SVCKALE  D+               SYQ  LPEI +VL++
Sbjct  236   GVIEVVTTSQKIKYLPELESVCKALEACDM---------------SYQAALPEIQKVLRA  280

Query  1214  ACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHH  1393
             AC TH+LPLAQTWVPC+QQGK G RHS+EN   CVSTVD AC + DP  QGF EACSEHH
Sbjct  281   ACETHRLPLAQTWVPCIQQGKGGCRHSNENYYHCVSTVDDACCVGDPAFQGFLEACSEHH  340

Query  1394  LLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDF  1573
             LLKG GVVG AFMTNQPCFS D+T + KTEYPLSH+ARIF L AAVAIRLRS  TG+TDF
Sbjct  341   LLKGQGVVGEAFMTNQPCFSGDVTLYGKTEYPLSHHARIFGLCAAVAIRLRSMYTGTTDF  400

Query  1574  VLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIR  1753
             VLEFFLP DC+ P+E K MLTSLSIIIQ VCQTLRVVT +ELEEET  P S+V   SD R
Sbjct  401   VLEFFLPVDCRDPQEQKTMLTSLSIIIQRVCQTLRVVTVKELEEETDLPVSEVLVPSDGR  460

Query  1754  IH-KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSG  1930
                +E   +K + S     +   WT+  + VQ+S  ++S  + +K   +  K      + 
Sbjct  461   SSGEETSTVKESYSERNARDNSPWTACLLKVQQSESNASLSEKDKEKVMCEKSFESRHNQ  520

Query  1931  SGLSF--------DSTSGEGSAQNV--RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAK  2080
                S         DSTS EGS  +V   + G+K+R K EKTITLQ+L+QYFAGSLKDAAK
Sbjct  521   EDYSLRGSTKYGGDSTSAEGSFSSVCKTKPGEKRRAKTEKTITLQVLRQYFAGSLKDAAK  580

Query  2081  SLGV  2092
             S+GV
Sbjct  581   SIGV  584



>ref|XP_010266179.1| PREDICTED: protein NLP4 [Nelumbo nucifera]
 ref|XP_010266180.1| PREDICTED: protein NLP4 [Nelumbo nucifera]
Length=965

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/666 (51%), Positives = 431/666 (65%), Gaps = 54/666 (8%)
 Frame = +2

Query  254   MDESVFPSSIVLNTTsdssfm--dlddllfEGCWLETTDGSEFFQHSPFNANALFEPSYV  427
             M++ VFP +  L T  +++     +D+LL EGCWLET DGS+F Q     +   F+ S  
Sbjct  1     MEDGVFPRATTLETVPETTGDFDIMDELLLEGCWLETIDGSDFLQPGSSISTDFFDSSCF  60

Query  428   LPDLEPNNGELM----KESEVERKKSSLPENLSASQFHTE-----RVQCFGQNGSNAVCS  580
              P  E N G +     K  + +  + S PEN    QF  +     R+Q    N      S
Sbjct  61    SPTPEINTGNMNAIPPKNGQDKTNEPSFPEN-PPDQFERQTEGAIRIQPEKPNAVEIAES  119

Query  581   SGLAESS--------ELSRRWWIGPMAT--TSVMDRLIQALGYIKDFSRDKDVLIQIWVP  730
             SG A S         ELS+RWWIGP +    SV +RL+QALGYI++ ++D DVLIQIWVP
Sbjct  120   SGRAGSECCSAEANCELSKRWWIGPSSNLGPSVRERLMQALGYIQESTKDSDVLIQIWVP  179

Query  731   VNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPE  910
             V R G+ VL T  QPF L+    RLA+YR++S++Y+FP EEDS+E +GLPGRVFLGKVPE
Sbjct  180   VKRGGKHVLTTDGQPFSLNPSSQRLANYRNVSLSYQFPAEEDSKETIGLPGRVFLGKVPE  239

Query  911   WTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELD  1090
             WTPDV+ F+ +E+PRV +AQR D+RGT A+PVF++GSRTCLGVIEVV T QK+ YR +++
Sbjct  240   WTPDVRFFRSDEFPRVDYAQRCDIRGTLALPVFERGSRTCLGVIEVVTTAQKINYRPDVE  299

Query  1091  SVCKALEEVDLRGSKISNVRNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQ  1267
             +VC+AL+ VDL  S++S   ++K +  SYQ VLPEIL VLK+ C T+KL LAQTWVPC Q
Sbjct  300   NVCRALQAVDLTSSEVSISSHLKGSSTSYQAVLPEILGVLKAVCETYKLSLAQTWVPCTQ  359

Query  1268  QGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPC  1447
             QGK G RHSDEN   CVSTVDSACY+ DP++ GFHEACSEHHL +G GV GRAF TNQPC
Sbjct  360   QGKGGCRHSDENYAVCVSTVDSACYVTDPQMWGFHEACSEHHLFRGQGVAGRAFTTNQPC  419

Query  1448  FSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKR  1627
             FS D+T+FSKTEYPLSHYARIF L+AAVAIRLRS  TGS D+VLEFFLP DC   EE + 
Sbjct  420   FSTDVTAFSKTEYPLSHYARIFGLRAAVAIRLRSISTGSIDYVLEFFLPVDCMGTEEQRV  479

Query  1628  MLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVP-NLKYNSSIGPC  1804
             ML SLS I+Q VCQ+LRVVT++E+E+E   P  +VA  S+    +++   L      G  
Sbjct  480   MLNSLSTIVQRVCQSLRVVTDKEIEDEAGFPVHEVAVPSNESPEQKIATGLGSTGFKGSS  539

Query  1805  EEGLSWTSSPMLVQESCMSSS-AFQNEKPSE----LLYKRLPEFVSGSGLSFDSTS----  1957
             EE  SW +  M  Q+   S    FQ E+P+       + + P  V   G +F        
Sbjct  540   EEEPSWITHMMESQKKGESFPLIFQKEEPNSEFKITTHWQNPGLVFHQGETFSEYKQHRQ  599

Query  1958  ---------------------GEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDA  2074
                                  GE S+ +  + G+K+R K EKTI+LQ L+QYFAGSLKDA
Sbjct  600   DSRPKNVAEPECGGNSSAFGFGERSSSSGGKTGNKRRTKTEKTISLQALRQYFAGSLKDA  659

Query  2075  AKSLGV  2092
             AKS+GV
Sbjct  660   AKSIGV  665



>ref|XP_008237985.1| PREDICTED: protein NLP4-like isoform X1 [Prunus mume]
Length=911

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/610 (54%), Positives = 408/610 (67%), Gaps = 47/610 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKK-------SS  496
             EGCWLETTDG EF   S  N+ A    S     LE N    M  SE   ++         
Sbjct  31    EGCWLETTDGPEFPNQSHANSGAHLNSSVFWHTLEANGNLTMNPSENSNQEVIQTPFFKQ  90

Query  497   LPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLI  664
             L E     QF ++ +     +G +   +    +S EL+RRWWIGP+      +SVM+RL 
Sbjct  91    LHEGPVNPQFPSQNM--IDVDGYSGHSADPTIKSYELNRRWWIGPLGNQGPASSVMERLT  148

Query  665   QALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFP  844
             +AL  I+D  RDK+VL+Q+WVPVN+ GR VL T D  F LD  CPRL+ YRDIS+NY+F 
Sbjct  149   RALVCIRDVMRDKNVLVQVWVPVNKGGRNVLTTNDDLFSLDSSCPRLSKYRDISVNYQFS  208

Query  845   VEEDSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
               EDS E V GLPGRVF G+VPEWTPDV+ F+ +EYPRV +AQRYDVRGT A+P+F+QGS
Sbjct  209   TGEDSTELVKGLPGRVFSGQVPEWTPDVRFFRSDEYPRVDYAQRYDVRGTLALPIFEQGS  268

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC-HSYQVVLPEIL  1198
              TCLGVIEVV TTQK+KY+ EL+SVCKALE VDL+ S+  + +NVK C   YQ  LPEI 
Sbjct  269   STCLGVIEVVTTTQKIKYQLELESVCKALEAVDLQSSRNWSTQNVKGCVKPYQAALPEIR  328

Query  1199  EVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEA  1378
             EVL+SAC THKLPLAQTWV C+QQGK+G RHSD+N + CVSTVD A ++ DP I+GFHEA
Sbjct  329   EVLRSACETHKLPLAQTWVSCIQQGKDGCRHSDDNYVHCVSTVDHAFHVTDPYIEGFHEA  388

Query  1379  CSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCT  1558
             CSEHHLLKG G+VG+AFMTNQPCFS DITS  KTEYPLSH+AR+F L AAVAIRLRS  T
Sbjct  389   CSEHHLLKGQGIVGKAFMTNQPCFSDDITSCVKTEYPLSHHARMFGLHAAVAIRLRSMKT  448

Query  1559  GSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAK  1738
             GSTDFVLEFFLP +C+ PEE K+ML SLSIIIQ +C++LRVVT++ELEEE+  P S++  
Sbjct  449   GSTDFVLEFFLPVECRDPEEQKKMLNSLSIIIQQICRSLRVVTDKELEEESDFPVSEMIV  508

Query  1739  HSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELL---YKR  1909
              SD R                     S  +S   VQ S    S F  E P E+L     +
Sbjct  509   SSDPRP--------------------SGIASFTEVQLSGNDVSIFPMENPREVLGVKSSK  548

Query  1910  LPEFVSGSGLSFD-------STSGEG--SAQNVRRAGDKKRMKAEKTITLQILQQYFAGS  2062
             L +    S L          S  GEG  S+  V +  +K+R +AEK ITL++L++YF+GS
Sbjct  549   LRQHQPDSNLKVGVKCGRECSALGEGSFSSVGVSKTREKRRTRAEKAITLEVLRKYFSGS  608

Query  2063  LKDAAKSLGV  2092
             LKDAA S+GV
Sbjct  609   LKDAANSIGV  618



>ref|XP_007210497.1| hypothetical protein PRUPE_ppa001086mg [Prunus persica]
 gb|EMJ11696.1| hypothetical protein PRUPE_ppa001086mg [Prunus persica]
Length=912

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/610 (54%), Positives = 409/610 (67%), Gaps = 47/610 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKK-------SS  496
             EGCWLETTDG EF   S  N++A   PS     LE N    M  SE   ++         
Sbjct  31    EGCWLETTDGPEFPNQSHANSSAHINPSVFWHMLEANGNLTMNPSENSNQEVIQTPFFKQ  90

Query  497   LPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLI  664
             L E     QF ++ +     +G +   +    +S EL+RRWWIGP+      +SVM+RL 
Sbjct  91    LHEGPVNPQFPSQNM--IDVDGYSGHSADPTIKSYELNRRWWIGPLGNQGPASSVMERLT  148

Query  665   QALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFP  844
             +AL  I++  RDK+VL+Q+WVPVN+ GR VL T D  F LD  CPRL+ YRDIS+NY+F 
Sbjct  149   RALVCIREVMRDKNVLVQVWVPVNKGGRNVLTTNDDLFSLDSSCPRLSKYRDISVNYQFS  208

Query  845   VEEDSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
               EDS E V GLPGRVF G+VPEWTPDV+ F+ +EYPRV +AQRYDVRGT A+P+F+QGS
Sbjct  209   TGEDSTELVKGLPGRVFSGQVPEWTPDVRFFRSDEYPRVDYAQRYDVRGTLALPIFEQGS  268

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC-HSYQVVLPEIL  1198
             RTCLGVIEVV TTQK+KY+ EL+SVCKALE VDL+ S+  + +NVK C   YQ  LPEI 
Sbjct  269   RTCLGVIEVVTTTQKIKYQLELESVCKALEAVDLQSSRNWSTQNVKGCVKPYQAALPEIQ  328

Query  1199  EVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEA  1378
             EVL+ AC THKLPLAQTWV C+QQGK+G RHSD+N + CVSTVD A ++ DP I+GF+EA
Sbjct  329   EVLRCACETHKLPLAQTWVSCIQQGKDGCRHSDDNYVHCVSTVDHAFHVTDPYIEGFYEA  388

Query  1379  CSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCT  1558
             CSEHHLLKG G+VG+AFMTNQPCFS DITS  KTEYPLSH+AR+F L AAVAIRLRS  T
Sbjct  389   CSEHHLLKGQGIVGKAFMTNQPCFSDDITSCVKTEYPLSHHARMFGLHAAVAIRLRSMKT  448

Query  1559  GSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAK  1738
             GSTDFVLEFFLP +C+ PEE K+ML SLS+IIQ +C++LRVVT++ELEEE+  P S++  
Sbjct  449   GSTDFVLEFFLPVECRDPEEQKKMLNSLSLIIQQICRSLRVVTDKELEEESDFPVSEMIV  508

Query  1739  HSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELL---YKR  1909
              SD R                     S  +S   V  S    S F  E P E+L     +
Sbjct  509   SSDPRP--------------------SGIASFTEVHLSGNDVSIFPMENPREVLGVKSSK  548

Query  1910  LPEFVSGSGLSFD-------STSGEG--SAQNVRRAGDKKRMKAEKTITLQILQQYFAGS  2062
             L +    S L          S  GEG  S+  V +  +K+R KAEK ITL++L++YF+GS
Sbjct  549   LRQHQPDSNLKVGVKCGRECSALGEGSFSSVGVSKTREKRRTKAEKAITLEVLRKYFSGS  608

Query  2063  LKDAAKSLGV  2092
             LKDAA S+GV
Sbjct  609   LKDAANSIGV  618



>gb|KHG12417.1| Protein NLP4 -like protein [Gossypium arboreum]
Length=982

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/615 (53%), Positives = 406/615 (66%), Gaps = 36/615 (6%)
 Frame = +2

Query  338   EGCWLET--TDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKE-SEVERKKSSLPEN  508
             +GCWLE   T+GS+F      + NA F+P++  P L+ N G+L     + E + S LP N
Sbjct  21    DGCWLEASPTEGSDFL-----DPNAFFDPTFEWPILDSNGGDLGGSLFQGENQISFLPGN  75

Query  509   LSASQFHTERVQCFGQ-----NGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRL  661
                ++ H++              S  +    +  +SELSRRWWIGP      +TSVM RL
Sbjct  76    PHMNENHSQGAHLSPNLDDVDGMSRNLHGDCMTNTSELSRRWWIGPRTNPGPSTSVMLRL  135

Query  662   IQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEF  841
             I AL +IKD +++ DVL+Q+W+PVN+ GRR+L T +QPF LD    RLA YR+IS+ Y+F
Sbjct  136   IGALNHIKDSAKETDVLVQLWLPVNKGGRRILTTSEQPFSLDPNSQRLASYRNISVKYQF  195

Query  842   PVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
             P EEDS++  GLPGRVFL KVPEWTPDV+ F+ +EY RV HAQ++ VRGTFA+PVF+QG+
Sbjct  196   PAEEDSKDMAGLPGRVFLSKVPEWTPDVRFFRSDEYHRVDHAQQHGVRGTFALPVFEQGN  255

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEIL  1198
             RTCLGVIEVV+TT+K+K + E++SVCKALE V+LR    S+  N++ C+S YQ  LPEI 
Sbjct  256   RTCLGVIEVVMTTEKIKIKPEMESVCKALEAVNLRSFTASSTGNIQACNSSYQAALPEIK  315

Query  1199  EVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEA  1378
             EVLK AC TH+LPLAQTWVPC+Q GKEG  HS EN   CVSTVD ACYIA+P I+GFHE 
Sbjct  316   EVLKRACETHRLPLAQTWVPCMQLGKEGWPHSTENYFHCVSTVDDACYIAEPNIRGFHEV  375

Query  1379  CSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCT  1558
             CSEHHLLKG GV GRAFMTNQPCFS DITSF KTEYPL+H+A++F L AAVAIR R   T
Sbjct  376   CSEHHLLKGQGVAGRAFMTNQPCFSTDITSFKKTEYPLAHHAKMFKLHAAVAIRFRCIHT  435

Query  1559  GSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNV-CQtlrvvteqeleeettSPSSKVA  1735
             G  DFVLEFFLP DC+ PE  K ML SLSII+Q V C    V  E+  E+   + S  +A
Sbjct  436   GKADFVLEFFLPADCRDPEGKKEMLNSLSIILQQVCCSLRVVTNEELEEDRDMAVSEVIA  495

Query  1736  KHSDIRIHKEVP--NLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS------------AF  1873
                 I   KE+      Y+S      E  SWT S   V +S  +S+            A 
Sbjct  496   SLDGIPSRKELSEDQCTYHSE-KYSRESSSWTVSLTEVNQSSSTSTSTAMKLRKGKPRAT  554

Query  1874  QNEKPSELLYKRLPEFVSGSGLSFDSTSGE--GSAQNVRRAGDKKRMKAEKTITLQILQQ  2047
              +EK S++   +    + GS    DST  E   S+   R+ G K+R KAEKTITLQ+L+Q
Sbjct  555   WDEKLSKVKQHKKQISLRGSVEGGDSTINEISFSSATKRKTGQKRRSKAEKTITLQVLRQ  614

Query  2048  YFAGSLKDAAKSLGV  2092
             YF+ SLKDAAKSLGV
Sbjct  615   YFSESLKDAAKSLGV  629



>ref|XP_008373422.1| PREDICTED: protein NLP5-like [Malus domestica]
Length=640

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/615 (51%), Positives = 397/615 (65%), Gaps = 59/615 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKES------EVERK-KSS  496
             EGCWLETT G EF   S  +  A   PS+    LE N       S      E++R     
Sbjct  49    EGCWLETTYGPEFPNQSLPSTAAPLNPSFFWHTLETNGNMAXNTSHNSNQEEMQRPFLKQ  108

Query  497   LPENLSASQFHTERVQCFGQNGSNAVCSSGLA-----ESSELSRRWWIGPMAT----TSV  649
             L E     Q   E +        +AV  SG +     E  E SRRWWIGP       +SV
Sbjct  109   LVEGPVNXQSPREDMI------KDAVAYSGQSVDPTIEGREFSRRWWIGPTGNEGFASSV  162

Query  650   MDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISI  829
              +RL++AL  I +  R+KDVL+Q+WVPVNR GRRVL T ++ F LD  C RLA YRDIS 
Sbjct  163   TERLMRALVNIGEVMRNKDVLVQVWVPVNRGGRRVL-TMNELFYLDSSCSRLAKYRDISA  221

Query  830   NYEFPVEEDSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             NY+F   EDS E V GLPGRVF GK+PEWTPDV+ F+ +EYPRVGHAQ+Y+V GT A+P+
Sbjct  222   NYQFATGEDSTEMVMGLPGRVFSGKIPEWTPDVRYFRHDEYPRVGHAQQYNVSGTLALPI  281

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVV  1183
             F+QGSRTCLGVIEVV T QK+KY+ ++DSVCKALE VDLR S+  + +NVK C   +   
Sbjct  282   FEQGSRTCLGVIEVVTTDQKIKYQXDIDSVCKALEAVDLRSSRNLSTQNVKGCDKPFHAA  341

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQ  1363
             LPEI EVL+SAC THKLPLAQTW+ C+QQGK+G RH+D+N + CVSTV+ AC++ADP IQ
Sbjct  342   LPEIQEVLRSACETHKLPLAQTWMSCIQQGKDGCRHTDDNYVHCVSTVEHACHVADPCIQ  401

Query  1364  GFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRL  1543
              FHEACSEHHLL+G G+VGRAFMTNQPCFS DITSF KTEYPLSH+AR+F L AAVAIRL
Sbjct  402   SFHEACSEHHLLRGQGIVGRAFMTNQPCFSDDITSFVKTEYPLSHHARMFDLHAAVAIRL  461

Query  1544  RSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPS  1723
             RS  TGSTDFVLEFFLP +C+ PEE ++MLTSLS+++Q  C+                 S
Sbjct  462   RSIDTGSTDFVLEFFLPVECRDPEEQEKMLTSLSLVMQQTCR-----------------S  504

Query  1724  SKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLY  1903
              +V    ++   +E  N   +  I   + G S       VQ++    S F N+KP ++L 
Sbjct  505   LRVVTDKEV---EEETNFHVSEVIARSDPGPSNIXCFTXVQQNGKDVSMFPNQKPRKVLS  561

Query  1904  KRLPEF--------VSGS---GLSFDSTSGEG--SAQNVRRAGDKKRMKAEKTITLQILQ  2044
              +L +         + G    G  F S  GEG  S+  V +  +K+R KAEK I  ++L+
Sbjct  562   VKLSKLRQHQEDSNLKGGVECGQEF-SALGEGSFSSVGVSKTREKRRTKAEKDINFEVLR  620

Query  2045  QYFAGSLKDAAKSLG  2089
             +YF+GSLKDAAKS+G
Sbjct  621   KYFSGSLKDAAKSIG  635



>ref|XP_009369835.1| PREDICTED: protein NLP5-like [Pyrus x bretschneideri]
 ref|XP_009369836.1| PREDICTED: protein NLP5-like [Pyrus x bretschneideri]
Length=907

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/610 (51%), Positives = 390/610 (64%), Gaps = 49/610 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLE  DG EF   S    N    PS++   LE N       S+   ++         
Sbjct  31    EGCWLEARDGPEFPNQSL--PNTPLNPSFIWHTLETNGNMSTNPSQNSNQEEMQTPFFKQ  88

Query  518   SQFHTERVQCFGQNG-SNAVCSSGLAES----SELSRRWWIGPM----ATTSVMDRLIQA  670
              +      Q   QN   + V  SG +E      ELS RWWI P     + +SV  RL+ A
Sbjct  89    LEEGPANPQSPCQNMIEDVVACSGQSEDPTIGRELSTRWWIRPTGNDGSASSVTQRLMTA  148

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             L YI++  R+KDVL+Q+WVPVNR GR VL T ++ F LD  C RLA YRDIS+NY+F   
Sbjct  149   LTYIREVMRNKDVLVQVWVPVNRGGRDVLTT-NELFCLDPSCSRLAKYRDISVNYQFSTG  207

Query  851   EDSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRT  1027
             EDS E V GLPGRVF GKVPEWTPD + F  +EYPRVGHAQ+YDV GT A+P+F+QGSRT
Sbjct  208   EDSTEMVKGLPGRVFSGKVPEWTPDARYFTSDEYPRVGHAQQYDVSGTLALPIFEQGSRT  267

Query  1028  CLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILEV  1204
             CLGVIEVV T QK++Y+ ++D +CKALE VDLR S+  +  NVK C   Y   LPEI E+
Sbjct  268   CLGVIEVVTTDQKIRYQPDIDGICKALEAVDLRSSRNLSTENVKGCDKPYHAALPEIQEI  327

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             L+SAC THKLPLAQTWV C++QGK+G RHSD+N + CVSTVD AC++ADP IQGFHEACS
Sbjct  328   LRSACETHKLPLAQTWVSCIEQGKDGCRHSDDNYIHCVSTVDHACHVADPYIQGFHEACS  387

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLL+G G+VGRAFMTNQPCFS D+TSF KTEYPLSH+AR+F+L AAVAIRLRST  GS
Sbjct  388   EHHLLRGQGIVGRAFMTNQPCFSDDMTSFFKTEYPLSHHARMFNLHAAVAIRLRSTDIGS  447

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHS  1744
             TDFVLEFFLP +C+ P+E K+ML SLS+IIQ  C+                 S +V    
Sbjct  448   TDFVLEFFLPLECRDPKEQKKMLNSLSLIIQQTCR-----------------SLRVVTDK  490

Query  1745  DIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEF-  1921
             ++   +E      +  I P + G S  +    VQ++  + S F N+K  ++L  +L +  
Sbjct  491   EV---EEETKFHVSEVIVPSDPGPSNVACFTEVQQNGNAVSMFPNKKQRKVLSVKLSKLR  547

Query  1922  ---------VSGSGLSFDSTSGEG----SAQNVRRAGDKKRMKAEKTITLQILQQYFAGS  2062
                       +  G  F S  GEG    S     +  +K+R KAEK I LQ+L++YF+GS
Sbjct  548   QHQEDSNLKSAECGEEF-SVLGEGEVSFSTVGASKTREKRRAKAEKDINLQVLRKYFSGS  606

Query  2063  LKDAAKSLGV  2092
             LKDAAKS+GV
Sbjct  607   LKDAAKSIGV  616



>ref|XP_006581139.1| PREDICTED: protein NLP4-like isoform X3 [Glycine max]
Length=909

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/619 (50%), Positives = 397/619 (64%), Gaps = 72/619 (12%)
 Frame = +2

Query  338   EGCWLETT-DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELM-------KESEVERKKS  493
             +GCW+E + DGS+F   SP  +N LF+PS+  P LE N+ E         +ES      S
Sbjct  39    DGCWMEASADGSDFLLQSPSFSNTLFDPSFSWPALETNHNESQVAAFGSQQESHNNNMVS  98

Query  494   SLPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM--------ATTSV  649
              +     + QF +E     G              +SE  RRWW  P            S+
Sbjct  99    VVAGGDYSQQFQSETHSVEG--------------ASEGIRRWWFAPTHTPTPSPGPGPSI  144

Query  650   MDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISI  829
             M++LI+AL +IKD++R+KD+LIQIWVPV+++GR +L   D  F L+ K   LA YR+IS+
Sbjct  145   MEKLIRALMWIKDYNRNKDMLIQIWVPVHKEGRPILAADDLLFSLESKSLNLAKYREISV  204

Query  830   NYEFPVEE-DSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
              Y+F  EE DS+E   GLPGRVF  KVPEWTPDV+ FK +EYPRV HAQ YDVRGT AVP
Sbjct  205   TYKFSAEESDSKELAWGLPGRVFRDKVPEWTPDVRFFKIDEYPRVDHAQEYDVRGTLAVP  264

Query  1004  VFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQV  1180
             +F+QGS+TCLGVIEVV+TTQ++ Y  EL+SVCKALE VDLR SK  +++NVK C+ SY+ 
Sbjct  265   IFEQGSKTCLGVIEVVMTTQQINYGPELESVCKALEAVDLRSSKQLSIQNVKACNRSYEA  324

Query  1181  VLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRI  1360
              LPEI EVL+SAC  HKLPLAQTWVPCVQQGKEG RHS++N L C+S V+ ACY+ DP I
Sbjct  325   ALPEIHEVLRSACEMHKLPLAQTWVPCVQQGKEGCRHSEDNYLLCISPVEHACYVGDPSI  384

Query  1361  QGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIR  1540
             + FHEAC+EHHLLKG GV G AFMTNQPCFS DITS SK +YP+SH+AR+F L+AAVAIR
Sbjct  385   RSFHEACTEHHLLKGEGVAGGAFMTNQPCFSDDITSLSKKDYPMSHHARLFGLRAAVAIR  444

Query  1541  LRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP  1720
             LRS    + DFVLEFFLP DC   EE ++MLTSLS IIQ VC+                 
Sbjct  445   LRSIYNSTDDFVLEFFLPVDCNDIEEQRKMLTSLSNIIQRVCR-----------------  487

Query  1721  SSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELL  1900
             S +V +  ++    E  NL  N  I   + G +        Q+  M +S    EK SE +
Sbjct  488   SLRVIREKEL----EEANLSVNEVIALADSGFTRDEICSEPQQKGMVASLDTEEKSSETM  543

Query  1901  YKRLPE--------FVSGSGLSFD-----STSGEG--SAQNVRRAGDKKRMKAEKTITLQ  2035
              ++  E         + G   + D     STS EG  S+    + G+++R+KAEKTITLQ
Sbjct  544   GRKFSEPRQQQESPILKG---NLDCVRECSTSVEGNLSSPGTSKTGERRRVKAEKTITLQ  600

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +L+QYFAGSLKDAAK++GV
Sbjct  601   VLRQYFAGSLKDAAKNIGV  619



>ref|XP_010242905.1| PREDICTED: protein NLP4-like [Nelumbo nucifera]
Length=1202

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/615 (53%), Positives = 413/615 (67%), Gaps = 32/615 (5%)
 Frame = +2

Query  341   GCWLETTDGSEFFQHS-PFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             GCWLET+ GS+F Q      + AL + SY  P  E + G L         + +   +  A
Sbjct  308   GCWLETSGGSDFLQPGWSSTSAALSDSSYFFPTPEISAGSLNPVPPRTDPEETTGSSFLA  367

Query  518   SQFHTERVQCFGQNGSNAVCS---SGLAE------SSELSRRWWIGPMATT--SVMDRLI  664
             +Q H E          N V S   SG AE      SS+L ++WWIGP +    SV +RLI
Sbjct  368   NQPHVETETEDDIRTPNTVISANSSGRAECYPAIGSSKLKKKWWIGPSSNPGPSVRERLI  427

Query  665   QALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFP  844
             QA+GYI++ ++D+DVLIQIWVPV R G+ VL T  QPF LD  C RLA+YR+ S+NY+FP
Sbjct  428   QAVGYIRESTKDRDVLIQIWVPVKRGGKHVLTTDGQPFSLDPNCRRLANYRNASLNYQFP  487

Query  845   VEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSR  1024
              EE+S+E VGLPGRVFLGKVPEWTPDV+ +  +EYPR+ +AQR DVRGT A+PVF++ SR
Sbjct  488   AEENSEETVGLPGRVFLGKVPEWTPDVRFYDSDEYPRIDYAQRCDVRGTVALPVFERTSR  547

Query  1025  TCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCHSYQVVLPEILE  1201
             TCLGV+EVV+TTQK+ YR E +SVC+ALE VDLR S++    ++K T +SYQ  LPEILE
Sbjct  548   TCLGVVEVVMTTQKINYRPEFESVCRALEAVDLRSSEVPMSSHLKVTSNSYQAALPEILE  607

Query  1202  VLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEAC  1381
             VL+ AC TH LPLAQTWVPC+QQ K G RHSD+N   CVST+DSAC++ DP + GFHEAC
Sbjct  608   VLRVACETHSLPLAQTWVPCIQQCKGGYRHSDDNYADCVSTMDSACHMGDPLLWGFHEAC  667

Query  1382  SEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTG  1561
             SEHH  +G GVVG+AF TNQ CFS D+T+FSKTEYPL HYAR+F L+AAVAI LRST T 
Sbjct  668   SEHHFFRGQGVVGKAFTTNQLCFSTDVTTFSKTEYPLLHYARMFGLRAAVAIHLRSTRTE  727

Query  1562  STDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKH  1741
             +TD+VLEFFLP DC   E+ K +L SL II+Q V Q+L+V+T++EL EET    S+V   
Sbjct  728   TTDYVLEFFLPVDCVDIEKQKVILNSLFIIVQQVRQSLQVITDKELVEETDFLVSEVTTP  787

Query  1742  SD-IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMS-SSAFQNEKPSELLY----  1903
             S+     K++ N +   SIG C+E  S  +  M  Q+   S    FQ E+P+ + Y    
Sbjct  788   SNGTSDRKKLSNFRSMESIGSCKEESSEIAYIMESQQKDKSVPVVFQKEEPT-VEYKITT  846

Query  1904  --KRLPEFVS-----GSGLSFD-----STSGEGSAQNVRRAGDKKRMKAEKTITLQILQQ  2047
               K L E+       G   S D     S  GEG+  +  R G+K+R K EK I+LQ+LQQ
Sbjct  847   NGKMLSEYEQHLRDPGPRYSIDCHGKSSDFGEGTYSSGGRTGEKRRTKTEKIISLQVLQQ  906

Query  2048  YFAGSLKDAAKSLGV  2092
             YFAGSLKDAAKS+GV
Sbjct  907   YFAGSLKDAAKSIGV  921



>ref|XP_010645880.1| PREDICTED: protein NLP2-like [Vitis vinifera]
 ref|XP_010645886.1| PREDICTED: protein NLP2-like [Vitis vinifera]
 ref|XP_010645896.1| PREDICTED: protein NLP2-like [Vitis vinifera]
 ref|XP_010645900.1| PREDICTED: protein NLP2-like [Vitis vinifera]
Length=947

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/629 (51%), Positives = 412/629 (66%), Gaps = 49/629 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLE-PNNGELMKESEVERKKSSLPENLS  514
             EGCWLETTDG  F Q     ++AL + S+     E PN  E  K    + ++SSLPEN  
Sbjct  31    EGCWLETTDGFSFLQPGASTSSALNDSSHHSLTFENPNTPE--KSYGDDGQRSSLPEN--  86

Query  515   ASQFHTERVQCFGQNGSN-----AVCSSG-----LAESSELSRRWWIGPMAT----TSVM  652
                F+ +     G    N     A  +SG     L E +EL+RR WIGP A     +SV 
Sbjct  87    PPPFYPQAEGLVGTQSDNWKTFEAATASGQSESFLVERTELNRRLWIGPSANPGPVSSVK  146

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
             +RLI A+  +++F++++DVLIQIWVP+ R G+ VL T DQPF LD  C  LA+YR++S N
Sbjct  147   NRLILAIRNLREFTKERDVLIQIWVPIERGGKNVLTTNDQPFSLDPDCQSLANYRNVSEN  206

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y FP EEDS+E VGLPGRVFLGKVPEWTPDV+ FK EEYPR+ +AQRY+VRG+ A+PVF+
Sbjct  207   YHFPAEEDSKEQVGLPGRVFLGKVPEWTPDVRFFKSEEYPRINYAQRYNVRGSLALPVFE  266

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLP  1189
             +GS  CLGVIE+V TTQK+ YR EL++VCKALE VDLR S++  +  VK C+  YQ  LP
Sbjct  267   RGSGVCLGVIEIVTTTQKINYRPELENVCKALEAVDLRSSEVL-IPPVKACNELYQAALP  325

Query  1190  EILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGF  1369
             EIL+VL   C TH+LPLAQTW PC+QQGK G RHSD+N    +STVD A Y+ DP+ +GF
Sbjct  326   EILKVLARVCRTHRLPLAQTWAPCIQQGKGGCRHSDKNYALFLSTVDHAYYVTDPKFKGF  385

Query  1370  HEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRS  1549
             +EAC +HHL +G GVVGRA  TNQPCF +DIT+FSKTEYPLSH+AR+F L+AAVAIRL+S
Sbjct  386   NEACFDHHLFRGQGVVGRALTTNQPCFESDITAFSKTEYPLSHHARMFGLRAAVAIRLKS  445

Query  1550  TCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK  1729
                GS DF+LEFFLP DC+  EE K++L SLSI+IQ  CQ  RVVTE++LE+E+  P  +
Sbjct  446   IYNGSADFILEFFLPTDCQETEEQKQVLNSLSIVIQQTCQIFRVVTEKDLEKESILPVGE  505

Query  1730  VAKHSDIRIHKEVPNLKYNSSIG-PCEEGLSWTSSPMLVQESCMSSSA---FQ-------  1876
             +   SD R+ +E      +  I  P  E  SW +  M  Q+     S    +Q       
Sbjct  506   ILFASDERVKQEGSVKLLSPPIKEPSREESSWIAHMMEAQKKGKGVSVSLEYQKEEPEEE  565

Query  1877  -------NEKPSELLYKRL------PEFVSGSGLSF----DSTSGEGSAQNVRRAGDKKR  2005
                    +    EL + ++      P+  SG+  S     DS+ G   +   R+A +K+R
Sbjct  566   FKVTTNWDNTEVELHHGQVFSEFGQPQQNSGAKGSVEGGGDSSFGGQHSSGSRKAREKRR  625

Query  2006  MKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              K EKTI+LQ+L QYFAGSLKDAAKS+GV
Sbjct  626   TKTEKTISLQVLSQYFAGSLKDAAKSIGV  654



>ref|XP_009362861.1| PREDICTED: protein NLP5-like [Pyrus x bretschneideri]
 ref|XP_009362862.1| PREDICTED: protein NLP5-like [Pyrus x bretschneideri]
 ref|XP_009362863.1| PREDICTED: protein NLP5-like [Pyrus x bretschneideri]
Length=907

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/610 (51%), Positives = 389/610 (64%), Gaps = 49/610 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLE  DG EF   S    N    PS++   LE N    M   +   ++         
Sbjct  31    EGCWLEARDGPEFPNQSL--PNTPLNPSFIWHTLETNGNMSMNPYQNSNQEEMQTPFFKQ  88

Query  518   SQFHTERVQCFGQNG-SNAVCSSGLAES----SELSRRWWIGPM----ATTSVMDRLIQA  670
              +      Q   QN   + V  SG +E      ELS RWWIGP     + +SV  RL+ A
Sbjct  89    LEEGPANPQSPCQNMIEDVVAYSGQSEDPTIGRELSTRWWIGPTGNDGSASSVTQRLMTA  148

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             L YI++  R+KDVL+Q+WVPVNR GR VL T ++ F LD  C RLA YRDIS+NY+F   
Sbjct  149   LTYIREVMRNKDVLVQVWVPVNRGGRDVLTT-NELFCLDPSCSRLAKYRDISVNYQFSTG  207

Query  851   EDSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRT  1027
             EDS E V GLPGRVF GKVPEWTPD + F  +EYPRV HAQ+YDV GT A+P+F+QGSRT
Sbjct  208   EDSTEMVKGLPGRVFSGKVPEWTPDARYFTSDEYPRVRHAQQYDVSGTLALPIFEQGSRT  267

Query  1028  CLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILEV  1204
             CLGVIEVV T +K+ Y+ ++D +CKALE VDLR S+  +  NVK C   Y   LPEI E+
Sbjct  268   CLGVIEVVTTDRKISYQPDIDGICKALEAVDLRSSRNLSTENVKGCDKPYHAALPEIQEI  327

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             L+SAC THKLPLAQTWV C++QGK+G RHSD+N + CVSTVD AC++ADP IQGFHEACS
Sbjct  328   LRSACETHKLPLAQTWVSCIEQGKDGCRHSDDNYIHCVSTVDHACHVADPYIQGFHEACS  387

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLL+G G+VGRAFMTNQPCFS D+TSF KTEYPLSH+AR+F+L AAVAIRLRST  GS
Sbjct  388   EHHLLRGQGIVGRAFMTNQPCFSDDMTSFFKTEYPLSHHARMFNLHAAVAIRLRSTDIGS  447

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHS  1744
             TDFVLEFFLP +C+ P+E K+ML SLS+IIQ  C+                 S +V    
Sbjct  448   TDFVLEFFLPLECRDPKEQKKMLNSLSLIIQQTCR-----------------SLRVVTDK  490

Query  1745  DIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEF-  1921
             ++   +E      +  I P + G S  +    VQ++  + S F N+K  ++L  +L +  
Sbjct  491   EV---EEETKFHVSEVIVPSDPGPSNVACFTEVQQNGNAVSMFPNKKQRKVLSVKLSKLR  547

Query  1922  ---------VSGSGLSFDSTSGEG----SAQNVRRAGDKKRMKAEKTITLQILQQYFAGS  2062
                       +  G  F S  GEG    S     +  +K+R KAEK I LQ+L++YF+GS
Sbjct  548   QHQEDSNLKSAECGEEF-SVLGEGEVSFSTVGASKTREKRRAKAEKDINLQVLRKYFSGS  606

Query  2063  LKDAAKSLGV  2092
             LKDAAKS+GV
Sbjct  607   LKDAAKSIGV  616



>ref|XP_003527641.2| PREDICTED: protein NLP4-like isoform X1 [Glycine max]
 ref|XP_006581138.1| PREDICTED: protein NLP4-like isoform X2 [Glycine max]
Length=910

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/620 (50%), Positives = 397/620 (64%), Gaps = 73/620 (12%)
 Frame = +2

Query  338   EGCWLETT-DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELM-------KESEVERKKS  493
             +GCW+E + DGS+F   SP  +N LF+PS+  P LE N+ E         +ES      S
Sbjct  39    DGCWMEASADGSDFLLQSPSFSNTLFDPSFSWPALETNHNESQVAAFGSQQESHNNNMVS  98

Query  494   SLPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM--------ATTSV  649
              +     + QF +E     G              +SE  RRWW  P            S+
Sbjct  99    VVAGGDYSQQFQSETHSVEG--------------ASEGIRRWWFAPTHTPTPSPGPGPSI  144

Query  650   MDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISI  829
             M++LI+AL +IKD++R+KD+LIQIWVPV+++GR +L   D  F L+ K   LA YR+IS+
Sbjct  145   MEKLIRALMWIKDYNRNKDMLIQIWVPVHKEGRPILAADDLLFSLESKSLNLAKYREISV  204

Query  830   NYEFPVEE-DSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
              Y+F  EE DS+E   GLPGRVF  KVPEWTPDV+ FK +EYPRV HAQ YDVRGT AVP
Sbjct  205   TYKFSAEESDSKELAWGLPGRVFRDKVPEWTPDVRFFKIDEYPRVDHAQEYDVRGTLAVP  264

Query  1004  VFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCH-SYQ  1177
             +F+QGS+TCLGVIEVV+TTQ++ Y  EL+SVCKALE VDLR SK  +++NVK  C+ SY+
Sbjct  265   IFEQGSKTCLGVIEVVMTTQQINYGPELESVCKALEAVDLRSSKQLSIQNVKQACNRSYE  324

Query  1178  VVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPR  1357
               LPEI EVL+SAC  HKLPLAQTWVPCVQQGKEG RHS++N L C+S V+ ACY+ DP 
Sbjct  325   AALPEIHEVLRSACEMHKLPLAQTWVPCVQQGKEGCRHSEDNYLLCISPVEHACYVGDPS  384

Query  1358  IQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAI  1537
             I+ FHEAC+EHHLLKG GV G AFMTNQPCFS DITS SK +YP+SH+AR+F L+AAVAI
Sbjct  385   IRSFHEACTEHHLLKGEGVAGGAFMTNQPCFSDDITSLSKKDYPMSHHARLFGLRAAVAI  444

Query  1538  RLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettS  1717
             RLRS    + DFVLEFFLP DC   EE ++MLTSLS IIQ VC+                
Sbjct  445   RLRSIYNSTDDFVLEFFLPVDCNDIEEQRKMLTSLSNIIQRVCR----------------  488

Query  1718  PSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSEL  1897
              S +V +  ++    E  NL  N  I   + G +        Q+  M +S    EK SE 
Sbjct  489   -SLRVIREKEL----EEANLSVNEVIALADSGFTRDEICSEPQQKGMVASLDTEEKSSET  543

Query  1898  LYKRLPE--------FVSGSGLSFD-----STSGEG--SAQNVRRAGDKKRMKAEKTITL  2032
             + ++  E         + G   + D     STS EG  S+    + G+++R+KAEKTITL
Sbjct  544   MGRKFSEPRQQQESPILKG---NLDCVRECSTSVEGNLSSPGTSKTGERRRVKAEKTITL  600

Query  2033  QILQQYFAGSLKDAAKSLGV  2092
             Q+L+QYFAGSLKDAAK++GV
Sbjct  601   QVLRQYFAGSLKDAAKNIGV  620



>emb|CAN59896.1| hypothetical protein VITISV_002883 [Vitis vinifera]
Length=947

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/628 (50%), Positives = 409/628 (65%), Gaps = 47/628 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLETTDG  F Q     ++AL + S+     E N     K    + ++SSLPEN   
Sbjct  31    EGCWLETTDGFXFLQPGASXSSALNDSSHHSLTFE-NPNTPQKSYGDDGQRSSLPEN--P  87

Query  518   SQFHTERVQCFGQNGSN-----AVCSSG-----LAESSELSRRWWIGPMAT----TSVMD  655
               F+ +     G    N     A  +SG     L E +EL+RR WIGP A     +SV +
Sbjct  88    PPFYPQAEGLVGTQSDNWKTFEAATASGQSESFLVERTELNRRLWIGPSANPGPVSSVKN  147

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             RLI A+  +++F++++DVLIQIWVP+   G+ VL T DQPF LD  C  LA+YR++S NY
Sbjct  148   RLILAIRNLREFTKERDVLIQIWVPIXXGGKNVLTTNDQPFSLDPDCQSLANYRNVSENY  207

Query  836   EFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQ  1015
              FP EEDS+E VGLPGRVFLGKVPEWTPDV+ FK EEYPR+ +AQRY+VRG+ A+PVF++
Sbjct  208   HFPAEEDSKEQVGLPGRVFLGKVPEWTPDVRFFKSEEYPRINYAQRYNVRGSLALPVFER  267

Query  1016  GSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPE  1192
             GS  CLGVIE+V TTQK+ YR EL++VCKALE VDLR S++  +  VK C+  YQ  LPE
Sbjct  268   GSGVCLGVIEIVTTTQKINYRPELENVCKALEAVDLRSSEVL-IPPVKACNELYQAALPE  326

Query  1193  ILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFH  1372
             IL+VL   C TH+LPLAQTW PC+QQGK G RHSD+N    +STVD A Y+ DP+ +GF+
Sbjct  327   ILKVLARVCRTHRLPLAQTWAPCIQQGKGGCRHSDKNYALFLSTVDHAYYVTDPKFKGFN  386

Query  1373  EACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRST  1552
             EAC +HHL +G GVVGRA  TNQPCF +DIT+FSKTEYPLSH+AR+F L+AAVAIRL+S 
Sbjct  387   EACFDHHLFRGQGVVGRALTTNQPCFESDITAFSKTEYPLSHHARMFGLRAAVAIRLKSI  446

Query  1553  CTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKV  1732
               GS DF+LEFFLP DC+  EE K++L SLSI+IQ  CQ  RVVTE++LE+E+  P  ++
Sbjct  447   YNGSADFILEFFLPTDCQETEEQKQVLNSLSIVIQQTCQIFRVVTEKDLEKESILPVGEI  506

Query  1733  AKHSDIRIHKEVPNLKYNSSIG-PCEEGLSWTSSPMLVQESCMSSSA---FQ--------  1876
                SD R+ +E      +  I  P  E  SW +  M  Q+     S    +Q        
Sbjct  507   LVASDERVKQEGSVKLLSPPIKEPSREESSWIAHMMEAQKKGKGVSVSLEYQKEEPEEEF  566

Query  1877  ------NEKPSELLYKRL------PEFVSGSGLSF----DSTSGEGSAQNVRRAGDKKRM  2008
                   +    EL + ++      P+  SG+  S     DS+ G   +   R+A +K+R 
Sbjct  567   KVTTNWDNTEVELHHGQVFSEFGQPQQNSGAKGSVEGGGDSSFGGQHSSGSRKAREKRRT  626

Query  2009  KAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             K EKTI+LQ+L QYFAGSLKDAAKS+GV
Sbjct  627   KTEKTISLQVLSQYFAGSLKDAAKSIGV  654



>gb|KHN20112.1| Protein NLP4 [Glycine soja]
Length=910

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/620 (50%), Positives = 396/620 (64%), Gaps = 73/620 (12%)
 Frame = +2

Query  338   EGCWLETT-DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELM-------KESEVERKKS  493
             +GCW+E + DGS+F   SP  +N LF+PS+  P LE N+ E         +ES      S
Sbjct  39    DGCWMEASADGSDFLLQSPSFSNTLFDPSFSWPALETNHNESQVAAFGSQQESHNNNMVS  98

Query  494   SLPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM--------ATTSV  649
              +     + QF +E     G              +SE  RRWW  P            S+
Sbjct  99    VVAGGDYSQQFQSETHSVEG--------------ASEGIRRWWFAPTHTPTPSPGPGPSI  144

Query  650   MDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISI  829
             M++LI+AL +IKD++R+KD+LIQIWVPV+++GR +L   D  F L+ K   LA YR+IS+
Sbjct  145   MEKLIRALMWIKDYNRNKDMLIQIWVPVHKEGRPILAADDLLFSLESKSLNLAKYREISV  204

Query  830   NYEFPVEE-DSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
              Y+F  EE DS+E   GLPGRVF  KVPEWTPDV+ FK +EYPRV HAQ YDVRGT AVP
Sbjct  205   TYKFSAEESDSKELAWGLPGRVFRDKVPEWTPDVRFFKIDEYPRVDHAQEYDVRGTLAVP  264

Query  1004  VFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCH-SYQ  1177
             +F+QGS+TCLGVIEVV+TTQ++ Y  EL+SVCKALE VDLR SK  +++NVK  C+ SY+
Sbjct  265   IFEQGSKTCLGVIEVVMTTQQINYGPELESVCKALEAVDLRSSKQLSIQNVKQACNRSYE  324

Query  1178  VVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPR  1357
               LPEI EVL+SAC  HKLPLAQTWVPCVQQGKEG RHS++N L C+S V+ ACY+ DP 
Sbjct  325   AALPEIHEVLRSACEMHKLPLAQTWVPCVQQGKEGCRHSEDNYLLCISPVEHACYVGDPS  384

Query  1358  IQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAI  1537
             I+ FHEAC+EHHLLKG GV G AFMTNQPCFS DITS SK +YP+SH+AR+F L+AAVAI
Sbjct  385   IRSFHEACTEHHLLKGEGVAGGAFMTNQPCFSDDITSLSKKDYPMSHHARLFGLRAAVAI  444

Query  1538  RLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettS  1717
             RLRS    + DFVLEFFLP DC   EE ++MLTSLS IIQ VC+                
Sbjct  445   RLRSIYNSTDDFVLEFFLPIDCNDIEEQRKMLTSLSNIIQRVCR----------------  488

Query  1718  PSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSEL  1897
              S +V +  ++    E  NL  N  I   + G +        Q+  M +S    EK  E 
Sbjct  489   -SLRVIREKEL----EEANLSVNEVIALADSGFTRDEICSEPQQKGMVASLDTEEKSRET  543

Query  1898  LYKRLPE--------FVSGSGLSFD-----STSGEG--SAQNVRRAGDKKRMKAEKTITL  2032
             + ++  E         + G   + D     STS EG  S+    + G+++R+KAEKTITL
Sbjct  544   MGRKFSEPRQQQESPILKG---NLDCVRECSTSVEGNLSSPGTSKTGERRRVKAEKTITL  600

Query  2033  QILQQYFAGSLKDAAKSLGV  2092
             Q+L+QYFAGSLKDAAK++GV
Sbjct  601   QVLRQYFAGSLKDAAKNIGV  620



>ref|XP_008452963.1| PREDICTED: protein NLP4 isoform X4 [Cucumis melo]
Length=686

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/623 (50%), Positives = 398/623 (64%), Gaps = 44/623 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKE-----SEVERKKSSLP  502
             +GCWLET DG+EF   SP +     +P    P  + N    M +      E  RK S+  
Sbjct  31    DGCWLETADGTEFLHTSPSSFGVNLDPLIGWPATDMNGDFNMTQISRSNQEEGRKISTDE  90

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM----ATTSVMDRLIQA  670
              +L   +    + +C  Q+ +N        E SE+ RR WIGP     + TSVM+RLI+A
Sbjct  91    MSLGRKRIDMGQEECSDQSENNGF------EGSEMCRRLWIGPGEHLGSPTSVMERLIRA  144

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             +GYIKDF RDKDVL+Q+WVP+NR GR VL+T D PF  +  C RL  YRD+S+ YEF  +
Sbjct  145   VGYIKDFVRDKDVLVQVWVPINRGGRNVLITNDLPFSQNSSCTRLTKYRDVSVTYEFTAD  204

Query  851   EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             EDS++ +GLPGRVF  KVPEWTPDV+ F+ +EYPRV HA  +DVRGT A+P+F+QGS+ C
Sbjct  205   EDSKKALGLPGRVFSRKVPEWTPDVRFFRSDEYPRVNHAHEHDVRGTVALPIFEQGSKNC  264

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC--HSYQVVLPEILEV  1204
             LGVIEVV+ TQ+VKY +EL++VCKALE V LR S +    N K     S + VL EI   
Sbjct  265   LGVIEVVMVTQQVKYGSELENVCKALEAVKLRSSDVIGHPNKKQVFNRSNEAVLLEIQNT  324

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             LK+AC TH LPLAQTW  CVQQ + G RHSDEN   CVSTVD AC++AD RIQ FHEACS
Sbjct  325   LKTACETHGLPLAQTWASCVQQSRGGCRHSDENYSCCVSTVDRACFVADQRIQEFHEACS  384

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLLKG G+VG AF +N+PCFS+DITSF  TEYPLSH+A++F L AAVAIRLR      
Sbjct  385   EHHLLKGEGIVGMAFKSNEPCFSSDITSFCNTEYPLSHHAKLFGLHAAVAIRLRCIYISK  444

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK-VAKH  1741
             TDFVLEFFLP +C+ PEE + +LTSLS IIQ  C++LR+VT++E  EE    S + +   
Sbjct  445   TDFVLEFFLPVNCRDPEEQRVLLTSLSTIIQRSCRSLRLVTDKECREENMQQSCRSLHLV  504

Query  1742  SDIRIHKEVPNLKYNSSIGP----------------CEEGLSWTSSPMLVQESCMSSSAF  1873
             +D+++ +E       + +G                  E      SS   +Q+     S F
Sbjct  505   TDVKLGEESQFPFGEAGLGANGRSAMQDMSKVQNHQLETSHRTNSSVQNIQQHSGFVSFF  564

Query  1874  QNEKPSELL----YKRLPEFVSGSGLSFDS----TSGEGSAQNV--RRAGDKKRMKAEKT  2023
             Q  KPSE+L    Y+        +G+  DS    T G G+  +V   + G+K+R K +KT
Sbjct  565   QGGKPSEVLSSSGYQHRGFNYDLNGVVEDSDECTTVGNGTLPDVGLGKTGEKRRTKVDKT  624

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             ITLQ+L+QYFAGSLKDAAKS+GV
Sbjct  625   ITLQVLRQYFAGSLKDAAKSIGV  647



>gb|KHN33800.1| Protein NLP4 [Glycine soja]
Length=874

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/610 (50%), Positives = 392/610 (64%), Gaps = 57/610 (9%)
 Frame = +2

Query  338   EGCWLETT-DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLE + D S+F   SP  +N LF+PS   P LE N+ +    +   +++S       
Sbjct  7     DGCWLEASADVSDFLLQSPSFSNPLFDPSLSWPALETNHNKSQDAAFGTQQES-------  59

Query  515   ASQFHTERVQCFGQNGSNAVCSS---GLAESSELSRRWWIGPMATTSV------MDRLIQ  667
                 H   V      G +    S    +   SE  RRWW  P    S       M++LI+
Sbjct  60    ----HNNIVSVVAGGGYSQQFQSETHSVEGVSEGVRRWWFAPSPIPSPGPGPSIMEKLIR  115

Query  668   ALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPV  847
             AL +IKD++R+KD+LIQIWVP++++GR +L   D  F L+ K   LA YR+IS+ YEF  
Sbjct  116   ALMWIKDYNRNKDMLIQIWVPIHKEGRPILAADDLLFSLESKSLNLAKYREISVTYEFSA  175

Query  848   EE-DSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
             EE DS+E   GLPGRVF  KVPEWTPDV+ F+ +EYPRV HAQ YDVRGT AVP+F+QGS
Sbjct  176   EESDSKELARGLPGRVFRYKVPEWTPDVRFFRSDEYPRVDHAQEYDVRGTVAVPIFEQGS  235

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEIL  1198
             +TCLGVIEVV+TTQ++ Y  EL+SVCKALE VDLR SK  +++NVK C+ +Y+  LPEI 
Sbjct  236   KTCLGVIEVVMTTQQINYGPELESVCKALEAVDLRSSKQLSIQNVKACNRTYEAALPEIY  295

Query  1199  EVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEA  1378
             EVL+SAC  H+LPLAQTWVPCVQQGKEG RHS++N L C+S V+ ACY+ DP I+ FHEA
Sbjct  296   EVLRSACEMHRLPLAQTWVPCVQQGKEGCRHSEDNYLLCISPVEHACYVGDPSIRSFHEA  355

Query  1379  CSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCT  1558
             C+EHHLLKG GV G AFMTNQPCFS DITS SK +YPLSHYAR+F L AAVAIRLRS   
Sbjct  356   CTEHHLLKGEGVAGGAFMTNQPCFSDDITSLSKKDYPLSHYARLFGLHAAVAIRLRSIYN  415

Query  1559  GSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAK  1738
              + DFVLEFFLP DC   EE ++MLT+LSIIIQ VC+                 S +V +
Sbjct  416   STDDFVLEFFLPVDCNDSEEQRKMLTALSIIIQRVCR-----------------SLRVIR  458

Query  1739  HSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPE  1918
               ++    E  NL  +  I   + G +  +     Q   M +S    EK SE + ++  +
Sbjct  459   DKEL----EEANLSVDEVIALADSGFARNAIFSEPQYKGMVASLDAEEKSSETMGRKFSD  514

Query  1919  F--------VSGS--GLSFDSTSGEG--SAQNVRRAGDKKRMKAEKTITLQILQQYFAGS  2062
                      + G+   +   STS EG  S+    + G+++R KAEKTITLQ+L+QYFAGS
Sbjct  515   LRQQQESPILKGNLDCVKECSTSVEGNLSSLGTNKTGERRRAKAEKTITLQVLRQYFAGS  574

Query  2063  LKDAAKSLGV  2092
             LKDAAK++GV
Sbjct  575   LKDAAKNIGV  584



>ref|XP_006577940.1| PREDICTED: protein NLP4-like isoform X7 [Glycine max]
Length=907

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/613 (50%), Positives = 392/613 (64%), Gaps = 63/613 (10%)
 Frame = +2

Query  338   EGCWLETT-DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLE + D S+F   SP  +N LF+PS   P LE N+ +    +   +++S       
Sbjct  40    DGCWLEASADVSDFLLQSPSFSNPLFDPSLSWPALETNHNKSQDAAFGTQQES-------  92

Query  515   ASQFHTERVQCFGQNGSNAVCSS---GLAESSELSRRWWIGPMATTSV------MDRLIQ  667
                 H   V      G +    S    +   SE  RRWW  P    S       M++LI+
Sbjct  93    ----HNNIVSVVAGGGYSQQFQSETHSVEGVSEGVRRWWFAPSPIPSPGPGPSIMEKLIR  148

Query  668   ALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPV  847
             AL +IKD++R+KD+LIQIWVP++++GR +L   D  F L+ K   LA YR+IS+ YEF  
Sbjct  149   ALMWIKDYNRNKDMLIQIWVPIHKEGRPILAADDLLFSLESKSLNLAKYREISVTYEFSA  208

Query  848   EE-DSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
             EE DS+E   GLPGRVF  KVPEWTPDV+ F+ +EYPRV HAQ YDVRGT AVP+F+QGS
Sbjct  209   EESDSKELARGLPGRVFRYKVPEWTPDVRFFRSDEYPRVDHAQEYDVRGTVAVPIFEQGS  268

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEIL  1198
             +TCLGVIEVV+TTQ++ Y  EL+SVCKALE VDLR SK  +++NVK C+ +Y+  LPEI 
Sbjct  269   KTCLGVIEVVMTTQQINYGPELESVCKALEAVDLRSSKQLSIQNVKACNRTYEAALPEIY  328

Query  1199  EVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEA  1378
             EVL+SAC  H+LPLAQTWVPCVQQGKEG RHS++N L C+S V+ ACY+ DP I+ FHEA
Sbjct  329   EVLRSACEMHRLPLAQTWVPCVQQGKEGCRHSEDNYLLCISPVEHACYVGDPSIRSFHEA  388

Query  1379  CSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCT  1558
             C+EHHLLKG GV G AFMTNQPCFS DITS SK +YPLSHYAR+F L AAVAIRLRS   
Sbjct  389   CTEHHLLKGEGVAGGAFMTNQPCFSDDITSLSKKDYPLSHYARLFGLHAAVAIRLRSIYN  448

Query  1559  GSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAK  1738
              + DFVLEFFLP DC   EE ++MLT+LSIIIQ VC+                 S +V +
Sbjct  449   STDDFVLEFFLPVDCNDSEEQRKMLTALSIIIQRVCR-----------------SLRVIR  491

Query  1739  HSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPE  1918
               ++    E  NL  +  I   + G +  +     Q   M +S    EK SE + ++  +
Sbjct  492   DKEL----EEANLSVDEVIALADSGFARNAIFSEPQYKGMVASLDAEEKSSETMGRKFSD  547

Query  1919  F--------VSGSGLSFD-----STSGEG--SAQNVRRAGDKKRMKAEKTITLQILQQYF  2053
                      + G   + D     STS EG  S+    + G+++R KAEKTITLQ+L+QYF
Sbjct  548   LRQQQESPILKG---NLDCVKECSTSVEGNLSSLGTNKTGERRRAKAEKTITLQVLRQYF  604

Query  2054  AGSLKDAAKSLGV  2092
             AGSLKDAAK++GV
Sbjct  605   AGSLKDAAKNIGV  617



>ref|XP_008452961.1| PREDICTED: protein NLP4 isoform X2 [Cucumis melo]
Length=940

 Score =   550 bits (1418),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 310/622 (50%), Positives = 399/622 (64%), Gaps = 43/622 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKE-----SEVERKKSSLP  502
             +GCWLET DG+EF   SP +     +P    P  + N    M +      E  RK S+  
Sbjct  31    DGCWLETADGTEFLHTSPSSFGVNLDPLIGWPATDMNGDFNMTQISRSNQEEGRKISTDE  90

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM----ATTSVMDRLIQA  670
              +L   +    + +C  Q+ +N        E SE+ RR WIGP     + TSVM+RLI+A
Sbjct  91    MSLGRKRIDMGQEECSDQSENNGF------EGSEMCRRLWIGPGEHLGSPTSVMERLIRA  144

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             +GYIKDF RDKDVL+Q+WVP+NR GR VL+T D PF  +  C RL  YRD+S+ YEF  +
Sbjct  145   VGYIKDFVRDKDVLVQVWVPINRGGRNVLITNDLPFSQNSSCTRLTKYRDVSVTYEFTAD  204

Query  851   EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             EDS++ +GLPGRVF  KVPEWTPDV+ F+ +EYPRV HA  +DVRGT A+P+F+QGS+ C
Sbjct  205   EDSKKALGLPGRVFSRKVPEWTPDVRFFRSDEYPRVNHAHEHDVRGTVALPIFEQGSKNC  264

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVL  1207
             LGVIEVV+ TQ+VKY +EL++VCKALE V LR S +    N K  + S + VL EI   L
Sbjct  265   LGVIEVVMVTQQVKYGSELENVCKALEAVKLRSSDVIGHPNKKVFNRSNEAVLLEIQNTL  324

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
             K+AC TH LPLAQTW  CVQQ + G RHSDEN   CVSTVD AC++AD RIQ FHEACSE
Sbjct  325   KTACETHGLPLAQTWASCVQQSRGGCRHSDENYSCCVSTVDRACFVADQRIQEFHEACSE  384

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLLKG G+VG AF +N+PCFS+DITSF  TEYPLSH+A++F L AAVAIRLR      T
Sbjct  385   HHLLKGEGIVGMAFKSNEPCFSSDITSFCNTEYPLSHHAKLFGLHAAVAIRLRCIYISKT  444

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK-VAKHS  1744
             DFVLEFFLP +C+ PEE + +LTSLS IIQ  C++LR+VT++E  EE    S + +   +
Sbjct  445   DFVLEFFLPVNCRDPEEQRVLLTSLSTIIQRSCRSLRLVTDKECREENMQQSCRSLHLVT  504

Query  1745  DIRIHKEVPNLKYNSSIGP----------------CEEGLSWTSSPMLVQESCMSSSAFQ  1876
             D+++ +E       + +G                  E      SS   +Q+     S FQ
Sbjct  505   DVKLGEESQFPFGEAGLGANGRSAMQDMSKVQNHQLETSHRTNSSVQNIQQHSGFVSFFQ  564

Query  1877  NEKPSELL----YKRLPEFVSGSGLSFDS----TSGEGSAQNV--RRAGDKKRMKAEKTI  2026
               KPSE+L    Y+        +G+  DS    T G G+  +V   + G+K+R K +KTI
Sbjct  565   GGKPSEVLSSSGYQHRGFNYDLNGVVEDSDECTTVGNGTLPDVGLGKTGEKRRTKVDKTI  624

Query  2027  TLQILQQYFAGSLKDAAKSLGV  2092
             TLQ+L+QYFAGSLKDAAKS+GV
Sbjct  625   TLQVLRQYFAGSLKDAAKSIGV  646



>ref|XP_008452959.1| PREDICTED: protein NLP4 isoform X1 [Cucumis melo]
 ref|XP_008452960.1| PREDICTED: protein NLP4 isoform X1 [Cucumis melo]
Length=941

 Score =   550 bits (1416),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 310/623 (50%), Positives = 398/623 (64%), Gaps = 44/623 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKE-----SEVERKKSSLP  502
             +GCWLET DG+EF   SP +     +P    P  + N    M +      E  RK S+  
Sbjct  31    DGCWLETADGTEFLHTSPSSFGVNLDPLIGWPATDMNGDFNMTQISRSNQEEGRKISTDE  90

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM----ATTSVMDRLIQA  670
              +L   +    + +C  Q+ +N        E SE+ RR WIGP     + TSVM+RLI+A
Sbjct  91    MSLGRKRIDMGQEECSDQSENNGF------EGSEMCRRLWIGPGEHLGSPTSVMERLIRA  144

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             +GYIKDF RDKDVL+Q+WVP+NR GR VL+T D PF  +  C RL  YRD+S+ YEF  +
Sbjct  145   VGYIKDFVRDKDVLVQVWVPINRGGRNVLITNDLPFSQNSSCTRLTKYRDVSVTYEFTAD  204

Query  851   EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             EDS++ +GLPGRVF  KVPEWTPDV+ F+ +EYPRV HA  +DVRGT A+P+F+QGS+ C
Sbjct  205   EDSKKALGLPGRVFSRKVPEWTPDVRFFRSDEYPRVNHAHEHDVRGTVALPIFEQGSKNC  264

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC--HSYQVVLPEILEV  1204
             LGVIEVV+ TQ+VKY +EL++VCKALE V LR S +    N K     S + VL EI   
Sbjct  265   LGVIEVVMVTQQVKYGSELENVCKALEAVKLRSSDVIGHPNKKQVFNRSNEAVLLEIQNT  324

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             LK+AC TH LPLAQTW  CVQQ + G RHSDEN   CVSTVD AC++AD RIQ FHEACS
Sbjct  325   LKTACETHGLPLAQTWASCVQQSRGGCRHSDENYSCCVSTVDRACFVADQRIQEFHEACS  384

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLLKG G+VG AF +N+PCFS+DITSF  TEYPLSH+A++F L AAVAIRLR      
Sbjct  385   EHHLLKGEGIVGMAFKSNEPCFSSDITSFCNTEYPLSHHAKLFGLHAAVAIRLRCIYISK  444

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK-VAKH  1741
             TDFVLEFFLP +C+ PEE + +LTSLS IIQ  C++LR+VT++E  EE    S + +   
Sbjct  445   TDFVLEFFLPVNCRDPEEQRVLLTSLSTIIQRSCRSLRLVTDKECREENMQQSCRSLHLV  504

Query  1742  SDIRIHKEVPNLKYNSSIGP----------------CEEGLSWTSSPMLVQESCMSSSAF  1873
             +D+++ +E       + +G                  E      SS   +Q+     S F
Sbjct  505   TDVKLGEESQFPFGEAGLGANGRSAMQDMSKVQNHQLETSHRTNSSVQNIQQHSGFVSFF  564

Query  1874  QNEKPSELL----YKRLPEFVSGSGLSFDS----TSGEGSAQNV--RRAGDKKRMKAEKT  2023
             Q  KPSE+L    Y+        +G+  DS    T G G+  +V   + G+K+R K +KT
Sbjct  565   QGGKPSEVLSSSGYQHRGFNYDLNGVVEDSDECTTVGNGTLPDVGLGKTGEKRRTKVDKT  624

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             ITLQ+L+QYFAGSLKDAAKS+GV
Sbjct  625   ITLQVLRQYFAGSLKDAAKSIGV  647



>ref|XP_004145599.1| PREDICTED: protein NLP5-like [Cucumis sativus]
 gb|KGN55501.1| hypothetical protein Csa_4G658610 [Cucumis sativus]
Length=941

 Score =   550 bits (1416),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 314/622 (50%), Positives = 403/622 (65%), Gaps = 43/622 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKE-----SEVERKKSSLP  502
             +GCWLET DG+EF   SP +     +     P  E N    M +      E ERK S+  
Sbjct  31    DGCWLETADGTEFLHTSPSSFGVNLDALIGWPATEMNGDFNMTQISRSNQEEERKISTDE  90

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGP---MAT-TSVMDRLIQA  670
              +L   +    +  C GQ+ +N          SEL RR WIGP   + T TSVM+RLI A
Sbjct  91    MSLGRKRIDMGQEGCSGQSENNGF------GGSELCRRLWIGPGEHLGTPTSVMERLITA  144

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             +GYIKDF RDKDVL+Q+WVP+NR GR VL+T D PF  +  C RL  YRD+S+ YEF  +
Sbjct  145   VGYIKDFVRDKDVLVQVWVPINRGGRSVLITNDLPFSQNSSCTRLTKYRDVSVTYEFTAD  204

Query  851   EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             EDS++ +GLPGRVF  KVPEWTPDV+ F+ +EYPRV HA  +DVRGT A+P+F+QGS+ C
Sbjct  205   EDSKKALGLPGRVFSRKVPEWTPDVRFFRSDEYPRVNHAHEHDVRGTVALPIFEQGSKNC  264

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVL  1207
             LGVIEVV+ TQ++KY +EL++VCKALE V LR S +    N K  + S + VL EI   L
Sbjct  265   LGVIEVVMVTQQIKYGSELENVCKALEAVKLRSSDVMGHPNKKVFNRSNEAVLQEIQNTL  324

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
             KSAC TH LPLAQTW  C+QQ + G RHSDEN   CVSTVD AC++AD RIQ FHEACSE
Sbjct  325   KSACETHGLPLAQTWASCMQQSRGGCRHSDENYSCCVSTVDRACFVADQRIQEFHEACSE  384

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLLKG G+VG AF +N+PCFS+DITSF  TEYPLSH+A++F L AAVAIRLR      T
Sbjct  385   HHLLKGEGIVGMAFKSNEPCFSSDITSFCNTEYPLSHHAKLFGLHAAVAIRLRCIYISKT  444

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK-VAKHS  1744
             DFVLEFFLP +C++PE+ + +LTSLS IIQ  C++LR+VT++E  EE    S + +   +
Sbjct  445   DFVLEFFLPVNCRNPEDQRVLLTSLSTIIQRSCRSLRLVTDRECSEENMQQSYRSLHLVT  504

Query  1745  DIRIHKE----------VPN----LKYNSSI--GPCEEGLSWTSSPMLVQESCMSSSAFQ  1876
             D+++ ++          V N    ++  S +     E     TSS   +Q+     S FQ
Sbjct  505   DVKLGEQSKFPFGEAGFVANGRSAMQEMSKVQNHQLETSHPTTSSVQNIQQHSGFVSFFQ  564

Query  1877  NEKPSELL----YKRLPEFVSGSGLSFDS----TSGEGSAQNV--RRAGDKKRMKAEKTI  2026
               KPSE+L    Y+        +G+  DS    T G GS  +V   + G+K+R K +KTI
Sbjct  565   GGKPSEVLSSSGYQHRGFNYDLNGVVEDSEECATVGNGSFPDVGLGKTGEKRRTKVDKTI  624

Query  2027  TLQILQQYFAGSLKDAAKSLGV  2092
             TLQ+L+QYFAGSLKDAAKS+GV
Sbjct  625   TLQVLRQYFAGSLKDAAKSIGV  646



>ref|XP_004157118.1| PREDICTED: LOW QUALITY PROTEIN: protein NLP5-like [Cucumis sativus]
Length=941

 Score =   549 bits (1415),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 314/622 (50%), Positives = 403/622 (65%), Gaps = 43/622 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKE-----SEVERKKSSLP  502
             +GCWLET DG+EF   SP +     +     P  E N    M +      E ERK S+  
Sbjct  31    DGCWLETADGTEFLHTSPSSFGVNLDALIGWPATEMNGDFNMTQISRSNQEEERKISTDE  90

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGP---MAT-TSVMDRLIQA  670
              +L   +    +  C GQ+ +N          SEL RR WIGP   + T TSVM+RLI A
Sbjct  91    MSLGRKRIDMGQEGCSGQSENNGF------GGSELCRRLWIGPGEHLGTPTSVMERLITA  144

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             +GYIKDF RDKDVL+Q+WVP+NR GR VL+T D PF  +  C RL  YRD+S+ YEF  +
Sbjct  145   VGYIKDFVRDKDVLVQVWVPINRGGRSVLITNDLPFSQNSSCTRLTKYRDVSVTYEFTAD  204

Query  851   EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             EDS++ +GLPGRVF  KVPEWTPDV+ F+ +EYPRV HA  +DVRGT A+P+F+QGS+ C
Sbjct  205   EDSKKALGLPGRVFSRKVPEWTPDVRFFRSDEYPRVNHAHEHDVRGTVALPIFEQGSKNC  264

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVL  1207
             LGVIEVV+ TQ++KY +EL++VCKALE V LR S +    N K  + S + VL EI   L
Sbjct  265   LGVIEVVMVTQQIKYGSELENVCKALEAVKLRSSDVMGHPNKKVFNRSNEAVLQEIQNTL  324

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
             KSAC TH LPLAQTW  C+QQ + G RHSDEN   CVSTVD AC++AD RIQ FHEACSE
Sbjct  325   KSACETHGLPLAQTWASCMQQSRGGCRHSDENYSCCVSTVDRACFVADQRIQEFHEACSE  384

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLLKG G+VG AF +N+PCFS+DITSF  TEYPLSH+A++F L AAVAIRLR      T
Sbjct  385   HHLLKGEGIVGMAFKSNEPCFSSDITSFCNTEYPLSHHAKLFGLHAAVAIRLRCIYISKT  444

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK-VAKHS  1744
             DFVLEFFLP +C++PE+ + +LTSLS IIQ  C++LR+VT++E  EE    S + +   +
Sbjct  445   DFVLEFFLPVNCRNPEDQRVLLTSLSTIIQRSCRSLRLVTDRECSEENMQQSYRSLHLVT  504

Query  1745  DIRIHKE----------VPN----LKYNSSI--GPCEEGLSWTSSPMLVQESCMSSSAFQ  1876
             D+++ ++          V N    ++  S +     E     TSS   +Q+     S FQ
Sbjct  505   DVKLGEQSKFPFGEAGFVANGRSAMQEMSKVQNHQLETSHPTTSSVQNIQQHSGFVSFFQ  564

Query  1877  NEKPSELL----YKRLPEFVSGSGLSFDS----TSGEGSAQNV--RRAGDKKRMKAEKTI  2026
               KPSE+L    Y+        +G+  DS    T G GS  +V   + G+K+R K +KTI
Sbjct  565   GGKPSEVLSSSGYQHRGFNYDLNGVVEDSEECATVGNGSFPDVGLGKTGEKRRTKVDKTI  624

Query  2027  TLQILQQYFAGSLKDAAKSLGV  2092
             TLQ+L+QYFAGSLKDAAKS+GV
Sbjct  625   TLQVLRQYFAGSLKDAAKSIGV  646



>ref|XP_003523077.1| PREDICTED: protein NLP4-like isoform X1 [Glycine max]
 ref|XP_006577935.1| PREDICTED: protein NLP4-like isoform X2 [Glycine max]
 ref|XP_006577936.1| PREDICTED: protein NLP4-like isoform X3 [Glycine max]
 ref|XP_006577937.1| PREDICTED: protein NLP4-like isoform X4 [Glycine max]
 ref|XP_006577938.1| PREDICTED: protein NLP4-like isoform X5 [Glycine max]
 ref|XP_006577939.1| PREDICTED: protein NLP4-like isoform X6 [Glycine max]
Length=908

 Score =   547 bits (1410),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 306/614 (50%), Positives = 392/614 (64%), Gaps = 64/614 (10%)
 Frame = +2

Query  338   EGCWLETT-DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLE + D S+F   SP  +N LF+PS   P LE N+ +    +   +++S       
Sbjct  40    DGCWLEASADVSDFLLQSPSFSNPLFDPSLSWPALETNHNKSQDAAFGTQQES-------  92

Query  515   ASQFHTERVQCFGQNGSNAVCSS---GLAESSELSRRWWIGPMATTSV------MDRLIQ  667
                 H   V      G +    S    +   SE  RRWW  P    S       M++LI+
Sbjct  93    ----HNNIVSVVAGGGYSQQFQSETHSVEGVSEGVRRWWFAPSPIPSPGPGPSIMEKLIR  148

Query  668   ALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPV  847
             AL +IKD++R+KD+LIQIWVP++++GR +L   D  F L+ K   LA YR+IS+ YEF  
Sbjct  149   ALMWIKDYNRNKDMLIQIWVPIHKEGRPILAADDLLFSLESKSLNLAKYREISVTYEFSA  208

Query  848   EE-DSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
             EE DS+E   GLPGRVF  KVPEWTPDV+ F+ +EYPRV HAQ YDVRGT AVP+F+QGS
Sbjct  209   EESDSKELARGLPGRVFRYKVPEWTPDVRFFRSDEYPRVDHAQEYDVRGTVAVPIFEQGS  268

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCH-SYQVVLPEI  1195
             +TCLGVIEVV+TTQ++ Y  EL+SVCKALE VDLR SK  +++NVK  C+ +Y+  LPEI
Sbjct  269   KTCLGVIEVVMTTQQINYGPELESVCKALEAVDLRSSKQLSIQNVKQACNRTYEAALPEI  328

Query  1196  LEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHE  1375
              EVL+SAC  H+LPLAQTWVPCVQQGKEG RHS++N L C+S V+ ACY+ DP I+ FHE
Sbjct  329   YEVLRSACEMHRLPLAQTWVPCVQQGKEGCRHSEDNYLLCISPVEHACYVGDPSIRSFHE  388

Query  1376  ACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTC  1555
             AC+EHHLLKG GV G AFMTNQPCFS DITS SK +YPLSHYAR+F L AAVAIRLRS  
Sbjct  389   ACTEHHLLKGEGVAGGAFMTNQPCFSDDITSLSKKDYPLSHYARLFGLHAAVAIRLRSIY  448

Query  1556  TGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVA  1735
               + DFVLEFFLP DC   EE ++MLT+LSIIIQ VC+                 S +V 
Sbjct  449   NSTDDFVLEFFLPVDCNDSEEQRKMLTALSIIIQRVCR-----------------SLRVI  491

Query  1736  KHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLP  1915
             +  ++    E  NL  +  I   + G +  +     Q   M +S    EK SE + ++  
Sbjct  492   RDKEL----EEANLSVDEVIALADSGFARNAIFSEPQYKGMVASLDAEEKSSETMGRKFS  547

Query  1916  EF--------VSGSGLSFD-----STSGEG--SAQNVRRAGDKKRMKAEKTITLQILQQY  2050
             +         + G   + D     STS EG  S+    + G+++R KAEKTITLQ+L+QY
Sbjct  548   DLRQQQESPILKG---NLDCVKECSTSVEGNLSSLGTNKTGERRRAKAEKTITLQVLRQY  604

Query  2051  FAGSLKDAAKSLGV  2092
             FAGSLKDAAK++GV
Sbjct  605   FAGSLKDAAKNIGV  618



>ref|XP_008452962.1| PREDICTED: protein NLP4 isoform X3 [Cucumis melo]
Length=911

 Score =   547 bits (1409),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 307/607 (51%), Positives = 393/607 (65%), Gaps = 42/607 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKE-----SEVERKKSSLP  502
             +GCWLET DG+EF   SP +     +P    P  + N    M +      E  RK S+  
Sbjct  31    DGCWLETADGTEFLHTSPSSFGVNLDPLIGWPATDMNGDFNMTQISRSNQEEGRKISTDE  90

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM----ATTSVMDRLIQA  670
              +L   +    + +C  Q+ +N        E SE+ RR WIGP     + TSVM+RLI+A
Sbjct  91    MSLGRKRIDMGQEECSDQSENNGF------EGSEMCRRLWIGPGEHLGSPTSVMERLIRA  144

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             +GYIKDF RDKDVL+Q+WVP+NR GR VL+T D PF  +  C RL  YRD+S+ YEF  +
Sbjct  145   VGYIKDFVRDKDVLVQVWVPINRGGRNVLITNDLPFSQNSSCTRLTKYRDVSVTYEFTAD  204

Query  851   EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             EDS++ +GLPGRVF  KVPEWTPDV+ F+ +EYPRV HA  +DVRGT A+P+F+QGS+ C
Sbjct  205   EDSKKALGLPGRVFSRKVPEWTPDVRFFRSDEYPRVNHAHEHDVRGTVALPIFEQGSKNC  264

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC--HSYQVVLPEILEV  1204
             LGVIEVV+ TQ+VKY +EL++VCKALE V LR S +    N K     S + VL EI   
Sbjct  265   LGVIEVVMVTQQVKYGSELENVCKALEAVKLRSSDVIGHPNKKQVFNRSNEAVLLEIQNT  324

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             LK+AC TH LPLAQTW  CVQQ + G RHSDEN   CVSTVD AC++AD RIQ FHEACS
Sbjct  325   LKTACETHGLPLAQTWASCVQQSRGGCRHSDENYSCCVSTVDRACFVADQRIQEFHEACS  384

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLLKG G+VG AF +N+PCFS+DITSF  TEYPLSH+A++F L AAVAIRLR      
Sbjct  385   EHHLLKGEGIVGMAFKSNEPCFSSDITSFCNTEYPLSHHAKLFGLHAAVAIRLRCIYISK  444

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK-VAKH  1741
             TDFVLEFFLP +C+ PEE + +LTSLS IIQ  C++LR+VT++E  EE    S + +   
Sbjct  445   TDFVLEFFLPVNCRDPEEQRVLLTSLSTIIQRSCRSLRLVTDKECREENMQQSCRSLHLV  504

Query  1742  SDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELL----YKR  1909
             +D+++ +E       S     E GL       +   S       +  KPSE+L    Y+ 
Sbjct  505   TDVKLGEE-------SQFPFGEAGLGANGRSAMQDMS-------KGGKPSEVLSSSGYQH  550

Query  1910  LPEFVSGSGLSFDS----TSGEGSAQNV--RRAGDKKRMKAEKTITLQILQQYFAGSLKD  2071
                    +G+  DS    T G G+  +V   + G+K+R K +KTITLQ+L+QYFAGSLKD
Sbjct  551   RGFNYDLNGVVEDSDECTTVGNGTLPDVGLGKTGEKRRTKVDKTITLQVLRQYFAGSLKD  610

Query  2072  AAKSLGV  2092
             AAKS+GV
Sbjct  611   AAKSIGV  617



>ref|XP_007136019.1| hypothetical protein PHAVU_009G011200g [Phaseolus vulgaris]
 gb|ESW08013.1| hypothetical protein PHAVU_009G011200g [Phaseolus vulgaris]
Length=914

 Score =   545 bits (1403),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 299/616 (49%), Positives = 394/616 (64%), Gaps = 59/616 (10%)
 Frame = +2

Query  338   EGCWLETT-DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCW E + DGS+F   SP  +N LF+PS+  P LE N+ E  + +    ++     N+ 
Sbjct  38    DGCWFEASVDGSDFLLQSPSYSNPLFDPSFSWPALETNHNE-SQGAAFGTQEEGHNNNVV  96

Query  515   ASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATT----SVMDRLIQALGYI  682
             A++      Q F         +  +  +S+  RRW   P  +     S+M++L++AL  I
Sbjct  97    AARGGGGGGQQFQPE------TISIEGASDGVRRWRFAPTPSPAPGPSIMEKLVRALMRI  150

Query  683   KDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEE---  853
             KD++R+K++LIQIWVPV+R GR +L   D  F LD +   LA YR+IS+ YEF  EE   
Sbjct  151   KDYNRNKNMLIQIWVPVHRGGRPILAANDILFSLDSRSMNLAKYREISVRYEFSAEEGEV  210

Query  854   ---------DSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
                      DS+E V GLPGRVF  KVPEWTPDV+ F+ +EYPR+ HAQ YDV G+ AVP
Sbjct  211   KELVPAEEGDSKELVLGLPGRVFRDKVPEWTPDVRFFRSDEYPRLDHAQEYDVSGSLAVP  270

Query  1004  VFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQV  1180
             +F+QGS+ CLGVIEVV+TTQ++ Y  EL+SVCKALE VDLR SK  +++NVK C+ SY+ 
Sbjct  271   IFEQGSKMCLGVIEVVMTTQQINYGPELESVCKALEAVDLRSSKQLSIQNVKACNRSYEA  330

Query  1181  VLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRI  1360
             VLPEI +VL+SAC  HKLPLAQTW+PCVQQGKEG RHS++N L C+S  + ACY+ DP+I
Sbjct  331   VLPEIQQVLRSACEMHKLPLAQTWIPCVQQGKEGCRHSEDNYLFCISPAEHACYVGDPKI  390

Query  1361  QGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIR  1540
             + FHE+C+EHHLLKG GV G AFMTNQPCFS DITS SK +YPLSH+AR+F L+AAVAIR
Sbjct  391   RSFHESCTEHHLLKGEGVAGGAFMTNQPCFSDDITSLSKKDYPLSHHARLFGLRAAVAIR  450

Query  1541  LRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP  1720
             LRS    + DFVLEFFLP DC   EE ++MLTSLSIIIQ VC+                 
Sbjct  451   LRSIYNSTDDFVLEFFLPVDCNDSEEQRKMLTSLSIIIQRVCR-----------------  493

Query  1721  SSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELL  1900
             S +V    ++   K    L  +  I   + G   T+    +Q     +S    EK SE  
Sbjct  494   SLRVISDKELVEAK----LSIDEGISLADSGFDRTAICEELQHKGTVASLDTEEKLSETT  549

Query  1901  YKRLPE--------FVSGS--GLSFDSTSGEGSAQNV--RRAGDKKRMKAEKTITLQILQ  2044
              ++  +         + G+   +   STS EG+  +V   + GD++R KAEKTITLQ+L+
Sbjct  550   GRKFSDPMRQQKSPILKGNLDCVRESSTSVEGNLSSVGMSKMGDRRRAKAEKTITLQVLR  609

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYFAGSLKDAAK++GV
Sbjct  610   QYFAGSLKDAAKNIGV  625



>ref|XP_010536471.1| PREDICTED: protein NLP4-like [Tarenaya hassleriana]
 ref|XP_010536472.1| PREDICTED: protein NLP4-like [Tarenaya hassleriana]
 ref|XP_010536473.1| PREDICTED: protein NLP4-like [Tarenaya hassleriana]
 ref|XP_010536474.1| PREDICTED: protein NLP4-like [Tarenaya hassleriana]
Length=891

 Score =   541 bits (1394),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 308/599 (51%), Positives = 391/599 (65%), Gaps = 44/599 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTDGSEF   SP   +A F+PS  +    P     +  S +             
Sbjct  32    DGCWLETTDGSEFLNFSPSTTSAPFDPSSFM--WSPAQDSAICGSGLS------------  77

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESS-----ELSRRWWIGPMAT------TSVMDRLI  664
                     Q F Q+G+     SG  E+       L+RRWWIGP         +SV +RL+
Sbjct  78    --------QMFSQDGAE---RSGHDEAHWKDIPSLNRRWWIGPRTNPPGVPGSSVTERLV  126

Query  665   QALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFP  844
             QAL  +KDF+R++  LIQ+WVPVNR G+R+L T +QPF +D  C RLA+YR+IS ++ F 
Sbjct  127   QALKSVKDFTRERGSLIQLWVPVNRGGKRILTTKEQPFSVDPMCHRLANYREISESFHFS  186

Query  845   VE-EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
              E EDS++ VGLPGRVFLGKVPEWTPDV+ F+ EEYPRV HAQ  DVRGT A+PVF+QGS
Sbjct  187   AEQEDSKDLVGLPGRVFLGKVPEWTPDVRFFRSEEYPRVQHAQDCDVRGTLAIPVFEQGS  246

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEIL  1198
             + CLGVIE+V+TTQ VK R EL+S+CKAL+ VDLR +++     VK    SYQ  LPEI 
Sbjct  247   KACLGVIEIVMTTQMVKSRFELESICKALQAVDLRSTEVPIPFPVKVRDLSYQGALPEIR  306

Query  1199  EVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEA  1378
              +L+ AC THKLPLAQTWV C+QQGK G RH+DEN + CVSTVD ACY+ D  +Q FHEA
Sbjct  307   NLLRCACETHKLPLAQTWVSCLQQGKGGCRHNDENYIHCVSTVDDACYVGDVTVQEFHEA  366

Query  1379  CSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCT  1558
             CSEHHLLKG GV G+AF+TN+PCFS D+T + KTEYPLSH+A +F L  AVAIRLR   T
Sbjct  367   CSEHHLLKGQGVAGQAFLTNEPCFSPDVTGYKKTEYPLSHHATMFGLHGAVAIRLRCIHT  426

Query  1559  GSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAK  1738
             GS DFVLEFFLP+ C+  EE ++ML SLS I+ +V ++LR VT +ELEEE  S +S+V +
Sbjct  427   GSADFVLEFFLPKSCRDLEEQRKMLNSLSTIMAHVPRSLRTVTNKELEEEADSITSEVTE  486

Query  1739  HSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELL-YKRLP  1915
               +  + K    L   SS  P    L  ++S         +  A +  K SE+   KR  
Sbjct  487   REET-VPKVENVLNEKSSWNPSVTELQQSNSNPQKLGPMFALGASEMGKQSEVFEMKRGF  545

Query  1916  EFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             ++   S ++  + S  G      R  +KKR KAEKTITL +L+QYFAGSLKDAAKS+GV
Sbjct  546   DYGGESSMNESTVSSSGFG----RMAEKKRTKAEKTITLDVLRQYFAGSLKDAAKSIGV  600



>gb|AHI17473.1| nodule inception protein [Casuarina glauca]
Length=936

 Score =   542 bits (1396),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 306/626 (49%), Positives = 403/626 (64%), Gaps = 65/626 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLETT GS      P  + AL +PS+ LP L+ N              SS   N+S 
Sbjct  40    EGCWLETTSGSNHLPSGPLTSRALNDPSHYLPLLDSN--------------SSGHLNISH  85

Query  518   SQ--FHTERVQCFGQNGSNAVCSSG-LAESSELSRRWWIGPMA----TTSVMDRLIQALG  676
              Q  F  E    F +       S G L E +EL RR WI P A    +TSV +RL+ A+G
Sbjct  86    HQQIFQEETEGTFPE-------SEGILVEGTELGRRLWIAPRANPSPSTSVKERLMLAIG  138

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
             Y+++ +++ +VLIQIWVP+ R G   L T DQP+     C  LA+YR++S  Y+F VEED
Sbjct  139   YLRECTKNMNVLIQIWVPIRRGGSYFLTTQDQPYYFGANCKNLANYRNVSKAYQFAVEED  198

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
              +E+ GLPGRVFLGK+PEWTPDV+ FK++EYPR+ +AQ+YDVRG+ A+PVF++GS TCLG
Sbjct  199   MEESAGLPGRVFLGKLPEWTPDVRFFKKDEYPRINYAQQYDVRGSLALPVFERGSGTCLG  258

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILEVLKS  1213
             V+E+V  TQK+ YR EL++VC+ALE VDLR S++ +   VK C   YQ  L EI+EVL +
Sbjct  259   VVEIVTNTQKINYRPELENVCQALESVDLRSSQLLSPPGVKACDELYQAALAEIIEVLAT  318

Query  1214  ACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHH  1393
              C  H+LPLA TW PC QQGK G RHSDEN   CVSTVD+AC++AD  + GFHEACSE+H
Sbjct  319   VCKAHRLPLALTWAPCYQQGKGGCRHSDENYALCVSTVDAACFVADLDVLGFHEACSEYH  378

Query  1394  LLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDF  1573
             L +G G VG AF T++PCF+ DIT+FSKTEYPLSH+AR+F L+AAVAI LRS  TGS++F
Sbjct  379   LFRGQGTVGTAFTTSKPCFATDITAFSKTEYPLSHHARMFGLRAAVAIPLRSIYTGSSEF  438

Query  1574  VLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqe-leeettSPSSKVAKHSDI  1750
             VLEFFLP+DC+ PEE ++ML SLSI++Q  C++L  V ++E  E+E   P  ++A  SD+
Sbjct  439   VLEFFLPKDCQDPEEQRQMLNSLSIVLQQACRSLHAVMDKEPEEQEVIYPVKEIAIASDV  498

Query  1751  RIHKEVPNLKYNSSIGPCEEG----LSWTSSPMLVQE--SCMSSSAFQNEKPSELLYKRL  1912
             RI+KE P     S   P  E      SW +  M  Q+    +S S    E+  +  +K  
Sbjct  499   RINKEEPQ---KSGSPPMREASTKESSWIAHMMEAQQKGKGVSISLEYQEEEPKEEFKVT  555

Query  1913  PEF---VSGS--GLSF-------DSTSGEGSAQN--------------VRRAGDKKRMKA  2014
               +   + GS  G +F        S+  +GS +                RRAG+K+R K 
Sbjct  556   THWDNTLGGSCHGQAFSDFGQLQQSSGSKGSVEGGGDSYSYGSRRSSGGRRAGEKRRTKT  615

Query  2015  EKTITLQILQQYFAGSLKDAAKSLGV  2092
             EKTI+L +L+QYFAGSLKDAAKS+GV
Sbjct  616   EKTISLPVLRQYFAGSLKDAAKSIGV  641



>emb|CBI37748.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   536 bits (1380),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 289/548 (53%), Positives = 374/548 (68%), Gaps = 34/548 (6%)
 Frame = +2

Query  548   FGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGYIKDFSRDKDVLI  715
             F Q G++      +   +EL+RR WIGP A     +SV +RLI A+  +++F++++DVLI
Sbjct  43    FLQPGASTSTEGLVGTQTELNRRLWIGPSANPGPVSSVKNRLILAIRNLREFTKERDVLI  102

Query  716   QIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFL  895
             QIWVP+ R G+ VL T DQPF LD  C  LA+YR++S NY FP EEDS+E VGLPGRVFL
Sbjct  103   QIWVPIERGGKNVLTTNDQPFSLDPDCQSLANYRNVSENYHFPAEEDSKEQVGLPGRVFL  162

Query  896   GKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKY  1075
             GKVPEWTPDV+ FK EEYPR+ +AQRY+VRG+ A+PVF++GS  CLGVIE+V TTQK+ Y
Sbjct  163   GKVPEWTPDVRFFKSEEYPRINYAQRYNVRGSLALPVFERGSGVCLGVIEIVTTTQKINY  222

Query  1076  RNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILEVLKSACATHKLPLAQTW  1252
             R EL++VCKALE VDLR S++  +  VK C+  YQ  LPEIL+VL   C TH+LPLAQTW
Sbjct  223   RPELENVCKALEAVDLRSSEVL-IPPVKACNELYQAALPEILKVLARVCRTHRLPLAQTW  281

Query  1253  VPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFM  1432
              PC+QQGK G RHSD+N    +STVD A Y+ DP+ +GF+EAC +HHL +G GVVGRA  
Sbjct  282   APCIQQGKGGCRHSDKNYALFLSTVDHAYYVTDPKFKGFNEACFDHHLFRGQGVVGRALT  341

Query  1433  TNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSP  1612
             TNQPCF +DIT+FSKTEYPLSH+AR+F L+AAVAIRL+S   GS DF+LEFFLP DC+  
Sbjct  342   TNQPCFESDITAFSKTEYPLSHHARMFGLRAAVAIRLKSIYNGSADFILEFFLPTDCQET  401

Query  1613  EEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSS  1792
             EE K++L SLSI+IQ  CQ  RVVTE++LE+E+  P  ++   SD R+ +E      +  
Sbjct  402   EEQKQVLNSLSIVIQQTCQIFRVVTEKDLEKESILPVGEILFASDERVKQEGSVKLLSPP  461

Query  1793  IG-PCEEGLSWTSSPMLVQESCMSSSA---FQ--------------NEKPSELLYKRL--  1912
             I  P  E  SW +  M  Q+     S    +Q              +    EL + ++  
Sbjct  462   IKEPSREESSWIAHMMEAQKKGKGVSVSLEYQKEEPEEEFKVTTNWDNTEVELHHGQVFS  521

Query  1913  ----PEFVSGSGLSF----DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLK  2068
                 P+  SG+  S     DS+ G   +   R+A +K+R K EKTI+LQ+L QYFAGSLK
Sbjct  522   EFGQPQQNSGAKGSVEGGGDSSFGGQHSSGSRKAREKRRTKTEKTISLQVLSQYFAGSLK  581

Query  2069  DAAKSLGV  2092
             DAAKS+GV
Sbjct  582   DAAKSIGV  589



>ref|XP_006390206.1| hypothetical protein EUTSA_v10018128mg [Eutrema salsugineum]
 gb|ESQ27492.1| hypothetical protein EUTSA_v10018128mg [Eutrema salsugineum]
Length=818

 Score =   535 bits (1379),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 297/593 (50%), Positives = 383/593 (65%), Gaps = 47/593 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTD SEF   SP  +   F+PS ++    P     +  S + +         S+
Sbjct  23    DGCWLETTDASEFLHFSPSTSVTPFDPSSLM--WSPTQDTAICSSSLSQMYGQDCAERSS  80

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA-TTSVMDRLIQALGYIKDFS  694
              + H        Q G +          S L+RRWWIGP    +SVM+RL+QA+ +IKDF+
Sbjct  81    LEDH-------HQQGKDL---------SSLNRRWWIGPTGHGSSVMERLVQAVKHIKDFT  124

Query  695   RDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQEN-  868
              ++  LIQ+WVPV+R G+RVL T +QPF  D  C RLAHYR+IS+NY F  E EDS  N 
Sbjct  125   SERGSLIQLWVPVDRGGKRVLTTKEQPFSHDPMCQRLAHYREISVNYHFSTEQEDSNSNS  184

Query  869   ---VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
                VGLPGRVFLG+VPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGV
Sbjct  185   KDLVGLPGRVFLGQVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSKICLGV  244

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSA  1216
             IEVV+TTQ VK   EL+S+C+AL+ VDLR +++    ++K    SYQ  LPEI  +L+ A
Sbjct  245   IEVVMTTQMVKLSPELESICRALQAVDLRSTQVPISPSLKGPDFSYQAALPEIRNLLRCA  304

Query  1217  CATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHL  1396
             C THKLPLAQTWV C++Q K G RHSDEN + CVST+D ACY+ DP ++ FHEACSEHHL
Sbjct  305   CETHKLPLAQTWVSCLKQSKTGCRHSDENYIHCVSTIDDACYVGDPTVREFHEACSEHHL  364

Query  1397  LKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFV  1576
             LKG GVVG AF+TN PCFS+D++S+ K+EYPL+H+A +F L   VAIRLR   TGS DFV
Sbjct  365   LKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLAHHATMFGLHGTVAIRLRCIHTGSADFV  424

Query  1577  LEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRI  1756
             LEFFLP++C+  EE ++ML +LS I+ +V ++LR VTE+ELE E  S +S+V + ++   
Sbjct  425   LEFFLPKNCRDVEEQRKMLNALSTIMAHVPKSLRTVTEKELEVEGDSMASEVIERAETLP  484

Query  1757  HKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSG  1936
               E  +  + S+  P   GL +      + E                       F  G G
Sbjct  485   KIENISEVHQSNAVPKNVGLVFDGGTSEIGEL---------------------GFDYGKG  523

Query  1937  LSFDSTSGEGSAQ-NVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             LS +  S   SA     R  ++KR KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  524   LSVNENSNFSSASGGFSRMTERKRTKAEKNITLDVLRQYFAGSLKDAAKSIGV  576



>ref|XP_004500875.1| PREDICTED: protein NLP4-like isoform X3 [Cicer arietinum]
Length=904

 Score =   531 bits (1369),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 307/611 (50%), Positives = 393/611 (64%), Gaps = 59/611 (10%)
 Frame = +2

Query  338   EGCWLETT-DGSEFF-QHSPFNANALFEPSYVLPDLE----PNNGELMKESEVERKKSSL  499
             +GCWLE + DGS+F  Q SPF +N LF+PS+  P L+    P+N        V+R KS  
Sbjct  34    DGCWLEASADGSDFLLQSSPF-SNPLFDPSFTWPSLDNIDPPDN--------VDRHKSQ-  83

Query  500   PENLSASQFHTERVQCFGQNGSNAVCSSGLAESSE-LSRRWWIGPMATTS-----VMDRL  661
               +L   Q     V   G  GSN         S E    RWWIGP   +      ++++L
Sbjct  84    DASLGTEQESRSIVNVDG--GSNQKEYRFETYSGEGFFSRWWIGPTPNSGPGGSFIVEKL  141

Query  662   IQALGYIKDFSRDKDVLIQIWVPVNR-DGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             I+AL +IKDF R+KD+LIQIWVPVNR D R  L   D PF L+ +   LA YR+IS+ Y+
Sbjct  142   IRALKWIKDFDRNKDMLIQIWVPVNRGDDRPFLTANDLPFSLETRSLNLARYREISVRYQ  201

Query  839   FPVEEDSQENV--GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             F  EE+  +++  GLPGRV+  KVPEWTPDV+ F+ +EYPRV HAQ  D+ GT AVPVF+
Sbjct  202   FSAEEEDSKDLVAGLPGRVYRDKVPEWTPDVRFFRSDEYPRVDHAQECDIHGTLAVPVFE  261

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT-CHSYQVVLP  1189
             QGSRTCLGVIEVV+TTQ+  Y  EL++VCKALE VDLR S+ S+++NVK    SY+  LP
Sbjct  262   QGSRTCLGVIEVVMTTQQSNYSAELETVCKALEVVDLRSSRHSSLQNVKARDRSYETALP  321

Query  1190  EILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGF  1369
             EI EVL+SAC  HKLPLAQTW+PC+QQGK+G RHSD+N + C+S V+ ACYI D  ++ F
Sbjct  322   EIQEVLRSACEMHKLPLAQTWIPCIQQGKDGCRHSDDNYVHCISPVEYACYIGDSSVRFF  381

Query  1370  HEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRS  1549
             HEAC EHHLLKG GV G AFMTNQPCFSADITS SK +YPLSH+AR+F L+AAVAIRLRS
Sbjct  382   HEACMEHHLLKGQGVAGGAFMTNQPCFSADITSLSKIDYPLSHHARLFGLRAAVAIRLRS  441

Query  1550  TCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK  1729
               + S D+VLEFFLP DC    E K+MLTSLS+IIQ VC+ L                 +
Sbjct  442   IYSTSDDYVLEFFLPVDCNDSGEQKKMLTSLSMIIQRVCRNL-----------------R  484

Query  1730  VAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA----FQNE----K  1885
             V  + ++    E  NL  N  +   + G +  ++   +Q   M++S     F NE    K
Sbjct  485   VITNKEL----EKNNLSANEVMDLADSGFASGATWSELQHRRMAASLDGDFFFNETMGGK  540

Query  1886  PSELLYKRLPEFVSGSGLSFD--STSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAG  2059
              SE   ++    + G   S    S S EG+  +     +K+R KA+KTITLQ+L+QYFAG
Sbjct  541   FSEQTQQQENLILKGDTESGRECSLSVEGNLLSSVGIREKRRPKADKTITLQVLRQYFAG  600

Query  2060  SLKDAAKSLGV  2092
             SLKDAAK++GV
Sbjct  601   SLKDAAKNIGV  611



>ref|NP_177761.1| nodule inception protein-like protein 5 [Arabidopsis thaliana]
 sp|Q9SFW8.1|NLP5_ARATH RecName: Full=Protein NLP5; Short=AtNLP5; AltName: Full=NIN-like 
protein 5; AltName: Full=Nodule inception protein-like protein 
5 [Arabidopsis thaliana]
 gb|AAF16666.1|AC012394_15 hypothetical protein; 65318-62644 [Arabidopsis thaliana]
 dbj|BAH30375.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35827.1| nodule inception protein-like protein 5 [Arabidopsis thaliana]
Length=808

 Score =   528 bits (1359),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 298/593 (50%), Positives = 382/593 (64%), Gaps = 51/593 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLETTD SEF   SP  + A F+PS  +             S  +   +SL +    
Sbjct  23    EGCWLETTDASEFLNFSPSTSVAPFDPSSFM------------WSPTQDTSNSLSQMYG-  69

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATT--SVMDRLIQALGYIKDF  691
              Q   ER     QN    +        S  +RRWWIGP      SVM+RL+QA+ +IKDF
Sbjct  70    -QDCPERSSLEDQNQGRDL--------STFNRRWWIGPSGHHGFSVMERLVQAVTHIKDF  120

Query  692   SRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED-----  856
             + ++  LIQ+WVPV+R G+RVL T +QPF  D  C RLAHYR+IS NY+F  E++     
Sbjct  121   TSERGSLIQLWVPVDRGGKRVLTTKEQPFSHDPMCQRLAHYREISENYQFSTEQEDSDSS  180

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
             S++ VGLPGRVFLGKVPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLG
Sbjct  181   SRDLVGLPGRVFLGKVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSQICLG  240

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKS  1213
             VIEVV+TTQ VK   +L+S+C+AL+ VDLR ++I    ++K    SYQ  LPEI  +L+ 
Sbjct  241   VIEVVMTTQMVKLSPDLESICRALQAVDLRSTEIPIPPSLKGPDFSYQAALPEIRNLLRC  300

Query  1214  ACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHH  1393
             AC THKLPLAQTWV C++Q K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHH
Sbjct  301   ACETHKLPLAQTWVSCLKQSKTGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHH  360

Query  1394  LLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDF  1573
             LLKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS DF
Sbjct  361   LLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSVDF  420

Query  1574  VLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIR  1753
             VLEFFLP++C+  EE ++ML +LS I+ +V ++LR VT++ELEEE  S  S+V     I 
Sbjct  421   VLEFFLPKNCRDIEEQRKMLNALSTIMAHVPRSLRTVTQKELEEEGDSMVSEV-----IE  475

Query  1754  IHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGS  1933
                 +P ++  + +          S+P  V       +    E  SE           G 
Sbjct  476   KGVTLPKIENTTEVHQS------ISTPQNVGLVFDGGTTEMGELGSEY----------GK  519

Query  1934  GLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             G+S +  +   SA    R  +KKR KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  520   GVSVNENNTFSSASGFNRVTEKKRTKAEKNITLDVLRQYFAGSLKDAAKSIGV  572



>ref|XP_006306759.1| hypothetical protein CARUB_v10008300mg [Capsella rubella]
 gb|EOA39657.1| hypothetical protein CARUB_v10008300mg [Capsella rubella]
Length=844

 Score =   528 bits (1361),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 279/597 (47%), Positives = 384/597 (64%), Gaps = 51/597 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNAN-ALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGSEF   +P  ++ + F+PS  +             S  +   +     + 
Sbjct  24    DGCWLETTDGSEFLNVAPSTSSVSPFDPSSFM------------WSPTQDTSAICTSGVV  71

Query  515   ASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFS  694
             ++ +           G + V  S L +  + ++RWWIGP    SV +RL+QA+ +IKD++
Sbjct  72    STMY-----------GQDCVERSSL-DDFQWNKRWWIGPGGGGSVTERLVQAVEHIKDYT  119

Query  695   RDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQENV  871
              ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+   
Sbjct  120   TERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDSKALA  179

Query  872   GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVV  1051
             GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ   VRGT A+PVF+QGS+ CLGVIEVV
Sbjct  180   GLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCGVRGTLAIPVFEQGSKICLGVIEVV  239

Query  1052  LTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATH  1228
             +TT+ VK R EL+S+CKAL+ VDLR +++    ++  C  SY+  LPEI  +L+ AC TH
Sbjct  240   MTTEMVKLRPELESICKALQAVDLRSTELPIPASLTGCDLSYKAALPEIRNLLRCACETH  299

Query  1229  KLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGL  1408
             KLPLAQTWV C+QQ K G RH+DEN + CVST++ ACY+ DP ++ FHEACSEHHLLKG 
Sbjct  300   KLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIEDACYVGDPTVREFHEACSEHHLLKGQ  359

Query  1409  GVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFF  1588
             GV G+AFMTN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TGS DFVLEFF
Sbjct  360   GVAGQAFMTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFVLEFF  419

Query  1589  LPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE-  1765
             LP+DC   EE ++ML +LS I+ +V +               + + K  +   + I +E 
Sbjct  420   LPKDCDDLEEQRKMLNALSTIMAHVPR------------SLRTVTDKELEEESVVIERED  467

Query  1766  --VPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS-----AFQNEKPSE-LLYKRLPEF  1921
                P ++  S +    +   W++S   +Q +  S+S      F  +KP++    KR  ++
Sbjct  468   IVTPKIENASELQHLHDNSPWSASLEEIQSNNTSNSQNLGLVFDGDKPNDGFGLKRGFDY  527

Query  1922  VSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                S +   + SG  S+       +KKR KA+KTITL +L+QYFAGSLKDAAK++GV
Sbjct  528   TMDSNV---NESGTFSSGGFSMMAEKKRTKADKTITLDVLRQYFAGSLKDAAKNIGV  581



>ref|XP_002887634.1| RWP-RK domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63893.1| RWP-RK domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   525 bits (1351),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 297/595 (50%), Positives = 381/595 (64%), Gaps = 55/595 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVL--PDLEPNNGELMKESEVERKKSSLPENL  511
             EGCWLETTD SEF   SP  +   F+PS  +  P  + +N       +   ++SSL +  
Sbjct  23    EGCWLETTDASEFLNFSPSTSVTPFDPSSFMWSPTQDTSNSLSQMYGQDSAERSSLED--  80

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATT--SVMDRLIQALGYIK  685
                           QN    +        S  +RRWWIGP      SVMDRL+QA+ +IK
Sbjct  81    --------------QNQGRDL--------SSFNRRWWIGPSGHHGFSVMDRLVQAVTHIK  118

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED---  856
             DF+ ++  LIQ+WVPV+R G+RVL T +QPF  D  C RLAHYR+IS NY+F  E++   
Sbjct  119   DFTSERGSLIQLWVPVDRGGKRVLTTKEQPFSHDPMCQRLAHYREISENYQFSTEQEDSG  178

Query  857   --SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
               S++ VGLPGRVFLGKVPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ C
Sbjct  179   SSSRDLVGLPGRVFLGKVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSQIC  238

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVL  1207
             LGVIEVV+TTQ VK   +L+S+C+AL+ VDLR ++I    ++K    SYQ  LPEI  +L
Sbjct  239   LGVIEVVMTTQMVKLSPDLESICRALQAVDLRSTEIPIPPSLKGPDFSYQAALPEIRNLL  298

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
             + AC THKLPLAQTWV C++Q K G RH+ EN + CVST+D ACY+ DP ++ FHEACSE
Sbjct  299   RCACETHKLPLAQTWVSCLKQSKTGCRHNYENYVHCVSTIDDACYVGDPSVREFHEACSE  358

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLLKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS 
Sbjct  359   HHLLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSA  418

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             DFVLEFFLP++C+  EE ++ML +LS I+ +V ++LR VTE+ELEEE  S  S+V     
Sbjct  419   DFVLEFFLPKNCRDIEEQRKMLNALSTIMAHVPRSLRTVTEKELEEEGDSMVSEV-----  473

Query  1748  IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVS  1927
             I     +P ++  S +          S+P  V       +    E  S+           
Sbjct  474   IERGVTLPKIENISEVPQS------ISTPQNVGIVFDGGTTEMGELGSDY----------  517

Query  1928  GSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             G GLS +  +   S     R  +KKR KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  518   GKGLSVNDNNTFSSGSGFNRVTEKKRTKAEKNITLDVLRQYFAGSLKDAAKSIGV  572



>ref|XP_006300747.1| hypothetical protein CARUB_v100198120mg [Capsella rubella]
 gb|EOA33645.1| hypothetical protein CARUB_v100198120mg [Capsella rubella]
Length=814

 Score =   524 bits (1350),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 293/600 (49%), Positives = 384/600 (64%), Gaps = 65/600 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLETTD SEF   SP  +   F+PS  +    P             + +++  + S 
Sbjct  23    EGCWLETTDASEFLNFSPSTSVTPFDPSSFM--WSPT------------QDTAICSSNSL  68

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA-TTSVMDRLIQALGYIKDFS  694
             S  + + V         +       + S  +RRWWIGP    +SVM+RL+QA+ +IKDF+
Sbjct  69    SHMYGQVV------AERSSIEDQGRDLSSFNRRWWIGPSGHGSSVMERLVQAVTHIKDFT  122

Query  695   RDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED-----S  859
              ++  LIQ+WVPV+R G+RVL T +QPF  D  C RLAHYR+IS+NY+F  E++     S
Sbjct  123   SERGSLIQLWVPVDRGGKRVLTTKEQPFSHDPMCQRLAHYREISVNYQFSTEQEDSGSSS  182

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
              + VGLPGRVFLGKVPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGV
Sbjct  183   NDLVGLPGRVFLGKVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSQNCLGV  242

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSA  1216
             IEVV+TTQ VK   +LDS+C+AL+ VDLR +++    ++K    SYQ  LPEI  +L+ A
Sbjct  243   IEVVMTTQMVKLSPDLDSICRALQAVDLRSTEVPIRPSLKGPDFSYQAALPEIRNLLRCA  302

Query  1217  CATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHL  1396
             C THKLPLAQTWV C++Q K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHL
Sbjct  303   CETHKLPLAQTWVSCLKQSKTGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHL  362

Query  1397  LKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFV  1576
             LKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS DFV
Sbjct  363   LKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSVDFV  422

Query  1577  LEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRI  1756
             LEFFLP++C+  EE K+ML +LS I+ +V ++LR V            + K  +  D+ +
Sbjct  423   LEFFLPKNCRDIEEQKKMLNALSTIMAHVPRSLRTV------------TEKELEEGDL-M  469

Query  1757  HKEVPNLKYNSSIGPCEEGLSW--TSSPMLVQESCMSSSAFQNEKPSELLYK----RLPE  1918
              +EV            E G++     +P  V +   S S  QN   + L++      + E
Sbjct  470   AREV-----------IERGVTLPKIENPSEVPK---SDSNLQN---AGLVFDEGTTEMGE  512

Query  1919  FVSGSG--LSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               S  G  LS +  S   SA    R  +KKR KAEK ITL++L+QYFAGSLKDAAKS+GV
Sbjct  513   VGSDYGKGLSVNENSTFSSASGFSRMTEKKRTKAEKNITLEVLRQYFAGSLKDAAKSIGV  572



>ref|XP_007041614.1| Plant regulator RWP-RK family protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOX97445.1| Plant regulator RWP-RK family protein, putative isoform 2 [Theobroma 
cacao]
Length=675

 Score =   518 bits (1333),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 299/628 (48%), Positives = 396/628 (63%), Gaps = 47/628 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPN------NGELMKESEVERKKSSL  499
             EGCWLET+DG  F +  P +++   +PS  LP    +      N   M + E ER     
Sbjct  32    EGCWLETSDGFNFTEPGPSSSSGPNDPSQCLPVSGSSTVPFTINSHPMHQGETERNVPPP  91

Query  500   P----ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMD  655
             P    E+LS SQ  ++     G   S +   S + E +EL  RWWIGP A    ++SV +
Sbjct  92    PLPKIEDLSKSQ--SQNWAAAGTATSLSQPGSFIVEGTELGSRWWIGPRAESGSSSSVKE  149

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             RL++A+GY+K+ ++D+DVLIQIWVPV R+G+ VL T  QP+ L+  C  L  +RD+S +Y
Sbjct  150   RLMEAIGYLKECTKDRDVLIQIWVPVKREGKHVLTTEGQPYSLNTNCKSLEIFRDVSKSY  209

Query  836   EFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQ  1015
              FP EEDS+E+VGLPGRV+LGK+PEWTPDV+ F+ +EYPR+  A +Y+V G+ A+PVF++
Sbjct  210   NFPAEEDSKESVGLPGRVYLGKLPEWTPDVRFFRSDEYPRINFAHKYNVGGSLALPVFER  269

Query  1016  GSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPE  1192
             GS TCLGV+E+V TTQK+ YR EL+ VCKALE VDLR S   +  +V+  +  YQ  LPE
Sbjct  270   GSGTCLGVVEIVTTTQKINYRPELEHVCKALEAVDLRSSHNFSPPSVEGYNELYQAALPE  329

Query  1193  ILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFH  1372
             I+EVL+S C T+KLPLA TW  CV Q K G RHSDEN   CVSTVD+AC +AD     F 
Sbjct  330   IVEVLRSVCKTYKLPLALTWAACVNQRKSGCRHSDENFYHCVSTVDAAC-LADEGFWDFL  388

Query  1373  EACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRST  1552
             EACSEHHL +G G+VGRAF TN+ CF  DIT+FSKT YPLSH+AR+F L+ AVAI L+S 
Sbjct  389   EACSEHHLFRGQGIVGRAFTTNKQCFVTDITAFSKTNYPLSHHARMFGLRGAVAIPLQSI  448

Query  1553  CTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKV  1732
              +GS +FVLE FLP+DC   EE K+ML SLS  ++  CQ+L VV ++ELEEE   P  ++
Sbjct  449   FSGSVEFVLELFLPKDCHDSEEQKQMLNSLSSFMRQACQSLHVVVDKELEEEVILPVKEM  508

Query  1733  AKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA---FQNEKPSE---  1894
                SD +  KE    + +       E  SW +  M  Q+     S    +Q E+P E   
Sbjct  509   VVASDGKSDKEETQFRISCLKENSPEESSWIAHMMEAQQKGKGVSVSWEYQKEEPKEEFR  568

Query  1895  ----------LLYKR--LPEF-----VSGSGLSFDSTSGEGSAQNVRR------AGDKKR  2005
                        LY +  L +F      +G+  S +   G+ S+    R      AG K+R
Sbjct  569   VTTHWEDTQLELYNKQVLSDFGQLHQNAGTKTSVEGGGGDSSSSGGHRLLAGKKAGGKRR  628

Query  2006  MKAEKTITLQILQQYFAGSLKDAAKSLG  2089
              K EKTI+LQ+L+QYFAGSLKDAAKS+G
Sbjct  629   TKMEKTISLQVLRQYFAGSLKDAAKSIG  656



>gb|KEH36316.1| plant regulator RWP-RK family protein [Medicago truncatula]
Length=909

 Score =   525 bits (1353),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 305/609 (50%), Positives = 384/609 (63%), Gaps = 53/609 (9%)
 Frame = +2

Query  338   EGCWLETT-DGSEFF-QHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLE + DGSEF  Q SPF +N +F+PS+  P LE N       ++V  +   +P  L
Sbjct  37    DGCWLEASADGSEFLLQSSPF-SNPIFDPSFSWPVLENNE---QPGNDVRHESQDVP--L  90

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT-----TSVMDRLIQALG  676
                Q    R+       S+           E   R WI P        +S+ ++LI+AL 
Sbjct  91    GTEQ--ESRIIVNNAGSSDLQQCEFKTHLGEGVSRLWIPPTPNPGPGGSSITEKLIRALK  148

Query  677   YIKDFSRDKDVLIQIWVPVNR-DGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-  850
             +IKDF+R+KD+LIQIWVPVNR D R +L   D PF L+ +   LA YR+IS+ Y+F  E 
Sbjct  149   WIKDFNRNKDMLIQIWVPVNRGDDRPILRANDLPFSLESRSLNLAKYREISVRYQFSAEV  208

Query  851   EDSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRT  1027
             EDS+E V GLPGRV+  K+PEWTPDV+ F+ +EYPRV HAQ  DV GT AVPVF+QGSRT
Sbjct  209   EDSKELVAGLPGRVYRDKIPEWTPDVRFFRSDEYPRVDHAQECDVHGTLAVPVFEQGSRT  268

Query  1028  CLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC-HSYQVVLPEILEV  1204
             CLGVIEVV+TTQ+  Y  EL++VCKALE VDL  S  S+ +NVK C  SY+  LPEI EV
Sbjct  269   CLGVIEVVMTTQQSNYGRELETVCKALEVVDLSSSGHSSPQNVKACVKSYETALPEIQEV  328

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             L+SAC  HKLPLAQTWV C+QQGK+G RHSD+N   C+S V+ ACY+ D  ++ FHEAC 
Sbjct  329   LRSACEMHKLPLAQTWVSCIQQGKDGCRHSDDNYTHCISPVEYACYVGDSSVRFFHEACM  388

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLL G GV G AFMTNQPCFS DITS SKT+YPLSH+AR+F L+AAVAIRLRS  + S
Sbjct  389   EHHLLIGQGVAGGAFMTNQPCFSTDITSLSKTDYPLSHHARLFGLRAAVAIRLRSIYSIS  448

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHS  1744
              D+VLEFFLP DC   EE K+MLTSLS+IIQ VC+                 S +V    
Sbjct  449   DDYVLEFFLPVDCNDGEEQKKMLTSLSMIIQRVCR-----------------SLRVITDK  491

Query  1745  DIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPE--  1918
             ++    E  NL  N  +   + G +  +    +Q   M+ S    EK +E +  +  E  
Sbjct  492   EL----EKNNLSSNEVMAVADIGFATDAVQSGLQHKRMAVSLDGEEKFNETMSSKFSEQR  547

Query  1919  -FVSGSGLSFDSTSG-------EG---SAQNVRRAGDKKRMKAEKTITLQILQQYFAGSL  2065
                    L  D+  G       EG   S+  V R G+K+R KAEKTITLQ+L+QYFAGSL
Sbjct  548   RQQESLTLRGDADCGRECSPSVEGNFLSSLGVNRTGEKRRAKAEKTITLQVLRQYFAGSL  607

Query  2066  KDAAKSLGV  2092
             KDAAK++GV
Sbjct  608   KDAAKNIGV  616



>ref|XP_010918251.1| PREDICTED: protein NLP1-like isoform X2 [Elaeis guineensis]
Length=832

 Score =   521 bits (1343),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 287/537 (53%), Positives = 350/537 (65%), Gaps = 39/537 (7%)
 Frame = +2

Query  596   SSELSRRWWIGPMATTSVMD-RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQ  772
             SSEL   WWI P A    M+ RLI+A+ YIKD  RD DVL+QIWVP     R VL T  Q
Sbjct  5     SSELHSSWWIQPSAHMETMEERLIRAINYIKDSQRDGDVLVQIWVPTRIGDRHVLTTRGQ  64

Query  773   PFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYP  952
             PF LD  C RL +YR +S  Y+F  EE+S   VGLPGRVFLG+VPEWTPDV+ F   EYP
Sbjct  65    PFTLDSTCQRLVNYRTVSTQYQFSAEENSNVAVGLPGRVFLGRVPEWTPDVRYFSHYEYP  124

Query  953   RVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGS  1132
             RV  AQRYDVRG+ A+PVFD+ SR+CLGV+EVV+TTQK+ Y ++L+++C AL+ V+LR S
Sbjct  125   RVNDAQRYDVRGSLALPVFDRNSRSCLGVVEVVMTTQKINYSSDLENICNALQAVNLRSS  184

Query  1133  KISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLL  1309
             ++  V +VK C+ SYQV LPEI  VL++ C TH LPLAQTW+ C+QQGK G RH+DEN  
Sbjct  185   EVPGVPHVKVCNESYQVALPEIQRVLRAVCETHSLPLAQTWISCIQQGKSGSRHTDENYK  244

Query  1310  RCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYP  1489
              CVSTVD ACY+ DP + GFH+ACSEHHL KG GV G+AF TNQPCFS+DIT+FSKTEYP
Sbjct  245   DCVSTVDVACYVRDPTMLGFHQACSEHHLFKGQGVSGKAFTTNQPCFSSDITAFSKTEYP  304

Query  1490  LSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQ  1669
             LSH+A++F L+AAVAIRLRS  TG+ DFVLE FLP +C   EE K ML SLSI IQ VCQ
Sbjct  305   LSHHAKLFHLRAAVAIRLRSIHTGTADFVLELFLPINCIEHEEQKLMLNSLSITIQQVCQ  364

Query  1670  tlrvvte-----------qeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGL  1816
             +LRVVT             +L      P   V++ S  R+  +   L  +  IG   E  
Sbjct  365   SLRVVTSKELEHEAILQVAQLNSSNVLPDKFVSETSQ-RLDDDDNLLTESPMIGVSGEVS  423

Query  1817  SWTSSPMLVQE----SCMSSSA---FQNEKPSELLYKRLPEFVSGSG------------L  1939
             SW+ S    QE    S + +S    F  ++   L      E V  +G            L
Sbjct  424   SWSGSIRETQENGGKSVLPTSVPLDFNEQEIEGLSVWHTSEVVLPAGKIFSEFKQHEEEL  483

Query  1940  SFDST------SGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             + DS       SGE    N  +A +K+R K EKTI LQ LQ+YFAGSLKDAAKSLGV
Sbjct  484   TKDSIDHKTFFSGEPGFSNTEKAMEKRRTKTEKTIGLQELQKYFAGSLKDAAKSLGV  540



>ref|XP_010416548.1| PREDICTED: protein NLP5-like [Camelina sativa]
 ref|XP_010416549.1| PREDICTED: protein NLP5-like [Camelina sativa]
Length=824

 Score =   521 bits (1342),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 295/595 (50%), Positives = 382/595 (64%), Gaps = 47/595 (8%)
 Frame = +2

Query  338   EGCWLETTDG-SEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             EGCWLETTD  SE F  SP  +   F+PS  +             ++ +   +++  + S
Sbjct  23    EGCWLETTDAASELFNFSPSTSVTPFDPSSFM----------WSPTQQDTPPAAICSSSS  72

Query  515   ASQFHTERVQCFGQN-GSNAVCSSGLAESSELSRRWWIGPMA-TTSVMDRLIQALGYIKD  688
              SQ        +GQ+    +       + S  +RRWWIGP    +SVM+RL+QA+ +IKD
Sbjct  73    LSQ------TMYGQDCAERSSLEDQGRDLSSFNRRWWIGPSGHGSSVMERLVQAVAHIKD  126

Query  689   FSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQE  865
             ++ ++  LIQ+WVPV+R G+RVL T +QPF  D  C RLAHYR+IS+NY+F  E EDS  
Sbjct  127   YTSERGSLIQLWVPVDRGGKRVLTTKEQPFSHDPMCQRLAHYREISVNYQFSTEQEDSGS  186

Query  866   N----VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCL  1033
             N    VGLPGRVFLGKVPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CL
Sbjct  187   NSNDLVGLPGRVFLGKVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSQNCL  246

Query  1034  GVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLK  1210
             GVIEVV+TTQ VK   +L+S+C+AL+ VDLR + +    ++K    SYQ  LPEI  +L+
Sbjct  247   GVIEVVMTTQMVKLSPDLESICRALQAVDLRSTGVPIPPSLKGPDFSYQAALPEIRNLLR  306

Query  1211  SACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEH  1390
              AC THKLPLAQTWV C++Q K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEH
Sbjct  307   CACETHKLPLAQTWVSCLKQSKTGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEH  366

Query  1391  HLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTD  1570
             HLLKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS D
Sbjct  367   HLLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSAD  426

Query  1571  FVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDI  1750
             FVLEFFLP+ C+  EE ++ML +LS I+ +V ++LR VTE+ELEEE    + +V +    
Sbjct  427   FVLEFFLPKSCRDIEEQRKMLNALSTIMAHVPRSLRTVTEKELEEEGNPMAREVIERRVT  486

Query  1751  RIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSG  1930
                 E P+    S+  P   GL +      + E  + S                     G
Sbjct  487   LPKIENPSEVQESNSNPQNAGLVFDGGTTEMGE--LGSDY-------------------G  525

Query  1931  SGLSFDSTSGEGSAQ-NVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              G+S +  S   SA     R  +KKR KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  526   KGISVNEKSTFSSATGGFSRITEKKRTKAEKNITLDVLRQYFAGSLKDAAKSIGV  580



>ref|XP_011088705.1| PREDICTED: LOW QUALITY PROTEIN: protein NLP2-like [Sesamum indicum]
Length=930

 Score =   524 bits (1349),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 297/635 (47%), Positives = 389/635 (61%), Gaps = 61/635 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANA---------LFEPSYVLPDLEPNNGELMKESEVERKK  490
             +G WLETTD S F+   P +            +F  S+   ++  +N    +++ +++  
Sbjct  30    DGFWLETTDESSFWHPCPTSTTTSTDFTSSSFVFPTSHT--NIHTSNTTPHQDTSLKQSH  87

Query  491   SSL---PENLSA------SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGP----  631
              S+   P +L+       SQ H   +     N S    ++ L + +++SRR W+GP    
Sbjct  88    KSVTFGPPSLTYPLMDDFSQNHQPSLPLVSSNQS----TNFLVQDTQVSRRLWVGPNTSP  143

Query  632   MATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAH  811
             +   S+  RL+QA+ ++KD  RDKDVLIQIWVPV + GR+VL T +QPF L+  C  LA 
Sbjct  144   IRNVSLKKRLVQAINHLKDSIRDKDVLIQIWVPVKKGGRQVLTTNNQPFSLNPNCKNLAD  203

Query  812   YRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGT  991
             YRD+S +Y+F  +E S+E  GLPGRVFL K+PEWTPDV+ FKREEYPRV HAQ+YDVRG+
Sbjct  204   YRDVSRSYQFAADEGSKEFTGLPGRVFLNKLPEWTPDVRFFKREEYPRVNHAQQYDVRGS  263

Query  992   FAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-  1168
              A+PVF+QGS  CLGV+E+V T+QKV YR EL++VCKALE VDL+ S I N  N++  + 
Sbjct  264   LALPVFEQGSGNCLGVVEIVTTSQKVNYRPELENVCKALEAVDLKSSDILNPPNIEDRNE  323

Query  1169  SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIA  1348
             SYQ  L EI  VLK  C THKLPLAQTW PCVQQGK G RHSDEN  +CVSTVD+ACY+A
Sbjct  324   SYQAALMEIRNVLKCVCDTHKLPLAQTWAPCVQQGKGGCRHSDENYTQCVSTVDTACYVA  383

Query  1349  DPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAA  1528
             D ++  FHEACSEHHLLKG GV G+AF+TNQPCF+ DIT+FSKTEYPL+H+AR+F+L AA
Sbjct  384   DQQVSTFHEACSEHHLLKGEGVAGKAFLTNQPCFAEDITAFSKTEYPLAHHARVFNLCAA  443

Query  1529  VAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleee  1708
             VAIRLRST TG+ DFVLE FLP +CK  E+ + ML SLS +IQ  CQ   +    + E  
Sbjct  444   VAIRLRSTYTGAADFVLELFLPLNCKDVEDQRWMLDSLSSVIQRTCQ--SLRVVTDQELA  501

Query  1709  ttSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKP  1888
               +    +A  SD   H   P L  + S  P     S     +  Q      +A      
Sbjct  502   RETSGRGIAGKSDGENH---PRLVTSPSEEPSPVASSCIRHVVDSQHKGKRIAASLGHHK  558

Query  1889  SELLYKRLPEFVSGSGLSFDST-----------------SGEGSAQNVRRAGD-------  1996
              EL   ++      SG  F  +                 SG+ +       GD       
Sbjct  559   EELGEFKVTTQWDNSGSDFHYSPAFSEHEQPQQDSGPKPSGDVTGNFFLAGGDLPVGPKT  618

Query  1997  ---KKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                K+R K EKTI+LQ+L++YFAGSLKDAAK++GV
Sbjct  619   NPEKRRTKIEKTISLQVLRKYFAGSLKDAAKNIGV  653



>gb|KHF97712.1| Protein NLP2 -like protein [Gossypium arboreum]
Length=931

 Score =   523 bits (1347),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 294/621 (47%), Positives = 381/621 (61%), Gaps = 52/621 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGEL--MKESEVERKKSSLPENL  511
             EGCWLET D   F Q +P  +N L + S V     P+N  L  M + E ER  S  P + 
Sbjct  33    EGCWLETNDDFNFMQPAPSTSNDLNKSSTV-----PSNANLHQMHQGETERSVSP-PRDG  86

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATT----SVMDRLIQALGY  679
             SA           G   S     + + + +EL  RWWIGP A +    SV +RL+QA+GY
Sbjct  87    SA----------VGNASSLLQPGTFIVQGTELGSRWWIGPSAESGSSLSVKERLMQAIGY  136

Query  680   IKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDS  859
             +K+ ++D+D+LIQIWVPVNR+G+ VL T  QP+ L+  C  L  +RD+S +Y FP EED+
Sbjct  137   LKESTKDRDLLIQIWVPVNREGKHVLTTEGQPYSLNSNCKSLEIFRDVSKSYNFPAEEDT  196

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
             +E+VGLPGRVFL K+PEWTPDV+ F+ EEYPR+  A++Y+V G+ A+PVF++ + TCLGV
Sbjct  197   KESVGLPGRVFLEKLPEWTPDVRFFRSEEYPRISFAEKYNVGGSLALPVFERANGTCLGV  256

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILEVLKSA  1216
             +E+V T QK  YR EL+ VCKALE VDLR S      NV+ C+  YQ  LPEI EVL+S 
Sbjct  257   VEIVTTIQKSNYRPELEHVCKALEAVDLRSSPNFTPPNVEACNELYQAALPEIAEVLRSV  316

Query  1217  CATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHL  1396
             C T+KLPLA TW PC+ QGK G RHS EN   CVSTVD+AC++AD     F EACSEHH+
Sbjct  317   CKTYKLPLALTWAPCLNQGKSGCRHSYENFYHCVSTVDAACFVADEEFSEFLEACSEHHM  376

Query  1397  LKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFV  1576
              +G GVVGRAF TN+ CF+ DIT+FSKT YPLSH+AR+F L+ AVAI L+S  TG  +FV
Sbjct  377   FRGQGVVGRAFTTNKQCFATDITAFSKTNYPLSHHARMFGLRGAVAIPLQSIFTGLVEFV  436

Query  1577  LEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRI  1756
             LE FLP+DC   E  K+ML SLS  +Q  CQ+L VV ++ LEEE   P  +V   SD R 
Sbjct  437   LELFLPKDCHDSEAQKQMLNSLSSFMQQACQSLHVVVDKMLEEEVILPVKEVVVASDGRS  496

Query  1757  HKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA---FQNEKPSE-----------  1894
               E      +S+     E  SW +  M  Q+     S    +Q E+P E           
Sbjct  497   DNEETQFTVSSAKENSPEESSWIAHMMEAQQKGKGVSVSWEYQKEEPKEEFKVTTHWEDT  556

Query  1895  LLYKRLPEFVSGSGLSFDSTSGEGSAQNV---------------RRAGDKKRMKAEKTIT  2029
              L     E +S       +     S +                 +RAG+K+R K EKTI+
Sbjct  557   QLELHDKEVLSDFQQLHQNAESNASVEGGGGDSSSSGGRGVLPSKRAGEKRRTKMEKTIS  616

Query  2030  LQILQQYFAGSLKDAAKSLGV  2092
             L++L+QYFAGSLKDAAKS+GV
Sbjct  617   LEVLRQYFAGSLKDAAKSIGV  637



>ref|XP_004500873.1| PREDICTED: protein NLP4-like isoform X1 [Cicer arietinum]
 ref|XP_004500874.1| PREDICTED: protein NLP4-like isoform X2 [Cicer arietinum]
Length=934

 Score =   521 bits (1341),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 307/641 (48%), Positives = 393/641 (61%), Gaps = 89/641 (14%)
 Frame = +2

Query  338   EGCWLETT-DGSEFF-QHSPFNANALFEPSYVLPDLE----PNNGELMKESEVERKKSSL  499
             +GCWLE + DGS+F  Q SPF +N LF+PS+  P L+    P+N        V+R KS  
Sbjct  34    DGCWLEASADGSDFLLQSSPF-SNPLFDPSFTWPSLDNIDPPDN--------VDRHKSQ-  83

Query  500   PENLSASQFHTERVQCFGQNGSNAVCSSGLAESSE-LSRRWWIGPMATTS-----VMDRL  661
               +L   Q     V   G  GSN         S E    RWWIGP   +      ++++L
Sbjct  84    DASLGTEQESRSIVNVDG--GSNQKEYRFETYSGEGFFSRWWIGPTPNSGPGGSFIVEKL  141

Query  662   IQALGYIKDFSRDKDVLIQIWVPVNR-DGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             I+AL +IKDF R+KD+LIQIWVPVNR D R  L   D PF L+ +   LA YR+IS+ Y+
Sbjct  142   IRALKWIKDFDRNKDMLIQIWVPVNRGDDRPFLTANDLPFSLETRSLNLARYREISVRYQ  201

Query  839   FPVEEDSQENV--GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             F  EE+  +++  GLPGRV+  KVPEWTPDV+ F+ +EYPRV HAQ  D+ GT AVPVF+
Sbjct  202   FSAEEEDSKDLVAGLPGRVYRDKVPEWTPDVRFFRSDEYPRVDHAQECDIHGTLAVPVFE  261

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH--------  1168
             QGSRTCLGVIEVV+TTQ+  Y  EL++VCKALE VDLR S+ S+++NVK           
Sbjct  262   QGSRTCLGVIEVVMTTQQSNYSAELETVCKALEVVDLRSSRHSSLQNVKVHRKSSLWQIL  321

Query  1169  -----------------------SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKE  1279
                                    SY+  LPEI EVL+SAC  HKLPLAQTW+PC+QQGK+
Sbjct  322   MNSFNSQFVSHNELIQFEQARDRSYETALPEIQEVLRSACEMHKLPLAQTWIPCIQQGKD  381

Query  1280  GLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSAD  1459
             G RHSD+N + C+S V+ ACYI D  ++ FHEAC EHHLLKG GV G AFMTNQPCFSAD
Sbjct  382   GCRHSDDNYVHCISPVEYACYIGDSSVRFFHEACMEHHLLKGQGVAGGAFMTNQPCFSAD  441

Query  1460  ITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTS  1639
             ITS SK +YPLSH+AR+F L+AAVAIRLRS  + S D+VLEFFLP DC    E K+MLTS
Sbjct  442   ITSLSKIDYPLSHHARLFGLRAAVAIRLRSIYSTSDDYVLEFFLPVDCNDSGEQKKMLTS  501

Query  1640  LSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLS  1819
             LS+IIQ VC+ L                 +V  + ++    E  NL  N  +   + G +
Sbjct  502   LSMIIQRVCRNL-----------------RVITNKEL----EKNNLSANEVMDLADSGFA  540

Query  1820  WTSSPMLVQESCMSSSA----FQNE----KPSELLYKRLPEFVSGSGLSFD--STSGEGS  1969
               ++   +Q   M++S     F NE    K SE   ++    + G   S    S S EG+
Sbjct  541   SGATWSELQHRRMAASLDGDFFFNETMGGKFSEQTQQQENLILKGDTESGRECSLSVEGN  600

Query  1970  AQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               +     +K+R KA+KTITLQ+L+QYFAGSLKDAAK++GV
Sbjct  601   LLSSVGIREKRRPKADKTITLQVLRQYFAGSLKDAAKNIGV  641



>ref|XP_007041613.1| Plant regulator RWP-RK family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX97444.1| Plant regulator RWP-RK family protein, putative isoform 1 [Theobroma 
cacao]
Length=952

 Score =   520 bits (1338),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 300/629 (48%), Positives = 397/629 (63%), Gaps = 47/629 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPN------NGELMKESEVERKKSSL  499
             EGCWLET+DG  F +  P +++   +PS  LP    +      N   M + E ER     
Sbjct  32    EGCWLETSDGFNFTEPGPSSSSGPNDPSQCLPVSGSSTVPFTINSHPMHQGETERNVPPP  91

Query  500   P----ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMD  655
             P    E+LS SQ  ++     G   S +   S + E +EL  RWWIGP A    ++SV +
Sbjct  92    PLPKIEDLSKSQ--SQNWAAAGTATSLSQPGSFIVEGTELGSRWWIGPRAESGSSSSVKE  149

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             RL++A+GY+K+ ++D+DVLIQIWVPV R+G+ VL T  QP+ L+  C  L  +RD+S +Y
Sbjct  150   RLMEAIGYLKECTKDRDVLIQIWVPVKREGKHVLTTEGQPYSLNTNCKSLEIFRDVSKSY  209

Query  836   EFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQ  1015
              FP EEDS+E+VGLPGRV+LGK+PEWTPDV+ F+ +EYPR+  A +Y+V G+ A+PVF++
Sbjct  210   NFPAEEDSKESVGLPGRVYLGKLPEWTPDVRFFRSDEYPRINFAHKYNVGGSLALPVFER  269

Query  1016  GSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPE  1192
             GS TCLGV+E+V TTQK+ YR EL+ VCKALE VDLR S   +  +V+  +  YQ  LPE
Sbjct  270   GSGTCLGVVEIVTTTQKINYRPELEHVCKALEAVDLRSSHNFSPPSVEGYNELYQAALPE  329

Query  1193  ILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFH  1372
             I+EVL+S C T+KLPLA TW  CV Q K G RHSDEN   CVSTVD+AC +AD     F 
Sbjct  330   IVEVLRSVCKTYKLPLALTWAACVNQRKSGCRHSDENFYHCVSTVDAAC-LADEGFWDFL  388

Query  1373  EACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRST  1552
             EACSEHHL +G G+VGRAF TN+ CF  DIT+FSKT YPLSH+AR+F L+ AVAI L+S 
Sbjct  389   EACSEHHLFRGQGIVGRAFTTNKQCFVTDITAFSKTNYPLSHHARMFGLRGAVAIPLQSI  448

Query  1553  CTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKV  1732
              +GS +FVLE FLP+DC   EE K+ML SLS  ++  CQ+L VV ++ELEEE   P  ++
Sbjct  449   FSGSVEFVLELFLPKDCHDSEEQKQMLNSLSSFMRQACQSLHVVVDKELEEEVILPVKEM  508

Query  1733  AKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA---FQNEKPSE---  1894
                SD +  KE    + +       E  SW +  M  Q+     S    +Q E+P E   
Sbjct  509   VVASDGKSDKEETQFRISCLKENSPEESSWIAHMMEAQQKGKGVSVSWEYQKEEPKEEFR  568

Query  1895  ----------LLYKR--LPEF-----VSGSGLSFDSTSGEGSAQNVRR------AGDKKR  2005
                        LY +  L +F      +G+  S +   G+ S+    R      AG K+R
Sbjct  569   VTTHWEDTQLELYNKQVLSDFGQLHQNAGTKTSVEGGGGDSSSSGGHRLLAGKKAGGKRR  628

Query  2006  MKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              K EKTI+LQ+L+QYFAGSLKDAAKS+GV
Sbjct  629   TKMEKTISLQVLRQYFAGSLKDAAKSIGV  657



>ref|XP_008812750.1| PREDICTED: protein NLP1-like [Phoenix dactylifera]
Length=953

 Score =   519 bits (1337),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 290/537 (54%), Positives = 354/537 (66%), Gaps = 38/537 (7%)
 Frame = +2

Query  596   SSELSRRWWIGPMATTSVMD-RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQ  772
             SSEL   WWI P      M+ RLI+A+ Y+KD  RD DVL+QIWVP     R VL T  Q
Sbjct  125   SSELGSSWWIRPSTRMGTMEERLIRAINYVKDSRRDGDVLVQIWVPTRMGERHVLTTCGQ  184

Query  773   PFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYP  952
             PF LD  C RL +YR +S  Y+F  EE+S    GLPGRVFLG+VPEWTPDV+ F   EYP
Sbjct  185   PFTLDSSCQRLVNYRTVSTRYQFSAEENSNVAQGLPGRVFLGRVPEWTPDVRYFSSYEYP  244

Query  953   RVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGS  1132
             RV  AQRYDVRG+ A+PVF++ SR+C+GV+EVV+TTQK+ Y ++L+ VC AL+ VDLR S
Sbjct  245   RVNDAQRYDVRGSLALPVFERNSRSCVGVLEVVMTTQKINYSSDLEGVCNALQAVDLRSS  304

Query  1133  KISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLL  1309
             ++S V  V   + SY+VVLPEI  VL++ C TH LPLAQTW+ C+QQGK G RHSDEN  
Sbjct  305   EVSGVPRVMVFNESYRVVLPEIQRVLRAVCKTHSLPLAQTWISCIQQGKSGSRHSDENYK  364

Query  1310  RCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYP  1489
              CVSTVD ACY+ DP + GFH+ACSEHHLLKG GV G+AF TNQPCFS+DITSFSKTEYP
Sbjct  365   DCVSTVDVACYVQDPTMLGFHQACSEHHLLKGQGVAGKAFTTNQPCFSSDITSFSKTEYP  424

Query  1490  LSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQ  1669
             LSH+A++F L+AAVAIRLRS  TG+ DFVLEFFLP  C   EE K ML SLSI IQ VCQ
Sbjct  425   LSHHAKLFHLRAAVAIRLRSNHTGTADFVLEFFLPFKCIESEEQKLMLNSLSITIQQVCQ  484

Query  1670  tlrvvteqeleeettSPSS----------KVAKHSDIRIHKEVPNLKYNS-SIGPCEEGL  1816
             +LRVVT +ELE E   P S          K    +  R+  +  NL   S +IG   E  
Sbjct  485   SLRVVTSKELEHEAVLPVSELNSSNALLDKFVSETSQRLDDDDDNLLTESPTIGISGEVS  544

Query  1817  SWTSSPMLVQE----SCMSSSA----FQNEKPSELLYKR----LP-------------EF  1921
             SW +S    QE    S + +S     ++ E     ++ R    LP             EF
Sbjct  545   SWIASIRETQEKRGKSVLPASVPLDFYKQEIEGLSVWDRSEVVLPAGKIFSEFKPHEEEF  604

Query  1922  VSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             +  S    +S +GE    N  +A +K+R K EKTI+LQ L++YFAGSLKDAAKSLGV
Sbjct  605   LRDSFDPKNSFAGEPGFSNTGKAMEKRRTKTEKTISLQELRKYFAGSLKDAAKSLGV  661



>ref|XP_010428689.1| PREDICTED: protein NLP5-like [Camelina sativa]
 ref|XP_010428691.1| PREDICTED: protein NLP5-like [Camelina sativa]
 ref|XP_010428692.1| PREDICTED: protein NLP5-like [Camelina sativa]
Length=827

 Score =   515 bits (1327),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 293/596 (49%), Positives = 375/596 (63%), Gaps = 48/596 (8%)
 Frame = +2

Query  338   EGCWLETTDG-SEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             EGCWLETTD  SE F  SP  +   F+PS  +      +      S       ++     
Sbjct  23    EGCWLETTDAASELFNFSPSTSVTPFDPSSFMWSPTQQDTAAAAISSSHSFSQTM-----  77

Query  515   ASQFHTERVQCFGQN-GSNAVCSSGLAESSELSRRWWIGPMA-TTSVMDRLIQALGYIKD  688
                        +GQ+    +       + S  +RRWWIGP    +SVM+RL+QA+ +IKD
Sbjct  78    -----------YGQDCAERSSLEDQGRDLSSFNRRWWIGPSGHGSSVMERLVQAVAHIKD  126

Query  689   FSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQE  865
             ++ ++  LIQ+WVPV+R G+RVL T +QPF  D  C RLAHYR+IS+NY+F  E EDS  
Sbjct  127   YTSERGSLIQLWVPVDRGGKRVLTTKEQPFSHDPMCQRLAHYREISVNYQFSTEQEDSGS  186

Query  866   N-----VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             N     VGLPGRVFLGKVPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ C
Sbjct  187   NNSNDLVGLPGRVFLGKVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSQNC  246

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVL  1207
             LGVIEVV+TTQ VK   +L+S+C+AL+ VDLR + +    ++K    SYQ  LPEI  +L
Sbjct  247   LGVIEVVMTTQMVKLSPDLESICRALQAVDLRSTGVPIPPSLKEPDFSYQAALPEIRNLL  306

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
             + AC THKLPLAQTWV C++Q K G RH+DEN + CVST+D ACY+ DP ++ FHEACSE
Sbjct  307   RCACETHKLPLAQTWVSCLKQSKTGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSE  366

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLLKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS 
Sbjct  367   HHLLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSA  426

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             DFVLEFFLP+ C+  EE ++ML +LS I+ +V ++LR VTE+ELEEE    + +V +   
Sbjct  427   DFVLEFFLPKSCRDIEEQRKMLNALSTIMAHVPRSLRTVTEKELEEEGNPMAREVIERGV  486

Query  1748  IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVS  1927
                  E  +    S+  P   GL +      + E  + S                     
Sbjct  487   TLPKIENTSEVQESNSNPQNAGLVFDGGTTEMGE--LGSDY-------------------  525

Query  1928  GSGLSFDSTSGEGSAQ-NVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             G GLS +  S   SA     R  +KKR KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  526   GKGLSVNEKSTFSSATGGFSRITEKKRTKAEKNITLDVLRQYFAGSLKDAAKSIGV  581



>ref|XP_010918248.1| PREDICTED: protein NLP1-like isoform X1 [Elaeis guineensis]
 ref|XP_010918249.1| PREDICTED: protein NLP1-like isoform X1 [Elaeis guineensis]
 ref|XP_010918250.1| PREDICTED: protein NLP1-like isoform X1 [Elaeis guineensis]
Length=956

 Score =   519 bits (1337),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 287/537 (53%), Positives = 350/537 (65%), Gaps = 39/537 (7%)
 Frame = +2

Query  596   SSELSRRWWIGPMATTSVMD-RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQ  772
             SSEL   WWI P A    M+ RLI+A+ YIKD  RD DVL+QIWVP     R VL T  Q
Sbjct  129   SSELHSSWWIQPSAHMETMEERLIRAINYIKDSQRDGDVLVQIWVPTRIGDRHVLTTRGQ  188

Query  773   PFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYP  952
             PF LD  C RL +YR +S  Y+F  EE+S   VGLPGRVFLG+VPEWTPDV+ F   EYP
Sbjct  189   PFTLDSTCQRLVNYRTVSTQYQFSAEENSNVAVGLPGRVFLGRVPEWTPDVRYFSHYEYP  248

Query  953   RVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGS  1132
             RV  AQRYDVRG+ A+PVFD+ SR+CLGV+EVV+TTQK+ Y ++L+++C AL+ V+LR S
Sbjct  249   RVNDAQRYDVRGSLALPVFDRNSRSCLGVVEVVMTTQKINYSSDLENICNALQAVNLRSS  308

Query  1133  KISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLL  1309
             ++  V +VK C+ SYQV LPEI  VL++ C TH LPLAQTW+ C+QQGK G RH+DEN  
Sbjct  309   EVPGVPHVKVCNESYQVALPEIQRVLRAVCETHSLPLAQTWISCIQQGKSGSRHTDENYK  368

Query  1310  RCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYP  1489
              CVSTVD ACY+ DP + GFH+ACSEHHL KG GV G+AF TNQPCFS+DIT+FSKTEYP
Sbjct  369   DCVSTVDVACYVRDPTMLGFHQACSEHHLFKGQGVSGKAFTTNQPCFSSDITAFSKTEYP  428

Query  1490  LSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQ  1669
             LSH+A++F L+AAVAIRLRS  TG+ DFVLE FLP +C   EE K ML SLSI IQ VCQ
Sbjct  429   LSHHAKLFHLRAAVAIRLRSIHTGTADFVLELFLPINCIEHEEQKLMLNSLSITIQQVCQ  488

Query  1670  tlrvvte-----------qeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGL  1816
             +LRVVT             +L      P   V++ S  R+  +   L  +  IG   E  
Sbjct  489   SLRVVTSKELEHEAILQVAQLNSSNVLPDKFVSETSQ-RLDDDDNLLTESPMIGVSGEVS  547

Query  1817  SWTSSPMLVQE----SCMSSSA---FQNEKPSELLYKRLPEFVSGSG------------L  1939
             SW+ S    QE    S + +S    F  ++   L      E V  +G            L
Sbjct  548   SWSGSIRETQENGGKSVLPTSVPLDFNEQEIEGLSVWHTSEVVLPAGKIFSEFKQHEEEL  607

Query  1940  SFDST------SGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             + DS       SGE    N  +A +K+R K EKTI LQ LQ+YFAGSLKDAAKSLGV
Sbjct  608   TKDSIDHKTFFSGEPGFSNTEKAMEKRRTKTEKTIGLQELQKYFAGSLKDAAKSLGV  664



>ref|XP_011092933.1| PREDICTED: protein NLP2 [Sesamum indicum]
Length=952

 Score =   517 bits (1332),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 296/632 (47%), Positives = 393/632 (62%), Gaps = 52/632 (8%)
 Frame = +2

Query  341   GCWLETTDGSEFFQHSP------FNANALFEPSYVLPDLEPNNGELMKESEVER-----K  487
             G WLETTD S F+  +       FN+ +  E +    + +P +   +KES +        
Sbjct  32    GFWLETTDLSNFWHPAASTPLTHFNSTSFSETNIHTLNTDPPHHSFLKESAISNFFDVPN  91

Query  488   KSSLP-ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGP----MATTSVM  652
              S L  +  S +Q H           S    ++ L E + ++ R W+GP    + T SV 
Sbjct  92    LSYLGMDEFSETQSHIHEATT--PPASLNQSANFLVEETHVNTRLWVGPNRNPIRTLSVK  149

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
              RL+QA+  +KD   DKDVLIQIW+PV R GR+VL T +QPF L+  C  LA YRD+S N
Sbjct  150   KRLVQAISCLKDSISDKDVLIQIWIPVKRGGRQVLTTNNQPFSLNANCKNLADYRDVSRN  209

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y+F  +EDS++ +GLPGRVFL K+PEWTPDV+ FKREEYPRV  AQ+++VRG+ A+PVF+
Sbjct  210   YQFAADEDSKDFIGLPGRVFLNKLPEWTPDVRFFKREEYPRVNDAQQHNVRGSLALPVFE  269

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKI---SNVRNVKTCHSYQVV  1183
             QGS  CLGV+E+V T+QKV YR EL+++CKALE VDL+ S I   SN+ N +   SYQ  
Sbjct  270   QGSGICLGVVEIVTTSQKVNYRPELENICKALEAVDLKSSNILSPSNIENRE--ESYQGA  327

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQ  1363
             L EI  VLK  C THKLPLAQTW  CVQQ K G RHS EN  RCVST+DSACY+ADP++ 
Sbjct  328   LTEINNVLKFVCNTHKLPLAQTWASCVQQNKGGCRHSVENYARCVSTIDSACYVADPQVS  387

Query  1364  GFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRL  1543
             GFHEACSEHHLLKG GV G+AF+TNQPCF+ DIT+FSKTEYPL+H+AR+F L A+ AIRL
Sbjct  388   GFHEACSEHHLLKGEGVAGKAFLTNQPCFAEDITAFSKTEYPLAHHARVFHLCASAAIRL  447

Query  1544  RSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPS  1723
             RST   + DFVLEFFLP +CK  +   RML  LS +IQ  CQ+L+V+T+QEL +ET    
Sbjct  448   RSTYNRTADFVLEFFLPLNCKDTQHQMRMLNLLSSVIQQTCQSLQVITDQELAQETLGRE  507

Query  1724  SKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPML--VQESCMSSSAFQN--EKPS  1891
                     +   K+ P L  + S     +G  W ++  +   Q+    + +F N  E+P 
Sbjct  508   RSNTSAGRLDDEKKHPKLVISPSKQDLLDGSPWIAASRVDSQQKGKGIAVSFSNRMEEPE  567

Query  1892  ELL------------YKRLPEFVSGSGLSFDS---TSGEGSAQ----------NVRRAGD  1996
                            ++ +P  +    L  DS    SGEG               + + +
Sbjct  568   REFKLTTQWDNSGSDFQNVPAVLEHDELQRDSGPRRSGEGGGSFSLTIGHLPLGAQTSSE  627

Query  1997  KKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             ++R K EK+I+LQ+L+QYFAGSLK+AA+S+GV
Sbjct  628   RRRTKTEKSISLQVLRQYFAGSLKEAARSIGV  659



>ref|XP_010471784.1| PREDICTED: protein NLP5 [Camelina sativa]
 ref|XP_010471785.1| PREDICTED: protein NLP5 [Camelina sativa]
Length=824

 Score =   513 bits (1322),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 290/595 (49%), Positives = 375/595 (63%), Gaps = 47/595 (8%)
 Frame = +2

Query  338   EGCWLETTDG-SEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             EGCWLETTD  SE F  SP  +   F+PS  +      +              ++     
Sbjct  23    EGCWLETTDAASELFNFSPSTSVTPFDPSSFMWSPTQQDTAAAAICSSSSLSQTM-----  77

Query  515   ASQFHTERVQCFGQN-GSNAVCSSGLAESSELSRRWWIGPMA-TTSVMDRLIQALGYIKD  688
                        +GQ+    +       + +  +RRWWIGP    +SVM+RL+QA+ +IKD
Sbjct  78    -----------YGQDCAERSSLEDQGRDLTSFNRRWWIGPSGHGSSVMERLVQAVAHIKD  126

Query  689   FSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQE  865
             ++ ++  LIQ+WVPV+R G+RVL T +QPF  D  C RLAHYR+IS+NY+F  E EDS  
Sbjct  127   YTSERGSLIQLWVPVDRGGKRVLTTKEQPFSHDPMCQRLAHYREISVNYQFSTEQEDSGS  186

Query  866   N----VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCL  1033
             N    VGLPGRVFL KVPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CL
Sbjct  187   NSNDLVGLPGRVFLEKVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSQNCL  246

Query  1034  GVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLK  1210
             GVIEVV+TTQ VK   +L+S+C+AL+ VDLR + +    ++K    SYQ  LPEI  +L+
Sbjct  247   GVIEVVMTTQMVKLSPDLESICRALQAVDLRSTGVPIPPSLKGPDFSYQAALPEIRNLLR  306

Query  1211  SACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEH  1390
              AC THKLPLAQTWV C++Q K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEH
Sbjct  307   CACETHKLPLAQTWVSCLKQSKTGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEH  366

Query  1391  HLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTD  1570
             HLLKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS D
Sbjct  367   HLLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSAD  426

Query  1571  FVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDI  1750
             FVLEFFLP++C+  EE ++ML +LS I+ +V ++LR VTE+ELEEE    + +V +    
Sbjct  427   FVLEFFLPKNCRDIEEQRKMLNALSTIMAHVPRSLRTVTEKELEEEGNPMAREVIERGVT  486

Query  1751  RIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSG  1930
                 E  +    S+  P + GL +      + E  + S                     G
Sbjct  487   LPKIENTSEVQESNSNPQKAGLVFDGGTTEMGE--LGSDY-------------------G  525

Query  1931  SGLSFDSTSGEGSAQ-NVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              GLS +  S   SA     R  +KKR KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  526   KGLSVNEKSTFSSATGGFSRITEKKRTKAEKNITLDVLRQYFAGSLKDAAKSIGV  580



>ref|XP_010477309.1| PREDICTED: protein NLP4-like [Camelina sativa]
 ref|XP_010477310.1| PREDICTED: protein NLP4-like [Camelina sativa]
 ref|XP_010477311.1| PREDICTED: protein NLP4-like [Camelina sativa]
 ref|XP_010477312.1| PREDICTED: protein NLP4-like [Camelina sativa]
 ref|XP_010477313.1| PREDICTED: protein NLP4-like [Camelina sativa]
Length=845

 Score =   513 bits (1321),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 294/600 (49%), Positives = 391/600 (65%), Gaps = 58/600 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANAL-FEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGSEF   +P  ++ + F+PS  +                           S
Sbjct  24    DGCWLETTDGSEFLNVAPSTSSVIPFDPSSFM--------------------------WS  57

Query  515   ASQFHTERV-QCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYIK  685
              +Q  +  V Q +GQ+    V  S L +  + ++RWWIGP     +SV +RL+QA+ +IK
Sbjct  58    PTQDTSAVVSQMYGQD---CVERSSL-DDFQWNKRWWIGPGGGGGSSVTERLVQAVEHIK  113

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQ  862
             D++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+
Sbjct  114   DYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDSK  173

Query  863   ENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVI  1042
                GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVI
Sbjct  174   ALAGLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCDVRGTLAIPVFEQGSKICLGVI  233

Query  1043  EVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSAC  1219
             EVV+TT+ VK R EL+S+CKAL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC
Sbjct  234   EVVMTTEMVKLRPELESICKALQAVDLRSTELPIPPSLKGCDLSYKAALPEIRNLLRCAC  293

Query  1220  ATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLL  1399
              THKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHLL
Sbjct  294   ETHKLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHLL  353

Query  1400  KGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVL  1579
             KG GV G+AF+TN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TGS DFVL
Sbjct  354   KGQGVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFVL  413

Query  1580  EFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIH  1759
             EFFLP+DC   EE ++ML +LS I+ +V ++LR VT++ELEEE+     +      I   
Sbjct  414   EFFLPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEVVTPKIENT  473

Query  1760  KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGL  1939
              E+  L  +S          W++S   +Q S  SS    N +   L++    +   G GL
Sbjct  474   SELQQLHGSS---------PWSASLEEIQRSNNSS----NPQNLGLVFDGGDKPNDGFGL  520

Query  1940  ------SFDSTSGEGSAQNVRR---AGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                   + DS   E S  +        +KKR KA+KTITL +L+QYFAGSLKDAAK++GV
Sbjct  521   KRGFDYTMDSNVNESSTFSSGGFSMTAEKKRTKADKTITLDVLRQYFAGSLKDAAKNIGV  580



>ref|XP_010459756.1| PREDICTED: protein NLP4 isoform X3 [Camelina sativa]
 ref|XP_010459757.1| PREDICTED: protein NLP4 isoform X3 [Camelina sativa]
 ref|XP_010459758.1| PREDICTED: protein NLP4 isoform X3 [Camelina sativa]
Length=852

 Score =   513 bits (1322),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 295/600 (49%), Positives = 392/600 (65%), Gaps = 51/600 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNAN-ALFEPS-YVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTDGSEF   +P  ++ + F+PS ++    +  +  L     V           
Sbjct  24    DGCWLETTDGSEFLNVAPSTSSVSPFDPSSFMWSPTQDTSAALCTSGGV-----------  72

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYIK  685
               SQ +          G + V  S L +  + ++RWWIGP     +SV +RL+QA+ +IK
Sbjct  73    -VSQMY----------GQDCVERSSL-DDFQWNKRWWIGPGGGGGSSVTERLVQAVEHIK  120

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQ  862
             D++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+
Sbjct  121   DYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDSK  180

Query  863   ENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVI  1042
                GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVI
Sbjct  181   ALAGLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCDVRGTLAIPVFEQGSKICLGVI  240

Query  1043  EVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSAC  1219
             EVV+TT+ VK R EL+S+CKAL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC
Sbjct  241   EVVMTTEMVKLRPELESICKALQAVDLRSTELPIPPSLKGCDLSYKAALPEIRNLLRCAC  300

Query  1220  ATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLL  1399
              THKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHLL
Sbjct  301   ETHKLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHLL  360

Query  1400  KGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVL  1579
             KG GV G+AF+TN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TGS DFVL
Sbjct  361   KGQGVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFVL  420

Query  1580  EFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIH  1759
             EFFLP+DC   EE ++ML +LS I+ +V ++LR VT++ELEEE+     +      I   
Sbjct  421   EFFLPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEIVKPKIENT  480

Query  1760  KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGL  1939
              E+ +L  NS          W++S   +Q S  +S    N +   L++    +   G GL
Sbjct  481   SELQHLHGNS---------PWSASLEEIQRSNNTS----NPQNLGLVFDGGDKPNDGFGL  527

Query  1940  --SFDST-------SGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                FD T       S   S+       +KKR KA+KTITL IL+QYFAGSLKDAAK++GV
Sbjct  528   KRGFDYTMDYNVNESSTFSSGGFSMTAEKKRTKADKTITLDILRQYFAGSLKDAAKNIGV  587



>ref|XP_010459755.1| PREDICTED: protein NLP4 isoform X2 [Camelina sativa]
Length=878

 Score =   514 bits (1324),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 295/600 (49%), Positives = 392/600 (65%), Gaps = 51/600 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNAN-ALFEPS-YVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTDGSEF   +P  ++ + F+PS ++    +  +  L     V           
Sbjct  50    DGCWLETTDGSEFLNVAPSTSSVSPFDPSSFMWSPTQDTSAALCTSGGV-----------  98

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYIK  685
               SQ +          G + V  S L +  + ++RWWIGP     +SV +RL+QA+ +IK
Sbjct  99    -VSQMY----------GQDCVERSSL-DDFQWNKRWWIGPGGGGGSSVTERLVQAVEHIK  146

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQ  862
             D++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+
Sbjct  147   DYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDSK  206

Query  863   ENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVI  1042
                GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVI
Sbjct  207   ALAGLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCDVRGTLAIPVFEQGSKICLGVI  266

Query  1043  EVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSAC  1219
             EVV+TT+ VK R EL+S+CKAL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC
Sbjct  267   EVVMTTEMVKLRPELESICKALQAVDLRSTELPIPPSLKGCDLSYKAALPEIRNLLRCAC  326

Query  1220  ATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLL  1399
              THKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHLL
Sbjct  327   ETHKLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHLL  386

Query  1400  KGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVL  1579
             KG GV G+AF+TN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TGS DFVL
Sbjct  387   KGQGVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFVL  446

Query  1580  EFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIH  1759
             EFFLP+DC   EE ++ML +LS I+ +V ++LR VT++ELEEE+     +      I   
Sbjct  447   EFFLPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEIVKPKIENT  506

Query  1760  KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGL  1939
              E+ +L  NS          W++S   +Q S  +S    N +   L++    +   G GL
Sbjct  507   SELQHLHGNS---------PWSASLEEIQRSNNTS----NPQNLGLVFDGGDKPNDGFGL  553

Query  1940  --SFDST-------SGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                FD T       S   S+       +KKR KA+KTITL IL+QYFAGSLKDAAK++GV
Sbjct  554   KRGFDYTMDYNVNESSTFSSGGFSMTAEKKRTKADKTITLDILRQYFAGSLKDAAKNIGV  613



>ref|XP_006416377.1| hypothetical protein EUTSA_v10006790mg [Eutrema salsugineum]
 gb|ESQ34730.1| hypothetical protein EUTSA_v10006790mg [Eutrema salsugineum]
Length=845

 Score =   513 bits (1321),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 296/607 (49%), Positives = 390/607 (64%), Gaps = 71/607 (12%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTDGSEF                 LP                      P   S 
Sbjct  24    DGCWLETTDGSEFLN---------------LP----------------------PSTSSD  46

Query  518   SQFHTERVQCFGQNGSNAVCSSGL------AESSEL-----SRRWWIGPMAT-TSVMDRL  661
             S F    +       ++A+C+SG+      AE S L     ++RWWIGP    +SV +RL
Sbjct  47    SPFDPSSLMWSPTQDTSALCTSGIVYGRDSAERSSLDEFQWNKRWWIGPGGGGSSVTERL  106

Query  662   IQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEF  841
             +QA+ +IKD++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F
Sbjct  107   VQAVEHIKDYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHF  166

Query  842   PVE-EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
               E +DS+   GLPGRVFLGK+PEWTPDV+ F+ EEYPRV HAQ  DVRGT A+PVF+QG
Sbjct  167   SAEQDDSKALAGLPGRVFLGKLPEWTPDVRFFRSEEYPRVQHAQDCDVRGTLAIPVFEQG  226

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEI  1195
             S+ CLGVIEVV+TT+ VK R EL+S+C+AL+ VDLR +++    ++K C  SY+  LPEI
Sbjct  227   SKICLGVIEVVMTTEMVKLRPELESICRALQAVDLRSTELPIPPSLKGCDLSYKAALPEI  286

Query  1196  LEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHE  1375
               +L+ AC THKLPLAQTWV C+QQ K G RH+DEN   CVST+D ACY+ DP ++ FHE
Sbjct  287   RNLLRCACETHKLPLAQTWVSCLQQSKSGCRHNDENYTHCVSTIDDACYVGDPTVREFHE  346

Query  1376  ACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTC  1555
             ACSEHHLLKG GV G+AF+TN PCFS+DI+++ K+EYPLSH+A +F L  +VAIRLR   
Sbjct  347   ACSEHHLLKGQGVAGQAFLTNGPCFSSDISNYKKSEYPLSHHANMFGLHGSVAIRLRCIH  406

Query  1556  TGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVA  1735
             TGS DFVLEFFLP+DC   EE ++ML +LS I+ +V ++LR VT++ELEEE+     +  
Sbjct  407   TGSADFVLEFFLPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREET  466

Query  1736  KHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQ-------NEKPSE  1894
                 I    E+ +L  NS         SW++S   +Q+S  S++           EKP++
Sbjct  467   VTPKIENTSELHHLHGNS---------SWSASFDEIQQSNNSNNPQNLGLVFDGGEKPND  517

Query  1895  -LLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKD  2071
                 KR  ++   S ++  ST    S     R  +KKR KA+KTITL +L+QYFAGSLKD
Sbjct  518   GFGLKRGFDYTRDSNVNESSTF---STDGFSRMTEKKRTKADKTITLDVLRQYFAGSLKD  574

Query  2072  AAKSLGV  2092
             AAK++GV
Sbjct  575   AAKNIGV  581



>ref|XP_010459754.1| PREDICTED: protein NLP4 isoform X1 [Camelina sativa]
Length=906

 Score =   514 bits (1325),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 295/600 (49%), Positives = 392/600 (65%), Gaps = 51/600 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNAN-ALFEPS-YVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTDGSEF   +P  ++ + F+PS ++    +  +  L     V           
Sbjct  78    DGCWLETTDGSEFLNVAPSTSSVSPFDPSSFMWSPTQDTSAALCTSGGV-----------  126

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYIK  685
               SQ +          G + V  S L +  + ++RWWIGP     +SV +RL+QA+ +IK
Sbjct  127   -VSQMY----------GQDCVERSSL-DDFQWNKRWWIGPGGGGGSSVTERLVQAVEHIK  174

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQ  862
             D++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+
Sbjct  175   DYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDSK  234

Query  863   ENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVI  1042
                GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVI
Sbjct  235   ALAGLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCDVRGTLAIPVFEQGSKICLGVI  294

Query  1043  EVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSAC  1219
             EVV+TT+ VK R EL+S+CKAL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC
Sbjct  295   EVVMTTEMVKLRPELESICKALQAVDLRSTELPIPPSLKGCDLSYKAALPEIRNLLRCAC  354

Query  1220  ATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLL  1399
              THKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHLL
Sbjct  355   ETHKLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHLL  414

Query  1400  KGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVL  1579
             KG GV G+AF+TN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TGS DFVL
Sbjct  415   KGQGVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFVL  474

Query  1580  EFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIH  1759
             EFFLP+DC   EE ++ML +LS I+ +V ++LR VT++ELEEE+     +      I   
Sbjct  475   EFFLPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEIVKPKIENT  534

Query  1760  KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGL  1939
              E+ +L  NS          W++S   +Q S  +S    N +   L++    +   G GL
Sbjct  535   SELQHLHGNS---------PWSASLEEIQRSNNTS----NPQNLGLVFDGGDKPNDGFGL  581

Query  1940  --SFDST-------SGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                FD T       S   S+       +KKR KA+KTITL IL+QYFAGSLKDAAK++GV
Sbjct  582   KRGFDYTMDYNVNESSTFSSGGFSMTAEKKRTKADKTITLDILRQYFAGSLKDAAKNIGV  641



>ref|XP_010498501.1| PREDICTED: protein NLP4-like isoform X3 [Camelina sativa]
 ref|XP_010498502.1| PREDICTED: protein NLP4-like isoform X3 [Camelina sativa]
 ref|XP_010498503.1| PREDICTED: protein NLP4-like isoform X3 [Camelina sativa]
Length=852

 Score =   511 bits (1315),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 295/601 (49%), Positives = 395/601 (66%), Gaps = 53/601 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ-HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGSEF    S  ++ + F+PS  +                     S  ++ S
Sbjct  24    DGCWLETTDGSEFLNVASSTSSVSPFDPSSFM--------------------WSPTQDAS  63

Query  515   ASQFHTERV--QCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYI  682
             A+   +  V  Q +GQ+    V  S L +  + ++RWWIGP     +SV +RL+QA+ +I
Sbjct  64    AALCTSGGVVSQMYGQD---CVERSSL-DDFQWNKRWWIGPGGGGGSSVTERLVQAVEHI  119

Query  683   KDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDS  859
             KD++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS
Sbjct  120   KDYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDS  179

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
             +   GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGV
Sbjct  180   KALAGLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCDVRGTLAIPVFEQGSKICLGV  239

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSA  1216
             IEVV+TT+ VK R EL+S+CKAL+ VDLR +++    ++K C  SY+  LPEI ++L+ A
Sbjct  240   IEVVMTTEMVKLRPELESICKALQAVDLRSTELPISPSLKGCDLSYKAALPEIRKLLRCA  299

Query  1217  CATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHL  1396
             C THKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHL
Sbjct  300   CETHKLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHL  359

Query  1397  LKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFV  1576
             LKG GV G+AF+TN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TGS DFV
Sbjct  360   LKGQGVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFV  419

Query  1577  LEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRI  1756
             LEFFLP+DC   EE ++ML +LS I+ +V ++LR VT++ELEEE+     +      I  
Sbjct  420   LEFFLPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEIVTPKIEN  479

Query  1757  HKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSG  1936
               E+  L  NS          W++S   +Q S  +S    N +   L++    +   G G
Sbjct  480   TSELQQLHGNS---------PWSASLEEIQRSNNTS----NPQNLGLVFDGGDKPNDGFG  526

Query  1937  L------SFDSTSGEGSAQNVRR---AGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLG  2089
             L      + DS   E S+ +        +KKR KA+KTITL +L+QYFAGSLKDAAK++G
Sbjct  527   LKRGFDYTMDSNVNESSSFSSGGFSMTAEKKRTKADKTITLDVLRQYFAGSLKDAAKNIG  586

Query  2090  V  2092
             V
Sbjct  587   V  587



>ref|XP_010498500.1| PREDICTED: protein NLP4-like isoform X2 [Camelina sativa]
Length=878

 Score =   511 bits (1317),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 295/601 (49%), Positives = 395/601 (66%), Gaps = 53/601 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ-HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGSEF    S  ++ + F+PS  +                     S  ++ S
Sbjct  50    DGCWLETTDGSEFLNVASSTSSVSPFDPSSFM--------------------WSPTQDAS  89

Query  515   ASQFHTERV--QCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYI  682
             A+   +  V  Q +GQ+    V  S L +  + ++RWWIGP     +SV +RL+QA+ +I
Sbjct  90    AALCTSGGVVSQMYGQD---CVERSSL-DDFQWNKRWWIGPGGGGGSSVTERLVQAVEHI  145

Query  683   KDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDS  859
             KD++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS
Sbjct  146   KDYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDS  205

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
             +   GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGV
Sbjct  206   KALAGLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCDVRGTLAIPVFEQGSKICLGV  265

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSA  1216
             IEVV+TT+ VK R EL+S+CKAL+ VDLR +++    ++K C  SY+  LPEI ++L+ A
Sbjct  266   IEVVMTTEMVKLRPELESICKALQAVDLRSTELPISPSLKGCDLSYKAALPEIRKLLRCA  325

Query  1217  CATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHL  1396
             C THKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHL
Sbjct  326   CETHKLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHL  385

Query  1397  LKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFV  1576
             LKG GV G+AF+TN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TGS DFV
Sbjct  386   LKGQGVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFV  445

Query  1577  LEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRI  1756
             LEFFLP+DC   EE ++ML +LS I+ +V ++LR VT++ELEEE+     +      I  
Sbjct  446   LEFFLPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEIVTPKIEN  505

Query  1757  HKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSG  1936
               E+  L  NS          W++S   +Q S  +S    N +   L++    +   G G
Sbjct  506   TSELQQLHGNS---------PWSASLEEIQRSNNTS----NPQNLGLVFDGGDKPNDGFG  552

Query  1937  L------SFDSTSGEGSAQNVRR---AGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLG  2089
             L      + DS   E S+ +        +KKR KA+KTITL +L+QYFAGSLKDAAK++G
Sbjct  553   LKRGFDYTMDSNVNESSSFSSGGFSMTAEKKRTKADKTITLDVLRQYFAGSLKDAAKNIG  612

Query  2090  V  2092
             V
Sbjct  613   V  613



>ref|XP_010498499.1| PREDICTED: protein NLP4-like isoform X1 [Camelina sativa]
Length=905

 Score =   511 bits (1317),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 295/601 (49%), Positives = 395/601 (66%), Gaps = 53/601 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ-HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGSEF    S  ++ + F+PS  +                     S  ++ S
Sbjct  77    DGCWLETTDGSEFLNVASSTSSVSPFDPSSFM--------------------WSPTQDAS  116

Query  515   ASQFHTERV--QCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYI  682
             A+   +  V  Q +GQ+    V  S L +  + ++RWWIGP     +SV +RL+QA+ +I
Sbjct  117   AALCTSGGVVSQMYGQD---CVERSSL-DDFQWNKRWWIGPGGGGGSSVTERLVQAVEHI  172

Query  683   KDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDS  859
             KD++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS
Sbjct  173   KDYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDS  232

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
             +   GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGV
Sbjct  233   KALAGLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCDVRGTLAIPVFEQGSKICLGV  292

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSA  1216
             IEVV+TT+ VK R EL+S+CKAL+ VDLR +++    ++K C  SY+  LPEI ++L+ A
Sbjct  293   IEVVMTTEMVKLRPELESICKALQAVDLRSTELPISPSLKGCDLSYKAALPEIRKLLRCA  352

Query  1217  CATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHL  1396
             C THKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHL
Sbjct  353   CETHKLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHL  412

Query  1397  LKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFV  1576
             LKG GV G+AF+TN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TGS DFV
Sbjct  413   LKGQGVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFV  472

Query  1577  LEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRI  1756
             LEFFLP+DC   EE ++ML +LS I+ +V ++LR VT++ELEEE+     +      I  
Sbjct  473   LEFFLPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEIVTPKIEN  532

Query  1757  HKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSG  1936
               E+  L  NS          W++S   +Q S  +S    N +   L++    +   G G
Sbjct  533   TSELQQLHGNS---------PWSASLEEIQRSNNTS----NPQNLGLVFDGGDKPNDGFG  579

Query  1937  L------SFDSTSGEGSAQNVRR---AGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLG  2089
             L      + DS   E S+ +        +KKR KA+KTITL +L+QYFAGSLKDAAK++G
Sbjct  580   LKRGFDYTMDSNVNESSSFSSGGFSMTAEKKRTKADKTITLDVLRQYFAGSLKDAAKNIG  639

Query  2090  V  2092
             V
Sbjct  640   V  640



>ref|NP_173488.1| nodule inception protein-like protein 4 [Arabidopsis thaliana]
 ref|NP_973874.1| nodule inception protein-like protein 4 [Arabidopsis thaliana]
 sp|Q9LE38.1|NLP4_ARATH RecName: Full=Protein NLP4; Short=AtNLP4; AltName: Full=NIN-like 
protein 4; AltName: Full=Nodule inception protein-like protein 
4 [Arabidopsis thaliana]
 gb|AAF79626.1|AC027665_27 F5M15.4 [Arabidopsis thaliana]
 gb|AAF80612.1|AC069251_5 F2D10.12 [Arabidopsis thaliana]
 gb|AAM14037.1| putative nodule inception protein [Arabidopsis thaliana]
 gb|AAM51312.1| putative nodule inception protein [Arabidopsis thaliana]
 gb|AEE29999.1| nodule inception protein-like protein 4 [Arabidopsis thaliana]
 gb|AEE30000.1| nodule inception protein-like protein 4 [Arabidopsis thaliana]
Length=844

 Score =   509 bits (1311),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 292/598 (49%), Positives = 385/598 (64%), Gaps = 53/598 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNAN-ALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGSEF   +P  ++ + F+P+  +     +   L     V            
Sbjct  24    DGCWLETTDGSEFLNIAPSTSSVSPFDPTSFMWSPTQDTSALCTSGVVS-----------  72

Query  515   ASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGP-MATTSVMDRLIQALGYIKDF  691
                      Q +GQ   + V  S L E  + ++RWWIGP    +SV +RL+QA+ +IKD+
Sbjct  73    ---------QMYGQ---DCVERSSLDE-FQWNKRWWIGPGGGGSSVTERLVQAVEHIKDY  119

Query  692   SRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQEN  868
             +  +  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+  
Sbjct  120   TTARGSLIQLWVPVNRGGKRVLTTKEQPFSHDPLCQRLANYREISVNYHFSAEQDDSKAL  179

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
              GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVIEV
Sbjct  180   AGLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCDVRGTLAIPVFEQGSKICLGVIEV  239

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACAT  1225
             V+TT+ VK R EL+S+C+AL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC T
Sbjct  240   VMTTEMVKLRPELESICRALQAVDLRSTELPIPPSLKGCDLSYKAALPEIRNLLRCACET  299

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             HKLPLAQTWV C QQ K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHLLKG
Sbjct  300   HKLPLAQTWVSCQQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHLLKG  359

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              GV G+AF+TN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TGS DFVLEF
Sbjct  360   QGVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFVLEF  419

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP+DC   EE ++ML +LS I+ +V ++LR VT++ELEEE+     +      I    E
Sbjct  420   FLPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEIVTPKIENASE  479

Query  1766  VPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGL--  1939
                L  NS          W +S   +Q S  +S    N +   L++    +   G GL  
Sbjct  480   ---LHGNS---------PWNASLEEIQRSNNTS----NPQNLGLVFDGGDKPNDGFGLKR  523

Query  1940  ----SFDSTSGEGSAQNVRRA---GDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                 + DS   E S  +        +KKR KA+KTITL +L+QYFAGSLKDAAK++GV
Sbjct  524   GFDYTMDSNVNESSTFSSGGFSMMAEKKRTKADKTITLDVLRQYFAGSLKDAAKNIGV  581



>ref|XP_009623517.1| PREDICTED: protein NLP2-like [Nicotiana tomentosiformis]
Length=913

 Score =   510 bits (1314),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 301/612 (49%), Positives = 380/612 (62%), Gaps = 51/612 (8%)
 Frame = +2

Query  338   EGCWLETTD-GSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +G WLETT+  S F   S   +  L   +       P   +L  + E ++ K    +   
Sbjct  32    DGFWLETTNHASNFLTPSSLASQPLLLDTTKAGHFLPTTDQLTLQEETDKDKILFAQ---  88

Query  515   ASQFHTERVQCFGQNGSNAVCSSGLAESSELS-RRWWIGPM----ATTSVMDRLIQALGY  679
                F   R                  E+SE S RR WIGP      T SV  RL+QA+ +
Sbjct  89    MDDFSPTR-----------------RENSETSPRRLWIGPNINPNPTLSVKKRLVQAIEH  131

Query  680   IKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDS  859
             +KD +RDKDVLIQIWVPV R G+ VL+T +QP+ L+     L  YR +S NY+F  E+DS
Sbjct  132   LKDSTRDKDVLIQIWVPVKRGGKHVLITNNQPYFLNPNFQSLVEYRYVSQNYQFAAEKDS  191

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
             +E VGLPGRVFL K+PEWTPDV+ FKREEYPRV HA +Y+VRG+ AVPVF+ GS TCLGV
Sbjct  192   KELVGLPGRVFLKKLPEWTPDVRFFKREEYPRVNHAHQYNVRGSIAVPVFETGSGTCLGV  251

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSA  1216
             +E+V TTQK  Y  EL+ VCKALE V+LR S ISN   +K C+ SY   L EI  +L   
Sbjct  252   VEIVTTTQKTHYHPELEDVCKALEAVNLRSSGISNPAKIKDCNESYLAALAEIQYILTCV  311

Query  1217  CATHKLPLAQTWVPCVQQGKEG-LRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHH  1393
             C THKLPLAQTW PC+QQGK G LR  DEN   CV+TVD ACY+ DP++  FH ACSEHH
Sbjct  312   CDTHKLPLAQTWAPCIQQGKGGCLR--DENFTFCVTTVDEACYVRDPQVLPFHYACSEHH  369

Query  1394  LLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDF  1573
             LLKG GV G AF TNQPCF+ DIT+FSKTEYPLSH+AR+F L +AVAIRLRS  TGS DF
Sbjct  370   LLKGEGVAGGAFNTNQPCFATDITAFSKTEYPLSHHARMFGLCSAVAIRLRSIYTGSADF  429

Query  1574  VLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIR  1753
             VLEFFLP DCK+ E+ K+ML+SLS +IQ  C++LRVVT+QEL+EE      +    S   
Sbjct  430   VLEFFLPLDCKNTEDQKQMLSSLSSVIQQSCRSLRVVTDQELQEEKELLQREKVILSAGE  489

Query  1754  IHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNE-----------------  1882
              H+E+     +   G  ++  SW S  M  Q     ++  Q E                 
Sbjct  490   SHEEISRKPVSPPYGD-QDASSWLSQMMDSQRKGKGAAVSQEENFKVTANHWRESIHAST  548

Query  1883  --KPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFA  2056
               +P+++     P   SG  L F S +    +   +RAG+++R K EK+I+LQ+L+QYFA
Sbjct  549   YSEPNQIQDNFGPNGGSGGSLDFSSGT-GSHSSGAKRAGERRRSKTEKSISLQVLRQYFA  607

Query  2057  GSLKDAAKSLGV  2092
             GSLKDAAKS+GV
Sbjct  608   GSLKDAAKSIGV  619



>emb|CAE30324.1| NIN-like protein 1 [Lotus japonicus]
Length=904

 Score =   509 bits (1310),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 293/609 (48%), Positives = 382/609 (63%), Gaps = 48/609 (8%)
 Frame = +2

Query  338   EGCWLETT-DGSEFF-QHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPEN-  508
             +GCWLE + DGS F  Q SP  ++ LF+PS+  P LE N    + E + E +++ L    
Sbjct  34    DGCWLEASADGSNFLLQQSPPFSSPLFDPSFSWPALETNEPTHV-EDQHESQEAPLGNTQ  92

Query  509   -LSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATT----SVMDRLIQAL  673
              +S SQ     V     N S     S +  +S+  +RWWI P  +     S+M++LI+AL
Sbjct  93    LVSQSQNMVNVVDGRYNNQSETETHSVVEGTSDGVKRWWIAPTCSPGLGPSIMEKLIRAL  152

Query  674   GYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEE  853
              +IK F+ +KD+LIQIWVPV R  R +L   + PF LD     LA YR+IS  ++F  EE
Sbjct  153   KWIKQFNWNKDMLIQIWVPVPRGDRPILSANNLPFSLDSGSENLARYREISEGFQFSAEE  212

Query  854   DSQENV-GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             DS+E V GLPGRVF  KVPEWTPDV+ F+ +EYPRV HA+ +D+ GT AVP+F+QGSRTC
Sbjct  213   DSKELVPGLPGRVFRDKVPEWTPDVRFFRSDEYPRVEHAREFDICGTLAVPIFEQGSRTC  272

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH--SYQVVLPEILEV  1204
             LGVIEVV+TTQ++ Y  +L+SVCKALE VDL   K S+++N K     SY+  LPEI EV
Sbjct  273   LGVIEVVMTTQQINYVPQLESVCKALEVVDLTSLKHSSIQNAKQARDKSYEAALPEIQEV  332

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             L+SAC  HKLPLAQTWV C QQGK+G RHS++N L C+S V+ ACY+ DP ++ FHEAC 
Sbjct  333   LRSACHMHKLPLAQTWVSCFQQGKDGCRHSEDNYLHCISPVEQACYVGDPSVRFFHEACM  392

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLLKG GV G+AFM NQP FS DIT  SKT+YPLSH+AR+F L+AAVAIRLRS  + +
Sbjct  393   EHHLLKGQGVAGKAFMINQPFFSTDITMLSKTDYPLSHHARLFGLRAAVAIRLRSIYSSA  452

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHS  1744
              D+VLEFFLP +C   EE K ML SLSIIIQ  C++LR                      
Sbjct  453   DDYVLEFFLPVNCNDSEEQKNMLISLSIIIQRCCRSLR----------------------  490

Query  1745  DIRIHKEVPNLKYNSSIGPCEE-GLSWTSSPMLVQESCMSSSAFQNEKPSELL---YKRL  1912
              +   KE+     +  +   E+ G + T      Q     +S    EK SE +   +  L
Sbjct  491   -VITDKELERTSSSVEVMALEDSGFARTVKWSEPQHITSVASLEPEEKSSETVGGKFSDL  549

Query  1913  PEFVSGSGLSFD-------STSGEGSAQNV--RRAGDKKRMKAEKTITLQILQQYFAGSL  2065
              E    S L  +       S   EG+  +V   + G+K+R KA+KTITL++L+QYF GSL
Sbjct  550   REHQEDSILKGNIECDRECSPFVEGNLSSVGISKTGEKRRAKADKTITLEVLRQYFPGSL  609

Query  2066  KDAAKSLGV  2092
             KDAAK++GV
Sbjct  610   KDAAKNIGV  618



>ref|XP_009766436.1| PREDICTED: protein NLP2-like [Nicotiana sylvestris]
 ref|XP_009766437.1| PREDICTED: protein NLP2-like [Nicotiana sylvestris]
 ref|XP_009766438.1| PREDICTED: protein NLP2-like [Nicotiana sylvestris]
Length=910

 Score =   509 bits (1310),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 286/525 (54%), Positives = 351/525 (67%), Gaps = 27/525 (5%)
 Frame = +2

Query  593   ESSELS-RRWWIGPM----ATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVL  757
             E+SE S RR WIGP      T SV  RL+QA+ ++KD +RDKDVLIQIWVPV R  + VL
Sbjct  94    ENSETSPRRLWIGPNINPNPTLSVKKRLVQAIEHLKDSTRDKDVLIQIWVPVKRGDKHVL  153

Query  758   VTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFK  937
             +T +QP+ L+     L  YR +S NY+F  E+DS E VGLPGRVFL K+PEWTPDV+ FK
Sbjct  154   ITNNQPYFLNPNFQSLVEYRYVSQNYQFAAEKDSNELVGLPGRVFLKKLPEWTPDVRFFK  213

Query  938   REEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEV  1117
             REEYPRV HA +Y+VRG+ AVPVF+ GS TCLGV+E+V TTQK  Y  EL+ VCKALE V
Sbjct  214   REEYPRVNHAHQYNVRGSIAVPVFETGSGTCLGVVEIVTTTQKTHYHPELEDVCKALEAV  273

Query  1118  DLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHS  1294
             +LR S ISN   +K C+ SY   L EI  +L   C THKLPLAQTW PC+QQGK G   S
Sbjct  274   NLRSSGISNPAKIKDCNESYLAALAEIQYILTCVCDTHKLPLAQTWAPCIQQGKGGCLQS  333

Query  1295  DENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFS  1474
             DEN   CV+TVD ACY+ DP++  FH ACSEHHLLKG GV G AF TNQPCF+ DIT+FS
Sbjct  334   DENSASCVTTVDEACYVRDPQVLPFHYACSEHHLLKGEGVAGGAFNTNQPCFATDITAFS  393

Query  1475  KTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIII  1654
             KTEYPLSH+AR+F L +AVAIRLRS  TGS DFVLEFFLP DCK+ E+ K+ML+SLS +I
Sbjct  394   KTEYPLSHHARMFGLCSAVAIRLRSIYTGSADFVLEFFLPLDCKNTEDQKQMLSSLSSVI  453

Query  1655  QNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSP  1834
             Q  C++LRVVT+QEL EE      +    S    H+EV + K  S     E+  SW S  
Sbjct  454   QQSCRSLRVVTDQELLEEKELLQREKVSLSAGESHEEV-SRKPVSPPYRDEDASSWLSQM  512

Query  1835  MLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLS--------FDSTSGEGSAQN----  1978
               VQ      +A   E+  ++   R  E +  S  S        F    G G + +    
Sbjct  513   TDVQRKG-KGAAISQEENFKVTANRWRESIHASTYSEPNQIQDNFGPKGGYGGSLDFSSG  571

Query  1979  -------VRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                     +RAG++KR K EK+I+LQ+L+QYFAGSLKDAAK++GV
Sbjct  572   TGSHSSGAKRAGERKRSKTEKSISLQVLRQYFAGSLKDAAKNIGV  616



>emb|CDY31491.1| BnaC05g16000D [Brassica napus]
Length=703

 Score =   502 bits (1293),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 279/589 (47%), Positives = 376/589 (64%), Gaps = 62/589 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTDGSEF    PF+ ++                             S P++ SA
Sbjct  24    DGCWLETTDGSEFLNLPPFDPSSFMW--------------------------SPPQDTSA  57

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYIKDF  691
                     Q +GQ+          A+  + ++RWWIGP     +SV +RL+QA+ +IKD+
Sbjct  58    ICTSGVVSQTYGQD---------CADEFQYNKRWWIGPGGGGGSSVTERLVQAVEHIKDY  108

Query  692   SRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQEN  868
             + ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+  
Sbjct  109   TTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDSKAL  168

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
              GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVIEV
Sbjct  169   AGLPGRVFLGKLPEWTPDVRFFKSEEYPRVQHAQDCDVRGTLAIPVFEQGSKICLGVIEV  228

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACAT  1225
             V+TT+ VK + EL+S+C+AL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC T
Sbjct  229   VMTTEMVKLKPELESICRALQAVDLRSTELPVPPSLKGCDLSYKAALPEIRNLLRCACET  288

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             HKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ F EACSEHHLLKG
Sbjct  289   HKLPLAQTWVSCLQQSKSGCRHNDENYIHCVSTIDEACYLGDPTVREFQEACSEHHLLKG  348

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              GV G+AF+TN PCFS D+ ++ K+EYPLSH+A +F L  AVAIRLR   TG  DFVLEF
Sbjct  349   QGVAGQAFLTNGPCFSPDVANYKKSEYPLSHHANMFGLHGAVAIRLRCIHTGDADFVLEF  408

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP+DC +  E ++ML +LS I+ +V ++LR VT++ELEEE+     +      +   + 
Sbjct  409   FLPKDCDNMGEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVVEREEVVTPKV---EN  465

Query  1766  VPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSF  1945
              P L +++   P   GL +     L  +                  KR  ++   + ++ 
Sbjct  466   TPELHHSN---PQNLGLVFDGGDKLPNDG--------------FGLKRGYDYTRDANINE  508

Query  1946  DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              +T   G   ++    +KKR KA+KTITL +L+QYFAGSLKDAAKS+GV
Sbjct  509   SNTFTIGGFNSM---AEKKRTKADKTITLDVLRQYFAGSLKDAAKSIGV  554



>ref|XP_002890396.1| RWP-RK domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66655.1| RWP-RK domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=842

 Score =   506 bits (1302),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 289/594 (49%), Positives = 383/594 (64%), Gaps = 46/594 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNAN-ALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGSEF   +P  ++ + F+PS  +     +   L     V            
Sbjct  24    DGCWLETTDGSEFLNIAPSTSSVSPFDPSSFMWSPTQDTSALCTSGVVS-----------  72

Query  515   ASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGP-MATTSVMDRLIQALGYIKDF  691
                      Q +GQ   + V  S L E  + ++RWWIGP    +SV +RL+QA+ YIKD+
Sbjct  73    ---------QMYGQ---DCVERSSLDE-FQWNKRWWIGPGGGGSSVTERLVQAVEYIKDY  119

Query  692   SRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQEN  868
             + ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+ Y+F  E +DS+  
Sbjct  120   TTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPLCQRLANYREISVKYQFSAEQDDSKAL  179

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
              GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ   VRGT A+PVF+QGS+ CLGVIEV
Sbjct  180   TGLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCGVRGTLAIPVFEQGSKICLGVIEV  239

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACAT  1225
             V+TT+ VK R EL+S+C+AL+ VDLR +++     +K C  SYQ  LPEI  +L+ AC T
Sbjct  240   VMTTEMVKLRPELESICRALQAVDLRSTELPIPPTLKGCDLSYQAALPEIRNLLRCACET  299

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             HKLPLAQTWV C QQ K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHLLKG
Sbjct  300   HKLPLAQTWVSCQQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHLLKG  359

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              GV G+AF+TN PCFS+D++++ K+EYPLSH+A ++ L  AVAIRLR   TG  DFVLEF
Sbjct  360   QGVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGPADFVLEF  419

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP++C   EE + ML +LS I+ +V ++LR VT++ELEEE+     +      I    E
Sbjct  420   FLPKECDDLEEQRTMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEIVTPKIENASE  479

Query  1766  V-PNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSE-LLYKRLPEFVSGSGL  1939
             +  N  +N+S+   +   + TS+P  +         F   +P +    KR      G   
Sbjct  480   LHGNSPWNASLEEIQRSNN-TSNPQNL------GLVFDGGEPHDGFGLKR------GFDY  526

Query  1940  SFDSTSGEGSAQNVRRA---GDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             + DS   E S  +        +KKR KA+KTITL +L+QYFAGSLKDAAK++GV
Sbjct  527   TMDSNVNESSTFSSGGFSMMAEKKRTKADKTITLDVLRQYFAGSLKDAAKNIGV  580



>gb|EPS69544.1| hypothetical protein M569_05222, partial [Genlisea aurea]
Length=661

 Score =   498 bits (1282),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 269/495 (54%), Positives = 336/495 (68%), Gaps = 49/495 (10%)
 Frame = +2

Query  617   WWIGPMAT-TSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDG-RRVLVTGDQPFQLDL  790
             W   PMA+ T V+DRLIQAL +I++ + D   LIQ+WVPV+R G  RVL T DQPF L  
Sbjct  1     WIDPPMASPTPVVDRLIQALSHIRNSTTDAK-LIQVWVPVDRGGGERVLTTNDQPFSLHP  59

Query  791   KCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQ  970
              CP LAHYR+IS++Y FP E+DS+  +GLPGRVF  +VPEWTPDV+ F  +EYPR+ HA+
Sbjct  60    GCPSLAHYREISVDYHFPAEDDSEGVLGLPGRVFRSRVPEWTPDVRFFTWDEYPRIVHAR  119

Query  971   RYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVR  1150
             +YDVRG+  VPV ++GSR+CLGV+EVVLTTQK++YR EL+SVCKALE V+LR  ++S+  
Sbjct  120   KYDVRGSLVVPVLEEGSRSCLGVVEVVLTTQKIRYRPELESVCKALEAVNLRAVELSSSS  179

Query  1151  NVKTCHS-YQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTV  1327
             NV T  S YQ  LPEIL VL+SAC  H LPLAQTWV C+ QGK+G RHS++N+  CVS V
Sbjct  180   NVNTSDSTYQAALPEILHVLRSACFDHSLPLAQTWVSCISQGKQGCRHSNDNVKNCVSPV  239

Query  1328  DSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYAR  1507
             +SAC I DP I+GFHEACSE+HLLKGLGVVGRAF TN+PCFS D+TS SKTEYPLSHYA+
Sbjct  240   ESACCIFDPHIRGFHEACSEYHLLKGLGVVGRAFNTNKPCFSNDVTSCSKTEYPLSHYAK  299

Query  1508  IFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvt  1687
             +F L+ AVAIRLRS  TGSTDFVLEFFLP +C+   E K++L SLS  +Q+ C     V 
Sbjct  300   MFGLKGAVAIRLRSASTGSTDFVLEFFLPVNCEDSAEQKKLLISLSKTVQD-CSQTLYVV  358

Query  1688  eqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS  1867
               E    T    SK+A    +  H+E                               SSS
Sbjct  359   TDEETNYTVINESKIAAAQSMANHQE------------------------------SSSS  388

Query  1868  AFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQ  2047
              F+      L  K    FV      F  ++ E  A N  R  +K+R+KAEK ITLQ L+Q
Sbjct  389   TFK------LGSKYDYTFV------FSGSTSETLATN--RKKEKRRIKAEKAITLQDLRQ  434

Query  2048  YFAGSLKDAAKSLGV  2092
             +FAG+LK+AA++LGV
Sbjct  435   HFAGTLKEAARNLGV  449



>ref|XP_009149543.1| PREDICTED: protein NLP4 [Brassica rapa]
 ref|XP_009149544.1| PREDICTED: protein NLP4 [Brassica rapa]
 ref|XP_009149545.1| PREDICTED: protein NLP4 [Brassica rapa]
Length=817

 Score =   502 bits (1293),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 287/592 (48%), Positives = 380/592 (64%), Gaps = 64/592 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTDGSEF    P   +  F+PS  +                       P     
Sbjct  24    DGCWLETTDGSEFLNLPP---STPFDPSSFMWS---------------------PPTQDT  59

Query  518   SQFHTERV--QCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYIK  685
             S   T  V  Q +GQ+          A+  + ++RWWIGP     +SV +RL+QA+ +IK
Sbjct  60    SAICTSGVVSQTYGQD---------CADEFQWNKRWWIGPGGGGGSSVTERLVQAVEHIK  110

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQ  862
             D++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+
Sbjct  111   DYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDSK  170

Query  863   ENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVI  1042
                GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVI
Sbjct  171   ALAGLPGRVFLGKLPEWTPDVRFFKSEEYPRVQHAQDCDVRGTLAIPVFEQGSKICLGVI  230

Query  1043  EVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSAC  1219
             EVV+TT+ VK + EL+S+C+AL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC
Sbjct  231   EVVMTTEMVKLKPELESICRALQAVDLRSTELPVPPSLKGCDLSYKAALPEIRNLLRCAC  290

Query  1220  ATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLL  1399
              THKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ F EACSEHHLL
Sbjct  291   ETHKLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIDDACYLGDPTVREFQEACSEHHLL  350

Query  1400  KGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVL  1579
             KG GV G+AF+TN PCFS D++++ K+EYPLSH+A +F L  AVAIRLR   TG  DFVL
Sbjct  351   KGQGVAGQAFLTNGPCFSPDVSNYKKSEYPLSHHANMFGLHGAVAIRLRCIHTGDADFVL  410

Query  1580  EFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIH  1759
             EFFLP+DC + EE +RML +LS I+ +V ++LR VT++ELEEE+     +      I   
Sbjct  411   EFFLPKDCDNMEEQRRMLNALSTIMAHVPRSLRTVTDKELEEESEVVEREEVVTPKIENT  470

Query  1760  KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSE-LLYKRLPEFVSGSG  1936
              E+    ++S+  P   GL +     L               PS+    KR  ++   S 
Sbjct  471   SEL----HHSN--PQNLGLVFDGGDKL---------------PSDGFGLKRGYDYTRESN  509

Query  1937  LSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             ++  +T   G   ++    +KKR KA+KTITL +L+QYFAGSLKDAAKS+GV
Sbjct  510   INESNTFTSGGFNSM---AEKKRTKADKTITLDVLRQYFAGSLKDAAKSIGV  558



>emb|CDY29516.1| BnaA06g14540D [Brassica napus]
Length=814

 Score =   502 bits (1292),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 285/591 (48%), Positives = 378/591 (64%), Gaps = 62/591 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTDGSEF    P   +  F+PS  +                       P     
Sbjct  24    DGCWLETTDGSEFLNLPP---STPFDPSSFMWS---------------------PPTQDT  59

Query  518   SQFHTERV--QCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT--TSVMDRLIQALGYIK  685
             S   T  V  Q +GQ+          A+  + ++RWWIGP     +SV +RL+QA+ +IK
Sbjct  60    SAICTSGVVSQTYGQD---------CADEFQWNKRWWIGPGGGGGSSVTERLVQAVEHIK  110

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQ  862
             D++ ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+
Sbjct  111   DYTTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPMCQRLANYREISVNYHFSAEQDDSK  170

Query  863   ENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVI  1042
                GLPGRVFLGK+PEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVI
Sbjct  171   ALAGLPGRVFLGKLPEWTPDVRFFKSEEYPRVQHAQDCDVRGTLAIPVFEQGSKICLGVI  230

Query  1043  EVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSAC  1219
             EVV+TT+ VK + EL+S+C+AL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC
Sbjct  231   EVVMTTEMVKLKPELESICRALQAVDLRSTELPVPPSLKGCDLSYKAALPEIRNLLRCAC  290

Query  1220  ATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLL  1399
              THKLPLAQTWV C+QQ K G RH+DEN + CVST+D ACY+ DP ++ F EACSEHHLL
Sbjct  291   ETHKLPLAQTWVSCLQQNKSGCRHNDENYIHCVSTIDDACYLGDPTVREFQEACSEHHLL  350

Query  1400  KGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVL  1579
             KG GV G+AF+TN PCFS D++++ K+EYPLSH+A +F L  AVAIRLR   TG  DFVL
Sbjct  351   KGQGVAGQAFLTNGPCFSPDVSNYKKSEYPLSHHANMFGLHGAVAIRLRCIHTGDADFVL  410

Query  1580  EFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIH  1759
             EFFLP+DC + EE +RML +LS I+ +V ++LR VT++ELEEE+     +      I   
Sbjct  411   EFFLPKDCDNMEEQRRMLNALSTIMAHVPRSLRTVTDKELEEESEVVEREEVVTPKIENT  470

Query  1760  KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGL  1939
              E+    ++S+  P   GL +     L  +                  KR  ++   S +
Sbjct  471   SEL----HHSN--PQNLGLVFDGGDKLPNDG--------------FGLKRGYDYTRESNI  510

Query  1940  SFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             +  +T   G   ++    +KKR KA+KTITL +L+QYFAGSLKDAAKS+GV
Sbjct  511   NESNTFTSGGFNSM---AEKKRTKADKTITLDVLRQYFAGSLKDAAKSIGV  558



>ref|XP_009392335.1| PREDICTED: protein NLP1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009392336.1| PREDICTED: protein NLP1-like [Musa acuminata subsp. malaccensis]
Length=974

 Score =   504 bits (1299),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 294/650 (45%), Positives = 397/650 (61%), Gaps = 88/650 (14%)
 Frame = +2

Query  347   WLETTDGSEFFQ------HSPFNA---NALFEPSYVLPD---LEPNNGELMKESEV----  478
             W+E  D  +  Q       SPFN+   + LFE S   P+   L+  N + +  S V    
Sbjct  54    WMEFPDCPDALQAGTPDSMSPFNSLSFSPLFEVSNSSPNPDRLDGCNQDDIGRSVVSTCP  113

Query  479   ---ERKKSSLPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATT-S  646
                E +  ++ +  S +     R+     +G   +CS+  + SS     WWI P  +  S
Sbjct  114   PPDETRAENIDKKQSLNPSSVRRIMLSVDSGD--LCST--SPSSAPGTSWWIQPRESNFS  169

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             V ++ +QAL YIK+  R+ D L+Q+WVPV R G+ +L T  QPF L+ KC +L +YR++S
Sbjct  170   VKEKFMQALDYIKENQREGDALVQLWVPVKRGGQLILTTYSQPFLLNRKCEKLVNYREVS  229

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             +NY+F  EE+S + +GLPGRVFLG +PEWTPDV+LF   EYPRV +AQR D+RG+ A+PV
Sbjct  230   VNYQFSTEENSGKALGLPGRVFLGGLPEWTPDVRLFSSYEYPRVDYAQRLDIRGSIALPV  289

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCHSYQVV  1183
             FDQG+R+CLGV+EVV+TTQK+ Y  EL ++C AL+ VDLR S++++V   K +  SYQ  
Sbjct  290   FDQGNRSCLGVVEVVMTTQKINYTYELQNICSALQAVDLRSSEVASVPRFKVSSGSYQAA  349

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQ  1363
             LPEILEVLK+ C  H LPLAQTW+PC+QQGK+G+RHSDEN   CVST D  C + DP + 
Sbjct  350   LPEILEVLKAVCRMHMLPLAQTWIPCIQQGKKGIRHSDENYGYCVSTCDDVCCVNDPSMT  409

Query  1364  GFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRL  1543
             GFHEACSEHHLL+G GV GRAF TNQPCF +D+T+ SKTEYPLSHYA++F L+ AVAIRL
Sbjct  410   GFHEACSEHHLLRGQGVAGRAFTTNQPCFVSDVTASSKTEYPLSHYAKMFGLRGAVAIRL  469

Query  1544  RSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPS  1723
             RS  TG+ DFVLEFFLP +C   EE KRML SLS  IQ VCQTLRVVT           S
Sbjct  470   RSILTGNADFVLEFFLPANCILIEEQKRMLNSLSGTIQQVCQTLRVVT-----------S  518

Query  1724  SKVAKHSDIRIHKEVPN---LKYNSSIGP---CEEGLSWTSSPMLVQE-------SCMSS  1864
              ++A  + +++ + +PN    K +S   P   C+   S  +    V E       S M  
Sbjct  519   KELADEAMLQVSETIPNSWLAKSSSEAEPGQKCDTDTSLEAHKTGVYENTPPWFTSAMGD  578

Query  1865  S------AFQNEK-------------------PSELLYKRLPEFVSG---------SGLS  1942
             S       F+ +K                   P+E +  +L +   G         +  +
Sbjct  579   SNKKISHVFEFKKHGVERFSITTDRDHTEVVLPAEKISSKLRQHEQGFAKDISDNENSFN  638

Query  1943  FDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             FDS+  E +     R  +K+R K EKT++L++L++YFAGSLKDAAK +GV
Sbjct  639   FDSSCSEAT-----RTTEKRRRKTEKTVSLEVLRKYFAGSLKDAAKGIGV  683



>emb|CDY31876.1| BnaC07g15260D [Brassica napus]
Length=769

 Score =   498 bits (1281),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 271/591 (46%), Positives = 368/591 (62%), Gaps = 89/591 (15%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANA-LFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGS+F   +PF+ ++ ++ P+                           ++ S
Sbjct  24    DGCWLETTDGSDFLNLTPFDPSSFIWSPT---------------------------QDTS  56

Query  515   ASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA-TTSVMDRLIQALGYIKDF  691
             A   H      +GQ+ +     S L E  + ++RWWIGP    +SV +RL+QA+ +I+D+
Sbjct  57    ALVSHM-----YGQDCAE---RSSL-EDFQWNKRWWIGPGGGASSVTERLVQAVEHIRDY  107

Query  692   SRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQEN  868
             + ++  LIQ+WVPVNR G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+  
Sbjct  108   TTERGSLIQLWVPVNRGGKRVLTTKEQPFSHDPLCQRLANYREISVNYHFSAEQDDSKAL  167

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
              GLPGRVFLGK+PEWTPDV+ F+ EEYPRV HAQ   VRGT A+PVF+QGS+ CLGVIEV
Sbjct  168   AGLPGRVFLGKLPEWTPDVRFFRSEEYPRVQHAQDCGVRGTLAIPVFEQGSKICLGVIEV  227

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACAT  1225
             V+TT+ VK R EL+S+C+AL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC T
Sbjct  228   VMTTEMVKLRPELESICRALQAVDLRSTEVPIQPSLKGCDLSYKAALPEIQNLLRCACET  287

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             H LPLAQTWV C+QQ K G RH+DEN + C+ST+D ACY+ DP +  FHEACSEHHLLKG
Sbjct  288   HNLPLAQTWVSCLQQTKTGCRHNDENYIHCISTIDDACYVGDPTVLEFHEACSEHHLLKG  347

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              GV G+AF+TN PCFS D++++ K+EYPLSH+A +F L  AVAIRLR   TGS DF+LEF
Sbjct  348   QGVAGQAFLTNGPCFSTDVSNYKKSEYPLSHHANMFGLHGAVAIRLRCVHTGSADFILEF  407

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP++C   EE ++ML +LS I+ +V                  P S +   +D  + +E
Sbjct  408   FLPKECDDVEEQRKMLDALSSIMAHV------------------PRS-LRTVTDKELEEE  448

Query  1766  VPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQ-NEKPSELL-YKRLPEFVSGSGL  1939
                                  S ++V     ++  F   +KP+++   KR  E+ S    
Sbjct  449   ---------------------SEVIVTPKIENTLVFDGGDKPNDVFGLKRGYEYKSSESS  487

Query  1940  SFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              F       S        +KKR KA+K ITL +L+QYFAGSLKDAAKS+GV
Sbjct  488   MF-------SCGGFSSMAEKKRTKADKNITLDVLRQYFAGSLKDAAKSIGV  531



>ref|XP_008235979.1| PREDICTED: LOW QUALITY PROTEIN: protein NLP2-like [Prunus mume]
Length=942

 Score =   501 bits (1291),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 294/629 (47%), Positives = 379/629 (60%), Gaps = 59/629 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESE-----VERKKSSLP  502
             EGCWL++  G        FN     +   V P   P + +L           + + +S  
Sbjct  32    EGCWLQSNAG--------FNLLQQQQQQLVCP---PISQDLTDHPSHYFPPYDHQSNSTV  80

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLA--ESSELSRRWWIGPMA----TTSVMDRLI  664
              +LS S  H +  Q    +GS     S      ++E  RR WIGP A    ++SV +RL+
Sbjct  81    AHLSMSP-HQQIYQEENTDGSYPESHSSFVVEGNTEAGRRLWIGPRANPGPSSSVKERLM  139

Query  665   QALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFP  844
              A+GY+K+ ++ +DVLIQIWVP+ R GR+ L T DQP  LD  C  LA YR++S +Y+F 
Sbjct  140   LAIGYVKECTKGRDVLIQIWVPIKRGGRQYLTTHDQPLSLDPNCKSLAGYRNVSKDYQFI  199

Query  845   VEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSR  1024
              EEDS E+VGLP R FLGK+ EWTPDV  F+  EYPR+ +AQ+YDVRG+ A+P+F+ GS 
Sbjct  200   TEEDSAESVGLPSRAFLGKLLEWTPDVCFFRSYEYPRIDYAQQYDVRGSLALPIFENGSG  259

Query  1025  TCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILE  1201
             TCLGV E+V+T QKV YR EL+ VC+ALE VDLR S+      VKT    +Q  L EI+E
Sbjct  260   TCLGVFEIVMTPQKVNYRPELEYVCQALETVDLRSSQNFWPLCVKTRDELFQAALTEIVE  319

Query  1202  VLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEAC  1381
             VL S C TH+LPLAQTW  C+QQGK G RHSDEN   CVSTVD+AC++AD  I GFHEAC
Sbjct  320   VLASVCKTHRLPLAQTWALCIQQGKGGCRHSDENYAHCVSTVDAACFVADLDILGFHEAC  379

Query  1382  SEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTG  1561
             SEHHL +G G+VG AF  N+PCF+ DI +FSKTEYPLSH+AR+F L +AVAI  RS  TG
Sbjct  380   SEHHLFQGQGIVGTAFTINKPCFATDIKAFSKTEYPLSHHARMFGLHSAVAIPFRSVYTG  439

Query  1562  STDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKH  1741
               D VLEFFLP+DC+ PEE K+ML SL I+IQ  C++L V  ++ELEEE   P  +    
Sbjct  440   PADLVLEFFLPKDCQDPEEQKQMLNSLCIVIQQACRSLHVNVDKELEEEIMFPIREPVIG  499

Query  1742  SDIRIHKEVPNLKYNSSIGPCEEG----LSWTSSPMLVQESCMSSSA---FQNEKPSE--  1894
             SD  +HKE      +S   P EE      SW +  +  Q+     S    +Q E+P E  
Sbjct  500   SDGGLHKEETQRLISS---PTEEQSGKESSWIAHMIEAQQKGKGVSVSLDYQTEEPKEEF  556

Query  1895  ----------------LLYKRLPEFVSGSGLSFDSTSGEGS-------AQNVRRAGDKKR  2005
                              ++    +    SG   +   G  S           R+AG+K+R
Sbjct  557   KVTTHWGNTQGSLHSGQVFSEFGQLHQSSGSHGNVEGGADSYSFGGRRTSGGRKAGEKRR  616

Query  2006  MKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              K EKTI+L +LQQYFAGSLKDAAKS+GV
Sbjct  617   TKTEKTISLPVLQQYFAGSLKDAAKSIGV  645



>gb|KDO68320.1| hypothetical protein CISIN_1g004975mg [Citrus sinensis]
 gb|KDO68321.1| hypothetical protein CISIN_1g004975mg [Citrus sinensis]
 gb|KDO68322.1| hypothetical protein CISIN_1g004975mg [Citrus sinensis]
 gb|KDO68323.1| hypothetical protein CISIN_1g004975mg [Citrus sinensis]
 gb|KDO68324.1| hypothetical protein CISIN_1g004975mg [Citrus sinensis]
 gb|KDO68325.1| hypothetical protein CISIN_1g004975mg [Citrus sinensis]
Length=721

 Score =   493 bits (1268),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 289/632 (46%), Positives = 376/632 (59%), Gaps = 59/632 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGEL------MKESEVERKKSSL  499
             +GCWLETTD  +F Q  P ++    + S  LP  E   G L       ++   E  K+  
Sbjct  31    DGCWLETTDALDFLQPGPSSSGPADDTSQYLPYSEGTTGHLSMNLNPQQQVYQEETKNKF  90

Query  500   PENLSASQFHTERVQ---CFGQNGSNAVCSSG-----LAESSELSRRWWIGPMATT----  643
              EN S      E +Q        G +   SSG     LA+ +EL RRWWIGP   T    
Sbjct  91    TENPSLVYPKIEEIQDTRTQDHQGFDPATSSGQSGSFLAQGNELGRRWWIGPRENTGHSS  150

Query  644   SVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDI  823
             SV DRL+QA+ Y+KD+ +D   L+QIWVP+N  G+++L T DQP+ LD     L  YR++
Sbjct  151   SVKDRLMQAIIYLKDYIKDGKALVQIWVPINSGGKQLLTTDDQPYSLDPNSKSLESYRNV  210

Query  824   SINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
             S  Y F  +EDS+E VGLPGRVF  + PEWTPDV  F+ EEYPRV HAQ+YDV G+ A+P
Sbjct  211   STTYHFAADEDSKEFVGLPGRVFREQSPEWTPDVLFFRSEEYPRVNHAQQYDVHGSLALP  270

Query  1004  VFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQV  1180
             VF++GS  CLGV+EVV T++K+ YR +L++VCKALE VDLR S   +   VK  +  Y  
Sbjct  271   VFERGSGACLGVVEVVTTSRKINYRLDLENVCKALEAVDLRSSGNFSTSCVKARNELYHA  330

Query  1181  VLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRI  1360
              +PEI EVL+S C THKLPLA TW PCVQ  K   + SDEN   C  TVDSAC++A+  +
Sbjct  331   AMPEIAEVLRSVCKTHKLPLALTWAPCVQGRKVECQQSDENFPHCFLTVDSACFVANENL  390

Query  1361  QGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIR  1540
              GF  ACSE  LL+G G+VG+AF  ++ CF+ADIT+FSK+ YPLSH AR+F L+AAVAI 
Sbjct  391   SGFFVACSEQQLLQGQGIVGKAFSLSKQCFTADITAFSKSNYPLSHLARMFGLRAAVAIP  450

Query  1541  LRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP  1720
             LRS  TG  +F+LEFFLPR+C+  EE K+M+ SLS+ +Q VCQ+LR+  E+ELE     P
Sbjct  451   LRSITTGVVEFILEFFLPRECQDIEEQKQMVKSLSVAMQQVCQSLRLAMEKELEVVIL-P  509

Query  1721  SSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQE--SCMSSSAFQNEKPSE  1894
               ++A  SD            + S    +E  SW S  +  Q+    +S S    E+P E
Sbjct  510   VGEMAVTSD----------GSSPSKETSQEQSSWISHMIEAQQKGKGVSVSWDHQEEPKE  559

Query  1895  LLYKRL-----------PEFVSGSGLSFDSTSGEGSAQNV---------------RRAGD  1996
                               E   G G  F   SG  S+                  R+AG+
Sbjct  560   EFKMTTHWDDARAESFHKEVFPGFG-QFQHNSGAKSSVEGGGDSSSLGGHLSVGSRKAGE  618

Query  1997  KKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             K+R K EKTI+LQ+L+QYFAGSLKDAAKS+GV
Sbjct  619   KRRTKTEKTISLQVLRQYFAGSLKDAAKSIGV  650



>ref|XP_009106295.1| PREDICTED: protein NLP5 isoform X2 [Brassica rapa]
Length=792

 Score =   494 bits (1273),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 284/598 (47%), Positives = 370/598 (62%), Gaps = 66/598 (11%)
 Frame = +2

Query  338   EGCWLETT--DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETT  D SEF   SP  + A F+PS  +   + +N   +  S             
Sbjct  12    DGCWLETTTTDASEFPNFSPSTSLAPFDPSSFMWSPQQDNTAAISSS-------------  58

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTS---VMDRLIQALGYI  682
                   T     +GQ  +     S L + S L+RR+WIGP        VM+RL+QA+ +I
Sbjct  59    ------TTLSHMYGQGFAE---RSSLEDLSTLNRRFWIGPSGGGHGSSVMERLVQAVKHI  109

Query  683   KDFSRDK-DVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED-  856
             KDF+ ++ D LIQ+WVPV+R G+RVL T +QPF  D    RLAHYR+IS NY+F  E++ 
Sbjct  110   KDFTSERGDSLIQLWVPVDRGGKRVLTTKEQPFSHDPMSQRLAHYREISENYQFSAEQED  169

Query  857   --SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
               S++ VGLPGRVFLG+VPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+TC
Sbjct  170   SSSKDLVGLPGRVFLGQVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSKTC  229

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVL  1207
             LGVIEVV+TTQ VK   ELDS+C+AL+ VDLR +++    ++K    SYQ  LPEI  +L
Sbjct  230   LGVIEVVMTTQMVKLSPELDSICRALQAVDLRSTEVPVSPSLKGPDFSYQAALPEIRNLL  289

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
             + AC THKLPLAQTW+ C++Q K G RH+D N + CVST+D ACY+ DP ++ FHEACSE
Sbjct  290   RCACETHKLPLAQTWMSCLKQSKTGCRHNDHNYIHCVSTIDDACYVGDPTVRDFHEACSE  349

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLLKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS 
Sbjct  350   HHLLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSA  409

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             DFVLEFFLP+DC+  EE +RML +LS I+ +V +               + + K  +   
Sbjct  410   DFVLEFFLPKDCRDIEEQRRMLNALSTIMAHVPR------------SLRTVTEKELEEEG  457

Query  1748  IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVS  1927
              ++  EV  L                     ++E+C    +  N +   L       F  
Sbjct  458   DQMVSEVETLPK-------------------IEETCEVHESSSNPQHVGLAVDGEIGFDY  498

Query  1928  GSGLSF---DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             G G+S    +ST          R  +KK+ KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  499   GKGVSVVNENSTFSSAGGGGSSRVTEKKKTKAEKNITLDVLRQYFAGSLKDAAKSIGV  556



>ref|XP_009106294.1| PREDICTED: protein NLP5 isoform X1 [Brassica rapa]
Length=804

 Score =   495 bits (1274),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 287/598 (48%), Positives = 373/598 (62%), Gaps = 66/598 (11%)
 Frame = +2

Query  338   EGCWLETT--DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETT  D SEF   SP  + A F+PS  +   + +N   +  S             
Sbjct  24    DGCWLETTTTDASEFPNFSPSTSLAPFDPSSFMWSPQQDNTAAISSS-------------  70

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTS---VMDRLIQALGYI  682
                   T     +GQ  +     S L + S L+RR+WIGP        VM+RL+QA+ +I
Sbjct  71    ------TTLSHMYGQGFAE---RSSLEDLSTLNRRFWIGPSGGGHGSSVMERLVQAVKHI  121

Query  683   KDFSRDK-DVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED-  856
             KDF+ ++ D LIQ+WVPV+R G+RVL T +QPF  D    RLAHYR+IS NY+F  E++ 
Sbjct  122   KDFTSERGDSLIQLWVPVDRGGKRVLTTKEQPFSHDPMSQRLAHYREISENYQFSAEQED  181

Query  857   --SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
               S++ VGLPGRVFLG+VPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+TC
Sbjct  182   SSSKDLVGLPGRVFLGQVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSKTC  241

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVL  1207
             LGVIEVV+TTQ VK   ELDS+C+AL+ VDLR +++    ++K    SYQ  LPEI  +L
Sbjct  242   LGVIEVVMTTQMVKLSPELDSICRALQAVDLRSTEVPVSPSLKGPDFSYQAALPEIRNLL  301

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
             + AC THKLPLAQTW+ C++Q K G RH+D N + CVST+D ACY+ DP ++ FHEACSE
Sbjct  302   RCACETHKLPLAQTWMSCLKQSKTGCRHNDHNYIHCVSTIDDACYVGDPTVRDFHEACSE  361

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLLKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS 
Sbjct  362   HHLLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSA  421

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             DFVLEFFLP+DC+  EE +RML +LS I+ +V ++LR V            + K  +   
Sbjct  422   DFVLEFFLPKDCRDIEEQRRMLNALSTIMAHVPRSLRTV------------TEKELEEEG  469

Query  1748  IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVS  1927
              ++  EV  L                     ++E+C    +  N +   L       F  
Sbjct  470   DQMVSEVETLPK-------------------IEETCEVHESSSNPQHVGLAVDGEIGFDY  510

Query  1928  GSGLSF---DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             G G+S    +ST          R  +KK+ KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  511   GKGVSVVNENSTFSSAGGGGSSRVTEKKKTKAEKNITLDVLRQYFAGSLKDAAKSIGV  568



>emb|CDX87610.1| BnaA07g32630D [Brassica napus]
Length=802

 Score =   494 bits (1272),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 294/599 (49%), Positives = 380/599 (63%), Gaps = 70/599 (12%)
 Frame = +2

Query  338   EGCWLETT--DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETT  D SEF   SP  + A F+PS  +   + +N   +  S +           
Sbjct  24    DGCWLETTTTDASEFPNFSPSTSLAPFDPSSFMWSPQQDNTAAISSSTLS----------  73

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTS---VMDRLIQALGYI  682
                         +GQ  +     S L + S L+RR+WIGP        VM+RL+QA+ +I
Sbjct  74    ----------HMYGQGFAE---RSSLEDLSTLNRRFWIGPSGGGHGSSVMERLVQAVKHI  120

Query  683   KDFSRDK-DVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED-  856
             KDF+ ++ D LIQ+WVPV+R G+RVL T +QPF  D    RLAHYR+IS NY+F  E++ 
Sbjct  121   KDFTSERGDSLIQLWVPVDRGGKRVLTTKEQPFSHDPMSQRLAHYREISENYQFSAEQED  180

Query  857   --SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
               S++ VGLPGRVFLG+VPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+TC
Sbjct  181   SSSKDLVGLPGRVFLGQVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSKTC  240

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVL  1207
             LGVIEVV+TTQ VK   ELDS+C+AL+ VDLR +++    ++K    SYQ  LPEI  +L
Sbjct  241   LGVIEVVMTTQMVKLSPELDSICRALQAVDLRSTEVPVSPSLKGPDFSYQAALPEIRNLL  300

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
             + AC THKLPLAQTW+ C++Q K G RH+D N + CVST+D ACY+ DP ++ FHEACSE
Sbjct  301   RCACETHKLPLAQTWMSCLKQSKTGCRHNDHNYIHCVSTIDDACYVGDPTVREFHEACSE  360

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLLKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS 
Sbjct  361   HHLLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSA  420

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             DFVLEFFLP+DC+  EE +RML +LS I+ +V ++LR VTE+ELEEE     S+V     
Sbjct  421   DFVLEFFLPKDCRDIEEQRRMLNALSTIMAHVPRSLRTVTEKELEEEGDQMVSEVETLPK  480

Query  1748  I----RIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLP  1915
             I     +H+   N ++       E G  +     +V E+   SSA               
Sbjct  481   IEETCEVHESNSNPQHVGLSVDGEIGFDYGKGVSVVNENSTFSSA---------------  525

Query  1916  EFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                           G GS+    R  +KK+ KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  526   --------------GGGSS----RVTEKKKTKAEKNITLDVLRQYFAGSLKDAAKSIGV  566



>gb|KHG15132.1| Protein NLP5 -like protein [Gossypium arboreum]
Length=881

 Score =   493 bits (1270),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 280/600 (47%), Positives = 367/600 (61%), Gaps = 62/600 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPN------NGELMKESEVERKKS-S  496
             EGCWLET+DG  F Q +P  +       +  P    N      N   M + E + + + S
Sbjct  34    EGCWLETSDGFNFMQPTPSTSTPS---PHCFPVSGSNTFPFTINPHQMHQGETDMQFAPS  90

Query  497   LPENLSASQFHTERVQCFGQNGSNAVCS---SGLAESSELSRRWWIGPMATT----SVMD  655
               +NLS +     R Q +G  G+ +  S   S + E +E+  RWWIGP A +    SV +
Sbjct  91    QTDNLSKT-----RSQNWGGVGNASSLSQTGSFIVEGTEMGSRWWIGPKAESGSSLSVKE  145

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             RL+QA+GY+K+ ++D+DVLIQIWVPV R+G+ VL T  QP+ ++     L  +RD+S +Y
Sbjct  146   RLMQAIGYLKESTKDRDVLIQIWVPVTREGKHVLTTEGQPYSVNTNSKSLKIFRDVSKSY  205

Query  836   EFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQ  1015
              FP EEDS ++VGLPGRVFLGK+PEWTPDV+ F+ EEYPRV  A +Y+V G+ A+PVF++
Sbjct  206   NFPAEEDSNKSVGLPGRVFLGKLPEWTPDVRFFRSEEYPRVSFALKYNVGGSLALPVFER  265

Query  1016  GSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPE  1192
              S TCLGV+EVV T QK+ Y  EL+ VCKALE VDLR S   +  NV+ C+  YQ  LPE
Sbjct  266   ASGTCLGVVEVVTTAQKINYHPELEYVCKALEAVDLRTSHNFSPPNVEACNELYQAALPE  325

Query  1193  ILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFH  1372
             I EVL+S C  +KLPLA TW PC+ QGK G RHSDEN   CVSTVD+AC++AD +  GF 
Sbjct  326   IAEVLRSVCKIYKLPLALTWAPCLSQGKSGCRHSDENYYNCVSTVDAACFVADDKFLGFL  385

Query  1373  EACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRST  1552
             EACSEHHL KG G+VGRAF T++ CF+ DIT+FSKT YPLSH+AR+F L+ A+AI L+S 
Sbjct  386   EACSEHHLFKGQGIVGRAFTTDKQCFATDITAFSKTNYPLSHHARMFKLRGALAIPLQSI  445

Query  1553  CTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKV  1732
              TG  +FVLE F P+DC   E  ++ML SLS  +Q  CQ+L VV ++ELEEE   P  + 
Sbjct  446   FTGLVEFVLELFFPKDCHESEAQQQMLNSLSSFMQQACQSLHVVMDKELEEEVILPVKEA  505

Query  1733  AKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRL  1912
                SD    KE    K +S      E  SW +  M  Q+   +      ++ +       
Sbjct  506   VVASDGISDKEEIKFKLSSPNENSPEESSWIAHMMEAQQKGKARKKAGKKRRT-------  558

Query  1913  PEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                                             K EKTI+LQ+L+QYFAGSLKDAAKS+GV
Sbjct  559   --------------------------------KMEKTISLQVLRQYFAGSLKDAAKSIGV  586



>emb|CDP14498.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   491 bits (1264),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 272/535 (51%), Positives = 351/535 (66%), Gaps = 45/535 (8%)
 Frame = +2

Query  605   LSRRWWIGPMA----TTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQ  772
             ++RR W+GP       TSV  RL+QA+ Y++  + DKD LIQIWVPV R G RVL T +Q
Sbjct  1     MNRRLWVGPTGDPTPNTSVRKRLVQAIEYLRKSTSDKDALIQIWVPVTRGGGRVLSTKNQ  60

Query  773   PFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYP  952
             PF LD  C  LA YR +S NY+F  EEDS+E VGLPGRVFL K+PEWTPDV+ FK EEYP
Sbjct  61    PFSLDPNCRSLAEYRHVSRNYQFAAEEDSKELVGLPGRVFLKKLPEWTPDVRFFKGEEYP  120

Query  953   RVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGS  1132
             RV HAQ+Y+VRG  A+PVF +GS TCLGV+E+V T QKV Y  EL+++CKALE VDL  S
Sbjct  121   RVNHAQQYNVRGCLALPVFQRGSGTCLGVVEIVSTAQKVNYGPELENICKALEAVDLSSS  180

Query  1133  KISNVRNVKTC-HSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLL  1309
              IS   N+K C  SYQ+ L +I  VLK  C  +KLPLAQTW  C++QGK G RHS+EN +
Sbjct  181   IISTSPNMKDCDESYQLALVDIRSVLKYVCDMNKLPLAQTWASCIRQGKGGCRHSEENYV  240

Query  1310  RCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYP  1489
             RCVSTVDSACY+ DP++  FH ACSEHHLLK  G+ G AFMT+QPCF+ DIT+FSKT+YP
Sbjct  241   RCVSTVDSACYVRDPQVMDFHAACSEHHLLKAEGLPGGAFMTDQPCFATDITAFSKTDYP  300

Query  1490  LSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQ  1669
             LSH+A+IF ++AAVAIR++S  T S DFVLEFFLP DC   E+ K+ML S+   +Q +C 
Sbjct  301   LSHHAKIFGMRAAVAIRVQSIYTKSADFVLEFFLPLDCTDAEDQKQMLNSIFSALQQICH  360

Query  1670  tlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLV--  1843
              L V+T+Q++ EETT P  +    S  ++ KE    K    + P +E LS ++S  +   
Sbjct  361   CLHVITDQKVREETTIPDDEKPSSSVSKLVKE----KTLGFVSPAKE-LSLSTSSWVAPA  415

Query  1844  ---------------------QESCMSSSAFQNEKPSELLYK----RLPEFVSGSGLSFD  1948
                                  +E C  ++ + N K +EL +     +L +    SGL   
Sbjct  416   LDNSGTVKDVAFSLDNHQEDPEEECKLTTQWDNNK-AELHHTPTSPKLIQIQQRSGLKGH  474

Query  1949  -------STSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                    S  G  ++   R  G ++R K EK+I+LQ L+QYF+GSLKDAAKS+GV
Sbjct  475   VVGSEDVSAVGGHNSMGDRSTGQRRRTKTEKSISLQDLRQYFSGSLKDAAKSIGV  529



>emb|CDX88264.1| BnaC06g37080D [Brassica napus]
Length=802

 Score =   489 bits (1259),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 282/597 (47%), Positives = 373/597 (62%), Gaps = 66/597 (11%)
 Frame = +2

Query  338   EGCWLETT--DGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETT  D SEF   SP  + + F+PS  +   + +N   +  S +           
Sbjct  24    DGCWLETTTTDASEFPNFSPSTSISPFDPSSFMWSPQQDNTAAISSSTLS----------  73

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTS---VMDRLIQALGYI  682
                         +GQ  +     S L + S L+RR WIGP        VM+RL+QA+ +I
Sbjct  74    ----------HMYGQGFAE---RSSLEDLSTLNRRLWIGPSGGGHGSSVMERLVQAVKHI  120

Query  683   KDFSRDK-DVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED-  856
             KDF+ ++ D LIQ+WVPV+R G+RVL T +QPF  D    RLAHYR+IS NY+F  E++ 
Sbjct  121   KDFTSERGDSLIQLWVPVDRGGKRVLTTKEQPFSHDPMSQRLAHYREISENYQFSAEQED  180

Query  857   --SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
               S++ VGLPGRVFLG+VPEWTPDV+ FK EEYPRV HAQ  DVRGT A+PVF+QGS+TC
Sbjct  181   SSSKDLVGLPGRVFLGQVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSKTC  240

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVL  1207
             +GVIEVV+TTQ VK   ELDS+C+AL+ VDLR +++    ++K    SYQ  LPEI  +L
Sbjct  241   IGVIEVVMTTQMVKLSPELDSICRALQAVDLRSTEVPVSPSLKGPDFSYQAALPEIRNLL  300

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
             + AC THKLPLAQTW+ C++Q K G RH+D N + CVST+D ACY+ DP ++ FHEACSE
Sbjct  301   RCACETHKLPLAQTWMSCLKQSKTGCRHNDHNYIHCVSTIDDACYVGDPTVREFHEACSE  360

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLLKG GVVG AF+TN PCFS+D++S+ K+EYPLSH+A +F L   VAIRLR   TGS 
Sbjct  361   HHLLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSA  420

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             DFVLEFFLP+DC+  EE +RML +LS I+ +V ++LR V            + K  +   
Sbjct  421   DFVLEFFLPKDCRDIEEQRRMLNALSTIMAHVPRSLRTV------------TEKELEEEG  468

Query  1748  IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVS  1927
              ++  EV  L                     ++E+C    +  N +   L       F  
Sbjct  469   DQMVSEVETLPK-------------------IEETCEVHGSNSNPQHVGLAVDGELGFDY  509

Query  1928  GSGLSF--DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             G G+S   ++++         R  +KK+ KAEK ITL +L+QYFAGSLKDAAKS+GV
Sbjct  510   GKGVSVVNENSTFSSGGGGSSRVTEKKKTKAEKNITLDVLRQYFAGSLKDAAKSIGV  566



>ref|XP_010534200.1| PREDICTED: protein NLP4-like [Tarenaya hassleriana]
Length=819

 Score =   489 bits (1260),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 281/597 (47%), Positives = 375/597 (63%), Gaps = 82/597 (14%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLET + SEF   SP  +   F+PS  L    P + + +  S++             
Sbjct  21    DGCWLETMEESEFLDFSPSTSINPFDPS-PLTRSPPQDTQTISSSDIS------------  67

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATT------SVMDRLIQALGY  679
                     Q F Q+ +     SGL E+ E +RRWWIGP   +      SVM+RL+QAL Y
Sbjct  68    --------QMFCQDIAE---RSGLDEA-EGNRRWWIGPTRGSPGGPGCSVMERLVQALKY  115

Query  680   IKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-ED  856
             IKDF+R++  LIQ+WVPVNR G+RVL T +QPF +D  C +LA YR+IS ++ F  E ED
Sbjct  116   IKDFTRERGSLIQLWVPVNRGGKRVLTTKEQPFAIDPICRKLASYREISESFHFSAEMED  175

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
             S+E            +PEW+PDV+ F+ EEYPRV HAQ  DVRGT A+PVF+Q S+ CLG
Sbjct  176   SKE------------IPEWSPDVRFFRSEEYPRVHHAQDCDVRGTLAIPVFEQCSKICLG  223

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKI-----SNVRNVKTCHSYQVVLPEILE  1201
             VIE+V+TTQ VK R EL+++ +AL+ VDLR +++     +  R++    SY+  LPEI  
Sbjct  224   VIEIVMTTQMVKSRPELETISRALQAVDLRSTEVPVPSPAKARDI----SYRAALPEIRN  279

Query  1202  VLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEAC  1381
             +L+ AC THKLPLAQTWV C++Q K G RH+ +N + CVSTVD AC++ DP +Q FHEAC
Sbjct  280   LLRCACETHKLPLAQTWVSCLRQDKPGCRHNIDNYVHCVSTVDDACFVFDPTVQEFHEAC  339

Query  1382  SEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTG  1561
             SEHHLLKG GV G+AF+TNQPCFS D+T F KTEYPLSH+A +F L+AAV+IRLRS  TG
Sbjct  340   SEHHLLKGQGVSGQAFLTNQPCFSPDVTVFKKTEYPLSHHATVFGLRAAVSIRLRSILTG  399

Query  1562  STDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKH  1741
             S DFVLEFFLP+ C+  EE + ML SLS I+ N+ ++LR V+++ELEEE  S   +V + 
Sbjct  400   SADFVLEFFLPKGCRDLEEQRTMLNSLSTIVANMSRSLRTVSDKELEEEAESMRGEVIER  459

Query  1742  SDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEF  1921
              ++     VP ++ N       E  SW +    ++                   ++L + 
Sbjct  460   EEM-----VPKVEDN-----LHESSSWNTESRQIKSD----------------LRKLGQV  493

Query  1922  VSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              +G G    S  GE +        +KKR K EKT+TL +L+QYFAGSLKDAAKSLGV
Sbjct  494   SNGGGA---SEIGEQNGGGFSIMAEKKRAKTEKTVTLDVLRQYFAGSLKDAAKSLGV  547



>ref|XP_006422434.1| hypothetical protein CICLE_v10027765mg [Citrus clementina]
 gb|ESR35674.1| hypothetical protein CICLE_v10027765mg [Citrus clementina]
Length=945

 Score =   493 bits (1269),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 289/632 (46%), Positives = 376/632 (59%), Gaps = 59/632 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGEL------MKESEVERKKSSL  499
             +GCWLETTD  +F Q  P ++    + S  LP  E   G L       ++   E  K+  
Sbjct  31    DGCWLETTDALDFLQPGPSSSGPADDTSQYLPYSEGTTGHLSMNVNPQQQVYQEETKNKF  90

Query  500   PENLSASQFHTERVQ---CFGQNGSNAVCSSG-----LAESSELSRRWWIGPMATT----  643
              EN S      E +Q        G +   SSG     LA+ +EL RRWWIGP   T    
Sbjct  91    TENPSLVYPKIEEIQDTRTQDHQGFDPATSSGQSGSFLAQGNELGRRWWIGPRENTGHSS  150

Query  644   SVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDI  823
             SV DRL+QA+ Y+KD+ +D   L+QIWVP+N  G+++L T DQP+ LD     L  YR++
Sbjct  151   SVKDRLMQAIIYLKDYIKDGKALVQIWVPINSGGKQLLTTDDQPYSLDPNSKSLESYRNV  210

Query  824   SINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
             S  Y F  +EDS+E VGLPGRVF  + PEWTPDV  F+ EEYPRV HAQ+YDV G+ A+P
Sbjct  211   STTYHFAADEDSKEFVGLPGRVFREQSPEWTPDVLFFRSEEYPRVNHAQQYDVHGSLALP  270

Query  1004  VFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQV  1180
             VF++GS  CLGV+EVV T++K+ YR +L++VCKALE VDLR S   +   VK  +  Y  
Sbjct  271   VFERGSGACLGVVEVVTTSRKINYRLDLENVCKALEAVDLRSSGNFSTSCVKARNELYHA  330

Query  1181  VLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRI  1360
              +PEI EVL+S C THKLPLA TW PCVQ  K   + SDEN   C  TVDSAC++A+  +
Sbjct  331   AMPEIAEVLRSVCKTHKLPLALTWAPCVQGRKVECQQSDENFPHCFLTVDSACFVANENL  390

Query  1361  QGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIR  1540
              GF  ACSE  LL+G G+VG+AF  ++ CF+ADIT+FSK+ YPLSH AR+F L+AAVAI 
Sbjct  391   SGFFVACSEQQLLQGQGIVGKAFSLSKQCFTADITAFSKSNYPLSHLARMFGLRAAVAIP  450

Query  1541  LRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP  1720
             LRS  TG  +F+LEFFLPR+C+  EE K+M+ SLS+ +Q VCQ+LR+  E+ELE     P
Sbjct  451   LRSITTGVVEFILEFFLPRECQDIEEQKQMVKSLSVAMQQVCQSLRLAMEKELEVVIL-P  509

Query  1721  SSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQE--SCMSSSAFQNEKPSE  1894
               ++A  SD            + S    +E  SW S  +  Q+    +S S    E+P E
Sbjct  510   VGEMAVTSD----------GSSPSKETSQEQSSWISHMIEAQQKGKGVSVSWDHQEEPKE  559

Query  1895  LLYKRL-----------PEFVSGSGLSFDSTSGEGSAQNV---------------RRAGD  1996
                               E   G G  F   SG  S+                  R+AG+
Sbjct  560   EFKMTTHWDDARAESFHKEVFPGFG-QFQHNSGAKSSVEGGGDSSSLGGHLSVGSRKAGE  618

Query  1997  KKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             K+R K EKTI+LQ+L+QYFAGSLKDAAKS+GV
Sbjct  619   KRRTKTEKTISLQVLRQYFAGSLKDAAKSIGV  650



>ref|XP_010028835.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 ref|XP_010028836.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 ref|XP_010028837.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 ref|XP_010028838.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 gb|KCW55665.1| hypothetical protein EUGRSUZ_I01519 [Eucalyptus grandis]
 gb|KCW55666.1| hypothetical protein EUGRSUZ_I01519 [Eucalyptus grandis]
Length=926

 Score =   493 bits (1268),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 280/614 (46%), Positives = 377/614 (61%), Gaps = 51/614 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLETTD S +    PF      E      +  P+    ++E     +K+  P   +A
Sbjct  31    EGCWLETTDASNY----PFRGIFQEEAGKDFAESPPSTCPRIEERLEMEQKNINPFEATA  86

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLIQALGYIK  685
             S   +E  Q                E +E+ RR WI P A    ++S+  RL+  LG +K
Sbjct  87    SSSQSEGFQI---------------EGTEVGRRCWIAPTANPGPSSSMKQRLMMVLGRLK  131

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQE  865
             + ++DKDVL+QIWVPV + GR VL T DQP+  +     L  YR++S  Y+F  +E+++E
Sbjct  132   ECTKDKDVLVQIWVPVKKGGRNVLTTIDQPYVYNPNSKSLESYRNVSKTYQFLADEETKE  191

Query  866   NVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIE  1045
             +VGLPGRVFLGK+PEWTPDV+ F  EEYPR  +AQ+YDVRG+ A+PVF++GS TCLGV+E
Sbjct  192   SVGLPGRVFLGKLPEWTPDVRFFSSEEYPRRDYAQQYDVRGSLALPVFERGSGTCLGVVE  251

Query  1046  VVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACA  1222
             ++ T+QK+ YR EL++VCKALE VDLR S+     + K C+ S+Q  LP+ILEVL S C 
Sbjct  252   IITTSQKINYRPELETVCKALEAVDLRSSQTFRPPSAKACNQSHQAALPQILEVLTSVCR  311

Query  1223  THKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLK  1402
              ++LPLA TW  C+QQGKEG RHS+EN   CVSTVDSAC++AD    GF EACSEHHLL+
Sbjct  312   QYRLPLALTWASCLQQGKEGPRHSNENYEFCVSTVDSACFVADQHYLGFQEACSEHHLLR  371

Query  1403  GLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLE  1582
             G G+VGRAF  NQPCF+ADIT+FS+ EYPL+H+AR+  L  A AI L S  TGS DFVLE
Sbjct  372   GQGIVGRAFTINQPCFAADITAFSRKEYPLAHHARMLGLCCATAIPLASIHTGSVDFVLE  431

Query  1583  FFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHK  1762
             FFLPRDC+  EE K+M+ SLS     VCQTL+   +++ E   +S        SD RI  
Sbjct  432   FFLPRDCRDAEEQKQMINSLSSF---VCQTLQNSQKEQKETLVSSTRYTGVNTSDKRIQA  488

Query  1763  EVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA-FQNEK-PSE--------------  1894
             E  +    S      + +SW ++ +  Q++    S  F+ +K P E              
Sbjct  489   EETDKLLPSLNKRHPQEVSWIANMVEAQKNSKGISVPFEVQKEPKEEFTVTTKWEETEIG  548

Query  1895  LLYKRL-PEF-------VSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQY  2050
             L + +  PEF        +   +    T G+  +   R++G + R K EKTI+L +L+QY
Sbjct  549   LQHGQFHPEFHRVQQNLENKPNVEGGDTLGQFPSIGGRKSGQRTRTKTEKTISLDVLRQY  608

Query  2051  FAGSLKDAAKSLGV  2092
             FAGSLKDAA+S+GV
Sbjct  609   FAGSLKDAARSIGV  622



>ref|XP_006486601.1| PREDICTED: protein NLP2-like isoform X1 [Citrus sinensis]
 ref|XP_006486602.1| PREDICTED: protein NLP2-like isoform X2 [Citrus sinensis]
 ref|XP_006486603.1| PREDICTED: protein NLP2-like isoform X3 [Citrus sinensis]
 ref|XP_006486604.1| PREDICTED: protein NLP2-like isoform X4 [Citrus sinensis]
Length=945

 Score =   493 bits (1268),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 289/632 (46%), Positives = 376/632 (59%), Gaps = 59/632 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGEL------MKESEVERKKSSL  499
             +GCWLETTD  +F Q  P ++    + S  LP  E   G L       ++   E  K+  
Sbjct  31    DGCWLETTDALDFLQPGPSSSGPADDTSRYLPYSEGTTGHLSMNLNPQQQVYQEETKNKF  90

Query  500   PENLSASQFHTERVQ---CFGQNGSNAVCSSG-----LAESSELSRRWWIGPMATT----  643
              EN S      E +Q        G +   SSG     LA+ +EL RRWWIGP   T    
Sbjct  91    TENPSLVYPKIEEIQDTRTQDHQGFDPATSSGQSGSFLAQGNELGRRWWIGPRENTGHSS  150

Query  644   SVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDI  823
             SV DRL+QA+ Y+KD+ +D   L+QIWVP+N  G+++L T DQP+ LD     L  YR++
Sbjct  151   SVKDRLMQAIIYLKDYIKDGKALVQIWVPINSGGKQLLTTDDQPYSLDPNSKSLESYRNV  210

Query  824   SINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
             S  Y F  +EDS+E VGLPGRVF  + PEWTPDV  F+ EEYPRV HAQ+YDV G+ A+P
Sbjct  211   STTYHFAADEDSKEFVGLPGRVFREQSPEWTPDVLFFRSEEYPRVNHAQQYDVHGSLALP  270

Query  1004  VFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQV  1180
             VF++GS  CLGV+EVV T++K+ YR +L++VCKALE VDLR S   +   VK  +  Y  
Sbjct  271   VFERGSGACLGVVEVVTTSRKINYRLDLENVCKALEAVDLRSSGNFSTSCVKARNELYHA  330

Query  1181  VLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRI  1360
              +PEI EVL+S C THKLPLA TW PCVQ  K   + SDEN   C  TVDSAC++A+  +
Sbjct  331   AMPEIAEVLRSVCKTHKLPLALTWAPCVQGRKVECQQSDENFPHCFLTVDSACFVANENL  390

Query  1361  QGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIR  1540
              GF  ACSE  LL+G G+VG+AF  ++ CF+ADIT+FSK+ YPLSH AR+F L+AAVAI 
Sbjct  391   SGFFVACSEQQLLQGQGIVGKAFSLSKQCFTADITAFSKSNYPLSHLARMFGLRAAVAIP  450

Query  1541  LRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP  1720
             LRS  TG  +F+LEFFLPR+C+  EE K+M+ SLS+ +Q VCQ+LR+  E+ELE     P
Sbjct  451   LRSITTGVVEFILEFFLPRECQDIEEQKQMVKSLSVAMQQVCQSLRLAMEKELEVVIL-P  509

Query  1721  SSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQE--SCMSSSAFQNEKPSE  1894
               ++A  SD            + S    +E  SW S  +  Q+    +S S    E+P E
Sbjct  510   VGEMAVTSD----------GSSPSKETSQEQSSWISHMIEAQQKGKGVSVSWDHQEEPKE  559

Query  1895  LLYKRL-----------PEFVSGSGLSFDSTSGEGSAQNV---------------RRAGD  1996
                               E   G G  F   SG  S+                  R+AG+
Sbjct  560   EFKMTTHWDDARAESFHKEVFPGFG-QFQHNSGAKSSVEGGGDSSSLGGHLSVGSRKAGE  618

Query  1997  KKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             K+R K EKTI+LQ+L+QYFAGSLKDAAKS+GV
Sbjct  619   KRRTKTEKTISLQVLRQYFAGSLKDAAKSIGV  650



>emb|CDY01361.1| BnaA07g11340D [Brassica napus]
Length=775

 Score =   484 bits (1246),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 265/590 (45%), Positives = 363/590 (62%), Gaps = 87/590 (15%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANAL-FEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGS+F   +PF+ ++  + P+                    +  S+L  ++ 
Sbjct  24    DGCWLETTDGSDFLNLTPFDPSSFTWSPT--------------------QDTSALLSHM-  62

Query  515   ASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA-TTSVMDRLIQALGYIKDF  691
              SQ + ER                  E  + ++RWWIGP    +SV +RL+QA+ +IKD+
Sbjct  63    YSQDYAERSS---------------LEEFQWNKRWWIGPGGGASSVTERLVQAVEHIKDY  107

Query  692   SRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQEN  868
             + ++  LIQ+WVPV+R G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+  
Sbjct  108   TTERGSLIQLWVPVSRGGKRVLTTKEQPFSHDPLCQRLANYREISVNYHFSAEQDDSKAL  167

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
              GLPGRVFLGK+PEWTPDV+ F+ EEYPRV HAQ   VRGT A+PVF+QGS+ CLGVIEV
Sbjct  168   AGLPGRVFLGKLPEWTPDVRFFRSEEYPRVQHAQDCGVRGTLAIPVFEQGSKICLGVIEV  227

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACAT  1225
             V+TT+ +K R EL+S+C+AL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC T
Sbjct  228   VMTTEMIKLRPELESICRALQAVDLRSTEVPIQPSLKGCDLSYKAALPEIQNLLRCACET  287

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             H LPLAQTWV C+QQ K G RH+DEN + C+ST+D ACY+ DP +  FHEACSEHHLLKG
Sbjct  288   HNLPLAQTWVSCLQQTKTGCRHNDENYIHCISTIDDACYVGDPTVLEFHEACSEHHLLKG  347

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              GV G+AF+TN PCFS D++++ K+EYPLSH+A +F L  AVAIRLR   TGS DF+LEF
Sbjct  348   QGVAGQAFLTNGPCFSPDVSNYKKSEYPLSHHANMFGLHGAVAIRLRCVHTGSADFILEF  407

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP++C   EE ++ML +LS I+ +V ++LR VT            +++ + S++ +  +
Sbjct  408   FLPKECDDVEEQRKMLDALSSIMAHVPRSLRTVT-----------DTELEEESEVIVTPK  456

Query  1766  VPN-LKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLS  1942
             + N L ++                              +E       KR  E+ S     
Sbjct  457   IENTLVFDGG----------------------------DEHNDVFGLKRGFEYKSSESSM  488

Query  1943  FDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             F        A+  R   DK        ITL +L+QYFAGSLKDAAKS+GV
Sbjct  489   FFCDGFSSMAEKKRTKADKN-------ITLDVLRQYFAGSLKDAAKSIGV  531



>ref|XP_009103332.1| PREDICTED: protein NLP4-like [Brassica rapa]
Length=775

 Score =   483 bits (1242),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 266/591 (45%), Positives = 364/591 (62%), Gaps = 88/591 (15%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANAL-FEPSYVLPDLEPNNGELMKESEVERKKSSLPENLS  514
             +GCWLETTDGS+F   + FN ++  + P+                    +  S+L  ++ 
Sbjct  24    DGCWLETTDGSDFLNLTSFNPSSFTWSPT--------------------QDTSALLSHM-  62

Query  515   ASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA-TTSVMDRLIQALGYIKDF  691
              SQ + ER                  E  + ++RWWIGP    +SV +RL+QA+ +IKD+
Sbjct  63    YSQDYAERSS---------------LEEFQWNKRWWIGPGGGASSVTERLVQAVEHIKDY  107

Query  692   SRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQEN  868
             + ++  LIQ+WVPV+R G+RVL T +QPF  D  C RLA+YR+IS+NY F  E +DS+  
Sbjct  108   TTERGSLIQLWVPVSRGGKRVLTTKEQPFSHDPLCQRLANYREISVNYHFSAEQDDSKAL  167

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
              GLPGRVFLGK+PEWTPDV+ F+ EEYPRV HAQ   VRGT A+PVF+QGS+ CLGVIEV
Sbjct  168   AGLPGRVFLGKLPEWTPDVRFFRSEEYPRVQHAQDCGVRGTLAIPVFEQGSKICLGVIEV  227

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVR-NVKTCH-SYQVVLPEILEVLKSACA  1222
             V+TT+ VK R EL+S+C+AL+ VDLR +++  ++ ++K C  SY+  LPEI  +L+ AC 
Sbjct  228   VMTTEMVKLRPELESICRALQAVDLRSTEVPPIQPSLKGCDLSYKAALPEIQNLLRCACE  287

Query  1223  THKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLK  1402
             TH LPLAQTWV C+QQ K G RH+DEN + C+ST+D ACY+ DP +  FHEACSEHHLLK
Sbjct  288   THNLPLAQTWVSCLQQTKTGCRHNDENYIHCISTIDDACYVGDPTVLEFHEACSEHHLLK  347

Query  1403  GLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLE  1582
             G GV G+AF+TN PCFS D++++ K+EYPLSH+A +F L  AVAIRLR   TGS DF+LE
Sbjct  348   GQGVAGQAFLTNGPCFSPDVSNYKKSEYPLSHHANMFGLHGAVAIRLRCVHTGSADFILE  407

Query  1583  FFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHK  1762
             FFLP++C   EE ++ML +LS I+ +V ++LR VT            +++ + S++ +  
Sbjct  408   FFLPKECDDVEEQRKMLDALSSIMAHVPRSLRTVT-----------DTELEEESEVIVTS  456

Query  1763  EVPN-LKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGL  1939
             ++ N L ++                              +E       KR  E+ S    
Sbjct  457   KIENTLVFDGG----------------------------DEHNDVFGLKRGFEYKSSESS  488

Query  1940  SFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              F        A+  R   DK        ITL +L+QYFAGSLKDAAKS+GV
Sbjct  489   MFFCDGFSSMAEKKRTKADKN-------ITLDVLRQYFAGSLKDAAKSIGV  532



>ref|XP_007199040.1| hypothetical protein PRUPE_ppa018195mg [Prunus persica]
 gb|EMJ00239.1| hypothetical protein PRUPE_ppa018195mg [Prunus persica]
Length=865

 Score =   484 bits (1245),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 259/518 (50%), Positives = 336/518 (65%), Gaps = 30/518 (6%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P  ++SV +RL+ A+GY+K+ ++ +DVLIQIWVP+ R GR+ L T DQPF LD     LA
Sbjct  68    PGPSSSVKERLMLAIGYLKECTKGRDVLIQIWVPIKRGGRQYLTTHDQPFSLDPNSKSLA  127

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR++S +Y+F  EEDS E+VGLP R FLGK+ EWTPDV+ F+  EYPR+ +AQ+YDVR 
Sbjct  128   GYRNVSKDYQFITEEDSAESVGLPSRAFLGKLLEWTPDVRFFRSYEYPRIDYAQQYDVRD  187

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH  1168
             + A+P+F+ GS TCLGV+E+V+  QKV  R EL+ VC+ALE VDLR S+      VKT  
Sbjct  188   SLALPIFENGSGTCLGVVEIVMAPQKVNDRPELEYVCQALEAVDLRSSQNFWPLCVKTHD  247

Query  1169  S-YQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYI  1345
               YQ  L EI+EVL S C TH+LPLAQTW PC+QQGK G RHSDEN  RCVS VD+AC++
Sbjct  248   ELYQAALTEIVEVLASVCKTHRLPLAQTWAPCIQQGKGGCRHSDENYARCVSIVDAACFV  307

Query  1346  ADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQA  1525
             AD  I GFHEACSEHHL +G G+VG AF  N+PCF+ DI +FSKTEYPLSH+AR+F L A
Sbjct  308   ADLDILGFHEACSEHHLFQGQGIVGTAFTINKPCFATDIKAFSKTEYPLSHHARMFGLHA  367

Query  1526  AVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqelee  1705
             AVAI  RS  TG  D VLEFFLP+DC+ PEE K+ML SL I+IQ  CQ+L +  ++EL+E
Sbjct  368   AVAIPFRSVYTGPADLVLEFFLPKDCQDPEEQKQMLNSLCIVIQQACQSLHMNVDKELKE  427

Query  1706  ettSPSSKVAKHSDIRIH-KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA---F  1873
             E   P  +    SD  +H +E   L  +    P  +  SW +  +  Q+     S    +
Sbjct  428   EIMFPIREPVIGSDGGLHTEETQRLISSPPEEPSGKESSWIAHMIEAQQKGKGVSVSLDY  487

Query  1874  QNEKPSE------------------LLYKRLPEFVSGSGLSFDSTSGEGS-------AQN  1978
             Q E+P E                   ++    +    SG   +   G  S          
Sbjct  488   QTEEPKEEFKVTTHWGNTQGSLHSGQVFSEFGQLHQSSGSHGNVEGGADSYSFGGHRTSG  547

Query  1979  VRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              R+AG+K+R K EK I+L +L+QYFAGSLKDA+KS+GV
Sbjct  548   GRKAGEKRRTKTEKRISLPVLRQYFAGSLKDASKSIGV  585



>ref|XP_010530951.1| PREDICTED: protein NLP2-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010530952.1| PREDICTED: protein NLP2-like isoform X2 [Tarenaya hassleriana]
Length=965

 Score =   483 bits (1242),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 281/636 (44%), Positives = 377/636 (59%), Gaps = 51/636 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQH--SPFNANALFEPSYVL--PDLEPNNGEL-----MKESEVERKK  490
             +GCWLETTDG  F Q   SP N+N++ +  ++    DL+ +N  L         E E K 
Sbjct  35    DGCWLETTDGKSFKQPGPSPSNSNSVKDSPFLFRYQDLKSSNVGLNPPQNTSNGETESKL  94

Query  491   SSLPENLSASQFHTERVQCFGQNGSNAVCSSG------LAESSELSRRWWIGPMATTSVM  652
                P  L   Q   E  Q   Q   +   +S       L E +E  RRWWI P  ++SV 
Sbjct  95    PPSPTYLKKIQDLHETHQSMDQESFDLAATSSTQSEKLLVEGAEAGRRWWICPAPSSSVK  154

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
             DRL+ A+ ++++   DK+ LIQIWVP  + G+  L T +QP  ++ K   L  YR +S  
Sbjct  155   DRLVHAIQHLQEAVIDKNFLIQIWVPFQKGGKNFLTTLEQPHLVNPKYLSLQEYRHVSEK  214

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y FP +EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  AQ+ DVRG+ A+PVF+
Sbjct  215   YSFPADEDSKESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAQKCDVRGSLALPVFE  274

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS----YQV  1180
             +GS TCLGV+E+V TTQK+ YR EL+++CKALE VDLR S   N+ +++        YQ 
Sbjct  275   RGSGTCLGVVEIVTTTQKINYRPELENICKALEAVDLRSSSNLNLPSIEFLQVYNEFYQA  334

Query  1181  VLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRI  1360
              LPEI E L S C  + LPLA TW PC +QGK G RHSDEN  +CVST+DSAC++ D   
Sbjct  335   ALPEISEFLVSVCTLYDLPLALTWAPCARQGKSGCRHSDENYSQCVSTIDSACFVPDEHS  394

Query  1361  QGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIR  1540
             + F EACSEHHLL+G GVVG+AF  N+ CF  D+T+FSKT YPLSH+A+IF L AA+A+ 
Sbjct  395   KNFLEACSEHHLLQGEGVVGKAFKMNKRCFVPDVTTFSKTNYPLSHHAKIFGLHAALAVP  454

Query  1541  LRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP  1720
             +++  TG+ +FVLEFFLP+ C   E  K ML  LS  ++   ++L +V ++E EEE   P
Sbjct  455   VKNKYTGAVEFVLEFFLPKACIDTESRKEMLILLSTTLERDFRSLNLVVDKETEEEVILP  514

Query  1721  SSKVAKHSDIRI--HKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEK  1885
                     D  +   +   NLK ++      E  SW S  M         S    +Q E+
Sbjct  515   VRDTMVFLDHPLGGGEATQNLKSSTLTEISREESSWISHMMEANRKGKGVSLSWEYQKEE  574

Query  1886  PSELLY------KRLPE-----FVSGSG-----------LSFDST-----SGEGSAQNVR  1984
             P E            P+     F+SG+G           +  D +     SG G     R
Sbjct  575   PKEEFKMTTGWDDNQPDPDHHNFLSGAGQFQRGSSSGFMIDIDPSIESPPSGGGQTSGNR  634

Query  1985  RAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             + G+K+R K EKTI+L+IL+QYFAGSLKDAAKS+GV
Sbjct  635   KPGEKRRTKTEKTISLEILRQYFAGSLKDAAKSIGV  670



>gb|KDP42031.1| hypothetical protein JCGZ_03094 [Jatropha curcas]
Length=946

 Score =   481 bits (1239),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 284/629 (45%), Positives = 387/629 (62%), Gaps = 47/629 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNG----ELMKESEVERKKSSLPE  505
             +GCWLETTDG  F Q    N+    +PS   P LE ++      L +    E  +++LP 
Sbjct  31    DGCWLETTDGFNFLQPGLSNSGVPSDPSQYSPYLESSSSLASTNLHQVIHQEAAENNLPG  90

Query  506   NLSASQFH-TERVQCFGQNGSNAVCSSGLA-------ESSELSRRWWIGPMA----TTSV  649
             N   +     E  +   QN S+   +S L        E SEL  R WI PMA    ++SV
Sbjct  91    NPPCNNTRGKELTESESQNQSSLKITSSLVQPEPSPIEGSELGTRLWIAPMAGVQSSSSV  150

Query  650   MDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISI  829
               RLI A+G +K+ ++D +VL+QIWVP  ++G+ VL T  QP    LK   LA YR++S 
Sbjct  151   KQRLIHAIGKLKECAKDMEVLVQIWVPTKKEGKCVLTTIGQPSFHSLKNESLASYRNVSE  210

Query  830   NYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVF  1009
              Y FPVE DS+E++GLPGRVFLGK+PE TPDV+ F+ +EYPR  +A++Y++RG+ AVPV 
Sbjct  211   AYNFPVEGDSKESLGLPGRVFLGKLPESTPDVRFFRSDEYPRKSYAKQYNIRGSLAVPVL  270

Query  1010  DQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVL  1186
             ++G+  CLGV+EV+ T+Q + YR EL+++CKALE VDLR S+     +VK C  + Q  +
Sbjct  271   ERGTGNCLGVVEVITTSQYINYRPELETICKALEAVDLRSSQHFCPPSVKACKEFCQAAV  330

Query  1187  PEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQG  1366
             PEI E+L S C THKLPLA TW  C QQGK G RH DEN    +STVDSAC++AD     
Sbjct  331   PEISEILGSVCKTHKLPLALTWARCFQQGKGGCRHFDENFAHSISTVDSACFVADTEFLA  390

Query  1367  FHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLR  1546
             FH ACSE +L  G G+VG+AFM N+ CF+ DITSFSKT+YPLSH+A++  L AAVAI LR
Sbjct  391   FHAACSEQYLFLGQGIVGKAFMMNKQCFATDITSFSKTDYPLSHHAKVLDLHAAVAIPLR  450

Query  1547  STCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSS  1726
             ST  GS DFVLE FLP+DC+  EE KR+   L I IQ  C++L VV ++E EE+      
Sbjct  451   STYAGSADFVLELFLPKDCRDGEEQKRIWDLLPIAIQQSCKSLHVVMDKEQEEDIR---W  507

Query  1727  KVAKHSDIRIHK-EVPNLKYNSSIGPCEEGLSWTSSPMLVQES----CMS-------SSA  1870
             ++A +S+ R +K E  N   +S      E  SW +  M  Q+     C+S          
Sbjct  508   QMAVNSNGRYNKQENHNFASSSLQQHYPESSSWITQMMEAQQKGKSVCVSWDTENKPKQE  567

Query  1871  FQ-----NEKPSELLYKRL----PEFVSGSG------LSFDSTSGEGSAQNVRRAGDKKR  2005
             F+     ++ P +L  K++     +    SG      +S +S+     +   ++ G+K+R
Sbjct  568   FKVATNYDDTPEDLYSKQVFAESGQLHQNSGNKNSIEVSKNSSFAGQHSSGSKKGGEKRR  627

Query  2006  MKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              KAEKTI+LQ+L+QYFAGSLKDAAKS+GV
Sbjct  628   TKAEKTISLQVLRQYFAGSLKDAAKSIGV  656



>gb|EEC85004.1| hypothetical protein OsI_32291 [Oryza sativa Indica Group]
Length=871

 Score =   479 bits (1232),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 264/529 (50%), Positives = 353/529 (67%), Gaps = 28/529 (5%)
 Frame = +2

Query  527   HTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM-ATTSVMDRLIQALGYIKDFSRDK  703
             +T R   F    SN +  + +A ++  +  WWI P  A+TSV +R  QAL YI++  RD 
Sbjct  74    NTSRSPNFFATPSNCLTDASVATTTP-ANSWWIQPSGASTSVRERFDQALAYIRETQRDA  132

Query  704   DVLIQIWVPV-NRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLP  880
             DVL+Q+WVPV   DG+ VL T  QPF LD +   L  +R++S  Y+F  +  S  + GLP
Sbjct  133   DVLVQLWVPVKGNDGQLVLTTSGQPFTLDQRSNSLIQFREVSTKYQFSADVASGSSPGLP  192

Query  881   GRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTT  1060
             GRVF+G++PEW+PDV+ F   EYPR+ HAQ  DV GT  +PVF++G+ +CLGVIE+++T 
Sbjct  193   GRVFIGRLPEWSPDVRYFTSYEYPRISHAQYLDVHGTMGLPVFERGNYSCLGVIELIMTK  252

Query  1061  QKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCHSYQVVLPEILEVLKSACATHKLP  1237
             QK+ + +EL+++C AL+ V+L  +++S++   K    SY+  LPEILEVL++AC THKLP
Sbjct  253   QKLNFTSELNTICSALQAVNLTSTEVSSIPRTKLNSASYKDALPEILEVLRAACITHKLP  312

Query  1238  LAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVV  1417
             LAQTWV C QQGK G RHSDEN   C+ST+D+ACY+ +PR+Q FHEACSEHHLL+G GV 
Sbjct  313   LAQTWVTCAQQGKRGSRHSDENYKYCISTIDAACYVNEPRMQSFHEACSEHHLLRGQGVA  372

Query  1418  GRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPR  1597
             G+AF TNQPCF  DI S +K EYPLSH+A+IF+L+ AVAIRLR T TG  DFVLEFFLP 
Sbjct  373   GKAFTTNQPCFLPDIGSSTKLEYPLSHHAKIFNLKGAVAIRLRCTRTGIADFVLEFFLPT  432

Query  1598  DCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNL  1777
             DC+  EE K +L SLS  +++VCQTLRVVT++E+E+E     +++   S  R   +V  L
Sbjct  433   DCEVLEEQKAVLDSLSGTMRSVCQTLRVVTDKEMEDEAMREMNELNSFSP-RGKNKVEEL  491

Query  1778  KYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSEL----LYKRLPEFVSGSGLSF  1945
              +  +     E  SWT+   LV  S         +K S+L     +  L     GS  + 
Sbjct  492   SFGDNTRGDREEASWTT---LVGTS---------QKGSDLAELHTHGMLSHGGHGSSQAG  539

Query  1946  DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             D TS EGS         K+R K EKT++LQ+L+QYFAGSLKDAAKSLGV
Sbjct  540   DQTSKEGSKV-------KRRTKTEKTVSLQVLRQYFAGSLKDAAKSLGV  581



>ref|XP_010935286.1| PREDICTED: protein NLP1-like [Elaeis guineensis]
 ref|XP_010935287.1| PREDICTED: protein NLP1-like [Elaeis guineensis]
Length=920

 Score =   479 bits (1232),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 280/627 (45%), Positives = 383/627 (61%), Gaps = 60/627 (10%)
 Frame = +2

Query  347   WLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGE---LMKESE----VERKK-SSLP  502
             WLE  + S+  Q +  N+ + F+     P  E +NG    ++ ES+     +R   S+ P
Sbjct  30    WLEFPNSSDVLQSNTPNSMSPFDSLSFSPLFEVSNGNSTRVLPESDNLDDTDRSVISTNP  89

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSR---------RWWIGPMAT-TSVM  652
              +  +   + +R      +    +  S   +S ELS           WWI P ++ +SV 
Sbjct  90    PSDESQVGNIDRTHSLNSSTIGRIMYS--VQSGELSTINPSPEPGTNWWIRPSSSISSVK  147

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
             DR + AL YIK+  R+ +VL+Q+WVP+ R  + VL T  QPF +D  C +L +YR+IS N
Sbjct  148   DRFMHALSYIKETHREGNVLVQLWVPMKRGDQLVLTTYGQPFLVDPNCEKLVNYREISTN  207

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             YEF  EE+S   +GLPGRVFLG++PEWTPDV+ F   E+ RVG+A+ +DVRGT A+PVF+
Sbjct  208   YEFSAEENSGRALGLPGRVFLGRLPEWTPDVRYFDSSEFLRVGYAEYFDVRGTIALPVFE  267

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLP  1189
              G R+CLGV+EVV TTQ + + +EL ++C AL+  DL  S++ +V ++K    SYQ  LP
Sbjct  268   HGGRSCLGVVEVVTTTQDMNHSSELQNICNALQAADLTSSEVLSVPHLKVSGGSYQAALP  327

Query  1190  EILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGF  1369
             EILEVLK+ C  HKLPLAQTW+ C+QQGK G RHS EN   CVSTVD+ACY+ DP +  F
Sbjct  328   EILEVLKTICKMHKLPLAQTWIACIQQGKTGSRHSKENYKDCVSTVDAACYLNDPSMLSF  387

Query  1370  HEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRS  1549
             H ACSEHHLLKG GV G+AF TN+PCFS DIT+  KTEYPLSH+AR+ +L+ AVAIRLRS
Sbjct  388   HRACSEHHLLKGQGVAGKAFTTNEPCFSPDITASCKTEYPLSHHARMVNLKGAVAIRLRS  447

Query  1550  TCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK  1729
               +G+ DFVLEFFLP DC   EE K ML SLS  IQ VCQTLRV+T             +
Sbjct  448   IRSGNADFVLEFFLPPDCIGSEEQKLMLNSLSNTIQQVCQTLRVMTI-----------KE  496

Query  1730  VAKHSDIRIHKEVPN-LKYNSSIGPCEEGLSWTSSPML-VQESCMSSSAFQN------EK  1885
             +   + +++++ +P+ L+Y+ S    EEG       +L V+ S   +S F        E 
Sbjct  497   LEDEAMLQVNELIPSELRYDKS--GSEEGRRQNVDDVLSVEASEKETSEFLELEKDWFEG  554

Query  1886  PSELLYKRLPEFVSGSGLSF------------------DSTSGEGSAQNVRRAGDKKRMK  2011
              +   +   PE V  +G  F                  DS + + S     +A +K+R K
Sbjct  555   FTVTTHSNHPEVVLPAGEIFSEFKQHRQDLQNDVSNHKDSFTSDCSFPVSGKATEKRRTK  614

Query  2012  AEKTITLQILQQYFAGSLKDAAKSLGV  2092
              EKT++L++L+QYFAGSLKDAAKS+GV
Sbjct  615   TEKTVSLEVLRQYFAGSLKDAAKSIGV  641



>gb|EEE70166.1| hypothetical protein OsJ_30240 [Oryza sativa Japonica Group]
Length=865

 Score =   476 bits (1226),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 263/529 (50%), Positives = 352/529 (67%), Gaps = 28/529 (5%)
 Frame = +2

Query  527   HTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM-ATTSVMDRLIQALGYIKDFSRDK  703
             +T R   F    SN +  + +A ++  +  WWI P  A+TSV +R  QAL YI++   D 
Sbjct  68    NTSRSPNFFATPSNCLTDASVATTTP-ANSWWIQPSGASTSVRERFDQALAYIRETQSDA  126

Query  704   DVLIQIWVPV-NRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLP  880
             DVL+Q+WVPV   DG+ VL T  QPF LD +   L  +R++S  Y+F  +  S  + GLP
Sbjct  127   DVLVQLWVPVKGNDGQLVLTTSGQPFTLDQRSNSLIQFREVSTKYQFSADVASGSSPGLP  186

Query  881   GRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTT  1060
             GRVF+G++PEW+PDV+ F   EYPR+ HAQ  DV GT  +PVF++G+ +CLGVIE+++T 
Sbjct  187   GRVFIGRLPEWSPDVRYFTSYEYPRINHAQYLDVHGTMGLPVFERGNYSCLGVIELIMTK  246

Query  1061  QKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCHSYQVVLPEILEVLKSACATHKLP  1237
             QK+ + +EL+++C AL+ V+L  +++S++   K    SY+  LPEILEVL++AC THKLP
Sbjct  247   QKLNFTSELNTICSALQAVNLTSTEVSSIPRAKLNSASYKDALPEILEVLRAACITHKLP  306

Query  1238  LAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVV  1417
             LAQTWV C QQGK G RHSDEN   C+ST+D+ACY+ +PR+Q FHEACSEHHLL+G GV 
Sbjct  307   LAQTWVTCAQQGKRGSRHSDENYKYCISTIDAACYVNEPRMQSFHEACSEHHLLRGQGVA  366

Query  1418  GRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPR  1597
             G+AF TNQPCF  DI S +K EYPLSH+A+IF+L+ AVAIRLR T TG  DFVLEFFLP 
Sbjct  367   GKAFTTNQPCFLPDIGSSTKLEYPLSHHAKIFNLKGAVAIRLRCTRTGIADFVLEFFLPT  426

Query  1598  DCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNL  1777
             DC+  EE K +L SLS  +++VCQTLRVVT++E+E+E     +++   S  R   +V  L
Sbjct  427   DCEVLEEQKAVLDSLSGTMRSVCQTLRVVTDKEMEDEAMREMNELNSFSP-RGKNKVEEL  485

Query  1778  KYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSEL----LYKRLPEFVSGSGLSF  1945
              +  +     E  SWT+   LV  S         +K S+L     +  L     GS  + 
Sbjct  486   SFGDNTRGDREEASWTT---LVGTS---------QKGSDLAELHTHGMLSHGGHGSSQAG  533

Query  1946  DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             D TS EGS         K+R K EKT++LQ+L+QYFAGSLKDAAKSLGV
Sbjct  534   DQTSKEGSKV-------KRRTKTEKTVSLQVLRQYFAGSLKDAAKSLGV  575



>ref|XP_008781315.1| PREDICTED: protein NLP1-like [Phoenix dactylifera]
Length=919

 Score =   478 bits (1231),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 283/630 (45%), Positives = 383/630 (61%), Gaps = 60/630 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ------HSPFNA---NALFEPSY-----VLPDLEPNNGELMKESE  475
             E  WLE  + S+  Q       SPF++   + LFE SY     VLP  E +N E    S 
Sbjct  27    EEGWLEFPNSSDVLQTNTPSSMSPFDSLSFSPLFEVSYSNSTPVLP--ESDNPEDTDRSA  84

Query  476   VERKKSSLPENLSA-SQFHTERVQCFGQNGSNAVCS--SGLAESSELSRRWWIGPMAT-T  643
             +     S    +    + H+     FG+   +      S +  S E    WWI P ++ +
Sbjct  85    ISTNPPSDESQVEKIDRTHSLNSSTFGRIMYSVPSGELSTINPSPEPGTNWWIRPSSSIS  144

Query  644   SVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDI  823
             SV +R + AL YIK+  R+ +VL+Q+WVP+ R  + VL T  QPF +D  C +L +YR+I
Sbjct  145   SVKERFMHALSYIKETHREGNVLVQLWVPMKRGDQLVLTTYGQPFLVDPNCEKLVNYREI  204

Query  824   SINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
             S NY+F  EE S + +GLPGRVFLG +PEWTPDV+ F   E+ RVG+AQR DVRGT A+P
Sbjct  205   STNYQFSAEESSGQALGLPGRVFLGGLPEWTPDVRCFTSSEFLRVGYAQRLDVRGTIALP  264

Query  1004  VFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCHSYQV  1180
             VF++G R+CLGV+EVV TT+ + Y +EL ++C AL+ VDL  S++ +V ++K +  SYQ 
Sbjct  265   VFERGGRSCLGVVEVVTTTRNISYSSELQNICNALQAVDLMSSEVLSVPHLKVSISSYQA  324

Query  1181  VLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRI  1360
              LPEILEVLK+ C  HKLPLAQTW+PC+QQGK G RHS EN   CVSTVD+ACY+ +P +
Sbjct  325   ALPEILEVLKTVCKIHKLPLAQTWIPCIQQGKTGSRHSKENYEDCVSTVDAACYVNNPSM  384

Query  1361  QGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIR  1540
               FH ACSEHHLLKG GV G+AF TN+PCFS DI +  KTEYPLSH+AR+ +L+ AVAIR
Sbjct  385   LSFHRACSEHHLLKGQGVAGKAFTTNEPCFSPDIAASCKTEYPLSHHARMCNLKGAVAIR  444

Query  1541  LRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP  1720
             LRS  TG+ DFVLEFFLP DC   EE K ML SLS  IQ  CQTL+VVT           
Sbjct  445   LRSIRTGNADFVLEFFLPLDCIGSEEQKLMLNSLSNTIQQACQTLQVVTI----------  494

Query  1721  SSKVAKHSDIRIHKEVPN-LKYNSSIGPCEEGLSWTSSPMLVQESC--MSSSAFQNEKP-  1888
               ++   + +++++ +P+ L+++ S    EEG       +L  E+    +S   + EK  
Sbjct  495   -KELDDEAMLQLNESIPSELRFDRS--GAEEGHRQNVDDVLSVEASEKETSRYLELEKHW  551

Query  1889  ----SELLYKRLPEFVSGSGLSF------------------DSTSGEGSAQNVRRAGDKK  2002
                 +   +   PE V  +G  F                  DS   + +    R+A +K+
Sbjct  552   VEGFTVTTHSNQPEVVLPAGEIFSEFKQHCQDLQKDANSHKDSFIDDSNFPLSRKAIEKR  611

Query  2003  RMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R KAEKT++L++L+ YFAGSLKDAAK +GV
Sbjct  612   RTKAEKTVSLEVLRHYFAGSLKDAAKRIGV  641



>ref|XP_004231096.1| PREDICTED: protein NLP2 [Solanum lycopersicum]
Length=841

 Score =   476 bits (1224),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 264/549 (48%), Positives = 341/549 (62%), Gaps = 54/549 (10%)
 Frame = +2

Query  557   NGSNAVCSSGLAES---SELSRRWWIGP------MATTSVMDRLIQALGYIKD-FSRDKD  706
             N ++  C+S   +S   ++  R+ WIGP       +   V  RL+QA+ Y+K+  + +K+
Sbjct  36    NSNSNYCTSNQMDSAPPTQSRRKLWIGPNNPNPTSSIPPVNTRLVQAIEYLKNSTTHNKE  95

Query  707   VLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGR  886
             VLIQIWVPVNR G+ VL+T +QP+ L+     L  YR++S NY+F  ++DS E VGLPGR
Sbjct  96    VLIQIWVPVNRGGKHVLITNNQPYFLNPNSHSLLQYRNVSQNYQFAADKDSNELVGLPGR  155

Query  887   VFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQK  1066
             VFL K+PEWTPDV+ FK EEYPRV +A +++VRG+ AVPVF+ GS TCLGV+E+V T QK
Sbjct  156   VFLKKLPEWTPDVRFFKSEEYPRVNYAHQHNVRGSIAVPVFETGSGTCLGVVEIVTTIQK  215

Query  1067  VKYRNELDSVCKALEEVDLRGSKISN----VRNVKTCHSYQVVLPEILEVLKSACATHKL  1234
               Y  EL+ VCKALE V+LR S IS+    +++     SY   L EI  +L   C THKL
Sbjct  216   THYHLELEHVCKALEAVNLRSSGISSNPSKIKDQDCNESYLAALAEIQYILTCVCDTHKL  275

Query  1235  PLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGV  1414
             PLAQTW PC+QQGK G   SDEN   CVSTVDS+CY+ D  +  FH ACSEHHLLKG GV
Sbjct  276   PLAQTWAPCIQQGKGGCLQSDENFASCVSTVDSSCYVRDQHVVPFHLACSEHHLLKGEGV  335

Query  1415  VGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLP  1594
              G AF TNQPCF+ DIT+FSK EYPLSH+AR+F L +AVAIRLRS  TGS DFVLEFFLP
Sbjct  336   AGGAFNTNQPCFATDITAFSKAEYPLSHHARMFGLCSAVAIRLRSIYTGSADFVLEFFLP  395

Query  1595  RDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPN  1774
              DCK+ EE K ML+SLS +IQ  C+                 S +V    +++  KEV  
Sbjct  396   LDCKNTEEQKIMLSSLSSVIQQSCR-----------------SLRVVTDQELQEEKEVVR  438

Query  1775  L--------KYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF--------------QNEKP  1888
             L        K  SS    ++  SW S  +  Q     ++A               Q E  
Sbjct  439   LPIGEEESRKPVSSSYRDQDASSWLSEMLDAQRKGKGAAAVSENFKVTATPWDYTQRESI  498

Query  1889  SELLYKRLPEFVSGSGLSFD-STSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSL  2065
                 +    +     G SFD S+     +   +RAG+++R K EK+I+LQ+L+QYFAGSL
Sbjct  499   HASTFSEPNQTFEPKGGSFDFSSGTGSHSSGAKRAGERRRSKTEKSISLQVLRQYFAGSL  558

Query  2066  KDAAKSLGV  2092
             KDAAKS+GV
Sbjct  559   KDAAKSIGV  567



>ref|XP_002313580.2| RWP-RK domain-containing family protein [Populus trichocarpa]
 gb|EEE87535.2| RWP-RK domain-containing family protein [Populus trichocarpa]
Length=908

 Score =   477 bits (1227),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 272/605 (45%), Positives = 372/605 (61%), Gaps = 45/605 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GC  ET D   F +     +N L +P   LP  E N+  L      E  + +  +N  +
Sbjct  38    DGCCFETVDEFGFLEAGTSASNDLNDPKQYLPFFESNSCNLNVNPCQENYQVATEKNFQS  97

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM----ATTSVMDRLIQALGYIK  685
               F                    L E +EL RR WI P     ++T V +RL+ A+G +K
Sbjct  98    GGF--------------------LVEKNELGRRLWIAPTNNARSSTGVRERLMHAIGQLK  137

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQE  865
               ++D+D+LIQIWVP+ ++G+ VL T  QP+ L+ K   LA YR++S  ++FP EEDS+E
Sbjct  138   QCTKDRDLLIQIWVPIKKEGKHVLTTFGQPYLLNPKSQSLASYRNVSKKFQFPAEEDSKE  197

Query  866   NVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIE  1045
              VGLPGRVFL K+PEWTPDV  F   EYPR  HA+++++RG+FAVPVF+QGSRTCLGVIE
Sbjct  198   LVGLPGRVFLRKLPEWTPDVSYFSWVEYPRKNHAKQFNIRGSFAVPVFEQGSRTCLGVIE  257

Query  1046  VVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVLPEILEVLKSACA  1222
             VV TTQ V YR+EL+SVCKALE VDLR  K     ++K C  + Q  +PEI ++L+S C 
Sbjct  258   VVTTTQDVSYRSELESVCKALEAVDLRSPKDFRPSSLKACKEFCQAAVPEISKILESVCK  317

Query  1223  THKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLK  1402
             TH+LPLA TW PC +QGK G RH DEN   C+ TV+SAC++A+    GF+ ACSE +L  
Sbjct  318   THRLPLALTWAPCFRQGKGGCRHFDENYSNCICTVNSACFVAETDNFGFYVACSEQYLSF  377

Query  1403  GLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLE  1582
             G G+VGRAF T + CFS D+ +FSKT+YPLSH+A++F L AA+AI ++ST  G  DFVLE
Sbjct  378   GQGIVGRAFTTRKQCFSTDVAAFSKTDYPLSHHAKMFELHAAIAIPVQSTYAGPVDFVLE  437

Query  1583  FFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHK  1762
             FF P+DC + EE KRM   L I I+  C +L VV ++ELEE      +K  K + +    
Sbjct  438   FFFPKDCCNTEEQKRMWDILPITIKQACWSLHVVMDKELEETV----NKKMKFASLFKES  493

Query  1763  EVPNLKYNSSIGPCEEG-----LSWTSSPMLVQESCMSSSAFQNEKPSELLYKR-LPEF-  1921
                   + + +   ++      +SW       +E    +S +   +  EL +K+  PEF 
Sbjct  494   SEAESSWIARVAEAQQKGKGVCVSWDHRKEENKEEFKVTSHWGKTQ-DELYHKQAFPEFG  552

Query  1922  ----VSGSGLSFDSTSGEGSAQN----VRRAGDKKRMKAEKTITLQILQQYFAGSLKDAA  2077
                  S    S +ST+   SA++     R++GDK+R K EKTI+LQ+L+QYFAGSLKDAA
Sbjct  553   KFQQNSVPKGSIESTTDAASAEHHSVGSRKSGDKRRTKTEKTISLQVLRQYFAGSLKDAA  612

Query  2078  KSLGV  2092
             KS+GV
Sbjct  613   KSIGV  617



>ref|XP_010548150.1| PREDICTED: protein NLP2-like [Tarenaya hassleriana]
 ref|XP_010548151.1| PREDICTED: protein NLP2-like [Tarenaya hassleriana]
 ref|XP_010548152.1| PREDICTED: protein NLP2-like [Tarenaya hassleriana]
Length=968

 Score =   478 bits (1229),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 279/641 (44%), Positives = 377/641 (59%), Gaps = 56/641 (9%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQH---SPFNANALFEPSYVLPDLEPNNGEL-------MKESEVERK  487
             +GCWLETTDG  F Q    SP  +N + + S++    +P+N +        +   E +RK
Sbjct  35    DGCWLETTDGKSFQQPGGPSPSTSNPMNDSSFLFGYQDPSNSDFGVNPSQNISNEETKRK  94

Query  488   KSSLPENLSASQFHTERVQCFGQNGSNAVCSSG------LAESSELSRRWWIGPMATT--  643
                 P      +      Q   Q   +   +S       L E +E+ RRWWI P A++  
Sbjct  95    FPPSPPTYQKIEHLVVPNQSMNQEPLDLAATSSVQSEKLLVEGAEVGRRWWIAPRASSGA  154

Query  644   --SVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYR  817
               SV DRL+QA+ ++++   DKD LIQIWVP  + G+  L T +QP  ++ K   L  YR
Sbjct  155   SSSVKDRLLQAIQHVQEAVLDKDFLIQIWVPFQKGGKNFLTTLEQPHLVNPKYLSLQKYR  214

Query  818   DISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFA  997
              +S  Y FP +EDS+E+VGLPGRVFLGK+PEWTPDV+ FK EEYPR+  AQ+ DVRG+ A
Sbjct  215   HVSEKYSFPADEDSKESVGLPGRVFLGKLPEWTPDVRFFKSEEYPRIKEAQKCDVRGSLA  274

Query  998   VPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS--  1171
             +PVF++GS TCLGV+E+V TTQK+ YR EL+++CKALE VDLR S   N  +++      
Sbjct  275   LPVFERGSGTCLGVVEIVTTTQKINYRPELENICKALEAVDLRSSSNLNPPSIEFLQVYS  334

Query  1172  --YQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYI  1345
               YQ  LPEI E L S C +  LPLA TW PC +QGK G RHSDEN  +CVST+D AC++
Sbjct  335   EFYQAALPEISEFLVSVCRSFDLPLALTWAPCSRQGKSGSRHSDENYSQCVSTIDFACFV  394

Query  1346  ADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQA  1525
              D + + F EACSEHHLL+G GVVG+AF  N+ CF  D+T+FSKT YPL H+A+IF L A
Sbjct  395   PDEQSKNFLEACSEHHLLQGEGVVGKAFKMNKRCFVPDVTTFSKTNYPLVHHAKIFGLHA  454

Query  1526  AVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqelee  1705
             A+A+ ++S  TG+ + VLEFF P+ C   EE K ML  LS  ++   ++L +V ++E+EE
Sbjct  455   ALAVPVKSKFTGAVELVLEFFFPKACIDTEERKEMLNLLSTTLERDFRSLNLVIDKEIEE  514

Query  1706  ettSPSSKVAKHSD--IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---A  1870
             E   P  +    SD  +   +   NLK ++     +E  SW S  M         S    
Sbjct  515   EVILPVRETMVFSDNPLSGGEAGQNLKPSTLTEISQEESSWISHMMEANRKGKGVSLSWE  574

Query  1871  FQNEKPSEL------------------LYKRLPEFVSG--SGLSFD-------STSGEGS  1969
             +Q E+P E                     + +  F  G  SG   D       ++SG G 
Sbjct  575   YQKEEPKEEFKLTTGWVNNQTDQGHHNFLQGVGNFQQGPSSGPRIDVDPSFVSASSGGGQ  634

Query  1970  AQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                 RR G+K+R KAEKTI L++L+QYFAGSLKDAAKS+GV
Sbjct  635   TLGNRRPGEKRRTKAEKTIGLEVLRQYFAGSLKDAAKSIGV  675



>dbj|BAD33743.1| putative nodule inception protein [Oryza sativa Japonica Group]
Length=872

 Score =   474 bits (1221),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 262/528 (50%), Positives = 351/528 (66%), Gaps = 28/528 (5%)
 Frame = +2

Query  527   HTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPM-ATTSVMDRLIQALGYIKDFSRDK  703
             +T R   F    SN +  + +A ++  +  WWI P  A+TSV +R  QAL YI++   D 
Sbjct  45    NTSRSPNFFATPSNCLTDASVATTTP-ANSWWIQPSGASTSVRERFDQALAYIRETQSDA  103

Query  704   DVLIQIWVPV-NRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLP  880
             DVL+Q+WVPV   DG+ VL T  QPF LD +   L  +R++S  Y+F  +  S  + GLP
Sbjct  104   DVLVQLWVPVKGNDGQLVLTTSGQPFTLDQRSNSLIQFREVSTKYQFSADVASGSSPGLP  163

Query  881   GRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTT  1060
             GRVF+G++PEW+PDV+ F   EYPR+ HAQ  DV GT  +PVF++G+ +CLGVIE+++T 
Sbjct  164   GRVFIGRLPEWSPDVRYFTSYEYPRINHAQYLDVHGTMGLPVFERGNYSCLGVIELIMTK  223

Query  1061  QKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCHSYQVVLPEILEVLKSACATHKLP  1237
             QK+ + +EL+++C AL+ V+L  +++S++   K    SY+  LPEILEVL++AC THKLP
Sbjct  224   QKLNFTSELNTICSALQAVNLTSTEVSSIPRAKLNSASYKDALPEILEVLRAACITHKLP  283

Query  1238  LAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVV  1417
             LAQTWV C QQGK G RHSDEN   C+ST+D+ACY+ +PR+Q FHEACSEHHLL+G GV 
Sbjct  284   LAQTWVTCAQQGKRGSRHSDENYKYCISTIDAACYVNEPRMQSFHEACSEHHLLRGQGVA  343

Query  1418  GRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPR  1597
             G+AF TNQPCF  DI S +K EYPLSH+A+IF+L+ AVAIRLR T TG  DFVLEFFLP 
Sbjct  344   GKAFTTNQPCFLPDIGSSTKLEYPLSHHAKIFNLKGAVAIRLRCTRTGIADFVLEFFLPT  403

Query  1598  DCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNL  1777
             DC+  EE K +L SLS  +++VCQTLRVVT++E+E+E     +++   S  R   +V  L
Sbjct  404   DCEVLEEQKAVLDSLSGTMRSVCQTLRVVTDKEMEDEAMREMNELNSFSP-RGKNKVEEL  462

Query  1778  KYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSEL----LYKRLPEFVSGSGLSF  1945
              +  +     E  SWT+   LV  S         +K S+L     +  L     GS  + 
Sbjct  463   SFGDNTRGDREEASWTT---LVGTS---------QKGSDLAELHTHGMLSHGGHGSSQAG  510

Query  1946  DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLG  2089
             D TS EGS         K+R K EKT++LQ+L+QYFAGSLKDAAKSLG
Sbjct  511   DQTSKEGSKV-------KRRTKTEKTVSLQVLRQYFAGSLKDAAKSLG  551



>ref|XP_006364357.1| PREDICTED: protein NLP2-like isoform X1 [Solanum tuberosum]
 ref|XP_006364358.1| PREDICTED: protein NLP2-like isoform X2 [Solanum tuberosum]
Length=882

 Score =   474 bits (1221),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 273/528 (52%), Positives = 343/528 (65%), Gaps = 38/528 (7%)
 Frame = +2

Query  611   RRWWIGPMATTS------VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQ  772
             RR WIGP   T+      V  RL+QA+ Y+K+++  KDVLIQIWVPVNR G+ VL+T +Q
Sbjct  71    RRLWIGPNTLTNPNPTIPVNTRLVQAIEYLKNYTTHKDVLIQIWVPVNRGGKHVLITNNQ  130

Query  773   PFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYP  952
             P+ L+     L  YR++S  Y+F  E+DS+E VGLPGRVFL K PEWTPDV+ FKREEYP
Sbjct  131   PYFLNPNSHSLLEYRNVSQTYQFAAEKDSKELVGLPGRVFLKKQPEWTPDVRFFKREEYP  190

Query  953   RVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGS  1132
             RV +A +++V G+ A+PVF+ GS TCLGV+E+V T QK     EL+ VCKALE V+LR S
Sbjct  191   RVRYAHQHNVSGSIAIPVFESGSGTCLGVVEIVTTIQKTP---ELEDVCKALEAVNLRSS  247

Query  1133  KIS-NVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENL  1306
             +IS N   +K C+ SY  VL EI  +L   C THKLPLAQTW PC+QQGK G   SDEN 
Sbjct  248   RISSNPSKIKDCNESYLSVLAEIQYILTCVCDTHKLPLAQTWAPCIQQGKGGCLQSDENF  307

Query  1307  LRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEY  1486
               CVSTVDSACY+ D  +  FH ACSEHHLLKG GV G AF TNQPCF+ DIT+FSK EY
Sbjct  308   ASCVSTVDSACYVRDQHVVPFHLACSEHHLLKGEGVAGGAFNTNQPCFAMDITAFSKAEY  367

Query  1487  PLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVC  1666
             PLSH+ARI  L +AVAIRLRS  TGS DFVLEFFLP DCK+ E+ K ML+SLS +IQ  C
Sbjct  368   PLSHHARIVGLCSAVAIRLRSILTGSADFVLEFFLPLDCKNTEDQKIMLSSLSSVIQQSC  427

Query  1667  QtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQ  1846
             ++LRVVT+QEL+EE      +    S    H+E      +SS    ++  SW +  +  Q
Sbjct  428   RSLRVVTDQELQEEKELVQREKVSLSIGGYHEEESRKPVSSSYRD-QDASSWLAEMLDAQ  486

Query  1847  ESCMSSSAF----QNEKPSELLYKRLP---------------------EFVSGSGLSFD-  1948
                  ++A      +E+         P                     E   GSG SFD 
Sbjct  487   RKGKGAAAVSENHNDEQEENFKVTATPWDYTLRESIHASTFSEPNQNFEPKGGSGGSFDF  546

Query  1949  STSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             S+     +   +RAG+++R K EK+I+LQ+L+QYFAGSLKDAAKS+GV
Sbjct  547   SSGTGSHSSGAKRAGERRRSKTEKSISLQVLRQYFAGSLKDAAKSIGV  594



>ref|XP_009384610.1| PREDICTED: protein NLP1-like [Musa acuminata subsp. malaccensis]
Length=930

 Score =   474 bits (1221),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 258/515 (50%), Positives = 333/515 (65%), Gaps = 43/515 (8%)
 Frame = +2

Query  638   TTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYR  817
             T SV  RL   L YIK+  R+ DVL+Q+WVP  R  ++V+ T  QPF LD  C RL +YR
Sbjct  146   TGSVEQRLRYVLKYIKESQREGDVLVQMWVPAMRGNQQVVTTCGQPFLLDFNCQRLVNYR  205

Query  818   DISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFA  997
              +S  Y+F  +E S E VGLPGRVFLG++PEWTPDV+ F   EYPRVG AQRYDVRGT A
Sbjct  206   SVSTRYQFLADESSHEAVGLPGRVFLGRLPEWTPDVRYFSSFEYPRVGDAQRYDVRGTIA  265

Query  998   VPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCHSY  1174
             +P+F++ S +CLGV+EVV+TTQKV Y  +L+++C AL+ VDLR S++ +V  +K T  SY
Sbjct  266   LPIFERNSPSCLGVVEVVMTTQKVNYSYDLENICNALQAVDLRSSEVLSVPRLKMTGDSY  325

Query  1175  QVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADP  1354
                +PEI  VL++AC TH+LPL+QTW+ C+QQG+EG RHSDE+   CVST+D ACYI DP
Sbjct  326   LAAIPEIQMVLRTACETHRLPLSQTWISCIQQGREGSRHSDESFSECVSTIDEACYIQDP  385

Query  1355  RIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVA  1534
              + GF +ACSEHHL +G G+VG+AFMTNQPCFS+D+T FSK EYPLSH+A++F L+AAVA
Sbjct  386   SMLGFQQACSEHHLFRGQGLVGKAFMTNQPCFSSDVTEFSKIEYPLSHHAKLFHLRAAVA  445

Query  1535  IRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvte------qe  1696
             IRLR   +G+ DFVLEFFLP  C   EE K ML SLS+ IQ VCQTLRVVT         
Sbjct  446   IRLRCVHSGNVDFVLEFFLPIHCIEGEEQKLMLNSLSVTIQQVCQTLRVVTTRELEDETM  505

Query  1697  leeettSPSSKVAKHS----------DIRIHKEVPNLKYNSSIGPCE---------EGLS  1819
             LE     PS   + +S          D  +    P +    ++ P           EG S
Sbjct  506   LENNEQIPSDMFSDNSVSAIGQRYIVDELLPSGTPAVGIPKNVLPASVPTERTKEFEGFS  565

Query  1820  ----WTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRR  1987
                 W  S +++    + S   Q+   S   Y           +SF   S E +  N  +
Sbjct  566   VSTHWVPSDVVLPTGNIFSEVKQHHGESNSDYI----------VSF---SAETNVSNAEK  612

Query  1988  AGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             A +K+R K E+T++LQ LQ+YFAGSLKDAA+SLGV
Sbjct  613   ATEKRRAKTERTVSLQELQKYFAGSLKDAARSLGV  647



>ref|XP_002527149.1| hypothetical protein RCOM_0512940 [Ricinus communis]
 gb|EEF35231.1| hypothetical protein RCOM_0512940 [Ricinus communis]
Length=951

 Score =   473 bits (1216),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 285/630 (45%), Positives = 387/630 (61%), Gaps = 51/630 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANA-------LFEPSYVLPDLEPNN--GELMKESEVERKK  490
             +GCWLETTDG  + Q     +         L E S  L    P+    +   E  V    
Sbjct  32    DGCWLETTDGFSYPQTGSSTSTMTDSRSFPLIESSSSLASTNPHQQIHQEATEDNVPENP  91

Query  491   SSLPENLSASQF-HTERVQCFGQNGSNAVCSSG-LAESSELSRRWWIGPMA----TTSVM  652
             S+   NL+  +   T+   C  +N ++ V S G L E SELS+  WIGP A    ++SV 
Sbjct  92    STPLCNLNVKELTETQSQHCSVKNTTSLVQSEGFLNEGSELSKSLWIGPKADPGPSSSVK  151

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
              RL+ A+ ++K +++D +VL+QIWVP  ++G+RVL T DQP  L L    LA+YR +S  
Sbjct  152   QRLMDAIKHLKQYTKDSEVLVQIWVPTKKEGKRVLTTFDQPCFLSLNSESLANYRYVSET  211

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y F VE DS++ +GLPGRVFL K+PE TPDV+ F+REEYPR  +A++Y++ G+ AVPVF+
Sbjct  212   YHFSVEGDSKDFLGLPGRVFLRKLPESTPDVRFFRREEYPRKSYAKQYNISGSLAVPVFE  271

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVLP  1189
             +G+ TCLGV+EVV T++ + YR+EL+++CKALE  DLR S      +VK C  + Q  +P
Sbjct  272   RGTGTCLGVVEVVTTSRNINYRSELETICKALEAFDLRSSHDFCPPSVKACKEFCQSAVP  331

Query  1190  EILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGF  1369
             EI E+L S C  HKLPLA TW  C QQGK G RH DE    C+STVDSAC +AD  +  F
Sbjct  332   EISEILGSVCKKHKLPLALTWARCFQQGKGGCRHFDEKFANCISTVDSACCVADRELYAF  391

Query  1370  HEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRS  1549
             H ACSE +L  G G+VG+AF TN+ CF+ DITSFS+T+YPLSH+A++  L AAVAI LRS
Sbjct  392   HIACSELYLSLGQGIVGKAFTTNKQCFATDITSFSQTDYPLSHHAKVLDLHAAVAIPLRS  451

Query  1550  TCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSK  1729
               TGS DFVLE FLP+DC+  EE K M   +   IQ  CQ L VV E+ELEE+    S +
Sbjct  452   AYTGSADFVLELFLPKDCRDIEEQKAMWDLVPTAIQQACQNLHVVMEKELEEDI---SWQ  508

Query  1730  VAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQES----CMSSSAFQNEKPS--  1891
             +    D R +K+V +   +S   P  EG SW +  +  Q      C+S  + +  K    
Sbjct  509   IPVALDGRHNKQVTHNIASSLKEPFAEGSSWIAQMVEAQRKGKNVCVSWDSPKEPKEEFK  568

Query  1892  ---------ELLYKRLPEFVSGSGL------SFDSTS--------GEGSAQNVRRAGDKK  2002
                      E LY +  + ++G+GL      + DS +        G+ S+ N R+AG+K+
Sbjct  569   VATHWGDALEELYHK--QVLTGTGLLQQDAATKDSITDGCSNPFAGQHSSGN-RKAGEKR  625

Query  2003  RMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R K EKTI+L++L+QYFAGSLKDAAKS+GV
Sbjct  626   RTKTEKTISLEVLRQYFAGSLKDAAKSIGV  655



>emb|CDX96629.1| BnaA08g21720D [Brassica napus]
Length=764

 Score =   466 bits (1200),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 265/589 (45%), Positives = 354/589 (60%), Gaps = 84/589 (14%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTDGSEF      N  +  + S++ P                      P   ++
Sbjct  24    DGCWLETTDGSEF-----LNLTSSDQSSFMWP----------------------PTQDTS  56

Query  518   SQFHTERV-QCFGQNGSNAVCSSGLAESSELSRRWWI-GPMATTSVMDRLIQALGYIKDF  691
             S   +E V Q +GQ+     C+S   +    ++RWWI      +S+ +RL          
Sbjct  57    SICTSEVVSQTYGQD-----CAS--LDEFPWNKRWWIGPGGGGSSITERL----------  99

Query  692   SRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQEN  868
                      +WVPVNR G+RVL T +QP+  D  C RLA+YR++S+NY F  E +DS+  
Sbjct  100   ---------LWVPVNRGGKRVLTTREQPYSHDPTCQRLANYREVSVNYHFSAEKDDSKAL  150

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
              GLPGRVFLGK+PEWTPDV+ F+ EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVIEV
Sbjct  151   AGLPGRVFLGKLPEWTPDVRFFRSEEYPRVHHAQDCDVRGTLAIPVFEQGSKVCLGVIEV  210

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACAT  1225
             V+TT+ VK   EL+S+C+AL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC T
Sbjct  211   VMTTEMVKLAPELESICRALQAVDLRSTEVQIPPSLKGCDLSYKAALPEIRNLLRCACET  270

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             HKLPLAQTWV C+ Q K G RH+DEN + CVST+D ACY+ DP +  FHEACSEHHLLKG
Sbjct  271   HKLPLAQTWVSCLHQSKSGCRHNDENYIHCVSTIDDACYLGDPTVGEFHEACSEHHLLKG  330

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              GV G+AF+TN PCFS D++++ K++YPLSH+A +F L  +VAIRLR   TGS DFVLEF
Sbjct  331   QGVAGQAFLTNGPCFSPDVSNYKKSDYPLSHHANMFGLHGSVAIRLRCIHTGSVDFVLEF  390

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP+DC   EE ++ML +LS I+ +V +     + + + ++     S+V     I I  E
Sbjct  391   FLPKDCGDVEEQRKMLNALSTIMAHVPR-----SLRIVTDKELEDESEVIVTPKIEITSE  445

Query  1766  VPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSF  1945
                   + S  P   GL +                   +   E   KR      G G + 
Sbjct  446   HTKDWLHQSNNPENLGLIFD---------------VGGKASDEFGLKR------GFGYTR  484

Query  1946  DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             DS   E S  + + A D KR KA+KTITL +L+Q+FAGSLKDAAK++GV
Sbjct  485   DSNINESSTFSSQMA-DTKRTKADKTITLDVLRQHFAGSLKDAAKNIGV  532



>ref|XP_006661509.1| PREDICTED: protein NLP1-like [Oryza brachyantha]
Length=799

 Score =   467 bits (1202),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 254/496 (51%), Positives = 336/496 (68%), Gaps = 21/496 (4%)
 Frame = +2

Query  617   WWIGPM-ATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRR-VLVTGDQPFQLDL  790
             WWI P  A+TSV +R  QAL YI++   D DVL+Q+WVP+  DG + VL T  QPF LD 
Sbjct  72    WWIQPSGASTSVRERFDQALAYIRETQSDADVLVQLWVPIKGDGGQLVLTTSGQPFTLDQ  131

Query  791   KCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQ  970
             +   L  +R++S  Y+F  +  S  + GLPGRVF+G++PEW+PDV+ F   EYPRV HAQ
Sbjct  132   RSNSLIQFREVSTKYQFSADVASGSSPGLPGRVFIGRLPEWSPDVRYFTSYEYPRVSHAQ  191

Query  971   RYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVR  1150
               DV GT  +PVF++G+ +CLGVIE+++T QK+ + +E++++C AL+ V+L  +++S++ 
Sbjct  192   YLDVHGTMGLPVFERGNYSCLGVIELIMTKQKLNFTSEINTICSALQAVNLTSTEVSSIP  251

Query  1151  NVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTV  1327
               K +  SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST+
Sbjct  252   RTKLSSASYKDALPEILEVLRAACITHKLPLAQTWVTCAQQGKRGSRHSDENYRYCISTI  311

Query  1328  DSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYAR  1507
             D ACY+ + ++Q FH+ACSEHHLL+G GV G+AF TNQPCF  DI S +K EYPLSH+A+
Sbjct  312   DEACYVNESQMQSFHDACSEHHLLRGQGVAGKAFTTNQPCFLPDIGSSTKLEYPLSHHAK  371

Query  1508  IFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvt  1687
             IF+L+ AVAIRLR T TG  DFVLEFFLP DC+  EE K +L SLS  ++NVCQTLRVVT
Sbjct  372   IFNLKGAVAIRLRCTRTGIADFVLEFFLPTDCEVLEEQKAVLDSLSGTMRNVCQTLRVVT  431

Query  1688  eqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS  1867
             ++E+E+ET    +++   S  R   +V  L +  +     E  SWT    LV  S   S 
Sbjct  432   DKEMEDETMREMNELNSFSP-RGKNKVEELSFGGNTTEHREEASWTG---LVGTSQNGSD  487

Query  1868  AFQNEKPSEL-LYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQ  2044
                    +EL  +  L     GS  + D TS E S         K+R K EKT++LQ+L+
Sbjct  488   L------AELHTHGMLSHGGQGSSQAGDQTSKESSK-------IKRRTKTEKTVSLQVLR  534

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYFAGSLKDAAKSLGV
Sbjct  535   QYFAGSLKDAAKSLGV  550



>ref|XP_004957563.1| PREDICTED: protein NLP1-like isoform X2 [Setaria italica]
 ref|XP_004957564.1| PREDICTED: protein NLP1-like isoform X3 [Setaria italica]
Length=853

 Score =   469 bits (1206),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 255/496 (51%), Positives = 341/496 (69%), Gaps = 20/496 (4%)
 Frame = +2

Query  617   WWI--GPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNR-DGRRVLVTGDQPFQLD  787
             WWI  G  + +SV DR  QAL YI++   D DVL+Q+WVPV+R DGR VL T  QPF LD
Sbjct  83    WWIQTGGASPSSVRDRFSQALSYIRETQSDGDVLVQLWVPVSRGDGRLVLTTSGQPFTLD  142

Query  788   LKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHA  967
                  L  +R++S  Y+F  +  S ++ GLPGRVF+G++PEW+PDV+ F   EYPRV  A
Sbjct  143   QSSDSLIRFREVSTKYQFSADVKSGDSPGLPGRVFIGRLPEWSPDVRYFTTYEYPRVRDA  202

Query  968   QRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNV  1147
             Q  DV GT  +PVF++GS  CLGVIE+++T QK+ + +EL+++C AL+ V+LR +++S+V
Sbjct  203   QYLDVHGTMGLPVFEKGSYNCLGVIELIMTRQKLNFTSELNTICSALQAVNLRSAEVSSV  262

Query  1148  RNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVST  1324
               V+ +  SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST
Sbjct  263   PRVQFSTASYKNALPEILEVLRAACLTHKLPLAQTWVTCAQQGKRGSRHSDENYPYCIST  322

Query  1325  VDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYA  1504
             +D AC++ +P +Q FH+ACSEHHLL+G GV G+AF TNQPCF  DI S +K +YPLSH+A
Sbjct  323   IDEACFVNEPEMQDFHDACSEHHLLRGQGVAGKAFTTNQPCFLPDIGSSAKLDYPLSHHA  382

Query  1505  RIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvv  1684
             +IF L+ AVAIRLR T TG+ DFVLEFFLP DC++ EE K +L SLS  +++VCQTLRVV
Sbjct  383   KIFKLKGAVAIRLRCTRTGTADFVLEFFLPTDCQALEEQKEVLDSLSGTMRSVCQTLRVV  442

Query  1685  teqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSS  1864
             T++E+E+E    ++++   +    +K    L +  +        SWTS   L + S    
Sbjct  443   TDKEMEDEAMRETNELNSFTPQGKNK-AEELSFGGNSADRRGEASWTS---LAETS----  494

Query  1865  SAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQ  2044
                  ++ SEL   R+    S SG    S SG  SA    +A  K+R KAEKT++LQ+L+
Sbjct  495   -----QQESELAALRMHGMFS-SGGQGPSLSGVQSAAEGSKA--KRRTKAEKTVSLQVLR  546

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYFAGSLKDAA+SLGV
Sbjct  547   QYFAGSLKDAARSLGV  562



>ref|XP_011000886.1| PREDICTED: protein NLP2-like [Populus euphratica]
 ref|XP_011000887.1| PREDICTED: protein NLP2-like [Populus euphratica]
 ref|XP_011000889.1| PREDICTED: protein NLP2-like [Populus euphratica]
Length=969

 Score =   471 bits (1213),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 281/631 (45%), Positives = 381/631 (60%), Gaps = 51/631 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGEL----MKESEVERKKSSLPE  505
             +GC  ET D           ++ L +P    P  E N+  L     +E+     + +  E
Sbjct  38    DGCCFETADEFGVLLAGTSASDDLNDPKQYFPLFESNSCNLNVNPCQENYQVATEKNCDE  97

Query  506   NLSASQFHTERVQCFGQNGSN--AVCSSG------LAESSELSRRWWIGP----MATTSV  649
             N        E +   G    N   + +S       L E++EL RR WI P     ++T V
Sbjct  98    NPPIGNPKIEELGVIGSQNQNIHPLTASSVQPGCFLVENNELGRRLWIAPPNNSRSSTGV  157

Query  650   MDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISI  829
              +RL+ A+G +K  ++D+D+LIQIWVP+ ++G+ VL T  QP+ LD K   LA YR++S 
Sbjct  158   RERLMHAIGQLKQCTKDRDLLIQIWVPIKKEGKHVLTTFGQPYLLDPKSQSLASYRNVSK  217

Query  830   NYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVF  1009
              ++FP EEDS+E VGLPGRVFL K+PEWTPDV  F   EYPR  HA+++++RG+FAVPVF
Sbjct  218   KFQFPAEEDSKELVGLPGRVFLRKLPEWTPDVSYFSWVEYPRKHHAKQFNIRGSFAVPVF  277

Query  1010  DQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVL  1186
             +QGSRTCLGVIEVV TTQ V YR EL+SVCKALE VDLR  K     N K C  + Q  +
Sbjct  278   EQGSRTCLGVIEVVTTTQDVSYRPELESVCKALEAVDLRSPKDFRPPNPKACKEFCQAAV  337

Query  1187  PEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQG  1366
             PEI ++L+S C  H+LPLA TW PC +QGK G RH DEN   C+ TV+S+C++A+    G
Sbjct  338   PEISKILESVCKAHRLPLALTWAPCFRQGKGGCRHFDENYSNCICTVNSSCFVAETDNFG  397

Query  1367  FHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLR  1546
             F+ ACSE +L  G G+VGRAF T + CFS D+ +FSKT+YPLSH+A++F L AA+AI ++
Sbjct  398   FYVACSEQYLSFGQGIVGRAFTTRKQCFSTDVAAFSKTDYPLSHHAKMFELHAAIAIPVQ  457

Query  1547  STCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSS  1726
             ST  GS DFVLEFF P+DC + EE KRM   L + I+  C +L VV ++ELEE     + 
Sbjct  458   STYAGSVDFVLEFFFPKDCCNTEEQKRMWDILPVTIKQACWSLHVVMDKELEETV---NK  514

Query  1727  KVAKHSDIRIHK-EVPNLKYNSSIGPCEEG-LSWTSSPMLVQES----CMS---------  1861
             K+   SD R++K E P  K+ S      E   SW +     Q+     C+S         
Sbjct  515   KMVAASDERLNKDETP--KFASLFKESSEAESSWIACVAEAQQKGKGVCVSWDHPKEENK  572

Query  1862  ----SSAFQNEKPSELLYKR-LPEF--------VSGS-GLSFDSTSGEGSAQNVRRAGDK  1999
                  ++  ++   EL +K+  PEF          GS   + D+ S E  +   R++G+K
Sbjct  573   EEYKVTSHWDKTQDELYHKQAFPEFGKFQQNSVPKGSIETTTDAASAEHHSVGSRKSGNK  632

Query  2000  KRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             +R K EKTI+LQ+LQQYFAGSLKDAAKS+GV
Sbjct  633   RRTKTEKTISLQVLQQYFAGSLKDAAKSIGV  663



>ref|XP_010066333.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 ref|XP_010066334.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 gb|KCW64209.1| hypothetical protein EUGRSUZ_G01859 [Eucalyptus grandis]
Length=924

 Score =   470 bits (1210),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 258/610 (42%), Positives = 371/610 (61%), Gaps = 28/610 (5%)
 Frame = +2

Query  341   GCWLETTDGSEFFQHSPFNANALFEPSYVLPDLE----PNNGELMKESEVERKKSSLP--  502
             GCW+ET      F  SP  A     P++ L +      P+        + E + ++ P  
Sbjct  32    GCWVETAAAFSLFPQSPTFAAPNEAPNHSLSEETLTGIPSTDSYQNAFQEETRGNTAPGI  91

Query  503   ---ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRL  661
                 +   S+    R+Q     G+    S G  E +E+S+  W+ P ++    +S+  RL
Sbjct  92    PPSADPQTSELAESRIQDVNSVGN--ATSLGQVEGTEVSQSLWVAPKSSLGLSSSIKLRL  149

Query  662   IQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEF  841
             +QA+ ++ + S+ KD+LIQIWVPV R+GR+VL T DQPF L L    L  YR +S +Y+F
Sbjct  150   MQAISHLSESSKGKDMLIQIWVPVGREGRKVLTTDDQPFSLGLSSRSLQRYRSVSKSYQF  209

Query  842   PVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
               ++ S++++GLPGR FLGK+PEWTPDV+LF  EEYPR+ +A++YDVRG+ AVPVF++GS
Sbjct  210   QADDGSKDHLGLPGRAFLGKLPEWTPDVRLFSTEEYPRINYARQYDVRGSLAVPVFERGS  269

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQVVLPEILE  1201
              TCLGV+E+V T++K+  R++L++VCKALE VDLR ++  N   VK    Y+ V+P ILE
Sbjct  270   GTCLGVVEIVTTSEKINCRSDLENVCKALEAVDLRSTQSFNPSIVKVDVLYEAVIPRILE  329

Query  1202  VLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEAC  1381
              LKS   T+ LPLA TW  C++QGKEG RHSDEN   C+ST+DSAC + D  ++GFHEAC
Sbjct  330   ALKSVTKTYNLPLALTWASCIKQGKEGCRHSDENYSLCLSTMDSACLVVDLEMRGFHEAC  389

Query  1382  SEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTG  1561
             SEHHLLKG G+VG+AF T++P FS D+T+ S TEYPLSH+AR+F LQ+A+AI + +  TG
Sbjct  390   SEHHLLKGQGIVGKAFTTDKPSFSNDVTAISHTEYPLSHHARLFRLQSALAIPVINIYTG  449

Query  1562  STDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKH  1741
               +FVLE FLP+DC   EE KRML  L   I    Q  +  TE++L      P  +    
Sbjct  450   LAEFVLELFLPKDCGDMEEGKRMLNFLCADIHQAFQNSQFFTEKDLSGAIVLPFKETEIA  509

Query  1742  SDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQE-----SCMSSSAFQNEKPSELL--  1900
             ++ ++ K+   +  +S      +  SW +  +  Q      S  S+     ++P  +   
Sbjct  510   TEKKLQKKETEVASSSRKRTSSDESSWMAHMVETQTKGNGVSISSTYDMGTKEPFNITTQ  569

Query  1901  ------YKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGS  2062
                    ++  E ++G     DS S    ++   + G K++ K EKTIT+ +L+QYFAGS
Sbjct  570   HQEFWHLQQDSEHITGVEGRSDSLSLSQHSRGSGKDGQKRQTKMEKTITVDVLRQYFAGS  629

Query  2063  LKDAAKSLGV  2092
             LKDAAK LGV
Sbjct  630   LKDAAKELGV  639



>ref|XP_004957562.1| PREDICTED: protein NLP1-like isoform X1 [Setaria italica]
Length=886

 Score =   468 bits (1203),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 254/496 (51%), Positives = 340/496 (69%), Gaps = 20/496 (4%)
 Frame = +2

Query  617   WWI--GPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNR-DGRRVLVTGDQPFQLD  787
             WWI  G  + +SV DR  QAL YI++   D DVL+Q+WVPV+R DGR VL T  QPF LD
Sbjct  116   WWIQTGGASPSSVRDRFSQALSYIRETQSDGDVLVQLWVPVSRGDGRLVLTTSGQPFTLD  175

Query  788   LKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHA  967
                  L  +R++S  Y+F  +  S ++ GLPGRVF+G++PEW+PDV+ F   EYPRV  A
Sbjct  176   QSSDSLIRFREVSTKYQFSADVKSGDSPGLPGRVFIGRLPEWSPDVRYFTTYEYPRVRDA  235

Query  968   QRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNV  1147
             Q  DV GT  +PVF++GS  CLGVIE+++T QK+ + +EL+++C AL+ V+LR +++S+V
Sbjct  236   QYLDVHGTMGLPVFEKGSYNCLGVIELIMTRQKLNFTSELNTICSALQAVNLRSAEVSSV  295

Query  1148  RNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVST  1324
               V+ +  SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST
Sbjct  296   PRVQFSTASYKNALPEILEVLRAACLTHKLPLAQTWVTCAQQGKRGSRHSDENYPYCIST  355

Query  1325  VDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYA  1504
             +D AC++ +P +Q FH+ACSEHHLL+G GV G+AF TNQPCF  DI S +K +YPLSH+A
Sbjct  356   IDEACFVNEPEMQDFHDACSEHHLLRGQGVAGKAFTTNQPCFLPDIGSSAKLDYPLSHHA  415

Query  1505  RIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvv  1684
             +IF L+ AVAIRLR T TG+ DFVLEFFLP DC++ EE K +L SLS  +++VCQTLRVV
Sbjct  416   KIFKLKGAVAIRLRCTRTGTADFVLEFFLPTDCQALEEQKEVLDSLSGTMRSVCQTLRVV  475

Query  1685  teqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSS  1864
             T++E+E+E    ++++   +    +K    L +  +        SWT            S
Sbjct  476   TDKEMEDEAMRETNELNSFTPQGKNK-AEELSFGGNSADRRGEASWT------------S  522

Query  1865  SAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQ  2044
              A  +++ SEL   R+    S SG    S SG  SA    +A  K+R KAEKT++LQ+L+
Sbjct  523   LAETSQQESELAALRMHGMFS-SGGQGPSLSGVQSAAEGSKA--KRRTKAEKTVSLQVLR  579

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYFAGSLKDAA+SLGV
Sbjct  580   QYFAGSLKDAARSLGV  595



>ref|XP_008653047.1| PREDICTED: protein NLP1-like isoform X2 [Zea mays]
 tpg|DAA62646.1| TPA: putative plant regulator RWP-RK family protein [Zea mays]
Length=851

 Score =   465 bits (1196),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 253/500 (51%), Positives = 340/500 (68%), Gaps = 29/500 (6%)
 Frame = +2

Query  617   WWI--GPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRD-GRRVLVTGDQPFQLD  787
             WWI  G  + +SV +R  QAL YI+D   D DVL+Q+WVPVNRD G+ VL T +QPF LD
Sbjct  80    WWIQTGGASPSSVEERFSQALSYIRDTQSDGDVLVQLWVPVNRDDGKLVLTTSEQPFTLD  139

Query  788   LKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHA  967
              +   L  +R++S  Y+F  +  S ++ GLPGRVF+G++PEW+PD++ F   EYPRV  A
Sbjct  140   HRSDSLLRFREVSTKYQFSADVKSGDSPGLPGRVFIGRLPEWSPDIRYFTSYEYPRVRDA  199

Query  968   QRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNV  1147
             Q  DV GT  +PVF++GS  CLGVIE+++T QK+ + +EL+++C AL+ V+LR +++S++
Sbjct  200   QYLDVHGTMGLPVFEKGSYNCLGVIELIMTRQKINFTSELNTICSALQAVNLRSTEVSSI  259

Query  1148  RNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVST  1324
               +K +  SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST
Sbjct  260   PRIKFSTASYKDALPEILEVLRAACLTHKLPLAQTWVTCAQQGKRGSRHSDENYRYCIST  319

Query  1325  VDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYA  1504
             +D AC++ +  ++GFHEACSEHHLL+G GV G+AF TNQPCF  DI S +K EY LSH+A
Sbjct  320   IDEACFVNEAEMRGFHEACSEHHLLRGEGVAGKAFTTNQPCFLPDIGSSTKLEYSLSHHA  379

Query  1505  RIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvv  1684
             +IF L+ AVAIRLR T TG+ DFVLEFFLP DC++ EE K +L SLS  +++VCQTLRVV
Sbjct  380   KIFKLKGAVAIRLRCTRTGTADFVLEFFLPTDCEALEEQKSVLDSLSGTMRSVCQTLRVV  439

Query  1685  teqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSS  1864
             T++E+E+ET    +++  +S     K+   L +  +        SWT            S
Sbjct  440   TDREMEDETVLEMNEL--NSFTPHGKDKVELSFGCNSADRRGEASWT------------S  485

Query  1865  SAFQNEKPSELLYKRLPEFVS----GSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITL  2032
              A  +++ SEL   R+    S    G  LS    + EGS         K+R KAEKT++L
Sbjct  486   LAGTSQQESELAALRMHGMFSPGGQGPSLSGVQATAEGSKA-------KRRTKAEKTVSL  538

Query  2033  QILQQYFAGSLKDAAKSLGV  2092
             QIL+QYFAGSLKDAA+SLGV
Sbjct  539   QILRQYFAGSLKDAARSLGV  558



>ref|XP_009401874.1| PREDICTED: protein NLP1-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=864

 Score =   465 bits (1196),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 260/515 (50%), Positives = 335/515 (65%), Gaps = 20/515 (4%)
 Frame = +2

Query  581   SGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLV  760
             +G  E+ + + R  +      ++  RL  AL YIK+ + D DVL+QIWVPV R  ++V+ 
Sbjct  96    AGEWEADDSNYRSAMSRQIQPTMKQRLSYALRYIKESNGDGDVLVQIWVPVMRGNQQVVT  155

Query  761   TGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKR  940
             T  QPF L   C  L  YR +S  Y+F  +E+S+E VGLPGRVFLGK+PEWTPDV+ F  
Sbjct  156   TCGQPFLLQSNCQGLVKYRSVSTRYQFLADENSREAVGLPGRVFLGKLPEWTPDVRYFSS  215

Query  941   EEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVD  1120
              E+PRV  AQRY+V GT A+P+F+  SR+CLGV+EVV+ TQKV Y ++ + +C AL+ VD
Sbjct  216   CEFPRVSDAQRYEVCGTIALPIFEMDSRSCLGVVEVVMMTQKVNYSSDFEIICNALQAVD  275

Query  1121  LRGSKISNVRNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSD  1297
             LR S++S+V  +K +  SY   LPEI  VLK+AC TH+LPLAQTW+ C++QGK+G RHSD
Sbjct  276   LRSSEVSSVPRIKMSGDSYHGALPEIQMVLKAACETHRLPLAQTWISCIRQGKKGTRHSD  335

Query  1298  ENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSK  1477
             EN   CVSTVD+ACY+ DP + GFH+ACSEHHLL+G GV G+AFMTNQPCFS+DIT FSK
Sbjct  336   ENFKDCVSTVDAACYVRDPSMSGFHQACSEHHLLRGQGVAGKAFMTNQPCFSSDITDFSK  395

Query  1478  TEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQ  1657
              EYPLSH+A++F L+AAVAIRLR   T   DFVLEFFLP +C   E+ K ML SLS  IQ
Sbjct  396   IEYPLSHHAKLFRLRAAVAIRLRCIHTRKVDFVLEFFLPINCIESEKQKLMLNSLSTTIQ  455

Query  1658  NVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIG---PCEEGLSWTS  1828
              VCQTLRVVT +EL         +    +D RI     + K  S IG      E L   +
Sbjct  456   EVCQTLRVVTTKEL-------EHETVLENDDRIPSGTFSDKSVSEIGQRSTVNEILPVGT  508

Query  1829  SPMLVQESCMSSSAFQNEKPSELLY---KRLPEFVSGSGLSFDSTS----GEGSAQNVRR  1987
               + + E   S  A  +  PS+++        EF    G S D        E +  N+  
Sbjct  509   PDVDITEEGFSILAHWD--PSDIILPTGDMFSEFKQHYGESNDDNQVSFFAEINVSNMDS  566

Query  1988  AGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               +K+  K EK ++LQ LQ+YFAGSLKDAAKSLGV
Sbjct  567   ETEKRHTKTEKIVSLQELQKYFAGSLKDAAKSLGV  601



>ref|XP_008653046.1| PREDICTED: protein NLP1-like isoform X1 [Zea mays]
Length=869

 Score =   464 bits (1195),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 253/500 (51%), Positives = 340/500 (68%), Gaps = 29/500 (6%)
 Frame = +2

Query  617   WWI--GPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRD-GRRVLVTGDQPFQLD  787
             WWI  G  + +SV +R  QAL YI+D   D DVL+Q+WVPVNRD G+ VL T +QPF LD
Sbjct  98    WWIQTGGASPSSVEERFSQALSYIRDTQSDGDVLVQLWVPVNRDDGKLVLTTSEQPFTLD  157

Query  788   LKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHA  967
              +   L  +R++S  Y+F  +  S ++ GLPGRVF+G++PEW+PD++ F   EYPRV  A
Sbjct  158   HRSDSLLRFREVSTKYQFSADVKSGDSPGLPGRVFIGRLPEWSPDIRYFTSYEYPRVRDA  217

Query  968   QRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNV  1147
             Q  DV GT  +PVF++GS  CLGVIE+++T QK+ + +EL+++C AL+ V+LR +++S++
Sbjct  218   QYLDVHGTMGLPVFEKGSYNCLGVIELIMTRQKINFTSELNTICSALQAVNLRSTEVSSI  277

Query  1148  RNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVST  1324
               +K +  SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST
Sbjct  278   PRIKFSTASYKDALPEILEVLRAACLTHKLPLAQTWVTCAQQGKRGSRHSDENYRYCIST  337

Query  1325  VDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYA  1504
             +D AC++ +  ++GFHEACSEHHLL+G GV G+AF TNQPCF  DI S +K EY LSH+A
Sbjct  338   IDEACFVNEAEMRGFHEACSEHHLLRGEGVAGKAFTTNQPCFLPDIGSSTKLEYSLSHHA  397

Query  1505  RIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvv  1684
             +IF L+ AVAIRLR T TG+ DFVLEFFLP DC++ EE K +L SLS  +++VCQTLRVV
Sbjct  398   KIFKLKGAVAIRLRCTRTGTADFVLEFFLPTDCEALEEQKSVLDSLSGTMRSVCQTLRVV  457

Query  1685  teqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSS  1864
             T++E+E+ET    +++  +S     K+   L +  +        SWT            S
Sbjct  458   TDREMEDETVLEMNEL--NSFTPHGKDKVELSFGCNSADRRGEASWT------------S  503

Query  1865  SAFQNEKPSELLYKRLPEFVS----GSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITL  2032
              A  +++ SEL   R+    S    G  LS    + EGS         K+R KAEKT++L
Sbjct  504   LAGTSQQESELAALRMHGMFSPGGQGPSLSGVQATAEGSKA-------KRRTKAEKTVSL  556

Query  2033  QILQQYFAGSLKDAAKSLGV  2092
             QIL+QYFAGSLKDAA+SLGV
Sbjct  557   QILRQYFAGSLKDAARSLGV  576



>ref|XP_009401873.1| PREDICTED: protein NLP1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=894

 Score =   465 bits (1196),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 260/515 (50%), Positives = 335/515 (65%), Gaps = 20/515 (4%)
 Frame = +2

Query  581   SGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLV  760
             +G  E+ + + R  +      ++  RL  AL YIK+ + D DVL+QIWVPV R  ++V+ 
Sbjct  96    AGEWEADDSNYRSAMSRQIQPTMKQRLSYALRYIKESNGDGDVLVQIWVPVMRGNQQVVT  155

Query  761   TGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKR  940
             T  QPF L   C  L  YR +S  Y+F  +E+S+E VGLPGRVFLGK+PEWTPDV+ F  
Sbjct  156   TCGQPFLLQSNCQGLVKYRSVSTRYQFLADENSREAVGLPGRVFLGKLPEWTPDVRYFSS  215

Query  941   EEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVD  1120
              E+PRV  AQRY+V GT A+P+F+  SR+CLGV+EVV+ TQKV Y ++ + +C AL+ VD
Sbjct  216   CEFPRVSDAQRYEVCGTIALPIFEMDSRSCLGVVEVVMMTQKVNYSSDFEIICNALQAVD  275

Query  1121  LRGSKISNVRNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSD  1297
             LR S++S+V  +K +  SY   LPEI  VLK+AC TH+LPLAQTW+ C++QGK+G RHSD
Sbjct  276   LRSSEVSSVPRIKMSGDSYHGALPEIQMVLKAACETHRLPLAQTWISCIRQGKKGTRHSD  335

Query  1298  ENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSK  1477
             EN   CVSTVD+ACY+ DP + GFH+ACSEHHLL+G GV G+AFMTNQPCFS+DIT FSK
Sbjct  336   ENFKDCVSTVDAACYVRDPSMSGFHQACSEHHLLRGQGVAGKAFMTNQPCFSSDITDFSK  395

Query  1478  TEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQ  1657
              EYPLSH+A++F L+AAVAIRLR   T   DFVLEFFLP +C   E+ K ML SLS  IQ
Sbjct  396   IEYPLSHHAKLFRLRAAVAIRLRCIHTRKVDFVLEFFLPINCIESEKQKLMLNSLSTTIQ  455

Query  1658  NVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIG---PCEEGLSWTS  1828
              VCQTLRVVT +EL         +    +D RI     + K  S IG      E L   +
Sbjct  456   EVCQTLRVVTTKEL-------EHETVLENDDRIPSGTFSDKSVSEIGQRSTVNEILPVGT  508

Query  1829  SPMLVQESCMSSSAFQNEKPSELLY---KRLPEFVSGSGLSFDSTS----GEGSAQNVRR  1987
               + + E   S  A  +  PS+++        EF    G S D        E +  N+  
Sbjct  509   PDVDITEEGFSILAHWD--PSDIILPTGDMFSEFKQHYGESNDDNQVSFFAEINVSNMDS  566

Query  1988  AGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               +K+  K EK ++LQ LQ+YFAGSLKDAAKSLGV
Sbjct  567   ETEKRHTKTEKIVSLQELQKYFAGSLKDAAKSLGV  601



>emb|CDY33637.1| BnaC08g19370D [Brassica napus]
Length=761

 Score =   461 bits (1185),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 272/589 (46%), Positives = 362/589 (61%), Gaps = 88/589 (15%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTDGS     SPF+ ++   P                           P   ++
Sbjct  24    DGCWLETTDGSV----SPFDPSSFKWP---------------------------PTQDTS  52

Query  518   SQFHTERV-QCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT-TSVMDRLIQALGYIKDF  691
             S   +E V Q +GQ+     C+S   +    ++RWWIGP    +S+ +RL+         
Sbjct  53    SICTSEVVSQTYGQD-----CAS--LDEFPWNKRWWIGPGGGGSSITERLL---------  96

Query  692   SRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE-EDSQEN  868
                       WVPVNR G+RVL T +QP+  D  C RLA+YR++S+NY F  E +DS+  
Sbjct  97    ----------WVPVNRGGKRVLTTREQPYSHDPTCQRLANYREVSVNYHFSAEKDDSKAL  146

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
              GLPGRVFLG++PEWTPDV+ F+ EEYPRV HAQ  DVRGT A+PVF+QGS+ CLGVIEV
Sbjct  147   AGLPGRVFLGRLPEWTPDVRFFRSEEYPRVHHAQDCDVRGTLAIPVFEQGSKVCLGVIEV  206

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACAT  1225
             V+TT+ VK   EL+S+C+AL+ VDLR +++    ++K C  SY+  LPEI  +L+ AC T
Sbjct  207   VMTTEMVKLAPELESICRALQAVDLRSTEVQIPPSLKGCDLSYKAALPEIRNLLRCACET  266

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             HKLPLAQTWV C+ Q K G RH+DEN + CVST+D ACY+ DP ++ FHEACSEHHLLKG
Sbjct  267   HKLPLAQTWVSCLHQSKSGCRHNDENYIHCVSTIDDACYLGDPTVREFHEACSEHHLLKG  326

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              GV G+AF+TN PCFS D++++ K+EYPLSH+A IF L  +VAIRLR   TGS DFVLEF
Sbjct  327   QGVAGQAFLTNGPCFSPDVSNYKKSEYPLSHHANIFGLHGSVAIRLRCIHTGSVDFVLEF  386

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP+DC   EE +++L +LS I+ +V ++LR+VT++ELE+      S+V     I I  E
Sbjct  387   FLPKDCGDVEEQRKILNALSTIMAHVPRSLRIVTDKELED-----ESEVIVTPKIEITSE  441

Query  1766  VPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSF  1945
                   + S  P   GL +                  ++   E   KR      G G + 
Sbjct  442   HTKDWLHQSNNPENLGLIFD---------------VGDKASDEFGLKR------GFGYTR  480

Query  1946  DSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             DS   E S  + + A + KR KAEKTIT  +L+Q+FAGSLKDAAK++GV
Sbjct  481   DSNINESSTFSSKMA-ETKRTKAEKTITFDVLRQHFAGSLKDAAKNIGV  528



>ref|XP_010530953.1| PREDICTED: protein NLP2-like isoform X3 [Tarenaya hassleriana]
Length=852

 Score =   460 bits (1184),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 252/538 (47%), Positives = 337/538 (63%), Gaps = 36/538 (7%)
 Frame = +2

Query  587   LAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTG  766
             L E +E  RRWWI P  ++SV DRL+ A+ ++++   DK+ LIQIWVP  + G+  L T 
Sbjct  20    LVEGAEAGRRWWICPAPSSSVKDRLVHAIQHLQEAVIDKNFLIQIWVPFQKGGKNFLTTL  79

Query  767   DQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREE  946
             +QP  ++ K   L  YR +S  Y FP +EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ EE
Sbjct  80    EQPHLVNPKYLSLQEYRHVSEKYSFPADEDSKESVGLPGRVFLGKLPEWTPDVRFFRSEE  139

Query  947   YPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLR  1126
             YPR+  AQ+ DVRG+ A+PVF++GS TCLGV+E+V TTQK+ YR EL+++CKALE VDLR
Sbjct  140   YPRIKEAQKCDVRGSLALPVFERGSGTCLGVVEIVTTTQKINYRPELENICKALEAVDLR  199

Query  1127  GSKISNVRNVKTCHS----YQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHS  1294
              S   N+ +++        YQ  LPEI E L S C  + LPLA TW PC +QGK G RHS
Sbjct  200   SSSNLNLPSIEFLQVYNEFYQAALPEISEFLVSVCTLYDLPLALTWAPCARQGKSGCRHS  259

Query  1295  DENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFS  1474
             DEN  +CVST+DSAC++ D   + F EACSEHHLL+G GVVG+AF  N+ CF  D+T+FS
Sbjct  260   DENYSQCVSTIDSACFVPDEHSKNFLEACSEHHLLQGEGVVGKAFKMNKRCFVPDVTTFS  319

Query  1475  KTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIII  1654
             KT YPLSH+A+IF L AA+A+ +++  TG+ +FVLEFFLP+ C   E  K ML  LS  +
Sbjct  320   KTNYPLSHHAKIFGLHAALAVPVKNKYTGAVEFVLEFFLPKACIDTESRKEMLILLSTTL  379

Query  1655  QNVCQtlrvvteqeleeettSPSSKVAKHSD--IRIHKEVPNLKYNSSIGPCEEGLSWTS  1828
             +   ++L +V ++E EEE   P        D  +   +   NLK ++      E  SW S
Sbjct  380   ERDFRSLNLVVDKETEEEVILPVRDTMVFLDHPLGGGEATQNLKSSTLTEISREESSWIS  439

Query  1829  SPMLVQESCMSSS---AFQNEKPSELLY------KRLPE-----FVSGSG----------  1936
               M         S    +Q E+P E            P+     F+SG+G          
Sbjct  440   HMMEANRKGKGVSLSWEYQKEEPKEEFKMTTGWDDNQPDPDHHNFLSGAGQFQRGSSSGF  499

Query  1937  -LSFDST-----SGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              +  D +     SG G     R+ G+K+R K EKTI+L+IL+QYFAGSLKDAAKS+GV
Sbjct  500   MIDIDPSIESPPSGGGQTSGNRKPGEKRRTKTEKTISLEILRQYFAGSLKDAAKSIGV  557



>ref|XP_011040794.1| PREDICTED: protein NLP2-like isoform X2 [Populus euphratica]
Length=945

 Score =   461 bits (1187),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 264/618 (43%), Positives = 374/618 (61%), Gaps = 45/618 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLET +   F Q    +++ L +P    P  EPN+      S  E  +    + L  
Sbjct  34    EGCWLETANEFNFLQAGTISSSDLNDPRQYFPLFEPNSSNSNVNSHQENYQGV--DELGG  91

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT---TSVMDRLIQALGYIKD  688
                  + ++   Q+GS         ES+EL RR WI P AT   + V DRL+ A+G +K+
Sbjct  92    IGSQNQNIRSLDQSGSFP------DESNELGRRLWIAPTATGPSSPVRDRLMHAIGQVKE  145

Query  689   FSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQEN  868
              ++D+DVLIQIWVPV ++G+ VL T  QP+ LD KC  LA YR++S +++FP +EDS+E 
Sbjct  146   CTKDRDVLIQIWVPVKKEGKNVLTTIGQPYLLDRKCQSLASYRNVSKDFQFPADEDSKEL  205

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
             VGLPGRVFL ++PEWTPDV+ F+  EY R  HA++ ++RG+ AVPVF++GSRTCLGVIEV
Sbjct  206   VGLPGRVFLRELPEWTPDVRFFRGVEYLRKSHAKQLNIRGSLAVPVFERGSRTCLGVIEV  265

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVLPEILEVLKSACAT  1225
             V TT+ + YR +L++VCKALE VDLR  +      +K C    Q   PEI ++L+S C  
Sbjct  266   VTTTRDISYRPDLENVCKALEAVDLRSPQDFCPPRLKVCKEVCQAAAPEISKILESVCKA  325

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             H+LPLA  W PC ++GK G RH DE+    +S V+SA ++A+    GF+ ACSE +L  G
Sbjct  326   HRLPLALAWAPCFREGKGGCRHFDESYSYFISLVNSAYFVAERDDWGFYMACSEQYLSFG  385

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              G+VGRAF TN+ C S D+ +FSKT+YPLSH+A++F L AA+AI L+S+  GS DFVLE 
Sbjct  386   QGIVGRAFATNKQCLSTDVAAFSKTDYPLSHHAKMFGLHAAIAIPLQSSYAGSADFVLEL  445

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP+DC++ EE K+M   L I +Q  CQ+  V+ ++ELEE     + K+   SD R HK+
Sbjct  446   FLPKDCRNTEEQKQMSDILPITVQQACQSWHVIMDKELEETV---NKKMVVASDERFHKD  502

Query  1766  VPNLKYNSSI--GPCEEGLSWTSSPMLVQESCMSSSA---------------------FQ  1876
               + K+ SS+     +   SW +  +  Q+     S                       Q
Sbjct  503   -ESQKFASSLFKDSSKAESSWIARTVEAQQKGKGVSVSWDHTKEEPREEFKVKSQRGRTQ  561

Query  1877  NEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRA------GDKKRMKAEKTITLQI  2038
             +++  +  +    +F   SG      +G  S+   R +      GDK+R K EKTI+L++
Sbjct  562   DDRYHKQAFPAFGQFQQNSGPKSSIEAGTDSSSAGRHSLGSIKFGDKRRTKTEKTISLEV  621

Query  2039  LQQYFAGSLKDAAKSLGV  2092
             L+Q+FAGSLKDAAKS+GV
Sbjct  622   LRQHFAGSLKDAAKSIGV  639



>ref|XP_011040792.1| PREDICTED: protein NLP1-like isoform X1 [Populus euphratica]
 ref|XP_011040793.1| PREDICTED: protein NLP1-like isoform X1 [Populus euphratica]
Length=976

 Score =   460 bits (1184),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 264/618 (43%), Positives = 374/618 (61%), Gaps = 45/618 (7%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLET +   F Q    +++ L +P    P  EPN+      S  E  +    + L  
Sbjct  34    EGCWLETANEFNFLQAGTISSSDLNDPRQYFPLFEPNSSNSNVNSHQENYQGV--DELGG  91

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT---TSVMDRLIQALGYIKD  688
                  + ++   Q+GS         ES+EL RR WI P AT   + V DRL+ A+G +K+
Sbjct  92    IGSQNQNIRSLDQSGSFP------DESNELGRRLWIAPTATGPSSPVRDRLMHAIGQVKE  145

Query  689   FSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQEN  868
              ++D+DVLIQIWVPV ++G+ VL T  QP+ LD KC  LA YR++S +++FP +EDS+E 
Sbjct  146   CTKDRDVLIQIWVPVKKEGKNVLTTIGQPYLLDRKCQSLASYRNVSKDFQFPADEDSKEL  205

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
             VGLPGRVFL ++PEWTPDV+ F+  EY R  HA++ ++RG+ AVPVF++GSRTCLGVIEV
Sbjct  206   VGLPGRVFLRELPEWTPDVRFFRGVEYLRKSHAKQLNIRGSLAVPVFERGSRTCLGVIEV  265

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVLPEILEVLKSACAT  1225
             V TT+ + YR +L++VCKALE VDLR  +      +K C    Q   PEI ++L+S C  
Sbjct  266   VTTTRDISYRPDLENVCKALEAVDLRSPQDFCPPRLKVCKEVCQAAAPEISKILESVCKA  325

Query  1226  HKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKG  1405
             H+LPLA  W PC ++GK G RH DE+    +S V+SA ++A+    GF+ ACSE +L  G
Sbjct  326   HRLPLALAWAPCFREGKGGCRHFDESYSYFISLVNSAYFVAERDDWGFYMACSEQYLSFG  385

Query  1406  LGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEF  1585
              G+VGRAF TN+ C S D+ +FSKT+YPLSH+A++F L AA+AI L+S+  GS DFVLE 
Sbjct  386   QGIVGRAFATNKQCLSTDVAAFSKTDYPLSHHAKMFGLHAAIAIPLQSSYAGSADFVLEL  445

Query  1586  FLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKE  1765
             FLP+DC++ EE K+M   L I +Q  CQ+  V+ ++ELEE     + K+   SD R HK+
Sbjct  446   FLPKDCRNTEEQKQMSDILPITVQQACQSWHVIMDKELEETV---NKKMVVASDERFHKD  502

Query  1766  VPNLKYNSSI--GPCEEGLSWTSSPMLVQESCMSSSA---------------------FQ  1876
               + K+ SS+     +   SW +  +  Q+     S                       Q
Sbjct  503   -ESQKFASSLFKDSSKAESSWIARTVEAQQKGKGVSVSWDHTKEEPREEFKVKSQRGRTQ  561

Query  1877  NEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRA------GDKKRMKAEKTITLQI  2038
             +++  +  +    +F   SG      +G  S+   R +      GDK+R K EKTI+L++
Sbjct  562   DDRYHKQAFPAFGQFQQNSGPKSSIEAGTDSSSAGRHSLGSIKFGDKRRTKTEKTISLEV  621

Query  2039  LQQYFAGSLKDAAKSLGV  2092
             L+Q+FAGSLKDAAKS+GV
Sbjct  622   LRQHFAGSLKDAAKSIGV  639



>ref|NP_001151571.1| NIN-like protein 1 [Zea mays]
 ref|XP_008668122.1| PREDICTED: NIN-like protein 1 isoform X1 [Zea mays]
 ref|XP_008668123.1| PREDICTED: NIN-like protein 1 isoform X1 [Zea mays]
 gb|ACG43389.1| NIN-like protein 1 [Zea mays]
Length=851

 Score =   457 bits (1175),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 247/496 (50%), Positives = 332/496 (67%), Gaps = 22/496 (4%)
 Frame = +2

Query  617   WWI--GPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRD-GRRVLVTGDQPFQLD  787
             W I  G  +T SV +R  QAL YI+D   D DVL+Q+WVPVNRD G+ VL T  QPF LD
Sbjct  81    WLIQTGGASTPSVRERFSQALSYIRDTQSDGDVLVQLWVPVNRDDGKLVLTTSGQPFTLD  140

Query  788   LKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHA  967
              +   L  +R++S  Y+FP +  S E+ GLPGRVF+G++PEW+PD++ F   EY RV  A
Sbjct  141   HRSDSLIRFREVSTKYQFPADVRSGESPGLPGRVFIGRLPEWSPDIRCFTSYEYARVTDA  200

Query  968   QRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNV  1147
             +  DV GT  +PVF++ S +CLGVIE+++T QK+ + +EL+++C AL+ V+LR +++S++
Sbjct  201   KYLDVHGTMGLPVFEKRSYSCLGVIELIMTKQKLNFTSELNTICSALQAVNLRSTEVSSI  260

Query  1148  -RNVKTCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVST  1324
              R   +  SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST
Sbjct  261   PRKKFSTASYKDALPEILEVLRAACLTHKLPLAQTWVTCTQQGKRGSRHSDENYRYCIST  320

Query  1325  VDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYA  1504
             +D AC++ +  ++GFHEACSEHHLL+G GV G+A  TNQPCF  DI S +K EYPLSH+A
Sbjct  321   IDEACFVNEAEMRGFHEACSEHHLLRGEGVAGKALTTNQPCFLPDIGSSTKLEYPLSHHA  380

Query  1505  RIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvv  1684
             +IF L+ AVAIRLR T TG  DFVLEFFLP DC++ EE K +L SLS  +++VCQTLRVV
Sbjct  381   KIFRLKGAVAIRLRCTRTGIADFVLEFFLPTDCEALEEQKTVLDSLSGTMRSVCQTLRVV  440

Query  1685  teqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSS  1864
             T++E+E E     +++   +     K+  +   NS+      G SWT        S   +
Sbjct  441   TDREMEGEAALEMNELNSFTPPEKDKDELSFGGNSAD---RRGASWT--------SLAGT  489

Query  1865  SAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQ  2044
             S  + E  +  ++        G  LS    + EGS         K+R KAEKT++LQ+L+
Sbjct  490   SQQEPELAALRMHGTFSPVGQGPSLSGVQATAEGSKT-------KRRTKAEKTVSLQVLR  542

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYFAGSLKDAA+SLGV
Sbjct  543   QYFAGSLKDAARSLGV  558



>ref|XP_003578585.1| PREDICTED: protein NLP1 isoform X2 [Brachypodium distachyon]
Length=843

 Score =   456 bits (1173),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 243/495 (49%), Positives = 338/495 (68%), Gaps = 23/495 (5%)
 Frame = +2

Query  620   WIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPV-NRDGRRVLVTGDQPFQLDLKC  796
             WI   ++++   RL QAL YI++  RD DVL+Q+W+PV + DG+ VL T  QPF LD   
Sbjct  77    WI--QSSSTFRQRLDQALAYIEETQRDTDVLVQLWMPVKSNDGQLVLTTSGQPFTLDKSS  134

Query  797   PRLAHYRDISINYEFPVEEDSQEN-VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQR  973
               L  +RD+S +Y+F  +  S+ + VGLPGRVF+GK+PEW+PDV+ F   EYPRV HAQ 
Sbjct  135   ESLKRFRDVSTHYQFSADVASESSPVGLPGRVFIGKLPEWSPDVRYFTSYEYPRVNHAQD  194

Query  974   YDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRN  1153
              DV GT  +PVF++G+ +CLGV+E+++T QK+ + +E++++C AL+ V+LR +++S++  
Sbjct  195   LDVHGTMGLPVFEKGNYSCLGVMELIMTRQKLNFTSEINNICSALQAVNLRSTEVSSIPR  254

Query  1154  VK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVD  1330
              K    SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST+D
Sbjct  255   TKFNSASYKDALPEILEVLRAACITHKLPLAQTWVTCDQQGKRGSRHSDENYRYCISTID  314

Query  1331  SACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARI  1510
             +ACY+ DP +Q FH +CSEHHLL+G GV G+AF TNQPCF  DI S +K EYPLSH+A+I
Sbjct  315   AACYVNDPCMQNFHYSCSEHHLLRGQGVAGKAFTTNQPCFLPDIGSSTKLEYPLSHHAKI  374

Query  1511  FSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvte  1690
             F+L+ AVAIRLR T TG+ DFVLEFFLP DC++ EE K +L SLS  +++VCQTLRVVT+
Sbjct  375   FNLKGAVAIRLRCTRTGTADFVLEFFLPTDCEALEEQKAVLDSLSGTMRSVCQTLRVVTD  434

Query  1691  qeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA  1870
             +E+E+E     +++      +   +V    +        E  SWTS         ++ ++
Sbjct  435   KEMEDEAMLEMNELNSFGP-KGKNKVKEFSFGGKATEHREEASWTS---------LAGTS  484

Query  1871  FQNEKPSEL-LYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQ  2047
              +    +EL ++        GS L+   T+ +GS         K+R K EKT++LQ+L+Q
Sbjct  485   QKESDLAELSIHGMFSPGGQGSSLAGVQTTAQGSK-------GKRRTKTEKTVSLQVLRQ  537

Query  2048  YFAGSLKDAAKSLGV  2092
             YFAGSLKDAAK+LGV
Sbjct  538   YFAGSLKDAAKNLGV  552



>ref|XP_006384842.1| nodule inception family protein [Populus trichocarpa]
 gb|ERP62639.1| nodule inception family protein [Populus trichocarpa]
Length=925

 Score =   457 bits (1177),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 270/619 (44%), Positives = 370/619 (60%), Gaps = 67/619 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             EGCWLET D   F Q    +++ L +P    P  EPN+                  + S 
Sbjct  34    EGCWLETADEFNFLQAGTISSSDLNDPRQYFPLFEPNS------------------SNSN  75

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT---TSVMDRLIQALGYIKD  688
                H E  Q   Q+GS  V      ES+EL RR WI P AT   + V DRL+ A+G +K+
Sbjct  76    VNSHQENYQ--DQSGSFPV------ESNELGRRLWIAPTATGPSSPVRDRLMHAIGQVKE  127

Query  689   FSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQEN  868
              ++D+DVLIQIWVPV ++G+ VL T  QP+ LD KC  LA YR++S +++FP +EDS+E 
Sbjct  128   CTKDRDVLIQIWVPVKKEGKNVLTTIGQPYLLDRKCQSLASYRNVSKDFQFPADEDSKEL  187

Query  869   VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEV  1048
             VGLPGRVFL ++PEWTPDV+ F   EY R  HA+++++RG+ AVPVF+QGSRTCLGVIEV
Sbjct  188   VGLPGRVFLRELPEWTPDVRFFSGVEYLRKNHAKQFNIRGSLAVPVFEQGSRTCLGVIEV  247

Query  1049  VLTTQKVKYRNELDSVCKALEEVDLRGSK--ISNVRNVKTCHSYQVVLPEILEVLKSACA  1222
             V TT+ + YR +L++VCKALE VDLR  +         K C   Q   PEI ++L+S C 
Sbjct  248   VTTTRDISYRPDLENVCKALEAVDLRSPQDFCPPSLKAKVC---QAAAPEISKILESVCK  304

Query  1223  THKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLK  1402
              H+LPLA  W PC ++GK G RH DE+    +S V+SA ++A+    GF+ ACSE +L  
Sbjct  305   AHRLPLALAWAPCFREGKGGCRHFDESYSYFISLVNSAYFVAERDDWGFYMACSEQYLSF  364

Query  1403  GLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLE  1582
             G G+VGRAF TN+ C S D+ +FSKT+YPLSH+A++F L AA+AI L+S+  GS DFVLE
Sbjct  365   GHGIVGRAFATNKQCLSTDVAAFSKTDYPLSHHAKMFGLHAAIAIPLQSSYAGSADFVLE  424

Query  1583  FFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHK  1762
              FLP+DC++ EE K+M   L I +Q  CQ+  V+ ++ELEE     + K+   SD R HK
Sbjct  425   LFLPKDCRNTEEQKQMWDILPITVQQACQSWHVIMDKELEETV---NKKMVVASDERFHK  481

Query  1763  EVPNLKYNSSI--GPCEEGLSWTSSPMLVQESCMSSSA---FQNEKPSELL---------  1900
             +  + K+ SS+     +   SW +  +  Q+     S       E+P E           
Sbjct  482   D-ESQKFASSLFKDSSKAESSWIARTVEAQQKGKGVSVSWDHTKEEPREEFKVKSQWGRT  540

Query  1901  ---------YKRLPEFVSGSGLSFDSTSGEGSAQNVRRA------GDKKRMKAEKTITLQ  2035
                      +    +F   SG      +G  S+   R +      GDK+R K EKTI+L+
Sbjct  541   QDDTYHKQAFPAFGQFQQNSGPKSSIEAGTDSSSAGRHSLGSIKFGDKRRTKTEKTISLE  600

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +L+Q+FAGSLKDAAKS+GV
Sbjct  601   VLRQHFAGSLKDAAKSIGV  619



>ref|XP_008668121.1| PREDICTED: NIN-like protein 1 isoform X2 [Zea mays]
 tpg|DAA40695.1| TPA: putative plant regulator RWP-RK family protein [Zea mays]
Length=872

 Score =   456 bits (1172),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 247/496 (50%), Positives = 332/496 (67%), Gaps = 22/496 (4%)
 Frame = +2

Query  617   WWI--GPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRD-GRRVLVTGDQPFQLD  787
             W I  G  +T SV +R  QAL YI+D   D DVL+Q+WVPVNRD G+ VL T  QPF LD
Sbjct  102   WLIQTGGASTPSVRERFSQALSYIRDTQSDGDVLVQLWVPVNRDDGKLVLTTSGQPFTLD  161

Query  788   LKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHA  967
              +   L  +R++S  Y+FP +  S E+ GLPGRVF+G++PEW+PD++ F   EY RV  A
Sbjct  162   HRSDSLIRFREVSTKYQFPADVRSGESPGLPGRVFIGRLPEWSPDIRCFTSYEYARVTDA  221

Query  968   QRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNV  1147
             +  DV GT  +PVF++ S +CLGVIE+++T QK+ + +EL+++C AL+ V+LR +++S++
Sbjct  222   KYLDVHGTMGLPVFEKRSYSCLGVIELIMTKQKLNFTSELNTICSALQAVNLRSTEVSSI  281

Query  1148  -RNVKTCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVST  1324
              R   +  SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST
Sbjct  282   PRKKFSTASYKDALPEILEVLRAACLTHKLPLAQTWVTCTQQGKRGSRHSDENYRYCIST  341

Query  1325  VDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYA  1504
             +D AC++ +  ++GFHEACSEHHLL+G GV G+A  TNQPCF  DI S +K EYPLSH+A
Sbjct  342   IDEACFVNEAEMRGFHEACSEHHLLRGEGVAGKALTTNQPCFLPDIGSSTKLEYPLSHHA  401

Query  1505  RIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvv  1684
             +IF L+ AVAIRLR T TG  DFVLEFFLP DC++ EE K +L SLS  +++VCQTLRVV
Sbjct  402   KIFRLKGAVAIRLRCTRTGIADFVLEFFLPTDCEALEEQKTVLDSLSGTMRSVCQTLRVV  461

Query  1685  teqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSS  1864
             T++E+E E     +++   +     K+  +   NS+      G SWT        S   +
Sbjct  462   TDREMEGEAALEMNELNSFTPPEKDKDELSFGGNSAD---RRGASWT--------SLAGT  510

Query  1865  SAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQ  2044
             S  + E  +  ++        G  LS    + EGS         K+R KAEKT++LQ+L+
Sbjct  511   SQQEPELAALRMHGTFSPVGQGPSLSGVQATAEGSKT-------KRRTKAEKTVSLQVLR  563

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYFAGSLKDAA+SLGV
Sbjct  564   QYFAGSLKDAARSLGV  579



>ref|XP_010238468.1| PREDICTED: protein NLP1 isoform X1 [Brachypodium distachyon]
Length=903

 Score =   456 bits (1173),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 243/495 (49%), Positives = 338/495 (68%), Gaps = 23/495 (5%)
 Frame = +2

Query  620   WIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPV-NRDGRRVLVTGDQPFQLDLKC  796
             WI   ++++   RL QAL YI++  RD DVL+Q+W+PV + DG+ VL T  QPF LD   
Sbjct  137   WI--QSSSTFRQRLDQALAYIEETQRDTDVLVQLWMPVKSNDGQLVLTTSGQPFTLDKSS  194

Query  797   PRLAHYRDISINYEFPVEEDSQEN-VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQR  973
               L  +RD+S +Y+F  +  S+ + VGLPGRVF+GK+PEW+PDV+ F   EYPRV HAQ 
Sbjct  195   ESLKRFRDVSTHYQFSADVASESSPVGLPGRVFIGKLPEWSPDVRYFTSYEYPRVNHAQD  254

Query  974   YDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRN  1153
              DV GT  +PVF++G+ +CLGV+E+++T QK+ + +E++++C AL+ V+LR +++S++  
Sbjct  255   LDVHGTMGLPVFEKGNYSCLGVMELIMTRQKLNFTSEINNICSALQAVNLRSTEVSSIPR  314

Query  1154  VK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVD  1330
              K    SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST+D
Sbjct  315   TKFNSASYKDALPEILEVLRAACITHKLPLAQTWVTCDQQGKRGSRHSDENYRYCISTID  374

Query  1331  SACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARI  1510
             +ACY+ DP +Q FH +CSEHHLL+G GV G+AF TNQPCF  DI S +K EYPLSH+A+I
Sbjct  375   AACYVNDPCMQNFHYSCSEHHLLRGQGVAGKAFTTNQPCFLPDIGSSTKLEYPLSHHAKI  434

Query  1511  FSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvte  1690
             F+L+ AVAIRLR T TG+ DFVLEFFLP DC++ EE K +L SLS  +++VCQTLRVVT+
Sbjct  435   FNLKGAVAIRLRCTRTGTADFVLEFFLPTDCEALEEQKAVLDSLSGTMRSVCQTLRVVTD  494

Query  1691  qeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA  1870
             +E+E+E     +++      +   +V    +        E  SWTS         ++ ++
Sbjct  495   KEMEDEAMLEMNELNSFGP-KGKNKVKEFSFGGKATEHREEASWTS---------LAGTS  544

Query  1871  FQNEKPSEL-LYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQ  2047
              +    +EL ++        GS L+   T+ +GS         K+R K EKT++LQ+L+Q
Sbjct  545   QKESDLAELSIHGMFSPGGQGSSLAGVQTTAQGSK-------GKRRTKTEKTVSLQVLRQ  597

Query  2048  YFAGSLKDAAKSLGV  2092
             YFAGSLKDAAK+LGV
Sbjct  598   YFAGSLKDAAKNLGV  612



>ref|XP_009413456.1| PREDICTED: protein NLP1-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   454 bits (1169),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 255/547 (47%), Positives = 346/547 (63%), Gaps = 49/547 (9%)
 Frame = +2

Query  581   SGLAESSELSR----RWWIGPMATT-SVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDG  745
             SG+  +++LS     R  I P  +   V +R +QAL +IKD  RD +VL+Q+WVPV R  
Sbjct  123   SGVVRTADLSSKPGTRRSIQPSDSNFYVKERFMQALYHIKDARRDSEVLVQLWVPVKRGD  182

Query  746   RRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDV  925
             + +L T  QPF L+  C +L +YR++S NY F  + +S + +GLPGRVFLG++PEWTPDV
Sbjct  183   QLILTTYSQPFSLNPNCEKLMNYREVSTNYHFSAQANSGKVLGLPGRVFLGRLPEWTPDV  242

Query  926   QLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKA  1105
             + F   EY RV +AQR D+RG+ A+PVFDQGSR+CLGV+EVV+TTQK+ Y  EL+ +C A
Sbjct  243   RFFSSYEYLRVDYAQRLDIRGSIAIPVFDQGSRSCLGVVEVVMTTQKLNYSVELEKICNA  302

Query  1106  LEEVDLRGSKISNVRNVKT-CHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEG  1282
             L+ VDLR S +++V   +    SYQ  LPEILEVLK+ C  H LPLAQTW+PC+QQGK G
Sbjct  303   LQAVDLRSSAVASVPRFEVGSGSYQAALPEILEVLKAVCRMHMLPLAQTWIPCIQQGKRG  362

Query  1283  LRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADI  1462
             +RHSDEN   CVST D+A Y+ DP +  FHEACSEHHLL+G G  GRAF TNQPCF +D+
Sbjct  363   IRHSDENYRHCVSTSDAAYYVNDPSMIEFHEACSEHHLLRGQGAAGRAFTTNQPCFVSDV  422

Query  1463  TSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSL  1642
             T+ SKTEYPLSH+A++F L+ AVAI ++S  +G+ DFVLEFFLP +C   EE K+ML SL
Sbjct  423   TASSKTEYPLSHHAKMFGLRGAVAICMQSILSGNVDFVLEFFLPTNCILIEEQKQMLDSL  482

Query  1643  SIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEV----PNLKYN--SSIGPC  1804
             S  IQ VC+TL V   +EL +      +++  H  I + K      P  KY+  +S+   
Sbjct  483   SGTIQQVCRTLSVAKSKELADANMLQKNEMIPH--ILLEKSFSEAQPAQKYDPVTSLDAR  540

Query  1805  EEGLSWTSSPMLVQESCMSSS------AFQNEK-------------------PSELLYKR  1909
              + L     P     S M +S       F+ +K                   P+  ++ +
Sbjct  541   TKKLHRNLPPWFT--STMKNSVNKRGHTFKFKKSEAEGFSITTDRGYTEEVLPAAEIFLK  598

Query  1910  LPEFVSGSGLSFDSTSGEGSAQ------NVRRAGDKKRMKAEKTITLQILQQYFAGSLKD  2071
             L     G  LS D T  E S+          +   K+R K+EKT++L++L+ +FAGSLKD
Sbjct  599   LGHHRKG--LSKDVTDIENSSNFNSTCSEAAKTTAKRRRKSEKTVSLEVLRTHFAGSLKD  656

Query  2072  AAKSLGV  2092
             AAK++GV
Sbjct  657   AAKNIGV  663



>ref|XP_006828708.1| hypothetical protein AMTR_s00001p00009420, partial [Amborella 
trichopoda]
 gb|ERM96124.1| hypothetical protein AMTR_s00001p00009420, partial [Amborella 
trichopoda]
Length=621

 Score =   444 bits (1142),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 263/614 (43%), Positives = 361/614 (59%), Gaps = 54/614 (9%)
 Frame = +2

Query  341   GCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSAS  520
             G WL+  D S+  Q  P  +++L +PSY +  +  N        +  ++++ + EN   +
Sbjct  31    GSWLDAVDCSDLSQPGPSTSSSLLDPSYFVSPVYINTQNPQNTDQDYQEQAVIFENPMEN  90

Query  521   QFHTERVQCFGQNGSNAVCSSGLAES--------SELSRRWWIGPMATTSVMDRLIQALG  676
                    Q    N   ++   G  +S          + +RW + P   + V DRL+QA+ 
Sbjct  91    PSENLETQSMNHN---SISKLGFPDSQWPPNSTTGSIMKRW-VNPNLVSPVNDRLMQAIQ  146

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
              IK+ + + DVL+QIWVPV +    VL T +QPF LD +   L  YR +S+NY F   E 
Sbjct  147   IIKESTSNGDVLVQIWVPVKKGDSHVLTTCEQPFILDPRSQTLTRYRTVSMNYFFSAGEG  206

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
             S   +GLPG                    EYPRV +AQ +DVRGT A+PVF++GSR CLG
Sbjct  207   SGGVLGLPGS------------------NEYPRVNYAQEFDVRGTLALPVFEKGSRACLG  248

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKS  1213
             V+EV++T QK+ Y  ELD +C+AL+ VDLR S++     VK  +  +Q   PEIL+VLK+
Sbjct  249   VVEVIMTDQKINYAPELDKICRALQAVDLRSSEVLTPPYVKVRNDGFQSAFPEILDVLKA  308

Query  1214  ACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHH  1393
              C TH+LPLAQTWVPC+Q GK+G RH+DE+   CVST D ACY+ D  + GF EACSEHH
Sbjct  309   VCETHRLPLAQTWVPCIQHGKKGSRHTDESYKDCVSTADGACYVRDSEMTGFQEACSEHH  368

Query  1394  LLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDF  1573
             L KG GV G+AF TNQPCFS D+TSFSK ++PL HYAR+F L AAVAIRL+ST TG+ D+
Sbjct  369   LFKGQGVAGKAFATNQPCFSPDVTSFSKMDFPLVHYARVFGLGAAVAIRLKSTYTGAADY  428

Query  1574  VLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP------SSKVA  1735
             V+EFFLP DC+  EE K ML SLS+ IQ VC++LRVVT++ELE+E  +       S K+A
Sbjct  429   VMEFFLPVDCRDNEEQKMMLNSLSVTIQQVCRSLRVVTDKELEDEMMTQVNDVFCSDKMA  488

Query  1736  KHSDIRIHKEVPNLKYN---SSIGPC---EEGLSWTSSP--------MLVQESCMSSSAF  1873
               S  +   E P+   N   S +G     + G+  +S P        ++V +SC   S  
Sbjct  489   SKSR-KADVENPSGDLNKSSSGVGASWREKTGVFLSSMPSGFQEGRDIMVAQSCHWGSPR  547

Query  1874  QNEKPSELLYK--RLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQ  2047
              +       +K  +  +  + S     S  GE    N  +  +K+R K EK I+LQ+L+Q
Sbjct  548   VSCHEGGRFFKVEQHQDSANNSADRGQSFVGELDFSNAGKGPEKRRAKTEKNISLQVLRQ  607

Query  2048  YFAGSLKDAAKSLG  2089
             YFAGSLKDAAKS+G
Sbjct  608   YFAGSLKDAAKSIG  621



>ref|XP_009413450.1| PREDICTED: protein NLP1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=999

 Score =   454 bits (1168),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 255/547 (47%), Positives = 346/547 (63%), Gaps = 49/547 (9%)
 Frame = +2

Query  581   SGLAESSELSR----RWWIGPMATT-SVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDG  745
             SG+  +++LS     R  I P  +   V +R +QAL +IKD  RD +VL+Q+WVPV R  
Sbjct  168   SGVVRTADLSSKPGTRRSIQPSDSNFYVKERFMQALYHIKDARRDSEVLVQLWVPVKRGD  227

Query  746   RRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDV  925
             + +L T  QPF L+  C +L +YR++S NY F  + +S + +GLPGRVFLG++PEWTPDV
Sbjct  228   QLILTTYSQPFSLNPNCEKLMNYREVSTNYHFSAQANSGKVLGLPGRVFLGRLPEWTPDV  287

Query  926   QLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKA  1105
             + F   EY RV +AQR D+RG+ A+PVFDQGSR+CLGV+EVV+TTQK+ Y  EL+ +C A
Sbjct  288   RFFSSYEYLRVDYAQRLDIRGSIAIPVFDQGSRSCLGVVEVVMTTQKLNYSVELEKICNA  347

Query  1106  LEEVDLRGSKISNVRNVKT-CHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEG  1282
             L+ VDLR S +++V   +    SYQ  LPEILEVLK+ C  H LPLAQTW+PC+QQGK G
Sbjct  348   LQAVDLRSSAVASVPRFEVGSGSYQAALPEILEVLKAVCRMHMLPLAQTWIPCIQQGKRG  407

Query  1283  LRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADI  1462
             +RHSDEN   CVST D+A Y+ DP +  FHEACSEHHLL+G G  GRAF TNQPCF +D+
Sbjct  408   IRHSDENYRHCVSTSDAAYYVNDPSMIEFHEACSEHHLLRGQGAAGRAFTTNQPCFVSDV  467

Query  1463  TSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSL  1642
             T+ SKTEYPLSH+A++F L+ AVAI ++S  +G+ DFVLEFFLP +C   EE K+ML SL
Sbjct  468   TASSKTEYPLSHHAKMFGLRGAVAICMQSILSGNVDFVLEFFLPTNCILIEEQKQMLDSL  527

Query  1643  SIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEV----PNLKYN--SSIGPC  1804
             S  IQ VC+TL V   +EL +      +++  H  I + K      P  KY+  +S+   
Sbjct  528   SGTIQQVCRTLSVAKSKELADANMLQKNEMIPH--ILLEKSFSEAQPAQKYDPVTSLDAR  585

Query  1805  EEGLSWTSSPMLVQESCMSSS------AFQNEK-------------------PSELLYKR  1909
              + L     P     S M +S       F+ +K                   P+  ++ +
Sbjct  586   TKKLHRNLPPWFT--STMKNSVNKRGHTFKFKKSEAEGFSITTDRGYTEEVLPAAEIFLK  643

Query  1910  LPEFVSGSGLSFDSTSGEGSAQ------NVRRAGDKKRMKAEKTITLQILQQYFAGSLKD  2071
             L     G  LS D T  E S+          +   K+R K+EKT++L++L+ +FAGSLKD
Sbjct  644   LGHHRKG--LSKDVTDIENSSNFNSTCSEAAKTTAKRRRKSEKTVSLEVLRTHFAGSLKD  701

Query  2072  AAKSLGV  2092
             AAK++GV
Sbjct  702   AAKNIGV  708



>gb|EMS65172.1| hypothetical protein TRIUR3_11978 [Triticum urartu]
Length=784

 Score =   447 bits (1150),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 238/499 (48%), Positives = 328/499 (66%), Gaps = 30/499 (6%)
 Frame = +2

Query  620   WIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVP-VNRDGRRVLVTGDQPFQLDLKC  796
             WI P A+++V  R  QAL YIK   RD  +L+Q+WVP  N DG+ VL T  QPF LD   
Sbjct  60    WIPP-ASSTVRQRFEQALDYIKQMQRDAGMLVQLWVPQKNCDGKLVLTTSGQPFTLDNTS  118

Query  797   PRLAHYRDISINYEFPVEEDSQEN-VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQR  973
              RL  +RD+S +Y F  +  S+ + VGLPGRVF+GK+PEW+PDV+LF   EYPRV +AQ 
Sbjct  119   DRLMQFRDVSTHYHFSADVGSEASPVGLPGRVFIGKLPEWSPDVRLFTSYEYPRVKYAQD  178

Query  974   YDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNV-R  1150
              DV GT  +PVF++GS +CLGV+E+++T QK+ + +E++ +C+AL+ V+LR +++S+  R
Sbjct  179   LDVHGTMGLPVFEKGSYSCLGVMELIMTRQKLNFTSEINDICRALQAVNLRSTEVSSTPR  238

Query  1151  NVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTV  1327
               K    SY+  LPEILEVL++AC TH LPLAQTWV C QQGK G RH+DEN   C+ST+
Sbjct  239   ATKFNSASYKDALPEILEVLRAACVTHNLPLAQTWVTCAQQGKGGSRHTDENYPYCISTI  298

Query  1328  DSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYAR  1507
             D+ACY+ DP++Q FH++CS+HHLL+G GV G+AF TNQPCF  DI S +K  YPLSH+A+
Sbjct  299   DTACYVNDPQMQNFHDSCSDHHLLRGQGVAGKAFETNQPCFLPDIGSSAKEHYPLSHHAK  358

Query  1508  IFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvt  1687
             IF+L+ AVAIRLR T TG+ DFVLEFFLP +C++ EE K +L SLS  +++ C+TL    
Sbjct  359   IFNLKGAVAIRLRCTRTGTADFVLEFFLPTNCEALEEQKAVLDSLSGTMRSACRTL----  414

Query  1688  eqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCE----EGLSWTSSPMLVQESC  1855
                          +V    +I   +E+  +   +S GP      E LS+ +     +E  
Sbjct  415   -------------RVVTDKEIG-DEEMLEVNELNSFGPQGKNKVEELSFGNQATEHREEA  460

Query  1856  MSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQ  2035
               +S  +  K S+L    +   +S  G        + SAQ  +    K+R K EKT++L 
Sbjct  461   SWTSLARTSKESDLAELSMHGMLSPVGQGLSPAGAQTSAQGSK---GKRRTKTEKTVSLP  517

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +L+QYFAGSLKDAA+SLGV
Sbjct  518   VLRQYFAGSLKDAARSLGV  536



>dbj|BAJ89813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=841

 Score =   448 bits (1153),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 242/499 (48%), Positives = 332/499 (67%), Gaps = 22/499 (4%)
 Frame = +2

Query  608   SRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVP-VNRDGRRVLVTGDQPFQL  784
             S   WI P ++T V  R  QAL +IK   RD  +L+Q+WVP  N DG+ VL T  QPF L
Sbjct  70    SSALWIQPPSST-VRQRFEQALDHIKQMQRDAGMLVQLWVPQKNSDGKLVLTTSGQPFTL  128

Query  785   DLKCPRLAHYRDISINYEFPVEEDSQEN-VGLPGRVFLGKVPEWTPDVQLFKREEYPRVG  961
             D    RL  +RD+S +Y F  +  S+ + VGLPGRVF+GK+PEW+PDV+LF   EYPRV 
Sbjct  129   DNTSDRLIQFRDVSTHYHFSADAGSEASPVGLPGRVFIGKLPEWSPDVRLFTSYEYPRVK  188

Query  962   HAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKIS  1141
             +AQ  DV GT  +PVF++GS +CLGV+E+++T QK+ + +E++++C AL+ V+LR +++S
Sbjct  189   YAQDLDVHGTMGLPVFEKGSYSCLGVMELIMTRQKLNFTSEINNICNALQAVNLRSTEVS  248

Query  1142  NV-RNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRC  1315
             +  R  K    SY+  LPEILEVL++AC TH LPLAQTWV C QQGK G RH+DEN   C
Sbjct  249   STPRATKFNSASYRDALPEILEVLRAACVTHNLPLAQTWVTCAQQGKGGSRHTDENYPYC  308

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST+D+ACY+ DP++Q FH++CS+HHLL+G GV G+AF TNQPCF  DI S +K  YPLS
Sbjct  309   ISTIDTACYVNDPQMQNFHDSCSDHHLLRGQGVAGKAFETNQPCFLPDIGSSAKEHYPLS  368

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             H+A+IF+L+ AVAIRLR T TG+ DFVLEFFLP +C++ EE K +L SLS  ++N C+TL
Sbjct  369   HHAKIFNLKGAVAIRLRCTRTGTADFVLEFFLPTNCEALEEQKAVLDSLSGTMRNTCRTL  428

Query  1676  rvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESC  1855
             RVVT++E+ +E     +++        +K V  L +        E  SWTS     +ES 
Sbjct  429   RVVTDKEMGDEAMLDRNELNTFGPQGKNK-VEELSFGDQATEHREEASWTSLAGTSKESD  487

Query  1856  MSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQ  2035
             ++  +       E           G GLS       G+  + + +  K+R K EKT++L 
Sbjct  488   LAELSMHGMLSPE-----------GQGLSL-----AGAQTSAQGSKGKRRTKTEKTVSLP  531

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +L+QYFAGSLKDAA+SLGV
Sbjct  532   VLRQYFAGSLKDAARSLGV  550



>emb|CDY40642.1| BnaA03g53210D [Brassica napus]
Length=897

 Score =   449 bits (1155),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 269/622 (43%), Positives = 367/622 (59%), Gaps = 69/622 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANA-----LFEPSYVLPDLEPNNGELMKESEVERKKSSLP  502
             +GCWLETTDG    Q +P N N      L+E     P + P  G L  E   ++  + +P
Sbjct  37    DGCWLETTDGKSLKQTTPTNMNDNNNSFLYETERKFPQITP--GSLKIEDLTDQPTNQVP  94

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLIQA  670
              + SA+   T+                 L E +E  +RWWI P      ++SV DRL+QA
Sbjct  95    SDHSAAMSSTQ-------------AEKFLLEETERGKRWWIAPRTRQGPSSSVKDRLVQA  141

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             +  + +  +DKD LIQIWVP+ ++G+  L T +QP   + K   L  YRD S+ Y F  +
Sbjct  142   IKGLNEAVQDKDSLIQIWVPIQQEGKNFLTTLEQPHSFNPKHLSLKRYRDASVAYNFLAD  201

Query  851   EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  AQ+ DVRG+ A+PVF++GS  C
Sbjct  202   EDSKESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAQKCDVRGSLALPVFERGSGIC  261

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS---------YQVV  1183
             LGV+E+V TTQK+ Y+ EL+++CKALE V+LR S+     N+K+  S         Y   
Sbjct  262   LGVVEIVRTTQKMNYKPELENICKALEAVNLRSSE-----NLKSPSSEFLQVYNQFYHAA  316

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCV-QQGKEGLRHSDENLLRCVSTVDSACYIADPRI  1360
             LPE+   L S C ++ LPLA TW PC  Q+G+ G RHSDEN   CVSTVDSAC++ D + 
Sbjct  317   LPEVSNFLASVCRSYDLPLALTWAPCARQEGRGGSRHSDENFSECVSTVDSACFVLDQQS  376

Query  1361  QGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIR  1540
               F  ACSEHHLL+G G+VG+AF   +  F  ++T+FSKT Y L+H+A+I  L AA+A+ 
Sbjct  377   YHFQVACSEHHLLQGEGIVGKAFRRTKLFFVPEVTTFSKTNYSLAHHAKISGLHAALAVP  436

Query  1541  LRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP  1720
             L++   GS +FVLEFF P+ C   E  + ML SLS+ +QN  ++L +V ++ELE E   P
Sbjct  437   LKNKFNGSVEFVLEFFFPKLCLDTEAQQDMLKSLSVTLQNDFRSLNLVIDKELELEVVFP  496

Query  1721  SSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEKPS  1891
               +    S+  +  E   L+  S     +E  SW S  +   E     S    +Q E+P 
Sbjct  497   VREELLFSEKPLPLEPFPLEEIS-----QEDSSWISHMIKANEKGKGVSLSWEYQKEEPK  551

Query  1892  ELLYKRLPEFVSGSGL-------------SFDSTS-GEG-SAQNVRRAGDKKRMKAEKTI  2026
             E       EF+  SG              SFDS S G G S    RR G+K+R K EKTI
Sbjct  552   E-------EFMLTSGWDNNNQIGLGHGHSSFDSASFGVGQSLLGSRRQGEKRRTKTEKTI  604

Query  2027  TLQILQQYFAGSLKDAAKSLGV  2092
              L++L+QYFAGSLKDAAK++GV
Sbjct  605   GLEVLRQYFAGSLKDAAKNIGV  626



>ref|XP_009138351.1| PREDICTED: protein NLP2-like [Brassica rapa]
 ref|XP_009138352.1| PREDICTED: protein NLP2-like [Brassica rapa]
 ref|XP_009138353.1| PREDICTED: protein NLP2-like [Brassica rapa]
 ref|XP_009138354.1| PREDICTED: protein NLP2-like [Brassica rapa]
Length=897

 Score =   447 bits (1151),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 270/622 (43%), Positives = 365/622 (59%), Gaps = 69/622 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANA-----LFEPSYVLPDLEPNNGELMKESEVERKKSSLP  502
             +GCWLETTDG    Q +P N N      L+E     P + P  G L  E   ++    +P
Sbjct  37    DGCWLETTDGKSLKQTTPTNMNDNNNSFLYETERKFPQITP--GSLKIEDLTDQPTDQVP  94

Query  503   ENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLIQA  670
              + SA+   T+                 L E +E  +RWWI P      ++SV DRL+QA
Sbjct  95    SDHSAAMSSTQ-------------AEKFLLEETERGKRWWIAPRTRQGPSSSVKDRLVQA  141

Query  671   LGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVE  850
             +  + +  +DKD LIQIWVP+ ++G+  L T +QP   + K   L  YRD S+ Y F  +
Sbjct  142   IKGLNEAVQDKDSLIQIWVPIQQEGKNFLTTLEQPHSFNPKHLSLKRYRDASVAYNFLAD  201

Query  851   EDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTC  1030
             EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  AQ+ DVRG+ A+PVF++GS  C
Sbjct  202   EDSKESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAQKCDVRGSLALPVFERGSGIC  261

Query  1031  LGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS---------YQVV  1183
             LGV+E+V TTQK+ Y+ EL+++CKALE V+LR S+     N+K+  S         Y   
Sbjct  262   LGVVEIVRTTQKMNYKPELENICKALEAVNLRSSE-----NLKSPRSEFLQVYNQFYHAA  316

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCV-QQGKEGLRHSDENLLRCVSTVDSACYIADPRI  1360
             LPE+   L S C ++ LPLA TW PC  Q+G+ G RHSDEN   CVSTVDSAC++ D + 
Sbjct  317   LPEVSNFLASVCRSYDLPLALTWAPCARQEGRGGSRHSDENFSECVSTVDSACFVLDQQS  376

Query  1361  QGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIR  1540
               F  ACSEHHLL+G G+VG+AF   +  F  ++T+FSKT Y L+H+A+I  L AA+A+ 
Sbjct  377   YHFQVACSEHHLLQGEGIVGKAFRRTKLFFVPEVTTFSKTNYSLAHHAKISGLHAALAVP  436

Query  1541  LRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSP  1720
             L++   GS +FVLEFF P+ C   E  + ML SLS+ +QN  ++L +V ++ELE E   P
Sbjct  437   LKNKFNGSVEFVLEFFFPKLCLDTEAQQDMLKSLSVTLQNDFRSLNLVIDKELELEVVFP  496

Query  1721  SSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEKPS  1891
                    S+  +  E   L+    I P  E  SW S  +   E     S    +Q E+P 
Sbjct  497   VRLELLFSEKPLPLEPFPLE---EISP--EDSSWISHMIKANEKGKGVSLSWEYQKEEPK  551

Query  1892  ELLYKRLPEFVSGSGL-------------SFDSTS-GEG-SAQNVRRAGDKKRMKAEKTI  2026
             E       EF+  SG              SFDS S G G S    RR G+K+R K EKTI
Sbjct  552   E-------EFMLTSGWDNNNQIGLGHGHSSFDSASFGVGQSLLGSRRQGEKRRTKTEKTI  604

Query  2027  TLQILQQYFAGSLKDAAKSLGV  2092
              L++L+QYFAGSLKDAAK++GV
Sbjct  605   GLEVLRQYFAGSLKDAAKNIGV  626



>gb|EYU38032.1| hypothetical protein MIMGU_mgv1a000964mg [Erythranthe guttata]
Length=929

 Score =   447 bits (1149),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 259/528 (49%), Positives = 338/528 (64%), Gaps = 69/528 (13%)
 Frame = +2

Query  608   SRRWWI----GPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQP  775
             +RR W+     P+ T SV  RL+QA+ ++KD  RDKDVLIQIWVPV ++G          
Sbjct  143   NRRMWVRPARNPIRTISVRKRLVQAINHLKDSIRDKDVLIQIWVPV-KNG----------  191

Query  776   FQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPR  955
                                     +E+S+E  GLPGRVFL K+PEWTPDV+ FK EEYPR
Sbjct  192   -----------------------ADENSKELAGLPGRVFLNKLPEWTPDVRFFKSEEYPR  228

Query  956   VGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSK  1135
             V HAQ+Y+VRG+ A+PVF+QGS  CLGV+E+V T+Q+V YR EL++VC+ALE VDL+ S 
Sbjct  229   VNHAQQYNVRGSVALPVFEQGSGNCLGVVEIVTTSQRVNYRPELENVCEALEAVDLKSSN  288

Query  1136  ISNVRNV--KTCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLL  1309
             I    NV      SYQ VL EI  VLK  C THKLPLAQTW PC QQGK G RHSDEN  
Sbjct  289   IPIPPNVVEDGNESYQDVLIEIRNVLKCVCNTHKLPLAQTWAPCTQQGKGGCRHSDENYT  348

Query  1310  RCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYP  1489
              CVST+DSACY+A+ ++ GFHEACSEHHLLKG G+ G+AF+TN+PCFS DIT+ SKTEYP
Sbjct  349   HCVSTIDSACYVANQQVSGFHEACSEHHLLKGEGIAGKAFLTNEPCFSEDITAMSKTEYP  408

Query  1490  LSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQ  1669
             L+H+AR+F++ AAVAIRLRST TG+ DFVLE FLP +C+  E  ++ML SLS +IQ  CQ
Sbjct  409   LAHHARMFNMCAAVAIRLRSTYTGTADFVLELFLPLNCRDAEGQRQMLDSLSSVIQRTCQ  468

Query  1670  tlrvvteqeleeettS-------PSSKVAKHSDIRIHKEVPN-------LKYNSSIGPCE  1807
             +LRVVT+QEL  ET++          K  K  D    +  PN       +K N S     
Sbjct  469   SLRVVTDQELARETSARETGGTLAGGKRPKLVDPTSKEASPNPSSSTMQMKMNDSQQKG-  527

Query  1808  EGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFV--------SGSGLSFDST---  1954
             +G+++T      + +  + S  Q +  S   + ++P F         SG   S +S+   
Sbjct  528   KGVAFTLGHHKEEPTEFNVSTTQWDN-SGSEFHQMPAFFGDEQHQQDSGPKPSLESSGNF  586

Query  1955  --SGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               +G   +   + + +K+R K EK+I+LQ+L+QYFAGSLKDAAK++GV
Sbjct  587   FFAGGDLSVGSKTSAEKRRTKTEKSISLQVLRQYFAGSLKDAAKNIGV  634



>gb|EMT31467.1| hypothetical protein F775_17765 [Aegilops tauschii]
Length=830

 Score =   442 bits (1137),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 236/499 (47%), Positives = 325/499 (65%), Gaps = 30/499 (6%)
 Frame = +2

Query  620   WIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNR-DGRRVLVTGDQPFQLDLKC  796
             WI   ++T V  RL QAL YIK+  RD  +L+Q+WVP+   +G+ VL T  QPF LD   
Sbjct  63    WIQSGSST-VRQRLDQALAYIKEMQRDVGMLVQLWVPIKSGEGQLVLSTSGQPFTLDETS  121

Query  797   PRLAHYRDISINYEFPVEEDSQEN-VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQR  973
              RL  +R++S  Y+F  +  S+ + +GLPGRVF+GK+PEW+PDV+ F   EYPRV HAQ 
Sbjct  122   ERLRQFREVSTRYQFSADVASESSPIGLPGRVFIGKLPEWSPDVRYFTSYEYPRVNHAQY  181

Query  974   YDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNV-R  1150
              DV GT  +PVF++GS +CLGV+E+++T QK+ + +E++++C AL+ V+LR +++S++ R
Sbjct  182   LDVHGTMGLPVFEKGSYSCLGVMELIMTRQKLNFTSEINNICSALQAVNLRSTEVSSIPR  241

Query  1151  NVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTV  1327
               K    SY+  LPEILEVL++AC THKLPLAQTWV C QQ K G RHSDEN   C+ST+
Sbjct  242   ATKFNSASYKDALPEILEVLRAACVTHKLPLAQTWVTCAQQEKRGSRHSDENYRHCISTI  301

Query  1328  DSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYAR  1507
             D+ACY+ DP++Q FHE+CS+HHLL+  GV G+AF TNQPCF  DI S +K EYPLSH+A+
Sbjct  302   DAACYVNDPQMQNFHESCSDHHLLRDQGVAGKAFSTNQPCFLPDIGSSTKMEYPLSHHAK  361

Query  1508  IFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvt  1687
             IF+L+ AVAIRLR T TG+ DFVLEFFLP +C++ EE K +L SLS  +++ C+TL    
Sbjct  362   IFNLKGAVAIRLRCTRTGTADFVLEFFLPTNCEALEEQKAVLDSLSGTMRSTCRTL----  417

Query  1688  eqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCE----EGLSWTSSPMLVQESC  1855
                          +V    ++   K +   + N S GP      E LS+       +E  
Sbjct  418   -------------RVVTDKEMGDEKMLEVNELN-SFGPQGKNKVEELSFGDQATEHREEA  463

Query  1856  MSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQ  2035
               +S     K S+L    +   +S  G        + SAQ  +    K+R K EKT++L 
Sbjct  464   SWTSLAGTSKESDLAELSIHGMLSPVGQGLSPAGAQTSAQGSK---GKRRTKTEKTVSLP  520

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +L+QYFAGSLKDAA+SLGV
Sbjct  521   VLRQYFAGSLKDAARSLGV  539



>ref|XP_006412126.1| hypothetical protein EUTSA_v10024319mg [Eutrema salsugineum]
 gb|ESQ53579.1| hypothetical protein EUTSA_v10024319mg [Eutrema salsugineum]
Length=973

 Score =   444 bits (1143),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 276/642 (43%), Positives = 372/642 (58%), Gaps = 61/642 (10%)
 Frame = +2

Query  338   EGCWLETTD--------GSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKS  493
             EGCWLETTD        G      +  + N  F   Y   +  P+   +  E E  RK  
Sbjct  36    EGCWLETTDSKSLKQTAGQSVSDSTTMSDNNSFLYGYQFAE-NPSQDHISNE-ETGRKFP  93

Query  494   SL-PENLSASQFHTERVQ--CFGQNG--SNAVCSSGLAESSELSRRWWIGPMAT----TS  646
              L P  L       + V    F Q    S+A     L E +E+ RRWWI P  +    +S
Sbjct  94    PLTPGFLKIEDLANQPVNQVSFDQPAAMSSAQAEKFLLEETEVGRRWWIAPRTSQGPSSS  153

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             V DRL+QA+  + +  +DKD LIQIWVP+ ++G+  L T +QP   + K   L  YRD+S
Sbjct  154   VKDRLVQAIKGLNEAVQDKDFLIQIWVPIQQEGKNFLTTLEQPHFFNPKYLSLKRYRDVS  213

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F  +EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ +EYPR+  AQ+ DVRG+ A+PV
Sbjct  214   VAYNFLADEDSKESVGLPGRVFLGKLPEWTPDVRFFRSDEYPRIKEAQKCDVRGSLALPV  273

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT------CH  1168
             F++GS TCLGV+E+V TTQK+ YR EL+++CKALE V+LR S  +N+++          H
Sbjct  274   FERGSGTCLGVVEIVTTTQKMNYRPELENICKALEAVNLRSS--TNLKSPSREFLQVYNH  331

Query  1169  SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIA  1348
              Y   LPE+ + L S C +++LPLA TW PC +QGK G RHSDEN   CVSTVDSAC++ 
Sbjct  332   FYHAALPEVSDFLTSVCRSYELPLALTWAPCARQGKGGSRHSDENFSECVSTVDSACFVL  391

Query  1349  DPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAA  1528
             D     F EACSEHHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L AA
Sbjct  392   DELSHHFLEACSEHHLLQGEGIVGKAFKAIKLFFVPEVTTFSKTNYPLAHHAKISGLHAA  451

Query  1529  VAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleee  1708
             +A+ L+S   GS +FVLEFF P+ C      + ML SLSI +Q   ++L +V +++LE E
Sbjct  452   LAVPLKSKFNGSVEFVLEFFFPKACLDTVAQQEMLKSLSITLQQDFRSLNLVIDKDLELE  511

Query  1709  ttSPSSKVAKHSD--IRIHKEV-PNLK--------------YNSSIGPCEEG----LSWT  1825
                P  +    S+  + I  E   NLK               +  I   E+G    LSW 
Sbjct  512   VVFPVREEVLFSEKPLIIDAETGENLKPLPLEEISQEDSSWISHMIKANEKGKGVSLSWE  571

Query  1826  SSPMLVQESCMSSSAFQNEKPSELLYKRLPEF-----VSGSGL------SFDSTSGEGSA  1972
                   +E  M +S + N +  +     L +       S SGL      SFDS S  G  
Sbjct  572   YQKEEPKEEFMLTSGWDNNQIGQGHNNFLSDTEQFQKASNSGLRLDIDPSFDSASFGGGQ  631

Query  1973  Q--NVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                  RR G+K+R K EKTI L++L+QYFAGSLKDAAKS+GV
Sbjct  632   PLLGSRRPGEKRRTKTEKTIGLEVLRQYFAGSLKDAAKSIGV  673



>ref|XP_010690230.1| PREDICTED: protein NLP2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690231.1| PREDICTED: protein NLP2 [Beta vulgaris subsp. vulgaris]
Length=933

 Score =   441 bits (1133),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 263/628 (42%), Positives = 361/628 (57%), Gaps = 67/628 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--------------------HSPFNANALFEPSYVLPDLEPNNGE  457
             EGCWL+T DGS   Q                     SP  +  L  PS+     +PN+  
Sbjct  29    EGCWLQTADGSNLLQLSQGPGQGQGQGEGEGQGQGSSPPTSRGLSYPSFPFLGSDPNSSS  88

Query  458   LMKESEVERKKSSLPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA  637
             L          +S P+    S      +    Q  +     S   +S+EL++  WI P A
Sbjct  89    L----------TSTPQPSKWSPKTEHGIDSENQENNMLAKRSFSWDSNELNKMLWIAPKA  138

Query  638   ----TTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRL  805
                 +TSV DRL+ A+ ++++ +R++DVLIQIWVP+ +  +  L T +QP        RL
Sbjct  139   NSGLSTSVKDRLMTAIYHLRELNRERDVLIQIWVPIKKGLKSFLTTVEQPHFYQPSSTRL  198

Query  806   AHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVR  985
              HYRD+S  YEF  +ED+++ +GLPGRVFLGK PEWTPDV+ F++EEYPR   A +YDVR
Sbjct  199   LHYRDVSEKYEFLADEDTKQALGLPGRVFLGKAPEWTPDVRFFRQEEYPRSVFAHKYDVR  258

Query  986   GTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC  1165
             G+ A+PVF++GS   LGV+E+++TT K  YR E++SVCKALE V LR S I +    +  
Sbjct  259   GSIALPVFEKGSALSLGVVEIIMTTDKFDYRPEVESVCKALETVHLRSSDILDTPQEQVV  318

Query  1166  H-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACY  1342
               SY+ V PEIL V+++ C T  LPLAQTW PC QQGK G  HSD N   CVS +DSACY
Sbjct  319   KGSYEAVQPEILTVVRTVCDTLDLPLAQTWAPCSQQGKGGCWHSDNN-THCVSIIDSACY  377

Query  1343  IADPRIQGFHEACSEHHLLKGL-GVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSL  1519
             + D R+  FH+ACS+HHLLK   G+VG+AF TNQPC++ D+T FSK EYPLSH+A++F L
Sbjct  378   VRDQRVMDFHKACSDHHLLKSQGGIVGKAFETNQPCYATDVTEFSKVEYPLSHHAKMFGL  437

Query  1520  QAAVAIRLRSTCTGSTDFVLEFFLPRDC--KSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
               AVAIRLR       D+VLE +LP +   K    H R+  S+S++IQ  C+ L+ +T++
Sbjct  438   HGAVAIRLRDIYHELNDYVLELYLPSNLQEKGLAFHARIWQSVSMVIQQHCRFLQFITDK  497

Query  1694  eleeettSP----SSKVAKHSDIRIHKEVPNLKYNSSIGPCEEG----------LSWTSS  1831
             + E++  +P    S    K +    H   P  K    +   E G          ++W+ S
Sbjct  498   DFEQKVLNPGKLSSDNEVKETSWLSHMIDPQRKGKEVVVSLEFGEEEPSKGFKVMNWSDS  557

Query  1832  -PMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRM  2008
              P L     +S S  +N  P            SGS     S+SG       R+A +K+R 
Sbjct  558   EPSLQLGQAVSDS--ENINPD-----------SGSKGISASSSGGRLPLGARKAVEKRRT  604

Query  2009  KAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             K +KTI+L IL+QYFAGSLK+AAKS+GV
Sbjct  605   KTQKTISLDILRQYFAGSLKEAAKSIGV  632



>emb|CDX72528.1| BnaC07g45500D [Brassica napus]
Length=901

 Score =   439 bits (1129),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 268/627 (43%), Positives = 365/627 (58%), Gaps = 75/627 (12%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSP---------FNANALFEPSYVLPDLEPNNGELMKESEVERKK  490
             +GCWLETTDG    Q +P          N + L+E     P + P  G L  E    R  
Sbjct  37    DGCWLETTDGKSLKQTTPTNMNDNNNNNNNSFLYETERKFPQITP--GSLKIEDLTNRPM  94

Query  491   SSLPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDR  658
             + +P    + QF            S+      L E +E  +RWWI P      ++SV +R
Sbjct  95    NQVP----SYQFTAM---------SSTQAEKSLLEETERGKRWWIAPRTRQGPSSSVKER  141

Query  659   LIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             L+QA+  + +  +DKD LIQIWVP+ ++G+  L T +QP   + K   L  YRD S+ Y 
Sbjct  142   LVQAIKGLNEAVQDKDSLIQIWVPIQQEGKNFLTTLEQPHSFNPKHLSLKRYRDASVAYN  201

Query  839   FPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
             F  +EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  AQ+ DVRG+ A+PVF++G
Sbjct  202   FLADEDSKESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAQKCDVRGSLALPVFEKG  261

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS---------  1171
             S  CLGV+E+V TTQK+ Y+ ELD++CKALE V+LR S+     N+K+  S         
Sbjct  262   SGICLGVVEIVRTTQKMNYKPELDNICKALEAVNLRSSE-----NLKSPSSEFLQVYNQF  316

Query  1172  YQVVLPEILEVLKSACATHKLPLAQTWVPCV-QQGKEGLRHSDENLLRCVSTVDSACYIA  1348
             Y   LPE+   L S C ++ LPLA TW PC  Q+G+ G RHSDEN   CVSTVDSAC++ 
Sbjct  317   YYAALPEVSNFLASVCRSYDLPLALTWAPCARQEGRGGSRHSDENFSECVSTVDSACFVL  376

Query  1349  DPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAA  1528
             D +   F  ACSEHHLL+G G+VG+AF   +  F  ++T+FSKT Y L+H+A+I  L AA
Sbjct  377   DQQSYHFQVACSEHHLLQGEGIVGKAFKRTKLFFVPEVTTFSKTNYSLAHHAKISGLHAA  436

Query  1529  VAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleee  1708
             +A+ L++   GS +FVLEFF P+ C   E  + ML SLS+ +QN  ++L +V ++ELE E
Sbjct  437   LAVPLKNKFNGSVEFVLEFFFPKTCLDTEAQQEMLKSLSVSLQNDFRSLNLVIDKELELE  496

Query  1709  ttSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQN  1879
                P  +    S+  +  E   L+  S     +E  SW S  +   E     S    +Q 
Sbjct  497   VVFPVREELLFSEKPLPLEPFPLEEIS-----QEDSSWISHMIKANEKGKGVSLSWEYQK  551

Query  1880  EKPSELLYKRLPEFVSGSGL-------------SFDSTSGEGSAQNV---RRAGDKKRMK  2011
             E+P E       EF+  SG              SFDS S  G  Q +   RR G+K+R K
Sbjct  552   EEPKE-------EFMLTSGWDNNNQICLGRGHSSFDSASF-GVGQPLLGSRRQGEKRRTK  603

Query  2012  AEKTITLQILQQYFAGSLKDAAKSLGV  2092
              EKTI L++L+QYFAGSLKDAAK++GV
Sbjct  604   TEKTIGLEVLRQYFAGSLKDAAKNIGV  630



>ref|XP_010432303.1| PREDICTED: protein NLP2 [Camelina sativa]
 ref|XP_010432304.1| PREDICTED: protein NLP2 [Camelina sativa]
 ref|XP_010432305.1| PREDICTED: protein NLP2 [Camelina sativa]
Length=973

 Score =   438 bits (1126),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 271/651 (42%), Positives = 364/651 (56%), Gaps = 80/651 (12%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ-----------HSPFNANALFEPSYVLPDLEPNNGELMKESEVER  484
             +GCWLETTDG    Q            S  N N  F   Y   +  P+   +  E    +
Sbjct  38    DGCWLETTDGKSLKQTLGQQVSDSTTMSDNNNNNSFLYGYQFAE-NPSQDHVSNEETGRK  96

Query  485   KKSSLPENLSASQFHTERVQCFGQNGSNAVCSSG----LAESSELSRRWWIGPMAT----  640
                  P  L       + +     + S A+ S+     L E +E  RRWWI P  +    
Sbjct  97    FPPIAPGFLKIEDLSNQPLNQLPFDQSVAMSSAQAEKFLLEETEGGRRWWIAPRTSQGPS  156

Query  641   TSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRD  820
             +SV DRL+QA   IK   +DKD LIQIWVP+ ++G+  L T +QP   + K   L  YRD
Sbjct  157   SSVKDRLVQA---IKGLMQDKDFLIQIWVPIQQEGKNFLTTLEQPHFFNPKYLSLKRYRD  213

Query  821   ISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAV  1000
             +S+ Y FP  EDS E+VGLPGRVFLGK+PEWTPDV+ F+ +EYPR+  A++ DVRG+ A+
Sbjct  214   VSVAYNFPAHEDSTESVGLPGRVFLGKLPEWTPDVRFFRSDEYPRIKEAEKCDVRGSLAL  273

Query  1001  PVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT------  1162
             PVF++GS TCLGV+E+V TTQK+ YR ELD++CKALE V+LR S     RN+K+      
Sbjct  274   PVFERGSGTCLGVVEIVTTTQKMNYRPELDNICKALESVNLRSS-----RNLKSPSREFL  328

Query  1163  ---CHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDS  1333
                   Y   LPE+ E L   C  + LPLA TW PC +QGK G RHSDEN   CVSTVD 
Sbjct  329   QVYNEFYYAALPEVSEFLTLVCRLYDLPLALTWAPCARQGKVGSRHSDENFSECVSTVDD  388

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             AC + D + + F EACSEHHLL+G G+VG+AF   +  F  ++ +FSKT YPL+H+A+I 
Sbjct  389   ACIVPDHQSRNFLEACSEHHLLQGEGIVGKAFKATKLFFVPEVITFSKTNYPLAHHAKIS  448

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L AA+A+ L+S   GS +FVLEFF P+ C   E  + ML SLS+ +Q   ++L +V ++
Sbjct  449   GLHAALAVPLKSKFNGSVEFVLEFFFPKTCLDTEAQQDMLKSLSVTLQQDFRSLNLVIDK  508

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGP------CEEGLSWTSSPMLVQESC  1855
             ELE E   P  +    ++  ++    N +   ++ P       +E  SW S  +   E  
Sbjct  509   ELELEVVFPVREEVVFAETPLN----NAQTGENMKPLPLEEISQEDSSWISHMIKANEKG  564

Query  1856  MSSS---AFQNEKPSELLY------------------KRLPEF--VSGSGL------SFD  1948
                S    +Q E+P E                         +F  VS SG       SF+
Sbjct  565   KGVSLSWEYQKEEPKEEFMLTSGWDNNQIGSGHNNFLSETEQFQKVSNSGRRIDMDPSFE  624

Query  1949  STSGEGSAQNV---RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             S S  G  Q +   RR G+K+R K EKTI L++L+QYFAGSLKDAAKS+GV
Sbjct  625   SASF-GVGQTLLGSRRPGEKRRTKTEKTIGLEVLRQYFAGSLKDAAKSIGV  674



>ref|XP_010437496.1| PREDICTED: protein NLP2-like [Camelina sativa]
 ref|XP_010437497.1| PREDICTED: protein NLP2-like [Camelina sativa]
Length=965

 Score =   437 bits (1124),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 273/650 (42%), Positives = 362/650 (56%), Gaps = 86/650 (13%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQH----------SPFNANALFEPSYVLPDLEPNNGELMKESEVERK  487
             +GCWLETTDG    Q              N N  F   Y   +  P+   +  E    + 
Sbjct  38    DGCWLETTDGKSLKQTLGQQVSDSTTMSDNNNNSFLYGYQFAE-NPSQDHISNEETGRKF  96

Query  488   KSSLPENLSASQFHTERVQ--CFGQNG--SNAVCSSGLAESSELSRRWWIGPMAT----T  643
                 P  L       + +    F Q+   S+A     L E +E  RRWWI P  +    +
Sbjct  97    PPITPGFLKIEDLSNQPLNQVPFDQSAAMSSAQAEKFLLEETEGGRRWWIAPRTSQGPSS  156

Query  644   SVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDI  823
             SV DRL+QA   IK   +DKD LIQIWVP+ ++G+  L T +QP   + K   L  YRD+
Sbjct  157   SVKDRLVQA---IKGLMQDKDFLIQIWVPIQQEGKNFLTTLEQPHFFNPKYLSLKRYRDV  213

Query  824   SINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
             S+ Y FP  EDS E+VGLPGRVFLGK+PEWTPDV+ F+ +EYPR+  A++ DVRG+ A+P
Sbjct  214   SVAYNFPAHEDSTESVGLPGRVFLGKLPEWTPDVRFFRSDEYPRIKEAEKCDVRGSLALP  273

Query  1004  VFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT-------  1162
             VF++GS TCLGV+E+V TTQK+ YR ELD++CKALE V+LR S     RN+K+       
Sbjct  274   VFERGSGTCLGVVEIVTTTQKMNYRPELDNICKALESVNLRSS-----RNLKSPSREFLQ  328

Query  1163  --CHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSA  1336
                  Y   LPE+ E L   C  + LPLA TW PC +QGK G RHSDEN   CVSTVD A
Sbjct  329   VYNEFYYAALPEVSEFLTWVCRLYDLPLALTWAPCARQGKVGSRHSDENFSECVSTVDDA  388

Query  1337  CYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFS  1516
             C + D + + F EACSEHHLL+G G+VG+AF   +  F  ++ +FSKT YPL+H+A+I  
Sbjct  389   CIVPDHQSRNFLEACSEHHLLQGEGIVGKAFKATKLFFVPEVITFSKTNYPLAHHAKISG  448

Query  1517  LQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqe  1696
             L AA+A+ L+S   GS +FVLEFF P+ C   E  + ML SLS+ +Q   ++L +V ++E
Sbjct  449   LHAALAVPLKSKFNGSVEFVLEFFFPKTCLDTEAQQDMLKSLSVTLQQDFRSLNLVIDKE  508

Query  1697  leeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGP------CEEGLSWTSSPMLVQESCM  1858
             LE E   P           + +EV   +   ++ P       +E  SW S  +   E   
Sbjct  509   LELEVVFP-----------VREEVVFGETGENMKPLPLEEISQEDSSWISHMIKANEKGK  557

Query  1859  SSS---AFQNEKPSELLY------------------KRLPEF--VSGSGL------SFDS  1951
               S    +Q E+P E                         +F  VS SGL      SF+S
Sbjct  558   GVSLSWEYQKEEPKEEFMLTSGWDNNQIGSGHSNFISETDQFQKVSNSGLRIDMDPSFES  617

Query  1952  TSGEGSAQNV---RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              S  G  Q +   RR G+K+R K EKTI L++L+QYFAGSLKDAAKS+GV
Sbjct  618   ASF-GVGQTLLGSRRPGEKRRTKTEKTIGLEVLRQYFAGSLKDAAKSIGV  666



>ref|XP_010446946.1| PREDICTED: protein NLP2-like [Camelina sativa]
 ref|XP_010446947.1| PREDICTED: protein NLP2-like [Camelina sativa]
 ref|XP_010446948.1| PREDICTED: protein NLP2-like [Camelina sativa]
 ref|XP_010446949.1| PREDICTED: protein NLP2-like [Camelina sativa]
 ref|XP_010446950.1| PREDICTED: protein NLP2-like [Camelina sativa]
Length=971

 Score =   435 bits (1118),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 273/651 (42%), Positives = 363/651 (56%), Gaps = 80/651 (12%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ-----------HSPFNANALFEPSYVLPDLEPNNGELMKESEVER  484
             +GCWLETTDG    Q            +  N N  F   Y   +  P+   +  E    +
Sbjct  38    DGCWLETTDGKSLKQTLGQQVSDSTTMNDNNNNNSFLYGYQFAE-NPSQDHISNEETGRK  96

Query  485   KKSSLPENLSASQFHTERVQ--CFGQNG--SNAVCSSGLAESSELSRRWWIGPMAT----  640
                  P  L       + +    F Q+   S+A     L E +E  RRWWI P  +    
Sbjct  97    FPPITPGFLKIEDLSNQPLNQVPFDQSAAMSSAQAEKFLLEETEGGRRWWIAPRTSQGPS  156

Query  641   TSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRD  820
             +SV DRL+QA   IK   +DKD LIQIWVP+ ++G+  L T +QP   + K   L  YRD
Sbjct  157   SSVKDRLVQA---IKGLMQDKDFLIQIWVPIQQEGKNFLTTLEQPHFFNPKYLSLKRYRD  213

Query  821   ISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAV  1000
             +S+ Y FP  EDS E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  A++ DVRG+ A+
Sbjct  214   VSVAYNFPAHEDSTESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAEKCDVRGSLAL  273

Query  1001  PVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT------  1162
             PVF++GS TCLGV+E+V TTQK+ YR ELD++CKALE V+LR S     RN+K+      
Sbjct  274   PVFERGSGTCLGVVEIVTTTQKMNYRPELDNICKALESVNLRSS-----RNLKSPSREFL  328

Query  1163  ---CHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDS  1333
                   Y   LPE+ E L   C  + LPLA TW PC +QGK G RHSDEN   CVSTVD 
Sbjct  329   QVYNEFYYAALPEVSEFLTWVCRLYDLPLALTWAPCARQGKVGSRHSDENFSECVSTVDD  388

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             AC + D + + F EACSEHHLL+G G+VG+AF   +  F  ++ +FSKT YPL+H+A+I 
Sbjct  389   ACIVPDHQSRNFLEACSEHHLLQGEGIVGKAFKATKLFFVPEVITFSKTNYPLAHHAKIS  448

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L AA+A+ L+S   GS +FVLEFF P+ C   E  + ML SLS+ +Q   ++L +V ++
Sbjct  449   GLHAALAVPLKSKFNGSVEFVLEFFFPKTCLDTEAQQDMLKSLSVTVQQDFRSLNLVIDK  508

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGP------CEEGLSWTSSPMLVQESC  1855
             ELE E   P     +   +     + N +   ++ P       +E  SW S  +   E  
Sbjct  509   ELELEVVFP----VREEVVFAKTPLINAQTGENMKPLPLEEISQEDSSWISHMIKANEKG  564

Query  1856  MSSS---AFQNEKPSELLY------------------KRLPEF--VSGSGL------SFD  1948
                S    +Q E+P E                         +F  VS SGL      SF+
Sbjct  565   KGVSLSWEYQKEEPKEEFMLTSGWDNNQTGSGHSNFLSEADQFQKVSNSGLRIDMDPSFE  624

Query  1949  STSGEGSAQNV---RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             S S  G  Q +   RR G+K+R K EKTI L++L+QYFAGSLKDAAKS+GV
Sbjct  625   SASF-GVGQTLLGSRRPGEKRRTKTEKTIGLEVLRQYFAGSLKDAAKSIGV  674



>tpg|DAA43174.1| TPA: putative plant regulator RWP-RK family protein [Zea mays]
Length=902

 Score =   432 bits (1112),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 247/539 (46%), Positives = 340/539 (63%), Gaps = 55/539 (10%)
 Frame = +2

Query  611   RRWWIGPM--ATTSVMDRLIQALGYIKDFSRDK--DVLIQIWVPVNRDGRRVLVTGDQPF  778
             R W   P      +V +RL +AL  I   S+ +  ++L Q+WVP     R+VL T  QPF
Sbjct  93    RGWVFQPRLEVDATVKERLRRALERIASLSQTQPGELLAQVWVPTVIGDRQVLTTCGQPF  152

Query  779   QLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRV  958
              LD +  RLA+YR +S+ Y+F  +E ++ ++G+PGRVF+G+VPEWTPDV+ F  EEYPRV
Sbjct  153   WLDCRNERLANYRTVSMKYQFSADETARTDLGMPGRVFVGRVPEWTPDVRYFSTEEYPRV  212

Query  959   GHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKI  1138
              HAQ +D+RG+ A+P+F+  SR CLGV+E+V+TT+KV Y  E+ ++C AL+EVDLR S +
Sbjct  213   HHAQYFDIRGSVALPIFEPRSRVCLGVVELVMTTEKVNYNAEIQNICSALKEVDLRSSDV  272

Query  1139  SNVRNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRC  1315
             S+    K T  SY+ ++PEI++VL++ C THKLPLAQTW+PC+ Q K G RH+DE L  C
Sbjct  273   SSDSRAKVTDTSYRAIIPEIVDVLRTVCETHKLPLAQTWIPCICQAKRGSRHTDEKLKYC  332

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             VST+D ACY+ D  + GFHEACSEHHL +G GVVGRAF TN+PCFS DIT+ SK +YPLS
Sbjct  333   VSTLDEACYVRDLNVNGFHEACSEHHLFRGEGVVGRAFATNEPCFSEDITASSKIQYPLS  392

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             H+A++FSL+AAVAIRLRS  TGS D+VLEFFLP DC   EE + ML SLSI IQ  C TL
Sbjct  393   HHAKLFSLRAAVAIRLRSISTGSLDYVLEFFLPVDCIEIEEQRAMLNSLSITIQQTCYTL  452

Query  1676  rvvteqeleeettSPSSKVA-KHSDIRIHKEVPNL-------KYNSSIGPCEEGLSWTSS  1831
             RVV+ +EL +E +  +S +     D  +H+ +  +          +S+   EE  SW +S
Sbjct  453   RVVSLKELVDEGSIETSALTPPEYDKSMHENIDEVCSGIGVPARTASLETSEEVSSWIAS  512

Query  1832  PMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSG---------EGS-----  1969
              +  Q   +       E   +L +     F       F  T+G         EGS     
Sbjct  513   LVCAQNKGV------KEMDGDLPFG----FSKQEDEGFSVTAGWHTSPVIEPEGSIFSGF  562

Query  1970  ------------------AQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                               + N+ +  +K+R K EKT++L+ L+++FAGSLK+AAK+LGV
Sbjct  563   KQHEEYKVKEVTCLRDPSSSNLEKTVEKRRTKMEKTVSLEELRKHFAGSLKEAAKNLGV  621



>emb|CDX75487.1| BnaA01g02150D [Brassica napus]
Length=889

 Score =   431 bits (1107),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 261/628 (42%), Positives = 353/628 (56%), Gaps = 90/628 (14%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANA------------LFEPSYV---LPDLEPNN-------  451
             +GCWLETTDG    Q +   A              L+   Y     PD   N        
Sbjct  12    DGCWLETTDGKSLKQTTGQQAPNSINMNDNNNSSFLYGYQYAENPSPDHISNGDTGRKFP  71

Query  452   -GELMKESEVERKKSSLPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIG  628
              G L  E    +  + +P + SA+              S+A     L E +E  RR+WI 
Sbjct  72    PGFLKMEDLTNQPMTQVPFDQSAAM-------------SSAQAEKFLLEETERGRRYWIP  118

Query  629   PMAT----TSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKC  796
             P  +    +SV DRL QA+  +K   +DKD LIQIW+P+ ++G+  L T +QP   + K 
Sbjct  119   PRTSQGPSSSVKDRLFQAINGLK--VQDKDFLIQIWLPIQQEGKNFLTTLEQPHFFNPKY  176

Query  797   PRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRY  976
               L  YRD+S++Y F  +EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  AQR 
Sbjct  177   KSLKRYRDVSVSYNFLADEDSKESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAQRC  236

Query  977   DVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNV  1156
             DVRG+ A+PVF+ GS  CLGV+E+V TTQK+ YR EL+++CKALE V+LR S      N+
Sbjct  237   DVRGSLALPVFESGSGICLGVVEIVTTTQKMNYRPELENICKALEAVNLRSSA-----NM  291

Query  1157  KTCHS---------YQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLL  1309
             K+  S         Y  V+PE+   L S C ++ LPLA TW PC +QG+ G RHSDEN  
Sbjct  292   KSPSSEFLQVYKQFYCAVIPEVSVFLTSVCRSYDLPLALTWAPCARQGRGGSRHSDENFS  351

Query  1310  RCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYP  1489
              CVST+DSAC++ D +   F EACSEHHLL+G G+VG+AF   +  F  ++T+FSKT YP
Sbjct  352   ECVSTLDSACFVLDQQSHNFQEACSEHHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYP  411

Query  1490  LSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQ  1669
             L+H+A+I  L AA+A+ L++   GS +FVLEFF P++C   E  + ML SLS+ +QN  +
Sbjct  412   LAHHAKISGLHAALAVPLKNKFNGSVEFVLEFFFPKNCLDTEAQQEMLKSLSVTLQNDFR  471

Query  1670  tlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPM--LV  1843
                              S  +    ++ +    P  +     G  E G S    P+  + 
Sbjct  472   -----------------SLNLVIDKEMELEVVFPVREELLFSGNAETGESLKPLPLEEIS  514

Query  1844  QE--SCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNV---RRAGDKKRM  2008
              E  S +S     NEK   +L             SFDS S  G  Q +   RR G+K+R 
Sbjct  515   HEDSSWISHMINANEKGKGVL---------DIDPSFDSASF-GVGQTLLGSRRPGEKRRT  564

Query  2009  KAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             K EKTI L++L+QYFAGSLKDAAKS+GV
Sbjct  565   KTEKTIGLEVLRQYFAGSLKDAAKSIGV  592



>emb|CDX69125.1| BnaC01g03280D [Brassica napus]
Length=966

 Score =   432 bits (1111),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 271/646 (42%), Positives = 368/646 (57%), Gaps = 77/646 (12%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNA-----------NALFEPSYVLPDLEPNNGELMKESEVER  484
             +GCWLETTDG    Q S   A           N  F   Y   +  P+   +  E +  R
Sbjct  36    DGCWLETTDGKSLKQTSGHQAPSSTNMNDNNNNNSFLYGYQFAE-NPSQDHISNE-DTGR  93

Query  485   KKSSLPENLSASQFHTERVQC---FGQNG--SNAVCSSGLAESSELSRRWWIGPMA----  637
             K   LP      +  T +      F Q+   S+A     L E +E  RR+WI P      
Sbjct  94    K---LPPGFLKMEDLTNQPMTQVSFDQSAAMSSAQAEKFLLEETERGRRYWIAPRTSQGP  150

Query  638   TTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYR  817
             ++SV DRL QA+  +K   +DKD LIQIWVP+ ++G+  L T +QP   + K   L  YR
Sbjct  151   SSSVKDRLFQAINGLK--VQDKDFLIQIWVPIQQEGKNFLTTLEQPHFFNPKYKSLKRYR  208

Query  818   DISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFA  997
             D+S++Y F  +EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  AQR DVRG+ A
Sbjct  209   DVSVSYNFLADEDSKESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAQRCDVRGSLA  268

Query  998   VPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQ  1177
             +PVF+ GS  CLGV+E+V TTQK+ YR EL+++CKALE V+LR S      + +    Y+
Sbjct  269   LPVFESGSGICLGVVEIVTTTQKMNYRPELENICKALEAVNLRSSANMESPSSEFLQVYK  328

Query  1178  ----VVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYI  1345
                  V+PE+   L S C ++ LPLA TW PC +QG+ G RHSDEN   CVST+DSAC++
Sbjct  329   QFYCAVIPEVSVFLTSVCRSYDLPLALTWAPCARQGRGGSRHSDENFSECVSTLDSACFV  388

Query  1346  ADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQA  1525
              D +   F EACSEHHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L A
Sbjct  389   LDQQSHNFQEACSEHHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYPLAHHAKISGLHA  448

Query  1526  AVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqelee  1705
             A+A+ L++   GS +FVLEFF P+ C   E  + ML SLS+ +Q   ++L +V ++ELE 
Sbjct  449   ALAVPLKNKFNGSVEFVLEFFFPKSCLDTEAQQEMLKSLSVTLQQDFRSLNLVIDKELEL  508

Query  1706  ettSPSSKVAKHSDIRIHKEVPNLKYNSSIGP------CEEGLSWTSSPMLVQESCMSSS  1867
             E   P  +    S         N +   S+ P       +E  SW S  +   E     S
Sbjct  509   EVVFPVREELLFSG--------NAETGESLKPSPLEEISQEDSSWISHMINANEKGKGVS  560

Query  1868  ---AFQNEKPSELLY---------KRLPEFVSGS----------GL------SFDSTSGE  1963
                 +Q E+P E             ++  F+S +          GL      SFDS S  
Sbjct  561   LSWEYQKEEPKEEFMLTSGWDNNNNQIGSFLSDAEQFQKASNSGGLRLDIDPSFDSASF-  619

Query  1964  GSAQNV---RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             G  Q +   RR G+K+R K EKTI L++L+QYFAGSLKDAAKS+GV
Sbjct  620   GVGQTLLGSRRPGEKRRTKTEKTIGLEVLRQYFAGSLKDAAKSIGV  665



>ref|XP_009103570.1| PREDICTED: protein NLP2 [Brassica rapa]
 ref|XP_009103644.1| PREDICTED: protein NLP2 [Brassica rapa]
 ref|XP_009103715.1| PREDICTED: protein NLP2 [Brassica rapa]
 ref|XP_009103768.1| PREDICTED: protein NLP2 [Brassica rapa]
 ref|XP_009103808.1| PREDICTED: protein NLP2 [Brassica rapa]
Length=961

 Score =   432 bits (1110),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 269/647 (42%), Positives = 366/647 (57%), Gaps = 78/647 (12%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNA--------NALFEPSYVLPDLEPNNGELMKESEVERKKS  493
             +GCWLETTDG    Q +   A        N     S++       N      S  +  + 
Sbjct  34    DGCWLETTDGKSLKQTTGQQAPSSTNMNDNNNNNNSFLYGYQFSENPSQDHISNGDTGRK  93

Query  494   SLPENLSASQFHTERVQCFGQNGSNAVCSSG----LAESSELSRRWWIGPMA----TTSV  649
               P  L       + +     + S A  SS     L E +E  RR+WI P      ++SV
Sbjct  94    FPPGFLKMEDLTNQPMTQVPFDQSAATSSSQAEKFLLEETERGRRYWIAPRTSQGPSSSV  153

Query  650   MDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISI  829
              DRL QA+  +K   +DKD LIQIW+P+ ++G+  L T DQP   + K   L  YRD+S+
Sbjct  154   KDRLFQAINGLK--VQDKDFLIQIWLPIQQEGKNFLTTLDQPHFFNPKYKSLKRYRDVSV  211

Query  830   NYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVF  1009
             +Y F  +EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  AQR DVRG+ A+PVF
Sbjct  212   SYNFLADEDSKESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAQRCDVRGSLALPVF  271

Query  1010  DQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS------  1171
             + GS  CLGV+E+V TTQK+ YR EL+++CKALE V+LR S      N+K+  S      
Sbjct  272   ESGSGICLGVVEIVTTTQKMNYRPELENICKALEAVNLRSSA-----NMKSPSSEFLQVY  326

Query  1172  ---YQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACY  1342
                Y  V+PE+   L S C ++ LPLA TW PC +QG+ G RHSDEN   CVST+DSAC+
Sbjct  327   KQFYCAVIPEVSVFLTSVCRSYDLPLALTWAPCARQGRGGSRHSDENFSECVSTLDSACF  386

Query  1343  IADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQ  1522
             + D +   F EACSEHHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L 
Sbjct  387   VLDQQSHNFQEACSEHHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYPLAHHAKISGLH  446

Query  1523  AAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqele  1702
             AA+A+ L++   GS +FVLEFF P++C   E  + ML SLS+ +QN  ++L +V ++E+E
Sbjct  447   AALAVPLKNKFNGSVEFVLEFFFPKNCLDTEAQQEMLKSLSVTLQNDFRSLNLVIDKEME  506

Query  1703  eettSPSSKVAKHSDIRIHKEVPNLKYNSSIGP------CEEGLSWTSSPMLVQESCMSS  1864
              E   P  +    S         N +   S+ P        E  SW S  +   E     
Sbjct  507   LEVVFPVREELLFSG--------NAETGESLKPLPLEEISHEDSSWISHMINANEKGKGV  558

Query  1865  S---AFQNEKPSELLY---------KRLPEFVSGS----------GL------SFDSTSG  1960
             S    +Q E+P E             ++  F+S +          GL      SFDS S 
Sbjct  559   SLSWEYQKEEPKEEFMLTSGWDNNNNQIGSFLSDAEQFQKASNSGGLRLDIDPSFDSASF  618

Query  1961  EGSAQNV---RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              G  Q +   RR G+K+R K EKTI L++L+QYFAGSLKDAAKS+GV
Sbjct  619   -GVGQTLLGSRRPGEKRRTKTEKTIGLEVLRQYFAGSLKDAAKSIGV  664



>ref|XP_006283075.1| hypothetical protein CARUB_v10004068mg [Capsella rubella]
 ref|XP_006283076.1| hypothetical protein CARUB_v10004068mg [Capsella rubella]
 ref|XP_006283077.1| hypothetical protein CARUB_v10004068mg [Capsella rubella]
 gb|EOA15973.1| hypothetical protein CARUB_v10004068mg [Capsella rubella]
 gb|EOA15974.1| hypothetical protein CARUB_v10004068mg [Capsella rubella]
 gb|EOA15975.1| hypothetical protein CARUB_v10004068mg [Capsella rubella]
Length=972

 Score =   431 bits (1108),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 274/655 (42%), Positives = 365/655 (56%), Gaps = 85/655 (13%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ-------HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSS  496
             +GCWLETTDG    Q        S    +     S++       N      S  E  K  
Sbjct  35    DGCWLETTDGKSLKQTMGQQVSDSTTMNDNNNNNSFLYGYQFAGNTSQDHISNEETGKKF  94

Query  497   LP--------ENLSASQFHTERVQCFGQNG--SNAVCSSGLAESSELSRRWWIGPMAT--  640
              P        E+LS    +      F Q+   S+A     L E +E  RR+WI P  +  
Sbjct  95    PPIAPGFLKIEDLSNQPMNQ---APFDQSAAMSSAQAEKFLLEETEGGRRYWIAPRTSQG  151

Query  641   --TSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHY  814
               +SV DRL+QA+  + +  +DKD LIQIWVP+ ++G+  L T +QP   + K   L  Y
Sbjct  152   PSSSVKDRLVQAIKGLDEAVQDKDFLIQIWVPIQQEGKNFLTTLEQPHFFNPKYSSLKRY  211

Query  815   RDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTF  994
             RD+S+ Y FP +EDS E+VGLPGRVFL K+PEWTPDV+ F+ EEYPR+  A++ DVRG+ 
Sbjct  212   RDVSVAYNFPADEDSTESVGLPGRVFLRKLPEWTPDVRFFRSEEYPRIKEAEKCDVRGSL  271

Query  995   AVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT----  1162
             A+PVF++GS TCLGV+E+V TTQK+ YR ELD++CKALE V+LR S     RN+K+    
Sbjct  272   ALPVFERGSGTCLGVVEIVTTTQKMNYRPELDNICKALESVNLRSS-----RNLKSPSRE  326

Query  1163  -----CHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTV  1327
                     Y   LPE+ E L   C  + LPLA TW PC +QGK G RHSDEN   CVSTV
Sbjct  327   FLQVYNEFYYAALPEVSEFLTWVCRLYDLPLALTWAPCARQGKVGSRHSDENFSECVSTV  386

Query  1328  DSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYAR  1507
             D AC + D + + F EACSEHHLL+G G+VG+AF   +  F  ++ +FSKT YPL+H+A+
Sbjct  387   DDACIVPDHQSRNFLEACSEHHLLQGEGIVGKAFKATKLFFVPEVITFSKTNYPLAHHAK  446

Query  1508  IFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvt  1687
             I  L AA+A+ L+S   GS +FVLEFF P+ C   E  + ML SLS+ +Q   ++L +V 
Sbjct  447   ISGLHAALAVPLKSKFNGSVEFVLEFFFPKTCLHTEAQQDMLKSLSVTLQQDFRSLNLVI  506

Query  1688  eqeleeettSPSSKVAKHSDIRIHKEVP--NLKYNSSIGP------CEEGLSWTSSPMLV  1843
             ++ELE E   P  +        +  E P  N +   ++ P       +E  SW S  +  
Sbjct  507   DKELELEVVFPVREEV------VFAETPLINAQTGENMKPLPLEEISQEDSSWISHMIKA  560

Query  1844  QESCMSSS---AFQNEKPSELLY------------------KRLPEF--VSGSGL-----  1939
              E     S    +Q E+P E                         +F  VS SGL     
Sbjct  561   NEKGKGVSLSWEYQKEEPKEEFMLTSGWDNNQIGSGHNNFLSEAEQFQKVSNSGLRIDMD  620

Query  1940  -SFDSTSGEGSAQNV---RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              SF+S S  G  Q +   RR G+K+R K EKTI LQ+L+QYFAGSLKDAAKS+GV
Sbjct  621   PSFESASF-GVGQTLLGSRRPGEKRRTKTEKTIGLQVLRQYFAGSLKDAAKSIGV  674



>ref|XP_006296933.1| hypothetical protein CARUB_v10012927mg [Capsella rubella]
 gb|EOA29831.1| hypothetical protein CARUB_v10012927mg [Capsella rubella]
Length=684

 Score =   422 bits (1086),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 253/623 (41%), Positives = 350/623 (56%), Gaps = 62/623 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTD     Q   S   + A+ + S  L   E  + +     E E  KS   E  
Sbjct  41    DGCWLETTDSKSLKQTEQSGSASTAMNDNSTFLCFGENPSQDNFSHEETENNKSMNQEPF  100

Query  512   S-ASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALG  676
               A +F                    L E +E+ + WWI P A+    +SV +RL+QA+ 
Sbjct  101   DQAEKF--------------------LLEEAEVGKSWWIAPRASEGASSSVKERLLQAIS  140

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
              + +  +DKD L+QIWVP+ ++G+  L T  QP   + +   LA YR +S  Y FP +E 
Sbjct  141   GLNEAVQDKDFLVQIWVPIQQEGKSFLTTWAQPHLFNQEYSSLAEYRHVSETYNFPADEG  200

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
               + VGLPGRVFL K+PEWTPDV+ F+R+EYPR+  AQ+ DVRG+ A+PVF++GS TCLG
Sbjct  201   LNDFVGLPGRVFLQKLPEWTPDVRFFRRDEYPRIKEAQKCDVRGSLALPVFERGSGTCLG  260

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQ----VVLPEILEV  1204
             V+E+V TTQK+ YR EL+ +CKALE VDLR S   N  + +    Y       LPEI + 
Sbjct  261   VVEIVTTTQKMNYRQELEKMCKALEAVDLRSSSNLNTPSSEFLQVYSDFYCAALPEIKDF  320

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             L + C  + LPLA +W PC  QGK G RHSD+N  +CVST DSAC + D + + F EACS
Sbjct  321   LATVCRLYDLPLALSWAPCAPQGKHGSRHSDDNFSQCVSTTDSACSVLDEQSKSFWEACS  380

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L AA+A+ L+S  +G 
Sbjct  381   EHHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKSK-SGL  439

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHS  1744
              +FVLEFF P+ C   E  + ML SLS+ +Q   ++  +V +++LE E   P  +    S
Sbjct  440   VEFVLEFFFPKACLDTEAQQEMLKSLSVTLQQNFRSSNLVIDKDLELEVVLPVRETMLFS  499

Query  1745  DIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEKPSELLYKRLP  1915
             +   + +       +      +  SW S  +   E     S    +Q E P EL   R  
Sbjct  500   E---NPQSGAETTETLTEIEMQESSWISHMIKANEKGKGVSLSWEYQKEDPKELSSGREN  556

Query  1916  EFV-----------------SGSGLSFDS-------TSGEGSAQNVRRAGDKKRMKAEKT  2023
               +                 S SGL  DS       ++G G+    RR GDK+R K EKT
Sbjct  557   TLIDPSPNNVPLEAEQLQQASTSGLRVDSGPSTKSPSTGGGNMLGSRRPGDKRRTKTEKT  616

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I L++L+Q+FAGSLKDAAKS+GV
Sbjct  617   IGLEVLRQHFAGSLKDAAKSIGV  639



>emb|CDY07871.1| BnaC03g47510D [Brassica napus]
Length=870

 Score =   428 bits (1101),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 253/623 (41%), Positives = 359/623 (58%), Gaps = 78/623 (13%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTD  +  + +   +NA+ + +  L   E    E +   E ER  +  P N +A
Sbjct  40    DGCWLETTDLKQS-EETASASNAMNDNTPFLYFAENPFQENVSNEETERTANQEPLNQAA  98

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGYIK  685
             +   +E+ + F            L E +E++RRWWI P  +    +SV +RL++A+  + 
Sbjct  99    TS--SEQAEKF------------LLEEAEVARRWWIAPRGSEGPSSSVKERLLRAISGLD  144

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQE  865
             +   DKD L+QIWVP  ++G+  L T  QP   + K   LA YR +S  Y FP +E S E
Sbjct  145   EAVPDKDFLVQIWVPFQQEGKNFLTTLAQPHLFNQKYSSLAKYRHVSETYNFPADEGSTE  204

Query  866   NVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIE  1045
              VGLPGRVFL K+PEWTPDV+ F+ EEYPR+  AQ+ DVRG+ AVPVF++GS TCLGV+E
Sbjct  205   -VGLPGRVFLQKLPEWTPDVRFFRSEEYPRIKEAQKCDVRGSLAVPVFERGSGTCLGVVE  263

Query  1046  VVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT------CHSYQVVLPEILEVL  1207
             ++ TTQK+ YR EL+++CKALE VDLR S  SN++   T         Y V LPEI + L
Sbjct  264   IITTTQKMNYRPELENICKALEAVDLRSS--SNLKTPSTEFLQVYNDFYYVALPEISDFL  321

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
              + C ++ LPLA +W PC +QGK G RHSDEN  +CVST+DSAC++ D + + F EACSE
Sbjct  322   ATVCRSYDLPLALSWAPCDRQGKGGSRHSDENFSQCVSTIDSACFVLDEQSKCFLEACSE  381

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             +HLL+G G+VG+AF   +  F  ++T FSKT Y L+H+A++  L AA+A+ L+S   G  
Sbjct  382   YHLLQGEGMVGKAFKETKLFFVPEVTIFSKTNYALAHHAKVSGLHAALAVPLKSKSNGLV  441

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             +FVLEFF P+ C   E  + ML SLS+ +Q   +                 SS +    D
Sbjct  442   EFVLEFFFPKACIDTEAKQEMLKSLSVTLQQDFR-----------------SSNLVIDKD  484

Query  1748  IRIHKEVPNLK------YNSSIGPCEEGLSWTSSPMLVQESCMS---------------S  1864
             + +   +P+++        ++    EE L      + +Q+S M+               S
Sbjct  485   LELEVVLPDVEDMVLSESPANGAETEESLR----EVHMQDSTMTKANEKGKDKKDESKLS  540

Query  1865  SAFQNEKPSELLYKRLPEFVSGSGLSFDS-------TSGEGSAQNVRRAGDKKRMKAEKT  2023
             S   N +  + +   +P      GL  D+       ++G GS    RR GDK+R K EK 
Sbjct  541   SGLDNSQ-LDSVPNNVPSGAEPGGLRVDAGPSTEPASTGGGSMLGSRRPGDKRRSKNEKI  599

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I L++LQQYFAGSLKDAAKS+GV
Sbjct  600   IGLEVLQQYFAGSLKDAAKSIGV  622



>emb|CDX88002.1| BnaA06g25930D [Brassica napus]
Length=872

 Score =   427 bits (1099),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 254/610 (42%), Positives = 360/610 (59%), Gaps = 51/610 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTD  +  + +   +NA+ + +  L   E    E +   E ER+ +  P N  A
Sbjct  40    DGCWLETTDLKQS-EETASASNAMNDNTPFLYFAENPFQENVSNEETERRANQEPLNQVA  98

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGYIK  685
             +   +E+ + F            L E +E++RRWWI P  +    +SV +RL++A+  + 
Sbjct  99    TS--SEQAEKF------------LLEEAEVARRWWIAPRGSEGPSSSVKERLLRAISGLD  144

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQE  865
             +   DKD L+QIWVP  ++G+  L T  QP   + K   LA YR +S  Y FP +E S+ 
Sbjct  145   EAVPDKDFLVQIWVPFQQEGKNFLTTLAQPHLFNQKYSSLAKYRHVSETYNFPADEGSK-  203

Query  866   NVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIE  1045
             +VGLPGRVFL K+PEWTPDV+ F+ EEYPR+  AQ+ DVRG+ AVPVF++GS TCLGV+E
Sbjct  204   DVGLPGRVFLQKLPEWTPDVRFFRSEEYPRIKEAQKCDVRGSLAVPVFERGSGTCLGVVE  263

Query  1046  VVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT------CHSYQVVLPEILEVL  1207
             ++ TTQK+ YR EL+++CKALE VDLR S  SN++   T         Y   LPEI + L
Sbjct  264   IITTTQKMNYRPELENICKALEAVDLRSS--SNLKTPSTEFLQVYNDFYYAALPEISDFL  321

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
              S C ++ LPLA +W PC +QGK G RHSDEN  +CVST+DSAC++ D + + F EACSE
Sbjct  322   ASVCRSYDLPLALSWAPCDRQGKGGSRHSDENFSQCVSTIDSACFVLDEQSKCFLEACSE  381

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             +HLL+G G+VG+AF   +  F  ++T FSKT Y LSH+A++  L AA+A+ L+    G  
Sbjct  382   YHLLQGEGMVGKAFKETKLFFVPEVTIFSKTNYALSHHAKVSGLHAALAVPLKGKSNGLV  441

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             +FVLEFF P+ C   E  ++ML SLS+ +Q   ++  +V +++LE E   P  +    S+
Sbjct  442   EFVLEFFFPKSCIDTEAKEKMLKSLSVTLQQDFRSSNLVIDKDLELEVVLPDGEDMVLSE  501

Query  1748  IRIH--------KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLY  1903
               ++        +EV     +  I   E+G        L   S M +S   +      + 
Sbjct  502   SPVNGAETEGSLREVHMQDSSQMIKANEKGKDKKDESKL--SSGMDNSQLDS------VP  553

Query  1904  KRLPEFVSGSGLSFDS-------TSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGS  2062
               +P      GL  D+       ++G GS    RR GDK+R K EK I L++LQQYFAGS
Sbjct  554   NNVPSGAEPGGLRVDAGPSTEPASTGGGSMLGSRRPGDKRRSKNEKIIGLEVLQQYFAGS  613

Query  2063  LKDAAKSLGV  2092
             LKDAAKS+GV
Sbjct  614   LKDAAKSIGV  623



>emb|CCI55432.1| PH01B031C15.15 [Phyllostachys edulis]
Length=940

 Score =   429 bits (1103),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 208/386 (54%), Positives = 272/386 (70%), Gaps = 14/386 (4%)
 Frame = +2

Query  551   GQNGSNAVCSSGLAESSELSRRWWIGP---MATTSVMDRLIQALGYIKDFSRDK------  703
             G++  +     G  E+S   R W   P    A  +V +RL +AL  I   S+ +      
Sbjct  74    GEDDRDEAERPGRLEASPACRAWLFQPPQEAAEPTVKERLQRALERIASRSQSQSQSQWQ  133

Query  704   ----DVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENV  871
                 ++L+Q+WVP     R+VL T  QPF LD +  RLA YR +S  Y+F  +E ++  +
Sbjct  134   RGLGELLVQVWVPTLIGDRQVLTTCGQPFWLDRRNDRLASYRTVSTKYQFSADESARAEL  193

Query  872   GLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVV  1051
             GLPGRVF+G+VPEWTPDV+ F  EEYPRV HAQR+D+RG+ A+PVF++ SR CLGVIE+V
Sbjct  194   GLPGRVFVGRVPEWTPDVRYFSTEEYPRVRHAQRFDIRGSVALPVFERRSRACLGVIELV  253

Query  1052  LTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATH  1228
             +TTQK+ Y  E++++C AL+EVDLRGS +S+    K    SY+ ++PEI++VL++ C TH
Sbjct  254   MTTQKINYNAEIENICNALKEVDLRGSDVSSDPRAKVVDTSYRAIVPEIIDVLRTVCETH  313

Query  1229  KLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGL  1408
             KLPLAQTW+PCV Q K   RHSDE    C+STVD ACY+ DP + GFH+ACSEHHL +G 
Sbjct  314   KLPLAQTWIPCVCQAKRASRHSDEKCKYCISTVDEACYVRDPTVIGFHQACSEHHLFRGE  373

Query  1409  GVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFF  1588
             GVVGRAF TN+PCFS DIT++SK +YPLSHYA++FSL+AAVAI+LRS  TGS +FVLEFF
Sbjct  374   GVVGRAFGTNEPCFSPDITAYSKAQYPLSHYAKLFSLRAAVAIQLRSVRTGSLNFVLEFF  433

Query  1589  LPRDCKSPEEHKRMLTSLSIIIQNVC  1666
             LP +C   EE + ML SLSI IQ VC
Sbjct  434   LPMNCIKSEEQRAMLNSLSITIQQVC  459



>ref|XP_002532423.1| transcription factor, putative [Ricinus communis]
 gb|EEF29964.1| transcription factor, putative [Ricinus communis]
Length=902

 Score =   427 bits (1099),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 255/609 (42%), Positives = 362/609 (59%), Gaps = 42/609 (7%)
 Frame = +2

Query  347   WLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKK-SSLPENLSASQ  523
             WLE+TDG    +  P  ++ LF+ S   P   P++  L  + ++ RK+  ++PEN S   
Sbjct  34    WLESTDGINLLEPEPSRSSVLFDTSQYSPFKRPDHFSLDSDHQIHRKEIENMPENPSLDV  93

Query  524   FHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDK  703
             +   +     ++ ++   S    E  E  +R    P +T  +  RL+ A+ Y+KD+  + 
Sbjct  94    YPGIK-----EHVADTTISLVQPEGGESGKRCLTDPSST--INSRLMIAIEYLKDYVEES  146

Query  704   DVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPG  883
             DVLIQIWVP N+ G+ VL T DQP+ L+  C  LA YR++S  +    + D +E+ GLPG
Sbjct  147   DVLIQIWVPTNKGGQIVLTTIDQPYSLNPNCKGLASYRNVSKTFHLTADADLKESAGLPG  206

Query  884   RVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQ  1063
             RVFLGK+PEWTPDV+ F+ +E PR  +A+ Y + G  A+PVF+Q S  C+ V+E+V TTQ
Sbjct  207   RVFLGKLPEWTPDVRFFRSDECPRKNYAKLYQISGCLALPVFEQDSGVCMAVVEIVTTTQ  266

Query  1064  KVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILEVLKSACATHKLPL  1240
             K+ Y  E++ VCKALE VDL+GS+      VK C+  YQ+ +PEI E+L+S   T +LPL
Sbjct  267   KISYHLEVEIVCKALEAVDLKGSQDCFPFGVKACNQFYQIAVPEISEILQSVYDTFRLPL  326

Query  1241  AQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVG  1420
             A TW  C +QG+       E    C+ TVDSAC +A+  + GFHEACSE +L    G+VG
Sbjct  327   AMTWAICDRQGESEQHQFAEEFGYCICTVDSACCVAENDLMGFHEACSEQYLFLDQGIVG  386

Query  1421  RAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRD  1600
             +AF TN+  F+ DITSFSKT YPLSH+ARIF+L AAVAI LR+  TG  ++VLE FLPRD
Sbjct  387   KAFATNKQRFATDITSFSKTSYPLSHHARIFNLGAAVAIPLRNMYTGLVEYVLELFLPRD  446

Query  1601  CKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLK  1780
             CKS EE K++   L  I+Q  CQ+  V+ ++EL+ E    S +V    D R+ K V    
Sbjct  447   CKSIEEQKQIWDILPGIVQQACQSFHVIMDKELDNEV---SEQVVVDLDRRLLKFV----  499

Query  1781  YNSSIGPCEEGLSWTSSPMLVQE----SCMSSSAFQNEKPSEL------------LYKRL  1912
              +S   P +E   WT   +  ++      MS    + E   E             +Y+  
Sbjct  500   -SSPSEPSQEESFWTPHKIDTEKKGKCDFMSWGCPKEEPEDEFKITTHWDNNELDIYQEQ  558

Query  1913  -------PEFVSGSGL--SFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSL  2065
                    P F+    +  S DS+ G+  + + R AG+K++MK EKTI+LQ+L+QYFAGSL
Sbjct  559   IFSDFDHPNFMLDLRVNDSEDSSVGQYRSLSSRSAGEKRQMKTEKTISLQVLRQYFAGSL  618

Query  2066  KDAAKSLGV  2092
             KDAAKS+GV
Sbjct  619   KDAAKSIGV  627



>ref|XP_009150852.1| PREDICTED: protein NLP1-like [Brassica rapa]
 ref|XP_009150853.1| PREDICTED: protein NLP1-like [Brassica rapa]
 ref|XP_009150854.1| PREDICTED: protein NLP1-like [Brassica rapa]
Length=871

 Score =   426 bits (1095),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 254/610 (42%), Positives = 360/610 (59%), Gaps = 51/610 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCWLETTD  +  + +   +NA+ + +  L   E +  E +   E ER  +  P N  A
Sbjct  40    DGCWLETTDLKQS-EETASASNAVNDNTPFLYFSENSFQENVSNEETERTPNQEPLNQVA  98

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGYIK  685
             S   +E+ + F            L E +E++RRWWI P  +    +SV +RL++A+  + 
Sbjct  99    SS--SEQAEKF------------LLEEAEVARRWWIAPRGSEGPSSSVKERLLRAISGLD  144

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQE  865
             +   DKD L+QIWVP  ++G+  L T  QP   + K   LA YR +S  Y FP +E S+ 
Sbjct  145   EAVPDKDFLVQIWVPFQQEGKNFLTTLAQPHLFNQKYSSLAKYRHVSETYNFPADEGSK-  203

Query  866   NVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIE  1045
             +VGLPGRVFL K+PEWTPDV+ F+ EEYPR+  AQ+ DVRG+ AVPVF++GS TCLGV+E
Sbjct  204   DVGLPGRVFLQKLPEWTPDVRFFRSEEYPRIKEAQKCDVRGSLAVPVFERGSGTCLGVVE  263

Query  1046  VVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT------CHSYQVVLPEILEVL  1207
             ++ TTQK+ YR EL+++CKALE VDLR S  SN++   T         Y   LPEI + L
Sbjct  264   IITTTQKMNYRPELENICKALEAVDLRSS--SNLKTPSTEFLQVYNDFYYAALPEISDFL  321

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
              S C ++ LPLA +W PC +QGK G RHSDEN  +CVST+DSAC++ D + + F EACSE
Sbjct  322   ASVCRSYDLPLALSWAPCDRQGKGGSRHSDENFSQCVSTIDSACFVLDDQSKCFLEACSE  381

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             +HLL+G G+VG+AF   +  F  ++T FSKT Y L+H+A++  L AA+A+ L+    G  
Sbjct  382   YHLLQGEGMVGKAFKETKLFFVPEVTIFSKTNYALAHHAKVSGLHAALAVPLKGKSNGLV  441

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             +FVLEFF P+ C   E  ++ML SLS+ +Q   ++  +V +++LE E   P  +    S+
Sbjct  442   EFVLEFFFPKSCIDTEAKEKMLKSLSVTLQQDFRSSNLVIDKDLELEVVLPDGEDMVLSE  501

Query  1748  IRIH--------KEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLY  1903
               ++        +EV     +  I   E+G        L   S M +S   +      + 
Sbjct  502   SPLNGAETEESLREVHMQDSSQMIKANEKGKDKKDESKL--SSGMDNSQLDS------VP  553

Query  1904  KRLPEFVSGSGLSFDS-------TSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGS  2062
               +P      GL  D+       ++G GS    RR GDK+R K EK I L++LQQYFAGS
Sbjct  554   NNVPSGAEPGGLRVDAGPSTEPASTGGGSMLGSRRPGDKRRSKNEKIIGLEVLQQYFAGS  613

Query  2063  LKDAAKSLGV  2092
             LKDAAKS+GV
Sbjct  614   LKDAAKSIGV  623



>ref|NP_195253.4| plant regulator RWP-RK family protein [Arabidopsis thaliana]
 sp|Q7X9B9.3|NLP2_ARATH RecName: Full=Protein NLP2; Short=AtNLP2; AltName: Full=NIN-like 
protein 2; AltName: Full=Nodule inception protein-like protein 
2 [Arabidopsis thaliana]
 gb|AEE86488.1| plant regulator RWP-RK family protein [Arabidopsis thaliana]
Length=963

 Score =   428 bits (1100),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 264/641 (41%), Positives = 362/641 (56%), Gaps = 62/641 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--------HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKS  493
             +GCWLETTDG    Q         +  N N      Y     E  + + +   E  RK  
Sbjct  37    DGCWLETTDGKSLKQTMGQQVSDSTTMNDNNNNSYLYGYQYAENLSQDHISNEETGRKFP  96

Query  494   SLPENLSASQFHTERVQCFGQNG--SNAVCSSGLAESSELSRRWWIGPMAT----TSVMD  655
              +P      +  + +V  F Q+   S+A     L E SE  RR+WI P  +    +SV +
Sbjct  97    PIPPGFLKIEDLSNQVP-FDQSAVMSSAQAEKFLLEESEGGRRYWIAPRTSQGPSSSVKE  155

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             RL+QA+  + +  +DKD LIQIW+P+ ++G+  L T +QP   + K   L  YRD+S+ Y
Sbjct  156   RLVQAIEGLNEEVQDKDFLIQIWLPIQQEGKNFLTTSEQPHFFNPKYSSLKRYRDVSVAY  215

Query  836   EFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQ  1015
              F  +EDS+E+VGLPGRVFL K+PEWTPDV+ F+ EEYPR+  A++ DVRG+ A+PVF++
Sbjct  216   NFLADEDSKESVGLPGRVFLKKLPEWTPDVRFFRSEEYPRIKEAEQCDVRGSLALPVFER  275

Query  1016  GSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISN--VRNVKTCHS--YQVV  1183
             GS TCLGV+E+V TTQK+ YR ELD++CKALE V+LR S+  N   R     ++  Y   
Sbjct  276   GSGTCLGVVEIVTTTQKMNYRPELDNICKALESVNLRSSRSLNPPSREFLQVYNEFYYAA  335

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQ  1363
             LPE+ E L   C  + LPLA TW PC +QGK G RHSDEN   CVSTVD AC + D + +
Sbjct  336   LPEVSEFLTLVCRVYDLPLALTWAPCARQGKVGSRHSDENFSECVSTVDDACIVPDHQSR  395

Query  1364  GFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRL  1543
              F EACSEHHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L AA+A+ L
Sbjct  396   HFLEACSEHHLLQGEGIVGKAFNATKLFFVPEVTTFSKTNYPLAHHAKISGLHAALAVPL  455

Query  1544  RSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPS  1723
             ++    S +FVLEFF P+ C   E  + ML SLS  +Q   ++L +  ++ELE E   P 
Sbjct  456   KNKFNSSVEFVLEFFFPKACLDTEAQQDMLKSLSATLQQDFRSLNLFIDKELELEVVFP-  514

Query  1724  SKVAKHSDIRIHKEVPNLKYNSSIGP------CEEGLSWTSSPMLVQESCMSSS---AFQ  1876
                 +   +     + N      + P       +E  SW S  +   E     S    +Q
Sbjct  515   ---VREEVVFAENPLINAGTGEDMKPLPLEEISQEDSSWISHMIKANEKGKGVSLSWEYQ  571

Query  1877  NEKPSELLY------------------KRLPEF--VSGSGL------SFDSTSGEGSAQN  1978
              E+P E                         +F  V+ SGL      SF+S S  G  Q 
Sbjct  572   KEEPKEEFMLTSGWDNNQIGSGHNNFLSEAEQFQKVTNSGLRIDMDPSFESASF-GVGQT  630

Query  1979  V---RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             +   RR G+K+R K EKTI L++L+QYFAGSLKDAAKS+GV
Sbjct  631   LLGSRRPGEKRRTKTEKTIGLEVLRQYFAGSLKDAAKSIGV  671



>ref|XP_006409346.1| hypothetical protein EUTSA_v10022536mg [Eutrema salsugineum]
 gb|ESQ50799.1| hypothetical protein EUTSA_v10022536mg [Eutrema salsugineum]
Length=914

 Score =   425 bits (1093),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 253/619 (41%), Positives = 357/619 (58%), Gaps = 60/619 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEF--FQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCW+ETTD       + +    NA+ E S  L                        EN 
Sbjct  41    DGCWIETTDSKSLKETEEAVLAPNAMNESSPFL---------------------CFGENP  79

Query  512   SASQFHTERVQCFGQ-NGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLIQALG  676
             S   F  +  + F Q   S+ +    L E +E+ R WWI P A    ++SV  RL+QA+ 
Sbjct  80    SQDDFSNQ--EPFNQAETSSEIAEKFLLEEAEVGRSWWIAPRANEGPSSSVKKRLLQAIS  137

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
              + +   DKD L+QIWVP  ++G+  L T  QP   + +   LA YR +S NY FP +E 
Sbjct  138   GLNEAVVDKDFLVQIWVPFQQEGKNFLTTWAQPHLFNQEYSSLAKYRHVSENYNFPADEG  197

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
             S+ +VGLPGRVFL K+PEWTPDV+ F+ +EYPR+  AQ+ DVRG+ A+PVF++GS TCLG
Sbjct  198   SK-DVGLPGRVFLQKLPEWTPDVRFFRSDEYPRIKEAQKCDVRGSLALPVFERGSGTCLG  256

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQVVLPEILEVLKSA  1216
             V+E+V TTQK+ Y  EL+++CKALE VDLR S       V +   Y   LPEI + L S 
Sbjct  257   VVEIVTTTQKMNYGPELENICKALEAVDLRSSSYPPSTEV-SSDFYNAALPEISDFLASV  315

Query  1217  CATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHL  1396
             C ++ LPLA +W PC + GK G RHSDEN  +CVST+DSAC++ D +   F +ACSEHHL
Sbjct  316   CRSYDLPLALSWAPCARNGKGGSRHSDENFSQCVSTIDSACFVLDEQSNDFLKACSEHHL  375

Query  1397  LKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFV  1576
             L+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L AA+A+ L+S C+G  +FV
Sbjct  376   LQGEGIVGKAFKETKLFFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKSKCSGLVEFV  435

Query  1577  LEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleee-----------ttSPS  1723
             LEFF P+ C   E  + ML SLS+ +Q   ++  +V +++++ E           + +P 
Sbjct  436   LEFFFPKSCLDTEAKQDMLKSLSVTLQQDFRSSNLVIDKDMDLEVVLLVREDMVFSENPL  495

Query  1724  SKVAKHSDIR-IHKEVPNLKYNSSIGPCEEG----LSWTSSPMLVQESCMSSSAFQNEK-  1885
             +       +R IH +  +   +  I   E+G    LSW       ++    SS + N + 
Sbjct  496   TGAETAESLREIHLQESSW-ISHMINANEKGKGVSLSWEYQNEDPKDEFKRSSGWDNNQL  554

Query  1886  ---PSEL-LYKRLPEFVSGSGLSFD------STSGEGSAQNVRRAGDKKRMKAEKTITLQ  2035
                P +  L  +  +  S SGL  D      S S  G+    RR G+K+R K EKTI L+
Sbjct  555   EPTPKDFPLEAQQFQQASNSGLRVDTGPSTESASTGGNMLGSRRPGEKRRTKTEKTIGLE  614

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +L+QYFAGSLKDAAKS+GV
Sbjct  615   VLRQYFAGSLKDAAKSIGV  633



>ref|XP_010229247.1| PREDICTED: protein NLP1-like [Brachypodium distachyon]
 ref|XP_010229248.1| PREDICTED: protein NLP1-like [Brachypodium distachyon]
 ref|XP_010229249.1| PREDICTED: protein NLP1-like [Brachypodium distachyon]
Length=921

 Score =   425 bits (1092),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 240/535 (45%), Positives = 324/535 (61%), Gaps = 45/535 (8%)
 Frame = +2

Query  614   RWWIGPMATTSVMDRLIQALGYIKDFSRDK--DVLIQIWVPVNRDGRRVLVTGDQPFQLD  787
             R W+      +V +RL +AL  I   S+    ++L+Q+WVP     R+VL T  QPF  D
Sbjct  96    RAWLLQAEADTVKERLRRALQGIASRSQSAAGELLVQVWVPTRIGDRQVLTTCGQPFWFD  155

Query  788   LKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHA  967
              +  RL  YR +S+ Y+F  +E +   +GLPGRVF+G+VPEWTPDV+ F  +EYPRV HA
Sbjct  156   SRSDRLESYRTVSVKYQFSADESACAELGLPGRVFVGRVPEWTPDVRYFTDQEYPRVRHA  215

Query  968   QRYDVRGTFAVPVFDQGSRT-----CLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGS  1132
             Q +D+RG+ A+PVFD+   +     CLGV+E+V+TTQK+ Y  E++++C AL EVDLR S
Sbjct  216   QHFDIRGSVAMPVFDRRRSSSSSRGCLGVVELVMTTQKINYNAEIENICNALGEVDLRSS  275

Query  1133  KISNVRNVKTCHS-YQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLL  1309
              +S+    +   S Y+ V+PEIL VL++ C THKLPLAQTW+PCV Q K   RHSDE   
Sbjct  276   DVSSDPRAQVFESSYRAVVPEILHVLRAVCDTHKLPLAQTWIPCVCQAKRASRHSDEKYK  335

Query  1310  RCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYP  1489
              CVSTVD ACY+ D  + GFH+ACSEHHL +G GVVG A  TN+PCFS DIT++SK +YP
Sbjct  336   YCVSTVDEACYVRDTDVIGFHQACSEHHLFRGEGVVGTALRTNEPCFSPDITTYSKVQYP  395

Query  1490  LSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQ  1669
             LSHYA++FSL+AAVAIRLRS  TGS DFVLEFFLPR+C   E+   ML+SLS  IQ VC 
Sbjct  396   LSHYAKLFSLRAAVAIRLRSVRTGSLDFVLEFFLPRNCIKSEDQGLMLSSLSNTIQQVC-  454

Query  1670  tlrvvteqeleeettSPSSKV-----------AKHSDIRIHKEVPNLKYNSSIGPCEEGL  1816
                 V   +   +  SP + +            K  +I     VP     +S+   EE  
Sbjct  455   CTLRVVSVKELVDDESPETNLPTPPEFYARATEKFDEICSGINVP--ARTTSLEASEEVS  512

Query  1817  SWTSSPMLVQE-------SCMSSSAFQNEKPSELL----YKRLPEFVSGSGL--------  1939
             SW +S + VQ         C     F  ++         ++  P  V   G         
Sbjct  513   SWIASLVDVQNKGAKEEIDCDLPFGFSKQEDEGFSVTAGWRTSPVLVPEDGFLSEFKQHE  572

Query  1940  SFDST----SGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              +++     S + S  N  +A +K+R K EKT++LQ L+++FAGSLK+AAK+LGV
Sbjct  573   EYEAKEVICSSDPSLSNSDKAVEKRRTKMEKTVSLQELRKHFAGSLKEAAKNLGV  627



>ref|XP_009121157.1| PREDICTED: protein NLP1 isoform X2 [Brassica rapa]
Length=896

 Score =   424 bits (1089),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 263/635 (41%), Positives = 345/635 (54%), Gaps = 94/635 (15%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSL---PEN  508
             +GCWLETTD                  S  L + E    E   +S      SS     EN
Sbjct  45    DGCWLETTD------------------SKSLKETE----EAASDSTAMNANSSFLCFGEN  82

Query  509   LSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALG  676
              S   F  E  +   Q G +      L + +E+ R WWI P       +SV +RL++A+ 
Sbjct  83    PSQDNFSNEETERMNQEGFDQA-EKFLLDEAEVGRSWWIAPRTREDPCSSVKERLLRAIS  141

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
              +++   DKD L+QIWVP  ++G+  L T  QP   + K   LA YR +S  Y FP +E 
Sbjct  142   GLEEAVPDKDFLVQIWVPFQQEGKNFLTTLAQPHLFNQKYSSLAKYRHVSETYNFPADEG  201

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
             S E  GLPGRVFL K PEWTPDV+ F+ +EYPR+  AQ+ DVRG+ A+PVF++ S TCLG
Sbjct  202   STEG-GLPGRVFLQKFPEWTPDVRFFRSDEYPRIKEAQKCDVRGSLALPVFERCSGTCLG  260

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVR---NVKTCHSYQVVLPEILEVL  1207
             V+EVV TTQK+ YR EL+++CKALE VDLR S  SN++   N      Y   LPEI + L
Sbjct  261   VVEVVTTTQKMNYRPELENICKALEAVDLRSS--SNLKPPNNEVYNDFYYAALPEISDFL  318

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
              S C  + LPLA +W PC QQGK G RHSDEN  +CVST+DSAC++ D   + F EACSE
Sbjct  319   ASVCRRYDLPLALSWAPCAQQGKGGSRHSDENFSQCVSTIDSACFVLDEESKYFLEACSE  378

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLL+G G+VG+AF   + CF  ++T+FSKT YPL+H+A+I  L AA+A+ L+S C G  
Sbjct  379   HHLLQGEGIVGKAFKATKLCFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKSKCNGLV  438

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             +FVLEFF P+ C   E  + ML SLS  +Q   +                 SS +    D
Sbjct  439   EFVLEFFFPKGCLDTEAKQEMLKSLSATLQQDFR-----------------SSNLVIDKD  481

Query  1748  IRIHKEVP-----NLKYNSSIGP-CEEGL---------SWTSSPMLVQESCMSSS---AF  1873
             + +   +P      L  N   G    E L         SW S  +   E     S    +
Sbjct  482   LELEVVLPVREDMVLSENPLTGAETAEALREIHLLQESSWISHMIKANEKGKDVSLSWEY  541

Query  1874  QNEKPSELLYKRLP-------------------EFVSGS--GLSFDS-TSGEGSAQNVRR  1987
             QNE P +  +K  P                   +F  GS  GL  D+  S E ++   RR
Sbjct  542   QNEDPKD-EFKLSPGWDNSQLDPAPNNIPSEAEQFQQGSTPGLRVDAGPSTESASTGGRR  600

Query  1988  AGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              G+K+R K EKTI L +L+QYFAGSLKDAAKS+GV
Sbjct  601   PGEKRRTKTEKTIGLDVLRQYFAGSLKDAAKSIGV  635



>emb|CDX71338.1| BnaC07g06170D [Brassica napus]
Length=896

 Score =   424 bits (1089),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 260/639 (41%), Positives = 344/639 (54%), Gaps = 102/639 (16%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ-------HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSS  496
             +GCWLETTD     +        +  NAN+ F                            
Sbjct  45    DGCWLETTDSKSLKETEEGASDSTAMNANSPF--------------------------LC  78

Query  497   LPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLI  664
               EN S   F  E  +   Q G +      L + +E+ R WWI P      ++SV +RL+
Sbjct  79    FGENPSQDNFSNEETERMNQEGLDQA-EKFLLDEAEVGRSWWIAPRTREDPSSSVKERLL  137

Query  665   QALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFP  844
             +A+  +++   DKD L+QIWVP  ++G+  L T  QP   + K   LA YR +S NY FP
Sbjct  138   RAISGLEEAVPDKDFLVQIWVPFQQEGKNFLTTLAQPHLFNQKYTSLAKYRHVSENYNFP  197

Query  845   VEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSR  1024
              +E S E  GLPGRVFL K PEWTPDV+ F+ +EYPR+  AQ+ DVRG+ A+PVF++ S 
Sbjct  198   ADEGSTEG-GLPGRVFLQKFPEWTPDVRFFRSDEYPRIKEAQKCDVRGSLALPVFERCSG  256

Query  1025  TCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVR---NVKTCHSYQVVLPEI  1195
             TCLGV+EVV TTQK+ YR EL+++CKALE VDLR S  SN++   N      Y   LPEI
Sbjct  257   TCLGVVEVVTTTQKMNYRPELENICKALEAVDLRSS--SNLKPPSNEVYNDFYYAALPEI  314

Query  1196  LEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHE  1375
              + L S C  + LPLA +W PC QQGK G RHSDEN  +CVST+DSAC++ D   + F E
Sbjct  315   SDFLASVCRRYDLPLALSWAPCAQQGKGGSRHSDENFSQCVSTIDSACFVLDEESKYFLE  374

Query  1376  ACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTC  1555
             ACSEHHLL+G G+VG+AF   + CF  ++ +FSKT YPL+H+A+I  L AA+A+ L+S  
Sbjct  375   ACSEHHLLQGEGIVGKAFKATKLCFVPEVITFSKTNYPLAHHAKISGLHAALAVPLKSKS  434

Query  1556  TGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVA  1735
              G  DFVLEFF P+ C   E  + ML SLS+ +Q   +                 SS + 
Sbjct  435   NGLVDFVLEFFFPKGCLDTEAKQEMLKSLSVTLQQDFR-----------------SSNLV  477

Query  1736  KHSDIRIHKEVP-----NLKYNSSIGP-CEEGL---------SWTSSPMLVQESCMSSS-  1867
                D+ +   +P      L  N   G    E L         SW S  +   E     S 
Sbjct  478   IDKDLELEVVLPVREDMVLLENPLTGAETAEALREIHLLQESSWISHMIKANEKGKDVSL  537

Query  1868  --AFQNEKPSELLYKRLP-------------------EFVSG--SGLSFDS-TSGEGSAQ  1975
                +QNE P +  +K  P                   +F  G  SGL  D+  S E ++ 
Sbjct  538   SWEYQNEDPKD-EFKLSPGWNNSQLDPAPNNIPSEAEQFQQGSTSGLRVDAGPSTESAST  596

Query  1976  NVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               RR G+K+R K EKTI L +L+QYFAGSLKDAAKS+GV
Sbjct  597   GGRRPGEKRRTKTEKTIGLDVLRQYFAGSLKDAAKSIGV  635



>emb|CDY31378.1| BnaA07g03130D [Brassica napus]
Length=895

 Score =   423 bits (1088),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 262/636 (41%), Positives = 346/636 (54%), Gaps = 93/636 (15%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSL---PEN  508
             +GCWLETTD                  S  L + E    E   +S      SS     EN
Sbjct  41    DGCWLETTD------------------SKSLKETE----EAASDSTAMNANSSFLCFGEN  78

Query  509   LSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALG  676
              S   F  E  +   Q G +      L + +E+ R WWI P       +SV +RL++A+ 
Sbjct  79    PSQDNFSNEETERMNQEGFDQA-EKFLLDEAEVGRSWWIAPRTREDPCSSVKERLLRAIS  137

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
              +++   DKD L+QIWVP  ++G+  L T  QP   + K   LA YR +S  Y FP +E 
Sbjct  138   GLEEAVPDKDFLVQIWVPFQQEGKNFLTTLAQPHLFNQKYSSLAKYRHVSETYNFPADEG  197

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
             S E  GLPGRVFL K PEWTPDV+ F+ +EYPR+  AQ+ DVRG+ A+PVF++ S TCLG
Sbjct  198   STEG-GLPGRVFLQKFPEWTPDVRFFRSDEYPRIKEAQKCDVRGSLALPVFERCSGTCLG  256

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGS---KISNVRNVKTCHS-YQVVLPEILEV  1204
             V+EVV TTQK+ YR EL+++CKALE VDLR S   K  N  +++  +  Y   LPEI + 
Sbjct  257   VVEVVTTTQKMNYRPELENICKALEAVDLRSSSNLKPPNNESLQVYNDFYYAALPEISDF  316

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             L S C  + LPLA +W PC QQGK G RHSDEN  +CVST+DSAC++ D   + F EACS
Sbjct  317   LASVCRRYDLPLALSWAPCAQQGKGGSRHSDENFSQCVSTIDSACFVLDEESKYFLEACS  376

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLL+G G+VG+AF   + CF  ++T+FSKT YPL+H+A+I  L AA+A+ L+S C G 
Sbjct  377   EHHLLQGEGIVGKAFKATKLCFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKSKCNGL  436

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHS  1744
              +FVLEFF P+ C   E  + ML SLS  +Q   +                 SS +    
Sbjct  437   VEFVLEFFFPKGCLDTEAKQEMLKSLSATLQQDFR-----------------SSNLVIDK  479

Query  1745  DIRIHKEVP-----NLKYNSSIGP-CEEGL---------SWTSSPMLVQESCMSSS---A  1870
             D+ +   +P      L  N   G    E L         SW S  +   E     S    
Sbjct  480   DLELEVVLPVREDMVLSENPLTGAETAEALREIHLLQESSWISHMIKANEKGKDVSLSWE  539

Query  1871  FQNEKPSELLYKRLP-------------------EFVSGS--GLSFDS-TSGEGSAQNVR  1984
             +QNE P +  +K  P                   +F  GS  GL  D+  S E ++   R
Sbjct  540   YQNEDPKD-EFKLSPGWDNSQLDPAPNNIPSEAEQFQQGSTPGLRVDAGPSTESASTGGR  598

Query  1985  RAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R G+K+R K EKTI L +L+QYFAGSLKDAAKS+GV
Sbjct  599   RPGEKRRTKTEKTIGLDVLRQYFAGSLKDAAKSIGV  634



>ref|XP_009121154.1| PREDICTED: protein NLP1 isoform X1 [Brassica rapa]
 ref|XP_009121155.1| PREDICTED: protein NLP1 isoform X1 [Brassica rapa]
 ref|XP_009121156.1| PREDICTED: protein NLP1 isoform X1 [Brassica rapa]
Length=899

 Score =   423 bits (1087),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 262/636 (41%), Positives = 346/636 (54%), Gaps = 93/636 (15%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSL---PEN  508
             +GCWLETTD                  S  L + E    E   +S      SS     EN
Sbjct  45    DGCWLETTD------------------SKSLKETE----EAASDSTAMNANSSFLCFGEN  82

Query  509   LSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALG  676
              S   F  E  +   Q G +      L + +E+ R WWI P       +SV +RL++A+ 
Sbjct  83    PSQDNFSNEETERMNQEGFDQA-EKFLLDEAEVGRSWWIAPRTREDPCSSVKERLLRAIS  141

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
              +++   DKD L+QIWVP  ++G+  L T  QP   + K   LA YR +S  Y FP +E 
Sbjct  142   GLEEAVPDKDFLVQIWVPFQQEGKNFLTTLAQPHLFNQKYSSLAKYRHVSETYNFPADEG  201

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
             S E  GLPGRVFL K PEWTPDV+ F+ +EYPR+  AQ+ DVRG+ A+PVF++ S TCLG
Sbjct  202   STEG-GLPGRVFLQKFPEWTPDVRFFRSDEYPRIKEAQKCDVRGSLALPVFERCSGTCLG  260

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGS---KISNVRNVKTCHS-YQVVLPEILEV  1204
             V+EVV TTQK+ YR EL+++CKALE VDLR S   K  N  +++  +  Y   LPEI + 
Sbjct  261   VVEVVTTTQKMNYRPELENICKALEAVDLRSSSNLKPPNNESLQVYNDFYYAALPEISDF  320

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             L S C  + LPLA +W PC QQGK G RHSDEN  +CVST+DSAC++ D   + F EACS
Sbjct  321   LASVCRRYDLPLALSWAPCAQQGKGGSRHSDENFSQCVSTIDSACFVLDEESKYFLEACS  380

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLL+G G+VG+AF   + CF  ++T+FSKT YPL+H+A+I  L AA+A+ L+S C G 
Sbjct  381   EHHLLQGEGIVGKAFKATKLCFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKSKCNGL  440

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHS  1744
              +FVLEFF P+ C   E  + ML SLS  +Q   +                 SS +    
Sbjct  441   VEFVLEFFFPKGCLDTEAKQEMLKSLSATLQQDFR-----------------SSNLVIDK  483

Query  1745  DIRIHKEVP-----NLKYNSSIGP-CEEGL---------SWTSSPMLVQESCMSSS---A  1870
             D+ +   +P      L  N   G    E L         SW S  +   E     S    
Sbjct  484   DLELEVVLPVREDMVLSENPLTGAETAEALREIHLLQESSWISHMIKANEKGKDVSLSWE  543

Query  1871  FQNEKPSELLYKRLP-------------------EFVSGS--GLSFDS-TSGEGSAQNVR  1984
             +QNE P +  +K  P                   +F  GS  GL  D+  S E ++   R
Sbjct  544   YQNEDPKD-EFKLSPGWDNSQLDPAPNNIPSEAEQFQQGSTPGLRVDAGPSTESASTGGR  602

Query  1985  RAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R G+K+R K EKTI L +L+QYFAGSLKDAAKS+GV
Sbjct  603   RPGEKRRTKTEKTIGLDVLRQYFAGSLKDAAKSIGV  638



>ref|XP_006296934.1| hypothetical protein CARUB_v10012927mg [Capsella rubella]
 gb|EOA29832.1| hypothetical protein CARUB_v10012927mg [Capsella rubella]
Length=917

 Score =   423 bits (1088),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 252/622 (41%), Positives = 352/622 (57%), Gaps = 60/622 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTD     Q   S   + A+ + S  L   E  + +     E E  KS      
Sbjct  41    DGCWLETTDSKSLKQTEQSGSASTAMNDNSTFLCFGENPSQDNFSHEETENNKS------  94

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGY  679
               +Q   ++ + F            L E +E+ + WWI P A+    +SV +RL+QA+  
Sbjct  95    -MNQEPFDQAEKF------------LLEEAEVGKSWWIAPRASEGASSSVKERLLQAISG  141

Query  680   IKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDS  859
             + +  +DKD L+QIWVP+ ++G+  L T  QP   + +   LA YR +S  Y FP +E  
Sbjct  142   LNEAVQDKDFLVQIWVPIQQEGKSFLTTWAQPHLFNQEYSSLAEYRHVSETYNFPADEGL  201

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
              + VGLPGRVFL K+PEWTPDV+ F+R+EYPR+  AQ+ DVRG+ A+PVF++GS TCLGV
Sbjct  202   NDFVGLPGRVFLQKLPEWTPDVRFFRRDEYPRIKEAQKCDVRGSLALPVFERGSGTCLGV  261

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQ----VVLPEILEVL  1207
             +E+V TTQK+ YR EL+ +CKALE VDLR S   N  + +    Y       LPEI + L
Sbjct  262   VEIVTTTQKMNYRQELEKMCKALEAVDLRSSSNLNTPSSEFLQVYSDFYCAALPEIKDFL  321

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
              + C  + LPLA +W PC  QGK G RHSD+N  +CVST DSAC + D + + F EACSE
Sbjct  322   ATVCRLYDLPLALSWAPCAPQGKHGSRHSDDNFSQCVSTTDSACSVLDEQSKSFWEACSE  381

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L AA+A+ L+S  +G  
Sbjct  382   HHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKSK-SGLV  440

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             +FVLEFF P+ C   E  + ML SLS+ +Q   ++  +V +++LE E   P  +    S+
Sbjct  441   EFVLEFFFPKACLDTEAQQEMLKSLSVTLQQNFRSSNLVIDKDLELEVVLPVRETMLFSE  500

Query  1748  IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEKPSELLYKRLPE  1918
                + +       +      +  SW S  +   E     S    +Q E P EL   R   
Sbjct  501   ---NPQSGAETTETLTEIEMQESSWISHMIKANEKGKGVSLSWEYQKEDPKELSSGRENT  557

Query  1919  FV-----------------SGSGLSFDS-------TSGEGSAQNVRRAGDKKRMKAEKTI  2026
              +                 S SGL  DS       ++G G+    RR GDK+R K EKTI
Sbjct  558   LIDPSPNNVPLEAEQLQQASTSGLRVDSGPSTKSPSTGGGNMLGSRRPGDKRRTKTEKTI  617

Query  2027  TLQILQQYFAGSLKDAAKSLGV  2092
              L++L+Q+FAGSLKDAAKS+GV
Sbjct  618   GLEVLRQHFAGSLKDAAKSIGV  639



>ref|XP_011000890.1| PREDICTED: protein NLP2-like isoform X1 [Populus euphratica]
Length=934

 Score =   423 bits (1088),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 245/632 (39%), Positives = 353/632 (56%), Gaps = 75/632 (12%)
 Frame = +2

Query  347   WLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMK-----ESEVERK-KSSLPEN  508
             W E   G  F Q     +N L +PS  +P     N  +       + E ER    + P +
Sbjct  34    WFEKDGGFNFLQQGLSTSNVLHDPSLYIPVTGTTNWSIASNQKDYQEETERHCHGNPPLD  93

Query  509   LSASQFHTERVQC-------------FGQNGSNAVCSSGLAESSELSRRWWIGPMATTSV  649
                S   TE VQ              F    S+ V ++GL     + +R  + P  + SV
Sbjct  94    YPNS---TELVQTELQVEDSVETSTPFSHPASSRVEAAGLGCEWRMVQR--VNPGTSCSV  148

Query  650   MDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISI  829
              +R++QA+GY+K+  +D+D+LIQIW+P+ ++G+RVL T DQP+ ++  C  LA YR +S 
Sbjct  149   KERVMQAVGYLKNCVQDRDILIQIWLPMEKEGKRVLATIDQPYFVNPSCKSLASYRKVST  208

Query  830   NYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVF  1009
              Y F  EED++ +VG PGRVFL K+PEWTPDV+LF+REEYP   HA ++++RG+ A+P+F
Sbjct  209   AYHFQAEEDAKCSVGFPGRVFLEKLPEWTPDVRLFRREEYPHKDHAVQHNIRGSLALPLF  268

Query  1010  DQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVL  1186
              QGS TCLG++E+  T QK+ YR+EL  +CK L+ VDLR S+      V+TC+   +  +
Sbjct  269   KQGSETCLGIVEIATTIQKISYRSELQDICKVLQAVDLRSSEDFCSPGVETCNRLNRAAV  328

Query  1187  PEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQG  1366
             PEI +++KS C T++LPLA TW  C +QGK G +   E    C+STVDSAC++AD    G
Sbjct  329   PEISDIVKSVCKTYRLPLALTWALCSRQGKIGRQQFPERFSSCISTVDSACFLADKDFSG  388

Query  1367  FHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLR  1546
             FH A  E +L  G G+VGRAF T + CF+ DI SFSK +YPL+H+A+IF L AA+AI LR
Sbjct  389   FHMASFEQYLFLGQGIVGRAFTTQKQCFTNDIASFSKKDYPLAHHAKIFGLHAAIAIPLR  448

Query  1547  STCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSS  1726
             S  TG  +FV+E FLP+DC+  EE K+M   L I+++ VC+                 S 
Sbjct  449   SISTGLVEFVVELFLPKDCQETEEQKKMWDLLPIVLKQVCR-----------------SI  491

Query  1727  KVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQ---ESCMSSSAFQNEKPSEL  1897
             ++    ++ I +   +  Y S   P +E  SW +  +  Q   +SC+ S  +  E   E 
Sbjct  492   QIVMDKELYIGENKSSESYPSKEAPPDES-SWIARMVEAQKKGKSCIVSWDYPKEPKEEF  550

Query  1898  --------------------------LYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDK  1999
                                        + R    + G G+SF    G   +    + G K
Sbjct  551   KTIIHWDDSAVEIDQKQVISELGQLQQHSRPNINIEGDGVSF--AFGGRRSLGSTKIGKK  608

Query  2000  KRMKAE-KTITLQILQQYFAGSLKDAAKSLGV  2092
             +R K E +TI+L +L+QYFAGSL DAA+SLGV
Sbjct  609   RRTKTEIQTISLGVLRQYFAGSLNDAAQSLGV  640



>ref|XP_002886100.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62359.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=914

 Score =   422 bits (1084),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 252/623 (40%), Positives = 354/623 (57%), Gaps = 64/623 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTD     Q   S   + A+ + S  L                        EN 
Sbjct  41    DGCWLETTDSKSLNQTEQSASASTAMNDNSPFL---------------------CFGENP  79

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGY  679
             S   F  E  +    +  +      L E +E+ + WWI P A+    +SV +RL+QA+  
Sbjct  80    SQDNFSNEETERMFPHSPSYQAEKFLLEEAEVGKSWWIAPRASEGPSSSVKERLLQAISG  139

Query  680   IKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDS  859
             + +  +DKD L+QIWVP+ ++G+  L T  QP   + +   LA YR +S  Y FP +E  
Sbjct  140   LNEAVQDKDFLVQIWVPIQQEGKSFLTTWAQPHLFNQEYSSLAEYRHVSETYNFPADEGM  199

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
             +E VGLPGRVFL K+PEWTPDV+ F+R+EYPR+  AQ+ DVRG+ A+PVF++GS  CLGV
Sbjct  200   KEFVGLPGRVFLQKLPEWTPDVRFFRRDEYPRIKEAQKCDVRGSLALPVFERGSGICLGV  259

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQ----VVLPEILEVL  1207
             +E+V TTQK+ YR EL+ +CKALE V+LR S   N  + +    Y       LPEI + L
Sbjct  260   VEIVTTTQKMNYRQELEKMCKALEAVNLRSSSNLNPPSSEFLQVYSDFYCAALPEIKDFL  319

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
              + C ++ LPLA +W PC +QGK G RHSDEN  +CVST+DSAC + D + + F EACSE
Sbjct  320   ATVCRSYDLPLALSWAPCARQGKVGSRHSDENFSQCVSTIDSACSVPDEQSKIFWEACSE  379

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L AA+A+ L+S  +G  
Sbjct  380   HHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKSK-SGLV  438

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             +FVLEFF P+ C   E  + +L SLS+ +Q   ++  +V +++LE E   P  +    S+
Sbjct  439   EFVLEFFFPKACLDTEAQQEILKSLSVTLQQDFRSSNLVIDKDLELEVVLPVRETMLFSE  498

Query  1748  IRIHKEVPNLKYNSSIGPCE-EGLSWTSSPMLVQESCMSSS---AFQNEKPSELLYKR--  1909
                   +   +   S+   E +  SW S  ++  E     S    +Q E P EL   R  
Sbjct  499   ----NPLSGAETAESLTEIEMQESSWISHMLMANEKGKDVSLSWEYQKEDPKELSSGREN  554

Query  1910  -----LPEFV----------SGSGLSFD-------STSGEGSAQNVRRAGDKKRMKAEKT  2023
                  +P  V          S SGL  D       S+ G G+    R+ G+K+R K EKT
Sbjct  555   TQLDPVPNNVPLEAEQFQQASTSGLKVDTGPSTESSSIGGGNMLGSRKPGEKRRTKTEKT  614

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I L++L+QYFAGSLKDAAKS+GV
Sbjct  615   IGLEVLRQYFAGSLKDAAKSIGV  637



>ref|XP_010467467.1| PREDICTED: protein NLP1 [Camelina sativa]
 ref|XP_010467468.1| PREDICTED: protein NLP1 [Camelina sativa]
Length=916

 Score =   420 bits (1080),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 252/622 (41%), Positives = 348/622 (56%), Gaps = 63/622 (10%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTD     Q   S   + A+ + S  L                        EN 
Sbjct  41    DGCWLETTDNKNLKQTEQSGSASTAMNDNSTFL---------------------CFGENP  79

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGY  679
             S     TE  +   Q   N      L E +EL + WWI P A+    +SV +RL+QA+  
Sbjct  80    SQDNEETENNKSMNQESFNQA-EKFLLEEAELGKSWWIAPRASEGPSSSVKERLLQAISG  138

Query  680   IKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDS  859
             + +  +DKD L+QIWVPV ++G+  L T  QP   + +   LA YR +S  Y FP +E  
Sbjct  139   LNETVQDKDFLVQIWVPVQQEGKSFLTTWAQPHLFNQEYSSLAEYRHVSETYNFPADEGM  198

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
              + VGLPGRVFL K+PEWTPDV+ F+R+EYPR+  A++ DVRG+ A+PVF++GS  CLGV
Sbjct  199   NDYVGLPGRVFLQKLPEWTPDVRFFRRDEYPRIKEARKCDVRGSLALPVFERGSGICLGV  258

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQ----VVLPEILEVL  1207
             +E+V TTQK+ YR EL+ +CKALE VDLR S   N  + +    Y+      LPEI + L
Sbjct  259   VEIVTTTQKMNYRQELEKMCKALEAVDLRSSSNLNTPSSEFLQVYKDFYCAALPEIKDFL  318

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
              + C ++ LPLA +W PC  QGK G RHSDEN  +CVST DSAC + D + + F EACSE
Sbjct  319   ATVCRSYDLPLALSWAPCAPQGKRGSRHSDENFSQCVSTTDSACSVPDEQSKSFWEACSE  378

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLL+G G+VG+AF   +  F  ++ +FSKT YPL+H+A+I  L AA+A+ L+S  +G  
Sbjct  379   HHLLQGEGIVGKAFEATKLFFVPEVATFSKTNYPLAHHAKISGLHAALAVPLKSK-SGLV  437

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             +FVLEFF P+ C   E  + ML SLS+ +Q   ++  +V +++LE E   P  +    S+
Sbjct  438   EFVLEFFFPKACLDTEAQQEMLKSLSVTLQQDFRSSNLVIDKDLELEVVLPVRETMLFSE  497

Query  1748  IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEKPSELLYKR---  1909
               +          +  G   +  SW S  +   E     S    +Q E P EL   R   
Sbjct  498   NPLSGAE---TAETLTGIQMQESSWISHMIKANEKGKDVSLSWEYQKEDPKELSSGRENH  554

Query  1910  --------LP------EFVSGSGLSFDS-------TSGEGSAQNVRRAGDKKRMKAEKTI  2026
                     +P      +  S SGL  DS       ++G  +    RR G+K+R K EKTI
Sbjct  555   QLDPSPNNVPLEAEQFQQASTSGLRVDSGPSTETPSTGGKNMSGSRRPGEKRRTKTEKTI  614

Query  2027  TLQILQQYFAGSLKDAAKSLGV  2092
              L++L+Q+FAGSLKDAAKS+GV
Sbjct  615   GLEVLRQHFAGSLKDAAKSIGV  636



>ref|XP_002465923.1| hypothetical protein SORBIDRAFT_01g048290 [Sorghum bicolor]
 gb|EER92921.1| hypothetical protein SORBIDRAFT_01g048290 [Sorghum bicolor]
Length=905

 Score =   420 bits (1079),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 199/357 (56%), Positives = 261/357 (73%), Gaps = 5/357 (1%)
 Frame = +2

Query  611   RRWWIGPM--ATTSVMDRLIQALGYIKDFSRDK--DVLIQIWVPVNRDGRRVLVTGDQPF  778
             R W   P      +V +RL +AL  I   S+ +  ++L Q+WVP     R+VL T  QPF
Sbjct  96    RGWVFQPRHEVEATVKERLRRALERIASLSQTQPGELLAQVWVPTVIGDRQVLTTCGQPF  155

Query  779   QLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRV  958
              LD +  RLA+YR +S+ Y+F  +E ++ ++G+PGRVF+G+VPEWTPDV+ F  EEYPRV
Sbjct  156   WLDRRNERLANYRTVSMKYQFSADETARADLGMPGRVFVGRVPEWTPDVRYFSTEEYPRV  215

Query  959   GHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKI  1138
              HAQ +D+RG+ A+P+F+  SR CLGV+E+V+TT+KV Y  E+ ++C AL+EVDLR S +
Sbjct  216   RHAQYFDIRGSVALPIFEPRSRACLGVVELVMTTEKVNYNAEIQNICSALKEVDLRSSDV  275

Query  1139  SNVRNVK-TCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRC  1315
             S+    K T  SY+  +PEI++VL++ C THKLPLAQTW+PC+ Q K G RH+DE L  C
Sbjct  276   SSDPRAKVTDTSYRATIPEIVDVLRTVCETHKLPLAQTWIPCICQAKRGSRHTDEKLKYC  335

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             VSTVD ACY+ D  ++GFHEACSEHHL +G GVVGRAF TN+PCFS DIT+ SK +YPLS
Sbjct  336   VSTVDEACYVRDLNVKGFHEACSEHHLFRGEGVVGRAFGTNEPCFSEDITTSSKVQYPLS  395

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVC  1666
             H+A++FSL+AAVAIRLRS  TGS D+VLEFFLP DC   E+ + ML SLSI IQ  C
Sbjct  396   HHAKLFSLRAAVAIRLRSITTGSLDYVLEFFLPVDCIEIEQQRAMLNSLSITIQQTC  452



>ref|NP_179306.2| nodule inception like protein 1 [Arabidopsis thaliana]
 sp|Q8H111.1|NLP1_ARATH RecName: Full=Protein NLP1; Short=AtNLP1; AltName: Full=NIN-like 
protein 1; AltName: Full=Nodule inception protein-like protein 
1 [Arabidopsis thaliana]
 gb|AAN41311.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06591.1| nodule inception like protein 1 [Arabidopsis thaliana]
Length=909

 Score =   417 bits (1072),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 249/623 (40%), Positives = 345/623 (55%), Gaps = 70/623 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTD     Q   SP  + A+ + S  L                        EN 
Sbjct  41    DGCWLETTDSKSLKQTEQSPSASTAMNDNSPFL---------------------CFGENP  79

Query  512   SASQFHTERVQ-CFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLIQALG  676
             S   F  E  +  F Q          L E +E+ + WWI P A    ++SV +RL+QA+ 
Sbjct  80    SQDNFSNEETERMFPQ------AEKFLLEEAEVGKSWWIAPSASEGPSSSVKERLLQAIS  133

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
              + +  +DKD L+QIWVP+ ++G+  L T  QP   + +   LA YR +S  Y FP +E 
Sbjct  134   GLNEAVQDKDFLVQIWVPIQQEGKSFLTTWAQPHLFNQEYSSLAEYRHVSETYNFPADEG  193

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
              ++ VGLPGRVFL K PEWTPDV+ F+R+EYPR+  AQ+ DVRG+ A+PVF++GS TCLG
Sbjct  194   MKDFVGLPGRVFLQKFPEWTPDVRFFRRDEYPRIKEAQKCDVRGSLALPVFERGSGTCLG  253

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQ----VVLPEILEV  1204
             V+E+V TTQK+ YR EL+ +CKALE VDLR S   N  + +    Y       LPEI + 
Sbjct  254   VVEIVTTTQKMNYRQELEKMCKALEAVDLRSSSNLNTPSSEFLQVYSDFYCAALPEIKDF  313

Query  1205  LKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACS  1384
             L + C ++  PLA +W PC +QGK G RHSDEN   CVST+DSAC + D + + F EACS
Sbjct  314   LATICRSYDFPLALSWAPCARQGKVGSRHSDENFSECVSTIDSACSVPDEQSKSFWEACS  373

Query  1385  EHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGS  1564
             EHHLL+G G+VG+AF   +  F  ++ +FSKT YPL+H+A+I  L AA+A+ L+S  +G 
Sbjct  374   EHHLLQGEGIVGKAFEATKLFFVPEVATFSKTNYPLAHHAKISGLHAALAVPLKSK-SGL  432

Query  1565  TDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHS  1744
              +FVLEFF P+ C   E  + ML SL + +Q   ++  +  +    E        +    
Sbjct  433   VEFVLEFFFPKACLDTEAQQEMLKSLCVTLQQDFRSSNLFIKDLELEVVLPVRETMLFSE  492

Query  1745  DIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEKPSELLYKR--  1909
             ++    E   ++  + I   E   SW +  +   E     S    +Q E P EL   R  
Sbjct  493   NLLCGAET--VESLTEIQMQES--SWIAHMIKANEKGKDVSLSWEYQKEDPKELSSGREN  548

Query  1910  -----LPEFV----------SGSGLSFD-------STSGEGSAQNVRRAGDKKRMKAEKT  2023
                  +P  V          S  GL  D       +++G G+  + RR G+KKR K EKT
Sbjct  549   SQLDPVPNNVPLEAEQLQQASTPGLRVDIGPSTESASTGGGNMLSSRRPGEKKRAKTEKT  608

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I L++L+QYFAGSLKDAAKS+GV
Sbjct  609   IGLEVLRQYFAGSLKDAAKSIGV  631



>ref|NP_001048860.1| Os03g0131100 [Oryza sativa Japonica Group]
 sp|Q10S83.1|NLP1_ORYSJ RecName: Full=Protein NLP1; Short=OsNLP1; AltName: Full=NIN-like 
protein 1; AltName: Full=Nodule inception protein-like protein 
1 [Oryza sativa Japonica Group]
 gb|ABF93809.1| RWP-RK domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10774.1| Os03g0131100 [Oryza sativa Japonica Group]
Length=942

 Score =   418 bits (1074),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 259/348 (74%), Gaps = 7/348 (2%)
 Frame = +2

Query  644   SVMDRLIQALGYIKDFSR------DKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRL  805
             +V +RL +AL  I   S+      D ++L+Q+WVP     R+VL T  QPF LD +  RL
Sbjct  124   TVKERLRRALERIASQSQSQAQRGDGELLVQVWVPTRIGDRQVLTTCGQPFWLDRRNQRL  183

Query  806   AHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVR  985
             A+YR +S+ Y+F  +E ++ ++GLPGRVF+G+VPEWTPDV+ F  EEYPRV HAQ +D+R
Sbjct  184   ANYRTVSMKYQFSADESARADLGLPGRVFVGRVPEWTPDVRYFSTEEYPRVQHAQYFDIR  243

Query  986   GTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC  1165
             G+ A+PVF+  SR CLGV+E+V+TTQKV Y  E++++C AL+EVDLR S +S+    K  
Sbjct  244   GSVALPVFEPRSRACLGVVELVMTTQKVNYSAEIENICNALKEVDLRSSDVSSDPRSKVV  303

Query  1166  H-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACY  1342
               SY+ ++PEI++VL++ C TH LPLAQTW+PC+ Q K G RHSDE+   CVSTVD ACY
Sbjct  304   DASYRAIIPEIMDVLRAVCDTHNLPLAQTWIPCICQAKRGSRHSDESYKHCVSTVDEACY  363

Query  1343  IADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQ  1522
             + D  + GFH+ACSEHHL +G GVVGRAF TN+PCFS DIT++SKT+YPLSH+A++F L+
Sbjct  364   VRDCSVLGFHQACSEHHLFRGEGVVGRAFGTNEPCFSPDITTYSKTQYPLSHHAKLFGLR  423

Query  1523  AAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVC  1666
             AAVAI+LRS  TGS DFVLEFFLP  C + EE + ML SLS  IQ VC
Sbjct  424   AAVAIQLRSVKTGSLDFVLEFFLPMKCINTEEQRAMLNSLSNTIQQVC  471



>gb|EAZ25469.1| hypothetical protein OsJ_09292 [Oryza sativa Japonica Group]
Length=942

 Score =   418 bits (1074),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 259/348 (74%), Gaps = 7/348 (2%)
 Frame = +2

Query  644   SVMDRLIQALGYIKDFSR------DKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRL  805
             +V +RL +AL  I   S+      D ++L+Q+WVP     R+VL T  QPF LD +  RL
Sbjct  124   TVKERLRRALERIASQSQSQAQRGDGELLVQVWVPTRIGDRQVLTTCGQPFWLDRRNQRL  183

Query  806   AHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVR  985
             A+YR +S+ Y+F  +E ++ ++GLPGRVF+G+VPEWTPDV+ F  EEYPRV HAQ +D+R
Sbjct  184   ANYRTVSMKYQFSADESARADLGLPGRVFVGRVPEWTPDVRYFSTEEYPRVQHAQYFDIR  243

Query  986   GTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC  1165
             G+ A+PVF+  SR CLGV+E+V+TTQKV Y  E++++C AL+EVDLR S +S+    K  
Sbjct  244   GSVALPVFEPRSRACLGVVELVMTTQKVNYSAEIENICNALKEVDLRSSDVSSDPRSKVV  303

Query  1166  H-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACY  1342
               SY+ ++PEI++VL++ C TH LPLAQTW+PC+ Q K G RHSDE+   CVSTVD ACY
Sbjct  304   DASYRAIIPEIMDVLRAVCDTHNLPLAQTWIPCICQAKRGSRHSDESYKHCVSTVDEACY  363

Query  1343  IADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQ  1522
             + D  + GFH+ACSEHHL +G GVVGRAF TN+PCFS DIT++SKT+YPLSH+A++F L+
Sbjct  364   VRDCSVLGFHQACSEHHLFRGEGVVGRAFGTNEPCFSPDITTYSKTQYPLSHHAKLFGLR  423

Query  1523  AAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVC  1666
             AAVAI+LRS  TGS DFVLEFFLP  C + EE + ML SLS  IQ VC
Sbjct  424   AAVAIQLRSVKTGSLDFVLEFFLPMKCINTEEQRAMLNSLSNTIQQVC  471



>gb|EAY88394.1| hypothetical protein OsI_09856 [Oryza sativa Indica Group]
Length=919

 Score =   417 bits (1071),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 258/348 (74%), Gaps = 7/348 (2%)
 Frame = +2

Query  644   SVMDRLIQALGYIKDFSR------DKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRL  805
             +V +RL +AL  I   S+      D ++L+Q+WVP     R+VL T  QPF LD +  RL
Sbjct  124   TVKERLRRALERIASQSQSQAQRGDGELLVQVWVPTRIGDRQVLTTCGQPFWLDRRNQRL  183

Query  806   AHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVR  985
             A YR +S+ Y+F  +E ++ ++GLPGRVF+G+VPEWTPDV+ F  EEYPRV HAQ +D+R
Sbjct  184   ASYRTVSMKYQFSADESARADLGLPGRVFVGRVPEWTPDVRYFSTEEYPRVQHAQYFDIR  243

Query  986   GTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTC  1165
             G+ A+PVF+  SR CLGV+E+V+TTQKV Y  E++++C AL+EVDLR S +S+    K  
Sbjct  244   GSVALPVFEPRSRACLGVVELVMTTQKVNYSAEIENICNALKEVDLRSSDVSSDPRSKVV  303

Query  1166  H-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACY  1342
               SY+ ++PEI++VL++ C TH LPLAQTW+PC+ Q K G RHSDE+   CVSTVD ACY
Sbjct  304   DASYRAIIPEIMDVLRAVCDTHNLPLAQTWIPCICQAKRGSRHSDESYKHCVSTVDEACY  363

Query  1343  IADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQ  1522
             + D  + GFH+ACSEHHL +G GVVGRAF TN+PCFS DIT++SKT+YPLSH+A++F L+
Sbjct  364   VRDCSVLGFHQACSEHHLFRGEGVVGRAFGTNEPCFSPDITTYSKTQYPLSHHAKLFGLR  423

Query  1523  AAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVC  1666
             AAVAI+LRS  TGS DFVLEFFLP  C + EE + ML SLS  IQ VC
Sbjct  424   AAVAIQLRSVKTGSLDFVLEFFLPMKCINTEEQRAMLNSLSNTIQQVC  471



>ref|XP_011000891.1| PREDICTED: protein NLP2-like isoform X2 [Populus euphratica]
Length=878

 Score =   416 bits (1068),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 225/546 (41%), Positives = 326/546 (60%), Gaps = 53/546 (10%)
 Frame = +2

Query  548   FGQNGSNAVCSSGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWV  727
             F    S+ V ++GL     + +R  + P  + SV +R++QA+GY+K+  +D+D+LIQIW+
Sbjct  61    FSHPASSRVEAAGLGCEWRMVQR--VNPGTSCSVKERVMQAVGYLKNCVQDRDILIQIWL  118

Query  728   PVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVP  907
             P+ ++G+RVL T DQP+ ++  C  LA YR +S  Y F  EED++ +VG PGRVFL K+P
Sbjct  119   PMEKEGKRVLATIDQPYFVNPSCKSLASYRKVSTAYHFQAEEDAKCSVGFPGRVFLEKLP  178

Query  908   EWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNEL  1087
             EWTPDV+LF+REEYP   HA ++++RG+ A+P+F QGS TCLG++E+  T QK+ YR+EL
Sbjct  179   EWTPDVRLFRREEYPHKDHAVQHNIRGSLALPLFKQGSETCLGIVEIATTIQKISYRSEL  238

Query  1088  DSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVLPEILEVLKSACATHKLPLAQTWVPCV  1264
               +CK L+ VDLR S+      V+TC+   +  +PEI +++KS C T++LPLA TW  C 
Sbjct  239   QDICKVLQAVDLRSSEDFCSPGVETCNRLNRAAVPEISDIVKSVCKTYRLPLALTWALCS  298

Query  1265  QQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQP  1444
             +QGK G +   E    C+STVDSAC++AD    GFH A  E +L  G G+VGRAF T + 
Sbjct  299   RQGKIGRQQFPERFSSCISTVDSACFLADKDFSGFHMASFEQYLFLGQGIVGRAFTTQKQ  358

Query  1445  CFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHK  1624
             CF+ DI SFSK +YPL+H+A+IF L AA+AI LRS  TG  +FV+E FLP+DC+  EE K
Sbjct  359   CFTNDIASFSKKDYPLAHHAKIFGLHAAIAIPLRSISTGLVEFVVELFLPKDCQETEEQK  418

Query  1625  RMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPC  1804
             +M   L I+++ VC+                 S ++    ++ I +   +  Y S   P 
Sbjct  419   KMWDLLPIVLKQVCR-----------------SIQIVMDKELYIGENKSSESYPSKEAPP  461

Query  1805  EEGLSWTSSPMLVQ---ESCMSSSAFQNEKPSEL--------------------------  1897
             +E  SW +  +  Q   +SC+ S  +  E   E                           
Sbjct  462   DES-SWIARMVEAQKKGKSCIVSWDYPKEPKEEFKTIIHWDDSAVEIDQKQVISELGQLQ  520

Query  1898  LYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAE-KTITLQILQQYFAGSLKDA  2074
              + R    + G G+SF    G   +    + G K+R K E +TI+L +L+QYFAGSL DA
Sbjct  521   QHSRPNINIEGDGVSF--AFGGRRSLGSTKIGKKRRTKTEIQTISLGVLRQYFAGSLNDA  578

Query  2075  AKSLGV  2092
             A+SLGV
Sbjct  579   AQSLGV  584



>ref|XP_010515531.1| PREDICTED: protein NLP1-like [Camelina sativa]
 ref|XP_010515539.1| PREDICTED: protein NLP1-like [Camelina sativa]
 ref|XP_010515548.1| PREDICTED: protein NLP1-like [Camelina sativa]
 ref|XP_010515553.1| PREDICTED: protein NLP1-like [Camelina sativa]
 ref|XP_010515562.1| PREDICTED: protein NLP1-like [Camelina sativa]
Length=922

 Score =   416 bits (1070),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 255/628 (41%), Positives = 352/628 (56%), Gaps = 69/628 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWL+TTD     Q   S   + A+ + S  L                        EN 
Sbjct  41    DGCWLQTTDSKNLNQAEQSGSASTAMNDNSTFL---------------------CFGENP  79

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDRLIQALGY  679
             S     TE  +   Q   N      L E +EL + WWI P A+    +SV +RL+QA+  
Sbjct  80    SQDNEETENNESMNQESFNQA-EKFLLEEAELGKGWWIAPRASEGPSSSVKERLLQAISG  138

Query  680   IKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDS  859
             + +  +DKD L+QIWVPV ++G+  L T  QP   + +   LA YR +S  Y FP +E  
Sbjct  139   LNETVQDKDFLVQIWVPVQQEGKSFLTTWAQPHLFNQEYSSLAEYRHVSETYNFPADEGM  198

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
              + VGLPGRVFL K+PEWTPDV+ F+R+EYPR+  A++ DVRG+ A+PVF++GS  CLGV
Sbjct  199   NDYVGLPGRVFLQKLPEWTPDVRFFRRDEYPRIKEARKCDVRGSLALPVFERGSGICLGV  258

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQ----VVLPEILEVL  1207
             +E+V TTQK+ YR EL+ +CKALE VDLR S   N  + +    Y       LPEI + L
Sbjct  259   VEIVTTTQKMNYRQELEKMCKALEAVDLRSSSNLNTPSSEFLQVYSDFYCAALPEIKDFL  318

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
              + C ++ LPLA +W PC  QGK G RHSDEN  +CVST DSAC + D + + F EACSE
Sbjct  319   ATVCRSYDLPLALSWAPCAPQGKRGSRHSDENFSQCVSTTDSACSVPDEQSKSFWEACSE  378

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L AA+A+ L+S  +G  
Sbjct  379   HHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKSK-SGLV  437

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             +FVLEFF P+ C + E  + ML SLS+ +Q   ++  +V +++LE E   P  +    S+
Sbjct  438   EFVLEFFFPKACLNTEAQQEMLRSLSVTLQQDFRSSNLVIDKDLELEVVLPVRETMLFSE  497

Query  1748  IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEKPSELLYKR---  1909
               +          +  G   +  SW S  +   E     S    +Q E P EL   R   
Sbjct  498   NPVSGAE---TAETLTGIQMQESSWISHMIKANEKGKDVSLSWEYQKEDPKELSSGRENH  554

Query  1910  --------LP------EFVSGSGLSFD--------STSGE---GSAQ--NVRRAGDKKRM  2008
                     +P      +  S SGL  D        ST G+   GS +    RR+G+K+R 
Sbjct  555   QLDPSPNNVPLEAEQFQQASTSGLRVDSGPSTETPSTGGKNMLGSRRPGESRRSGEKRRT  614

Query  2009  KAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             K EKTI L++L+Q+FAGSLKDAAKS+GV
Sbjct  615   KTEKTIGLEVLRQHFAGSLKDAAKSIGV  642



>ref|XP_002322654.2| hypothetical protein POPTR_0016s04220g [Populus trichocarpa]
 gb|EEF04415.2| hypothetical protein POPTR_0016s04220g [Populus trichocarpa]
Length=935

 Score =   416 bits (1070),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 252/615 (41%), Positives = 358/615 (58%), Gaps = 40/615 (7%)
 Frame = +2

Query  347   WLETTDGSEFFQHSPFNANALFE-PSYVLPDLEPNNGELMK-----ESEVERK-----KS  493
             W E      F Q  P  +N L++ PS  +P +  NN  +       + E ER        
Sbjct  34    WAENDGEFSFLQQGPSISNVLYDHPSLYMPFMGSNNLSIASNQQNYQEETERHCHGNPPL  93

Query  494   SLPENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWW----IGPMATTSVMDRL  661
               P+++   Q   +       + S    +S   E++ L   W     + P+ + SV +R 
Sbjct  94    DYPKSMELLQTEPQVEDSVDTSTSLLHTTSYRVEAAGLGVEWQMVPRVNPLTSFSVKERA  153

Query  662   IQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEF  841
             +QA+ Y+K+  + KD LIQIW+PV ++G++VL T DQP+ ++  C  LA YR++S+ Y F
Sbjct  154   MQAIRYLKNCIQYKDSLIQIWLPVEKEGKKVLATIDQPYFVNPSCKSLASYRNVSVAYHF  213

Query  842   PVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGS  1021
              VE D++ +VG PGRVFL K+PEWTPDV+LF+ EEYPR  HA ++++RG+ A+P+F QGS
Sbjct  214   QVEGDAKFSVGFPGRVFLEKLPEWTPDVRLFRSEEYPRRDHAVQHNIRGSLALPLFKQGS  273

Query  1022  RTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVLPEIL  1198
              TCLG++E+V TT+K+ YR EL+ + KAL+ VDLR S+      VKTC+   QV +PE+ 
Sbjct  274   ETCLGIVEIVTTTEKITYRPELEDIRKALKAVDLRSSEDFCSPGVKTCNGLNQVAVPELS  333

Query  1199  EVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEA  1378
             E++KS C T+ LPLA TW  C +QGK G +   E    C+STVDSAC++AD    GFH A
Sbjct  334   EIVKSVCKTYGLPLALTWALCSRQGKGGRQQFAEKSGACISTVDSACFLADRDFSGFHMA  393

Query  1379  CSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCT  1558
               E ++  G G+VGRAF T + CF+ DITSFSK +YPL+H+A+IF L AA+AI +RS  T
Sbjct  394   SFEQYIFLGQGIVGRAFTTQKQCFANDITSFSKKDYPLAHHAKIFGLHAAIAIPMRSIAT  453

Query  1559  GSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq-----eleeettSPS  1723
             G  +FVLE FLP DCK  EE K+M   L I IQ VC +L+VV ++     E +   +SPS
Sbjct  454   GLVEFVLELFLPIDCKDTEEQKKMWDLLPIAIQQVCWSLQVVMDKGLGNGENQSFESSPS  513

Query  1724  SKVAKHSDIRIHKEVPNLKYNSSI--------GPCEEG---LSWTSSPMLVQESCMSSSA  1870
              +        I + V   K + S          P EE      W  S + +    + S  
Sbjct  514   KQPPLDESSWISRMVEAQKKSKSFCVTWGYPKEPKEEFKMITHWDESAVELDHKQVISEL  573

Query  1871  FQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAE-KTITLQILQQ  2047
              Q ++ S     R      G G+S  S  G   +   R+ G K+R K + +TI+L++L+Q
Sbjct  574   GQLQQNS-----RTNSNTEGDGVS--SAFGRHLSFGSRKTGKKRRTKTDIQTISLEVLRQ  626

Query  2048  YFAGSLKDAAKSLGV  2092
             YFAGSLKDAA+SL V
Sbjct  627   YFAGSLKDAAQSLSV  641



>ref|XP_010489333.1| PREDICTED: protein NLP1-like [Camelina sativa]
Length=922

 Score =   416 bits (1069),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 256/628 (41%), Positives = 350/628 (56%), Gaps = 69/628 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTD     Q   S   + A+ + S  L                        EN 
Sbjct  41    DGCWLETTDSKNLKQTEQSGSASTAMNDNSTFL---------------------CFGENP  79

Query  512   SASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLIQALGY  679
             S     TE  +   Q   N      L E +EL + WWI P A    ++SV +RL+QA+  
Sbjct  80    SQDNEETEENRSMNQESFNQA-EKFLLEEAELGKSWWIAPRASEGPSSSVKERLLQAISG  138

Query  680   IKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDS  859
             + +  +DKD L+QIWVPV ++G+  L T  QP   + +   LA YR +S  Y FP +E  
Sbjct  139   LNETVQDKDFLVQIWVPVQQEGKSFLTTWAQPHLFNQEYSSLAEYRHVSETYNFPADEGM  198

Query  860   QENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGV  1039
              + VGLPGRVFL K PEWTPDV+ F+R+EYPR+  A++ DVRG+ A+PVF++GS  CLGV
Sbjct  199   NDYVGLPGRVFLQKFPEWTPDVRFFRRDEYPRIKEARKCDVRGSLALPVFERGSGICLGV  258

Query  1040  IEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQ----VVLPEILEVL  1207
             +E+V TTQK+ YR EL+ +CKALE VDLR S   N  + +    Y       LPEI + L
Sbjct  259   VEIVTTTQKMNYRQELEKMCKALEAVDLRSSSNLNTPSSEFLQVYSDFYCAALPEIKDFL  318

Query  1208  KSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSE  1387
              + C ++ LPLA +W PC  QGK G RHSDEN   CVST DSAC + D + + F EACSE
Sbjct  319   ATVCRSYDLPLALSWAPCAPQGKRGSRHSDENFSHCVSTTDSACSVPDEQSKSFWEACSE  378

Query  1388  HHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGST  1567
             HHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I  L AA+A+ L+S  +G  
Sbjct  379   HHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYPLAHHAKISGLHAALAVPLKSK-SGLV  437

Query  1568  DFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSD  1747
             +FVLEFF P+ C + E  + ML SLS+ +Q   ++  +V +++LE E   P  +    S+
Sbjct  438   EFVLEFFFPKACLNTEAQQEMLRSLSVTLQQDFRSSNLVIDKDLELEVVLPVRETMLFSE  497

Query  1748  IRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEKPSELLYKR---  1909
               +          +  G   +  SW S  +   E     S    +Q E P EL   R   
Sbjct  498   NPVSGAE---TAETLTGIQMQESSWISHMIKANEKGKDVSLSWEYQKEDPKELSSGRENH  554

Query  1910  --------LP------EFVSGSGLSFD--------STSGE---GSAQ--NVRRAGDKKRM  2008
                     +P      +  S SGL  D        ST G+   GS +    RR+G+K+R 
Sbjct  555   QLDPSPNNVPLEAEQFQQASTSGLRVDSGPSTETPSTGGKNMLGSRRPGESRRSGEKRRT  614

Query  2009  KAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             K EKTI L++L+Q+FAGSLKDAAKS+GV
Sbjct  615   KTEKTIGLEVLRQHFAGSLKDAAKSIGV  642



>ref|XP_002867080.1| RWP-RK domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43339.1| RWP-RK domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=975

 Score =   417 bits (1072),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 262/650 (40%), Positives = 356/650 (55%), Gaps = 70/650 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--------HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKS  493
             +GCWLETTDG  F Q         +  N N      Y     E  + + +   E  RK  
Sbjct  37    DGCWLETTDGKSFKQTMGQPVSDSTIMNDNNNNSYLYGYQYTENLSQDHISNEETGRKFP  96

Query  494   SL-PENLSASQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TSVMDR  658
              + P  L       +         S+A     L E SE  RR+WI P  +    +SV DR
Sbjct  97    PITPSFLKIEDLSNQLPFDEAAVMSSAQAEKLLLEESEGGRRYWIAPRTSQGPSSSVKDR  156

Query  659   LIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             L+QA+  + +  +DKD LIQIWVP+ ++G+  L T +QP   + K   L  YRD+S+ Y 
Sbjct  157   LVQAIKGLNEAVQDKDFLIQIWVPIQQEGKNFLTTLEQPHFFNPKYSSLKRYRDVSVAYN  216

Query  839   FPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
             F  +EDS+E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  A++ DVRG+ A+PVF++G
Sbjct  217   FLADEDSKESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAEKCDVRGSLALPVFERG  276

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQ-------  1177
             S  CLGV+E+V TTQK+ YR ELD++CKALE V+LR S+  N  + + C +         
Sbjct  277   SGICLGVVEIVTTTQKMNYRPELDNICKALESVNLRSSRSLNPPSREVCQNGLINQTLTS  336

Query  1178  --------VVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDS  1333
                     V L  I+    S C  + LPLA TW PC +QGK G RHSDEN   CVSTVD 
Sbjct  337   SIHRNNDIVFLNVIIPFCFSFCRLYDLPLALTWAPCARQGKVGSRHSDENFSECVSTVDD  396

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             AC + D + + F EACSEHHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I 
Sbjct  397   ACIVPDHQSRHFLEACSEHHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYPLAHHAKIS  456

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L AA+A+ L++    S +FVLEFF P+ C   E  + ML SLS  +Q   ++L +  ++
Sbjct  457   GLHAALAVPLKNKFNSSVEFVLEFFFPKACLDTEAQQEMLKSLSATLQQDFRSLNLFIDK  516

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGP------CEEGLSWTSSPMLVQESC  1855
             ELE E   P     +   +     + N     ++ P       +E  SW S  +   E  
Sbjct  517   ELELEVVFP----VREEVVFAENPLLNAGTGENMKPLPLEDMSQEDSSWISHMIKANEKG  572

Query  1856  MSSS---AFQNEKPSELLY------------------KRLPEF--VSGSGL------SFD  1948
                S    +Q E+P E                         +F  VS SGL      SF+
Sbjct  573   KGVSLSWEYQKEEPKEEFMLTSGWDNNQIGSGHNNFLSEAEQFQKVSNSGLRIDMDPSFE  632

Query  1949  STSGEGSAQNV---RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLG  2089
             S S     Q +   RR G+K+R K EKTI L++L+QYFAGSLKDAAKS+G
Sbjct  633   SASFGVVGQTLLGSRRPGEKRRTKTEKTIGLEVLRQYFAGSLKDAAKSIG  682



>tpg|DAA43175.1| TPA: putative plant regulator RWP-RK family protein [Zea mays]
Length=953

 Score =   415 bits (1067),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 244/570 (43%), Positives = 340/570 (60%), Gaps = 86/570 (15%)
 Frame = +2

Query  611   RRWWIGPM--ATTSVMDRLIQALGYIKDFSRDK--DVLIQIWVPVNRDGRRVLVTGDQPF  778
             R W   P      +V +RL +AL  I   S+ +  ++L Q+WVP     R+VL T  QPF
Sbjct  93    RGWVFQPRLEVDATVKERLRRALERIASLSQTQPGELLAQVWVPTVIGDRQVLTTCGQPF  152

Query  779   QLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRV  958
              LD +  RLA+YR +S+ Y+F  +E ++ ++G+PGRVF+G+VPEWTPDV+ F  EEYPRV
Sbjct  153   WLDCRNERLANYRTVSMKYQFSADETARTDLGMPGRVFVGRVPEWTPDVRYFSTEEYPRV  212

Query  959   GHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKAL----------  1108
              HAQ +D+RG+ A+P+F+  SR CLGV+E+V+TT+KV Y  E+ ++C AL          
Sbjct  213   HHAQYFDIRGSVALPIFEPRSRVCLGVVELVMTTEKVNYNAEIQNICSALKLCRLLCRYT  272

Query  1109  ----EEVDLRGSKIS----NVRNVKTCH--------------SYQVVLPEILEVLKSACA  1222
                 +E+ L    I+    N R+ ++ H              SY+ ++PEI++VL++ C 
Sbjct  273   LNLFDEMPLGKDVITTGHANPRSNQSFHLTLFGDVLVSVTDTSYRAIIPEIVDVLRTVCE  332

Query  1223  THKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLK  1402
             THKLPLAQTW+PC+ Q K G RH+DE L  CVST+D ACY+ D  + GFHEACSEHHL +
Sbjct  333   THKLPLAQTWIPCICQAKRGSRHTDEKLKYCVSTLDEACYVRDLNVNGFHEACSEHHLFR  392

Query  1403  GLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLE  1582
             G GVVGRAF TN+PCFS DIT+ SK +YPLSH+A++FSL+AAVAIRLRS  TGS D+VLE
Sbjct  393   GEGVVGRAFATNEPCFSEDITASSKIQYPLSHHAKLFSLRAAVAIRLRSISTGSLDYVLE  452

Query  1583  FFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVA-KHSDIRIH  1759
             FFLP DC   EE + ML SLSI IQ  C TLRVV+ +EL +E +  +S +     D  +H
Sbjct  453   FFLPVDCIEIEEQRAMLNSLSITIQQTCYTLRVVSLKELVDEGSIETSALTPPEYDKSMH  512

Query  1760  KEVPNL-------KYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPE  1918
             + +  +          +S+   EE  SW +S +  Q   +       E   +L +     
Sbjct  513   ENIDEVCSGIGVPARTASLETSEEVSSWIASLVCAQNKGV------KEMDGDLPFG----  562

Query  1919  FVSGSGLSFDSTSG---------EGS-----------------------AQNVRRAGDKK  2002
             F       F  T+G         EGS                       + N+ +  +K+
Sbjct  563   FSKQEDEGFSVTAGWHTSPVIEPEGSIFSGFKQHEEYKVKEVTCLRDPSSSNLEKTVEKR  622

Query  2003  RMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R K EKT++L+ L+++FAGSLK+AAK+LGV
Sbjct  623   RTKMEKTVSLEELRKHFAGSLKEAAKNLGV  652



>ref|XP_002313583.2| hypothetical protein POPTR_0009s16790g [Populus trichocarpa]
 gb|EEE87538.2| hypothetical protein POPTR_0009s16790g [Populus trichocarpa]
Length=904

 Score =   412 bits (1058),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 239/622 (38%), Positives = 346/622 (56%), Gaps = 85/622 (14%)
 Frame = +2

Query  347   WLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSASQF  526
             W E   G  F Q     +N L +PS   P     N   ++        +S P        
Sbjct  34    WFEKDGGFNFLQQGLSTSNVLHDPSLYFPVTGTTNWNSVE--------TSTP--------  77

Query  527   HTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKD  706
                    F    S  V ++GL    ++ +R  + P  + SV +R++QA+GY+K+  +D+D
Sbjct  78    -------FSHPASCRVEAAGLGFEWQMVQR--VNPGTSCSVKERVMQAVGYLKNCIQDRD  128

Query  707   VLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGR  886
             +LIQIW+P+ ++G+RVL T DQP+ +D  C  LA YR +S  Y F  EED++ +VG PGR
Sbjct  129   ILIQIWLPMEKEGKRVLATIDQPYFVDPSCKSLASYRKVSTAYHFQAEEDAKCSVGFPGR  188

Query  887   VFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQK  1066
             VFL K+PEWTPDV+LF+ EEYP   HA ++++RG+ A+P+F QGS TCLG++E+  T QK
Sbjct  189   VFLEKLPEWTPDVRLFRSEEYPHRDHAVQHNIRGSLALPLFKQGSETCLGIVEIATTIQK  248

Query  1067  VKYRNELDSVCKALEEVDLR--------GSKISNVRNV-KTCHSY-QVVLPEILEVLKSA  1216
             + YR+EL  +CK L+ VDLR        G +I+ V  + +TC+   +  +PEI +++KS 
Sbjct  249   ISYRSELQDICKVLQAVDLRSSEDFCSPGVEITIVFLLSQTCNRLNRAAVPEISDIVKSV  308

Query  1217  CATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHL  1396
             C T+ LPLA TW  C +QGK G +   E    C+STVDSAC++AD    GFH A  E +L
Sbjct  309   CKTYSLPLALTWALCSRQGKIGRQQFPERFSSCISTVDSACFLADRGFSGFHMASFEQYL  368

Query  1397  LKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFV  1576
               G G+VGRAF T + CF+ DITSFSK +YPL+H+A+IF L AA+AI LRS  TG  +FV
Sbjct  369   FLGQGIVGRAFTTQKQCFTNDITSFSKKDYPLAHHAKIFGLHAAIAIPLRSISTGLVEFV  428

Query  1577  LEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRI  1756
             +E FLP+DC+  EE K+M   L I+++ VC+                 S ++    ++ I
Sbjct  429   VELFLPKDCQETEEQKKMWDLLPIVLKQVCR-----------------SLQIVMDKELHI  471

Query  1757  HKEVPNLKYNSSIGPCEEGLSWTSSPMLVQ---ESCMSSSAFQNEKPSEL----------  1897
              +        S   P +E  SW +S +  Q   +SC+ +  +  E   E           
Sbjct  472   GENKSFESSPSKEAPPDES-SWIASMLEAQKKGKSCIVTWDYPKEPEEEFKTIIHWDDSA  530

Query  1898  ----------------LYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAE-KTI  2026
                              + R    + G G+SF    G   +    +AG K+R K E +TI
Sbjct  531   VEIDQKQVISELGRLQQHSRPNINIEGDGVSF--AFGGRRSLGSTKAGKKRRTKTEIQTI  588

Query  2027  TLQILQQYFAGSLKDAAKSLGV  2092
             +L +L+QYFAGSL DAA+S+GV
Sbjct  589   SLGVLRQYFAGSLNDAAQSIGV  610



>gb|EMT04155.1| hypothetical protein F775_24227 [Aegilops tauschii]
Length=714

 Score =   405 bits (1040),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 252/344 (73%), Gaps = 2/344 (1%)
 Frame = +2

Query  644   SVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDI  823
             +V +RL QAL YI++  RDK VL+Q+WVP    G+ VL T   PF L+    RL  +RD+
Sbjct  273   TVRERLTQALAYIEEMQRDKHVLLQVWVPTMSYGQLVLTTRGMPFTLNKSSERLVQFRDV  332

Query  824   SINYEFPVEEDSQEN-VGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAV  1000
             S  Y+   +  S+ + VGLPGRVF+GK+PEW+PDV+ F   EYP V HAQ  DV GT  +
Sbjct  333   STRYQLSADVASKGSPVGLPGRVFIGKLPEWSPDVRYFTSYEYPMVAHAQYLDVHGTMGL  392

Query  1001  PVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCHSYQ  1177
             PVF++G+ +CLGVIE+++T QK+ + +E++++C AL+ V+LR S++S++   K +  SY+
Sbjct  393   PVFEKGNPSCLGVIELIMTRQKLNFTSEINNICSALQAVNLRSSEVSSIPRAKFSSASYK  452

Query  1178  VVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPR  1357
               LPEILEVL++AC TH LPLAQTW  C QQ K G RHSDEN   C+ST+D+ACY+ DP+
Sbjct  453   DALPEILEVLRAACVTHNLPLAQTWATCAQQWKRGSRHSDENYQHCISTIDAACYVNDPQ  512

Query  1358  IQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAI  1537
             +Q FH++CS+HHLL   GV G+AF TNQPCF  DI S +K +YPL H+A+IF+L+ AVAI
Sbjct  513   MQNFHDSCSDHHLLLKQGVAGKAFTTNQPCFLPDIGSSAKPDYPLCHHAKIFNLKGAVAI  572

Query  1538  RLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQ  1669
             RLR T TG+ DFVLEFFLP DC++ EE K +L +LS  +QNVCQ
Sbjct  573   RLRCTRTGTADFVLEFFLPTDCEALEEQKAVLDTLSGTMQNVCQ  616



>emb|CAA18742.1| putative protein [Arabidopsis thaliana]
 emb|CAB80244.1| putative protein [Arabidopsis thaliana]
Length=1031

 Score =   412 bits (1059),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 260/651 (40%), Positives = 360/651 (55%), Gaps = 73/651 (11%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--------HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKS  493
             +GCWLETTDG    Q         +  N N      Y     E  + + +   E  RK  
Sbjct  37    DGCWLETTDGKSLKQTMGQQVSDSTTMNDNNNNSYLYGYQYAENLSQDHISNEETGRKFP  96

Query  494   SLPENLSASQFHTERVQCFGQNG--SNAVCSSGLAESSELSRRWWIGPMAT----TSVMD  655
              +P      +  + +V  F Q+   S+A     L E SE  RR+WI P  +    +SV +
Sbjct  97    PIPPGFLKIEDLSNQVP-FDQSAVMSSAQAEKFLLEESEGGRRYWIAPRTSQGPSSSVKE  155

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             RL+QA+  + +  +DKD LIQIW+P+ ++G+  L T +QP   + K   L  YRD+S+ Y
Sbjct  156   RLVQAIEGLNEEVQDKDFLIQIWLPIQQEGKNFLTTSEQPHFFNPKYSSLKRYRDVSVAY  215

Query  836   EFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQ  1015
              F  +EDS+E+VGLPGRVFL K+PEWTPDV+ F+ EEYPR+  A++ DVRG+ A+PVF++
Sbjct  216   NFLADEDSKESVGLPGRVFLKKLPEWTPDVRFFRSEEYPRIKEAEQCDVRGSLALPVFER  275

Query  1016  GSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQV-----  1180
             GS TCLGV+E+V TTQK+ YR ELD++CKALE V+LR S+  N  + + C +  +     
Sbjct  276   GSGTCLGVVEIVTTTQKMNYRPELDNICKALESVNLRSSRSLNPPSREVCKNGLLNQTLT  335

Query  1181  ----------VLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVD  1330
                       +L  I     S C  + LPLA TW PC +QGK G RHSDEN   CVSTVD
Sbjct  336   SSIHRNNEFWLLNVICPFCFSFCRVYDLPLALTWAPCARQGKVGSRHSDENFSECVSTVD  395

Query  1331  SACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARI  1510
              AC + D + + F EACSEHHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A+I
Sbjct  396   DACIVPDHQSRHFLEACSEHHLLQGEGIVGKAFNATKLFFVPEVTTFSKTNYPLAHHAKI  455

Query  1511  FSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvte  1690
               L AA+A+ L++    S +FVLEFF P+ C   E  + ML SLS  +Q   ++L +  +
Sbjct  456   SGLHAALAVPLKNKFNSSVEFVLEFFFPKACLDTEAQQDMLKSLSATLQQDFRSLNLFID  515

Query  1691  qeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGP------CEEGLSWTSSPMLVQES  1852
             +ELE E   P     +   +     + N      + P       +E  SW S  +   E 
Sbjct  516   KELELEVVFP----VREEVVFAENPLINAGTGEDMKPLPLEEISQEDSSWISHMIKANEK  571

Query  1853  CMSSS---AFQNEKPSELLY------------------KRLPEF--VSGSGL------SF  1945
                 S    +Q E+P E                         +F  V+ SGL      SF
Sbjct  572   GKGVSLSWEYQKEEPKEEFMLTSGWDNNQIGSGHNNFLSEAEQFQKVTNSGLRIDMDPSF  631

Query  1946  DSTSGEGSAQNV---RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLG  2089
             +S S  G  Q +   RR G+K+R K EKTI L++L+QYFAGSLKDAAKS+G
Sbjct  632   ESASF-GVGQTLLGSRRPGEKRRTKTEKTIGLEVLRQYFAGSLKDAAKSIG  681



>gb|KDP44508.1| hypothetical protein JCGZ_16341 [Jatropha curcas]
Length=800

 Score =   405 bits (1041),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 242/586 (41%), Positives = 330/586 (56%), Gaps = 63/586 (11%)
 Frame = +2

Query  341   GCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERK-KSSLPENLSA  517
             G WL TTD   F +  PF ++  +  SY              + E+E    +  P     
Sbjct  13    GSWLRTTDKVNFLESDPFISSVQYLDSY----------HQFSQKEMENLFDNPTPVYPGI  62

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSR  697
              +   E   C GQ       S G  ES   +R+  I P    SV DRL+ A+ Y+K++  
Sbjct  63    GKCVVETDTCLGQ-------SQG-GESR--TRKCLIEPYC--SVKDRLMLAIDYLKEYVE  110

Query  698   DKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGL  877
             D D LIQIWVP    G+ VL T DQP+ L+  C  LA YR++S  +    EEDS+E+ GL
Sbjct  111   DSDALIQIWVPTKIAGQNVLTTTDQPYSLNPSCLSLASYRNVSKAFHLTAEEDSKESAGL  170

Query  878   PGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLT  1057
             PG VFL K PEWTPDV+ F+ +E PR  +A+ Y++ G  A+PVF+Q S TCL V+E+V T
Sbjct  171   PGPVFLEKFPEWTPDVRFFRNDECPRKYYAELYNISGCLALPVFEQESGTCLAVVEIVTT  230

Query  1058  TQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILEVLKSACATHKL  1234
             TQK+ Y  EL+ VCKALE VDL+ S+      +KTC+  YQ+ +PEI ++LKS C T+ L
Sbjct  231   TQKINYHLELEIVCKALEAVDLKSSQDFFPFCIKTCNEFYQIAIPEISKILKSVCETNNL  290

Query  1235  PLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGLGV  1414
             PLA TW  C +QGK   +         +STVDSACY+AD  + GF++ACS  +L    G+
Sbjct  291   PLALTWALCNRQGKNEYKQVSGKYDYYISTVDSACYMADSDLFGFYKACSTQYLFLDQGI  350

Query  1415  VGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLP  1594
             VG+A   N+  F+ D+TSFSKT YPLSH+AR+F+L+AA+AI L +  TGS +FVLE FLP
Sbjct  351   VGKALTRNKQLFATDVTSFSKTSYPLSHHARMFNLRAALAIPLANIYTGSIEFVLEIFLP  410

Query  1595  RDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPN  1774
             RDC+  EE K M   L I+IQ+ C                       ++  + + KE  N
Sbjct  411   RDCQDIEEQKHMWDFLPIVIQHSC-----------------------RNFHVIMDKEKEN  447

Query  1775  LKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDST  1954
               +          +SW       +E+    S + N +     +++L E    S L F  T
Sbjct  448   FAF----------VSWECLKEEPEEAFKVISHWDNNESEFSEFEQLQE---SSALKFGVT  494

Query  1955  SGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                    +V   G+K++ KAEKTI+LQIL+QYFAGSLKDAAKS+GV
Sbjct  495   DESKENSSV---GEKRQTKAEKTISLQILRQYFAGSLKDAAKSIGV  537



>ref|XP_002313581.2| hypothetical protein POPTR_0009s16820g [Populus trichocarpa]
 gb|EEE87536.2| hypothetical protein POPTR_0009s16820g [Populus trichocarpa]
Length=906

 Score =   407 bits (1046),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 245/616 (40%), Positives = 353/616 (57%), Gaps = 72/616 (12%)
 Frame = +2

Query  347   WLETTDGSEFFQHSPFN-ANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSASQ  523
             W E   G  F Q    + +N L +PS  +P     N   ++        +S P       
Sbjct  34    WFEKDGGFNFLQQGRLSTSNVLHDPSLYIPVTGTPNWNSVE--------TSTP-------  78

Query  524   FHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDK  703
                     F    S  V ++GL    ++ +R  + P  + SV +R++QA+GY+K+  +D+
Sbjct  79    --------FAHPASCRVEAAGLGCEWQMVQR--VNPGTSCSVKERVLQAVGYLKNCIQDR  128

Query  704   DVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPG  883
             D+LIQIW+P+ ++G+RVL T DQP+ +D  C  LA YR +S  Y F  EED++ +VG PG
Sbjct  129   DILIQIWLPMEKEGKRVLATIDQPYFVDPSCKSLASYRKVSTAYHFQAEEDAKRSVGFPG  188

Query  884   RVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQ  1063
             RVFL K+PEWTPDV+LF+ EEYP   HA ++++RG+ A+P+F QGS TCLG++E+  T Q
Sbjct  189   RVFLEKLPEWTPDVRLFRSEEYPHRDHAVQHNIRGSLALPLFTQGSETCLGIVEIATTIQ  248

Query  1064  KVKYRNELDSVCKALEEVDLR--------GSKISNVRNV-KTCHSY-QVVLPEILEVLKS  1213
             K+ YR EL  +CK L+ VDLR        G +I+ V  + +TC+   +  +PEI +++KS
Sbjct  249   KISYRPELQDICKVLQAVDLRSSEDFCSPGVEITIVFLLSQTCNRLNRAAVPEISDIVKS  308

Query  1214  ACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHH  1393
              C T++LPLA TW  C +QGK G +   E    C+STVDSAC++AD    GFH A  E +
Sbjct  309   VCKTYRLPLALTWALCSRQGKSGRQQFPERFSSCISTVDSACFLADRGFSGFHMASFEQY  368

Query  1394  LLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDF  1573
             L  G G+VGRAF T + CF+ DITSFSK +YPL+H+A+IF L AA+AI LRS  TG  +F
Sbjct  369   LFLGQGIVGRAFTTQKQCFTNDITSFSKKDYPLAHHAKIFGLHAAIAIPLRSISTGLVEF  428

Query  1574  VLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq-----eleeettSPSSKVAK  1738
             VLEFFLP+DC+  EE K M   L I I+ VC +L+VV ++     E +   +SPS +  +
Sbjct  429   VLEFFLPKDCQDTEEQKEMWDLLPISIKQVCWSLQVVMDKELDQGENQSFVSSPSKEPPR  488

Query  1739  HSDIRIHKEVPNLKYNSS-----------------IGPCEEGLSWTSSPMLVQESCMSSS  1867
                  I   V   K   S                 I P ++      +  ++ E      
Sbjct  489   DESSWIAWMVEAQKKGKSCCITWDYPKEPKEEFKMITPWDDSEEELDNKQVISE---LGQ  545

Query  1868  AFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMK-AEKTITLQILQ  2044
               QN +P+          + G G+S  S  G   +   R+ G K+R K A +TI+L++L+
Sbjct  546   LQQNPRPNSC--------IEGDGVS--SAFGGCRSLGSRKTGKKRRTKTAIQTISLEVLR  595

Query  2045  QYFAGSLKDAAKSLGV  2092
             +YFAGSLKDA++SLGV
Sbjct  596   RYFAGSLKDASQSLGV  611



>pir||F84548 hypothetical protein At2g17150 [imported] - Arabidopsis thaliana
Length=890

 Score =   402 bits (1034),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 243/619 (39%), Positives = 337/619 (54%), Gaps = 81/619 (13%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTD     Q   SP  + A+ + S  L                        EN 
Sbjct  41    DGCWLETTDSKSLKQTEQSPSASTAMNDNSPFL---------------------CFGENP  79

Query  512   SASQFHTERVQ-CFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLIQALG  676
             S   F  E  +  F Q          L E +E+ + WWI P A    ++SV +RL+QA+ 
Sbjct  80    SQDNFSNEETERMFPQ------AEKFLLEEAEVGKSWWIAPSASEGPSSSVKERLLQAIS  133

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
              + +  +DKD L+QIWVP+ ++G+  L T  QP   + +   LA YR +S  Y FP +E 
Sbjct  134   GLNEAVQDKDFLVQIWVPIQQEGKSFLTTWAQPHLFNQEYSSLAEYRHVSETYNFPADEG  193

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
              ++ VGLPGRVFL K PEWTPDV+ F+R+EYPR+  AQ+ DVRG+ A+PVF++GS TCLG
Sbjct  194   MKDFVGLPGRVFLQKFPEWTPDVRFFRRDEYPRIKEAQKCDVRGSLALPVFERGSGTCLG  253

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSYQVVLPEILEVLKSA  1216
             V+E+V TTQK+ YR EL+ +CKALE                    Y   LPEI + L + 
Sbjct  254   VVEIVTTTQKMNYRQELEKMCKALEVYS---------------DFYCAALPEIKDFLATI  298

Query  1217  CATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHL  1396
             C ++  PLA +W PC +QGK G RHSDEN   CVST+DSAC + D + + F EACSEHHL
Sbjct  299   CRSYDFPLALSWAPCARQGKVGSRHSDENFSECVSTIDSACSVPDEQSKSFWEACSEHHL  358

Query  1397  LKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFV  1576
             L+G G+VG+AF   +  F  ++ +FSKT YPL+H+A+I  L AA+A+ L+S  +G  +FV
Sbjct  359   LQGEGIVGKAFEATKLFFVPEVATFSKTNYPLAHHAKISGLHAALAVPLKSK-SGLVEFV  417

Query  1577  LEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRI  1756
             LEFF P+ C   E  + ML SL + +Q   ++  +  +    E        +    ++  
Sbjct  418   LEFFFPKACLDTEAQQEMLKSLCVTLQQDFRSSNLFIKDLELEVVLPVRETMLFSENLLC  477

Query  1757  HKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSS---AFQNEKPSELLYKR------  1909
               E   ++  + I   E   SW +  +   E     S    +Q E P EL   R      
Sbjct  478   GAET--VESLTEIQMQES--SWIAHMIKANEKGKDVSLSWEYQKEDPKELSSGRENSQLD  533

Query  1910  -LPEFV----------SGSGLSFD-------STSGEGSAQNVRRAGDKKRMKAEKTITLQ  2035
              +P  V          S  GL  D       +++G G+  + RR G+KKR K EKTI L+
Sbjct  534   PVPNNVPLEAEQLQQASTPGLRVDIGPSTESASTGGGNMLSSRRPGEKKRAKTEKTIGLE  593

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +L+QYFAGSLKDAAKS+GV
Sbjct  594   VLRQYFAGSLKDAAKSIGV  612



>ref|XP_002525797.1| transcription factor, putative [Ricinus communis]
 gb|EEF36571.1| transcription factor, putative [Ricinus communis]
Length=907

 Score =   399 bits (1025),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 243/636 (38%), Positives = 360/636 (57%), Gaps = 84/636 (13%)
 Frame = +2

Query  344   CWLETT-DGSEFFQHSPFN-ANALFEPSYVLPDLE---PN---NGELMKESEVERKKSSL  499
             CWLE + +G    Q S  + +N +++PS  +P L    PN     E + + ++   ++  
Sbjct  9     CWLENSAEGFNMTQQSGNSISNIVYDPSRSVPSLRSSYPNINTQHEQLYQEQITGHRN-F  67

Query  500   PENLSASQFHTERVQCFGQNGSNAVCSS-------GLAESSELSRRWWIGPMATT--SVM  652
             P N   +  H  +     Q+ S +  ++        + E +E  R W I    ++  SV 
Sbjct  68    PSN---TPLHYHKADEHPQDESESTTTTVVQSKRLPIIEGTEAGRGWPISNSRSSNYSVK  124

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
             +R+ QAL Y++ +++DKDVLIQ+W+P+ R G+  L T DQP+ L   C  L+ YR+++  
Sbjct  125   ERIRQALQYLEGYTKDKDVLIQVWMPIKRGGKNFLTTIDQPYFLKPGCKNLSCYRNVAKT  184

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y+FP+EE+SQ+++G PGRVFL K+P+W+PDV+LF+  EYP   HA++Y++ G  A+PV  
Sbjct  185   YDFPLEENSQDSIGFPGRVFLEKLPDWSPDVRLFRENEYPFRDHARQYNICGCLAIPVLG  244

Query  1013  QGSRTCLGVIEVVLTT-QKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVL  1186
               S TCLGVIEVV T   K+  R EL+ +CKAL+EVDL+ S+     +VK  +  Y+V +
Sbjct  245   PSSGTCLGVIEVVTTAHHKISCRPELEYICKALKEVDLKTSQDFCSPSVKVLNELYEVAV  304

Query  1187  PEILEVLKSACATHKLPLAQTWVPCVQQGKEGL-RHSDENLLRCVSTVDSACYIADPRIQ  1363
             PEI E+L+S C   +LPLA TW PC + G+ G   H  E    C+ TVDSAC++AD  + 
Sbjct  305   PEISEILQSVCKRFRLPLALTWAPCKRLGESGYDEHFPEKFASCILTVDSACFLADKELS  364

Query  1364  GFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRL  1543
             GF++ACSE ++  G G VG+AF   + CFS DIT F+KT YPL+H+A I++LQAAVA  L
Sbjct  365   GFYKACSEQYIFLGQGTVGKAFSKQKQCFSPDITCFTKTSYPLAHHANIYNLQAAVAFPL  424

Query  1544  RSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPS  1723
             RS  TG  +FVLE FLP+ C+ PEE  RM   LSI IQ  C+                 S
Sbjct  425   RSIYTGLFEFVLELFLPQRCRDPEEQSRMWDLLSISIQQSCR-----------------S  467

Query  1724  SKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQES----CMSSSAFQNEKPS  1891
              +V    +I     VP  + +   G      SW +  M  Q++    C+S    +NE   
Sbjct  468   LQVILDKEI-----VPTEETDKKSG----SSSWIACTMGAQKNGNGCCVSWDCKENEPKE  518

Query  1892  EL--------------------LYKRL---------PEFVSGSGLSFDSTSGEGSAQNVR  1984
             E                     ++  L         P+ +S       S+SG+  A + R
Sbjct  519   EFKVITNWDGSDDQVELEHDLRVFSELQQLQKISPQPKSISIDDYGVSSSSGKRRASS-R  577

Query  1985  RAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             +AG+KKR+  E +I+L++LQQ+FAG+L+DAAKS+GV
Sbjct  578   KAGEKKRISIEDSISLEVLQQHFAGTLQDAAKSIGV  613



>ref|NP_001031361.2| nodule inception like protein 1 [Arabidopsis thaliana]
 dbj|BAD93733.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06592.1| nodule inception like protein 1 [Arabidopsis thaliana]
Length=654

 Score =   382 bits (982),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 199/448 (44%), Positives = 271/448 (60%), Gaps = 36/448 (8%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQ--HSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENL  511
             +GCWLETTD     Q   SP  + A+ + S  L                        EN 
Sbjct  41    DGCWLETTDSKSLKQTEQSPSASTAMNDNSPFL---------------------CFGENP  79

Query  512   SASQFHTERVQ-CFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLIQALG  676
             S   F  E  +  F Q          L E +E+ + WWI P A    ++SV +RL+QA+ 
Sbjct  80    SQDNFSNEETERMFPQ------AEKFLLEEAEVGKSWWIAPSASEGPSSSVKERLLQAIS  133

Query  677   YIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEED  856
              + +  +DKD L+QIWVP+ ++G+  L T  QP   + +   LA YR +S  Y FP +E 
Sbjct  134   GLNEAVQDKDFLVQIWVPIQQEGKSFLTTWAQPHLFNQEYSSLAEYRHVSETYNFPADEG  193

Query  857   SQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLG  1036
              ++ VGLPGRVFL K PEWTPDV+ F+R+EYPR+  AQ+ DVRG+ A+PVF++GS TCLG
Sbjct  194   MKDFVGLPGRVFLQKFPEWTPDVRFFRRDEYPRIKEAQKCDVRGSLALPVFERGSGTCLG  253

Query  1037  VIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVVLPEILEVLKS  1213
             V+E+V TTQK+ YR EL+ +CKALE VDLR S   N  + +     Y   LPEI + L +
Sbjct  254   VVEIVTTTQKMNYRQELEKMCKALEAVDLRSSSNLNTPSSEVYSDFYCAALPEIKDFLAT  313

Query  1214  ACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHH  1393
              C ++  PLA +W PC +QGK G RHSDEN   CVST+DSAC + D + + F EACSEHH
Sbjct  314   ICRSYDFPLALSWAPCARQGKVGSRHSDENFSECVSTIDSACSVPDEQSKSFWEACSEHH  373

Query  1394  LLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDF  1573
             LL+G G+VG+AF   +  F  ++ +FSKT YPL+H+A+I  L AA+A+ L+S  +G  +F
Sbjct  374   LLQGEGIVGKAFEATKLFFVPEVATFSKTNYPLAHHAKISGLHAALAVPLKSK-SGLVEF  432

Query  1574  VLEFFLPRDCKSPEEHKRMLTSLSIIIQ  1657
             VLEFF P+ C   E  + ML SL + +Q
Sbjct  433   VLEFFFPKACLDTEAQQEMLKSLCVTLQ  460


 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  1949  STSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLG  2089
             +++G G+  + RR G+KKR K EKTI L++L+QYFAGSLKDAAKS+G
Sbjct  581   ASTGGGNMLSSRRPGEKKRAKTEKTIGLEVLRQYFAGSLKDAAKSIG  627



>ref|XP_011033170.1| PREDICTED: protein NLP2-like [Populus euphratica]
 ref|XP_011033171.1| PREDICTED: protein NLP2-like [Populus euphratica]
Length=934

 Score =   388 bits (997),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 283/459 (62%), Gaps = 22/459 (5%)
 Frame = +2

Query  347   WLETTDGSEFFQHSPFNANALFE-PSYVLPDLEPNNGELMK-----ESEVERK-KSSLPE  505
             W E      F Q  P  +N L++ PS  +P +  NN  +       + E ER    + P 
Sbjct  34    WAENDGEFSFLQQGPATSNVLYDHPSLYIPFMGSNNLSIASNQQDYQEETERHCHGNPPL  93

Query  506   NLSASQFHTERVQCFGQNGSNAVCSSGL-------AESSELSRRWW----IGPMATTSVM  652
             +   S    E VQ   Q   +   S+ L        E++ L   W     + P+ + SV 
Sbjct  94    DYPKSM---ELVQTEPQVEDSVDTSTSLLHTTGYRVEAAGLGFEWQMVPRVNPVTSFSVK  150

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
             +R +QA+ Y+K+  + KD LIQIW+PV ++G++VL T DQP+ ++  C  LA YR++S  
Sbjct  151   ERAMQAIIYLKNCIQYKDSLIQIWLPVEKEGKKVLATIDQPYFVNPSCKSLASYRNVSTA  210

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y F VE D+  +VG PGRVFL K+PEWTPDV LF+ EEYPR  HA ++++RG+ A+P+F 
Sbjct  211   YHFQVEGDATFSVGFPGRVFLEKLPEWTPDVSLFRSEEYPRKDHAIQHNIRGSLALPLFK  270

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHSY-QVVLP  1189
             QGS TCLG++E+V T+QK+ YR EL+ +CKAL+ VDLR S+      VKTC+   QV +P
Sbjct  271   QGSETCLGIVEIVTTSQKITYRPELEDICKALKAVDLRSSEDFCSPGVKTCNGLNQVAVP  330

Query  1190  EILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGF  1369
             EI E++KS C T+ LPLA TW  C +QGK G +   E     +STVDSAC++AD    GF
Sbjct  331   EISEIVKSVCKTYGLPLALTWTLCSRQGKSGRQQFAEKSGAFISTVDSACFLADRDFSGF  390

Query  1370  HEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRS  1549
             H A  E ++  G G+VG+AF T + CF+ D+T FSK +YPL+H+A+IF L AA+AI LRS
Sbjct  391   HMASFEQYIFLGQGIVGKAFTTQKQCFANDVTCFSKKDYPLAHHAKIFGLHAAIAIPLRS  450

Query  1550  TCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVC  1666
               TG  +FVLE FLP DCK  EE K+M   L I IQ VC
Sbjct  451   IATGLVEFVLELFLPIDCKDTEEQKKMWDLLPIAIQQVC  489



>gb|AGR88904.1| nodule inception protein 1 [Datisca glomerata]
Length=894

 Score =   387 bits (994),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 250/634 (39%), Positives = 351/634 (55%), Gaps = 97/634 (15%)
 Frame = +2

Query  338   EGCWLETTDGSEFFQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSA  517
             +GCW+E TD S   +     ++ L + S+++ +  P++       + +       +N  +
Sbjct  35    DGCWVEVTDSS--IRPLTDQSSYLQDNSHLITN--PHHQIYQDHEDPDHHH----QNQGS  86

Query  518   SQFHTERVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMA----TTSVMDRLIQALGYIK  685
               FH  + +     GS+ + S          R+WWI P +    ++SV +RL+ A+GY++
Sbjct  87    FSFHEIQSESVVIEGSDQITS----------RKWWIAPRSYPSHSSSVKERLMLAIGYLR  136

Query  686   DFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDI--SINYEFPV--EE  853
             + ++D+DVLIQIWVP    G +  VT               +YR I    NY      EE
Sbjct  137   ECTKDRDVLIQIWVPARSKGSQQDVT--------------TNYRKIIPGDNYHLGGGDEE  182

Query  854   DSQE--------NVGLPGRVFLGK--VPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVP  1003
             + QE          GLP R  +GK    +W  DV+  +++EY R  + Q+ DVRG  A+P
Sbjct  183   NWQEIGGVGYGYGYGLPCRGMMGKNMQDQWGFDVRFIRKDEYMRFSYGQQVDVRGCLALP  242

Query  1004  VFDQGSRTCLGVIEVVLTTQK-VKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQ  1177
             VF++GS  CLGV+E+++TTQ+ + YR ELD + +ALE VDLR     +   +K     YQ
Sbjct  243   VFERGSGICLGVVEILMTTQRQLNYRPELDYINEALESVDLRSFHNFSPPTIKGFDELYQ  302

Query  1178  VVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEG-LRHSDENLLRCVSTVDSACYIADP  1354
               L EI+EVL S C TH+LPLA TW PC QQGK G  +HSD N   CVSTV+SACY+A+ 
Sbjct  303   AALGEIVEVLTSVCKTHRLPLALTWAPCSQQGKTGCYKHSDGNFAPCVSTVESACYVAEV  362

Query  1355  RIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVA  1534
                GFHEAC E HL KG G+VG +F TN+PCF+ DIT+FSK EYP  H+ARIF L+AA+A
Sbjct  363   DTLGFHEACLEQHLFKGQGIVGTSFTTNKPCFAVDITAFSKNEYPFCHHARIFGLRAAIA  422

Query  1535  IRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeett  1714
             I +RST TGS DFVLEFFLP+DC+  EE KRML SLSI+IQ  C++L + T+ +  +   
Sbjct  423   IPVRSTYTGSADFVLEFFLPKDCEDNEEQKRMLNSLSIVIQQSCRSLHIATDNKEVDGEE  482

Query  1715  SPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA---FQNEK  1885
             +   +V+  S+    KE                 SW +  +  Q+     S    +Q E+
Sbjct  483   NIVPQVSAASEASFPKES----------------SWIAHMIEAQQKGKGISVSMEYQIEE  526

Query  1886  PSE------------------LLYKRLPEFVSGSGL------SFDSTS-GEGSAQNVRRA  1990
             P E                   ++    +    SG         DS S G   +   R+A
Sbjct  527   PREEFKVTTHWDNIHGGLQNGQVFSEFGQLQQSSGAKGSVEGGADSYSFGSHQSSGGRKA  586

Query  1991  GDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             G+K+R KAEKTI+L +L+QYFAGSLKDAAKS+GV
Sbjct  587   GEKRRTKAEKTISLPVLRQYFAGSLKDAAKSIGV  620



>ref|XP_006651009.1| PREDICTED: protein NLP1-like [Oryza brachyantha]
Length=749

 Score =   373 bits (957),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/281 (59%), Positives = 218/281 (78%), Gaps = 1/281 (0%)
 Frame = +2

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y+F  +E S+ ++GLPGRVF+G+VPEWTPDV+ F  EEYPRV HAQ +D+RG+ A+PV
Sbjct  1     MKYQFSADESSRADLGLPGRVFVGRVPEWTPDVRYFSNEEYPRVQHAQYFDIRGSIALPV  60

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+  SR CLGV+E+V+TTQK+ Y  E++++C AL+EVDLR S +S+    K    SY+ +
Sbjct  61    FEPRSRACLGVVELVMTTQKINYSTEIENICSALKEVDLRSSDVSSDPRSKVVDTSYRAI  120

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQ  1363
             +PEI++VL++ C TH LPLAQTW+PC+ Q K G RHSDE    CVSTVD ACY+ D  + 
Sbjct  121   VPEIMDVLRAVCDTHNLPLAQTWIPCICQAKRGTRHSDERFKYCVSTVDEACYVRDCSVL  180

Query  1364  GFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRL  1543
             GFH+AC+EHHL +G G+VG+AF TN+PCFS DIT++SKT+YPLSH+A++FSL+AAVAIRL
Sbjct  181   GFHQACAEHHLFRGEGIVGKAFGTNEPCFSPDITAYSKTQYPLSHHAKLFSLRAAVAIRL  240

Query  1544  RSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVC  1666
             RS  TG+ DFVLEFFLP  C   EE + ML SLS  IQ VC
Sbjct  241   RSVRTGNLDFVLEFFLPLKCIKTEEQRAMLNSLSNTIQQVC  281



>ref|XP_008783158.1| PREDICTED: protein NLP3-like isoform X2 [Phoenix dactylifera]
Length=904

 Score =   377 bits (967),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 220/505 (44%), Positives = 295/505 (58%), Gaps = 43/505 (9%)
 Frame = +2

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             R+ QAL Y+KD S ++ +L+Q+W PV    R VL T  QPF LD     L HYR +S+ Y
Sbjct  112   RMSQALRYLKD-STNQHLLVQVWAPVKNGNRYVLTTSGQPFVLDPHSVGLLHYRTVSVTY  170

Query  836   EFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQ  1015
              F V+ D   ++GLPGRVF  KVPEWTPDVQ +  +EYPR+ HA  Y+VRGT A+PVF+ 
Sbjct  171   MFSVDGDQDGDLGLPGRVFRQKVPEWTPDVQFYSTKEYPRLSHALHYNVRGTLALPVFEP  230

Query  1016  GSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPE  1192
               ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I +  NV+ C+   Q  L E
Sbjct  231   YDQSCIGVVELIMTSQKINYAGEVDKVCKALEAVNLKSSEILDHPNVQICNEGRQAALAE  290

Query  1193  ILEVLKSACATHKLPLAQTWVPCVQQ--------GKEGLRHSDENLLR--CVSTVDSACY  1342
             ILE L   C  HKLPLAQTWVPC  +         K+     D   +   C+ST D+A +
Sbjct  291   ILETLTMVCEAHKLPLAQTWVPCRHRSILAHGGGSKKSCSSFDGGCMGQVCMSTTDAAFH  350

Query  1343  IADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQ  1522
             + D  + GF EAC+EHHL KG GV GRAF + + CFS DIT FSK +YPL HYAR+F L 
Sbjct  351   VIDAHMWGFREACTEHHLQKGQGVAGRAFASRRSCFSKDITQFSKIDYPLVHYARMFGLA  410

Query  1523  AAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqele  1702
                A+ L+ST TG+ D++LEFFLP DCK   E   +L S+  +++   +    +      
Sbjct  411   CCFALCLQSTRTGNDDYILEFFLPPDCKDTGEQLALLQSMRTMMEKCLR---SLKVITDV  467

Query  1703  eettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNE  1882
             E     S +V    +IR  K  P   Y   I  CE  L       LV+    + +  Q E
Sbjct  468   ELQGGSSLEVIDMLEIRNQKSEPKPIY---IRSCENRLHAFPEWNLVE----ALNEMQKE  520

Query  1883  KPSELLYKRLPEFV-----------SGSGLSFDSTS-GEGSAQNVRRAG---DKKRMKAE  2017
             K S      +PE               S +  DS S G  S+  V +     +++R KAE
Sbjct  521   KHS------MPELSEQHFLTDANDGKNSKIVVDSNSTGTPSSSLVNKNNKPLERRRGKAE  574

Query  2018  KTITLQILQQYFAGSLKDAAKSLGV  2092
             KTI+L++L+QYFAGSLKDAAKSLGV
Sbjct  575   KTISLEVLRQYFAGSLKDAAKSLGV  599



>ref|XP_008783157.1| PREDICTED: protein NLP3-like isoform X1 [Phoenix dactylifera]
Length=949

 Score =   376 bits (966),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 220/505 (44%), Positives = 295/505 (58%), Gaps = 43/505 (9%)
 Frame = +2

Query  656   RLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINY  835
             R+ QAL Y+KD S ++ +L+Q+W PV    R VL T  QPF LD     L HYR +S+ Y
Sbjct  112   RMSQALRYLKD-STNQHLLVQVWAPVKNGNRYVLTTSGQPFVLDPHSVGLLHYRTVSVTY  170

Query  836   EFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQ  1015
              F V+ D   ++GLPGRVF  KVPEWTPDVQ +  +EYPR+ HA  Y+VRGT A+PVF+ 
Sbjct  171   MFSVDGDQDGDLGLPGRVFRQKVPEWTPDVQFYSTKEYPRLSHALHYNVRGTLALPVFEP  230

Query  1016  GSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPE  1192
               ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I +  NV+ C+   Q  L E
Sbjct  231   YDQSCIGVVELIMTSQKINYAGEVDKVCKALEAVNLKSSEILDHPNVQICNEGRQAALAE  290

Query  1193  ILEVLKSACATHKLPLAQTWVPCVQQ--------GKEGLRHSDENLLR--CVSTVDSACY  1342
             ILE L   C  HKLPLAQTWVPC  +         K+     D   +   C+ST D+A +
Sbjct  291   ILETLTMVCEAHKLPLAQTWVPCRHRSILAHGGGSKKSCSSFDGGCMGQVCMSTTDAAFH  350

Query  1343  IADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQ  1522
             + D  + GF EAC+EHHL KG GV GRAF + + CFS DIT FSK +YPL HYAR+F L 
Sbjct  351   VIDAHMWGFREACTEHHLQKGQGVAGRAFASRRSCFSKDITQFSKIDYPLVHYARMFGLA  410

Query  1523  AAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqele  1702
                A+ L+ST TG+ D++LEFFLP DCK   E   +L S+  +++   +    +      
Sbjct  411   CCFALCLQSTRTGNDDYILEFFLPPDCKDTGEQLALLQSMRTMMEKCLR---SLKVITDV  467

Query  1703  eettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNE  1882
             E     S +V    +IR  K  P   Y   I  CE  L       LV+    + +  Q E
Sbjct  468   ELQGGSSLEVIDMLEIRNQKSEPKPIY---IRSCENRLHAFPEWNLVE----ALNEMQKE  520

Query  1883  KPSELLYKRLPEFV-----------SGSGLSFDSTS-GEGSAQNVRRAG---DKKRMKAE  2017
             K S      +PE               S +  DS S G  S+  V +     +++R KAE
Sbjct  521   KHS------MPELSEQHFLTDANDGKNSKIVVDSNSTGTPSSSLVNKNNKPLERRRGKAE  574

Query  2018  KTITLQILQQYFAGSLKDAAKSLGV  2092
             KTI+L++L+QYFAGSLKDAAKSLGV
Sbjct  575   KTISLEVLRQYFAGSLKDAAKSLGV  599



>gb|AFW71652.1| hypothetical protein ZEAMMB73_806651 [Zea mays]
Length=535

 Score =   363 bits (931),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 216/497 (43%), Positives = 293/497 (59%), Gaps = 78/497 (16%)
 Frame = +2

Query  620   WI--GPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRD-GRRVLVTGDQPFQLDL  790
             W+  G  + +SV ++  QAL YI+D   D DVL+Q+WVPVN D G+ VL T +QPF LD 
Sbjct  39    WLETGGASPSSVEEQFSQALSYIRDTQSDGDVLVQLWVPVNHDDGKLVLTTSEQPFTLDH  98

Query  791   KCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQ  970
             +   L  +R++S  Y+F     S ++ GL GRVF+G++PEW+PD++ F   EYPRV  AQ
Sbjct  99    RSDSLLRFREVSTKYQFSANVKSGDSPGLSGRVFIGRLPEWSPDIRYFTSYEYPRVRDAQ  158

Query  971   RYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVR  1150
               DV GT  +PVF++GS  CLGVIE+++  QK+ + +EL+++C AL+             
Sbjct  159   YLDVHGTMGLPVFEKGSYNCLGVIELIMIRQKINFTSELNTICSALQ-------------  205

Query  1151  NVKTCHSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVD  1330
                +  SY+  LPEILEVL++AC THKLPLAQTWV C QQGK G RHSDEN   C+ST+D
Sbjct  206   --FSTASYKDALPEILEVLRAACLTHKLPLAQTWVTCAQQGKRGNRHSDENYRYCISTID  263

Query  1331  SACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARI  1510
              AC++ +  ++GFHE CSEHHLL+G G                                 
Sbjct  264   EACFVNEAEMRGFHETCSEHHLLRGEG---------------------------------  290

Query  1511  FSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvte  1690
               L+ AVAIRLR T TG+TDFVLEFFLP DC++ E+   +L SLS  +++VCQTLRVVT 
Sbjct  291   --LKGAVAIRLRCTRTGTTDFVLEFFLPTDCEALEDQNIVLDSLSGTMRSVCQTLRVVTN  348

Query  1691  qeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSA  1870
             +E+E+E     +++  +S     K+   L +  +        SWT            S A
Sbjct  349   REMEDEAVLEMNEL--NSFTPHGKDKVELSFGGNSADRRGEASWT------------SLA  394

Query  1871  FQNEKPSELLYKRLPEFVS----GSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQI  2038
               +++ SEL   R+    S    G  LS    + EGS         K+R KAEKT++LQI
Sbjct  395   GTSQQESELAALRMHGMFSPGGQGPSLSGVQATAEGSKA-------KRRTKAEKTVSLQI  447

Query  2039  LQQYFAGSLKDAAKSLG  2089
             L+QYFAGSLKDAA+SLG
Sbjct  448   LRQYFAGSLKDAARSLG  464



>ref|XP_010915986.1| PREDICTED: protein NLP3-like [Elaeis guineensis]
Length=961

 Score =   371 bits (953),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 216/507 (43%), Positives = 293/507 (58%), Gaps = 45/507 (9%)
 Frame = +2

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
             +R+ QAL Y+KD S ++ +L+Q+W PV    R VL T +QPF LD +   L HYR +S+ 
Sbjct  124   ERMSQALRYLKD-STNQHLLVQVWAPVKNGNRYVLTTSEQPFVLDPRSVGLLHYRTVSVT  182

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y F V+ D   ++GLPGRVF  KVPEWTPDVQ +  +EYPR+ HA   +VRGT A+PVF+
Sbjct  183   YRFSVDGDQDGDLGLPGRVFRQKVPEWTPDVQYYSTKEYPRLSHALHDNVRGTLALPVFE  242

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLP  1189
                ++C+GV+E+++T+ K+ Y  E+D VCKAL+ V+L+ S+I N  NV+ C+   Q  L 
Sbjct  243   PCDQSCIGVVELIMTSPKINYAGEVDKVCKALKAVNLKSSEILNHPNVQICNEGRQAALA  302

Query  1190  EILEVLKSACATHKLPLAQTWVPCVQQG--------KEGLRHSDENLLR--CVSTVDSAC  1339
             EIL++L   C  +KLPLAQTWVPC  +         K+     D   +   C+ST D A 
Sbjct  303   EILKILTMVCEAYKLPLAQTWVPCRHRSILAHGGGLKKNCSSFDGTCMGQVCMSTTDVAF  362

Query  1340  YIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSL  1519
             ++ D  + GF EAC EHHL KG GV GRAF + +PCFS DIT FSK EYPL HYAR+F L
Sbjct  363   HVIDAHMWGFREACVEHHLQKGQGVAGRAFASRRPCFSKDITQFSKIEYPLVHYARMFGL  422

Query  1520  QAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqel  1699
                 A+ L+ST TG  D+VLEFFLP DC+   E   +L S++ +++   +    +     
Sbjct  423   ACCFALCLQSTQTGHDDYVLEFFLPPDCEDAGEQLALLQSMTTMME---KCFCSLKVITD  479

Query  1700  eeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQN  1879
              E     S +V    +I   K  P   Y      CE GL       LV+      +  Q 
Sbjct  480   VELQEGSSLEVIDMLEIGSQKSEPKPIYMRC---CENGLHTFPECNLVE----GLNGMQK  532

Query  1880  EKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAG----------------DKKRMK  2011
             EK        +PE      L+ DS  G+ +   V  +G                +++R K
Sbjct  533   EK------NAIPELSEQHFLT-DSNDGKNTKIVVDSSGTGTPCSSLVNKKNRPLERRRGK  585

Query  2012  AEKTITLQILQQYFAGSLKDAAKSLGV  2092
             AEKTI+L++LQQYFAGSLKDAAKSLGV
Sbjct  586   AEKTISLEVLQQYFAGSLKDAAKSLGV  612



>ref|XP_010267559.1| PREDICTED: protein NLP7-like isoform X3 [Nelumbo nucifera]
Length=868

 Score =   365 bits (937),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 209/503 (42%), Positives = 296/503 (59%), Gaps = 51/503 (10%)
 Frame = +2

Query  659   LIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             ++QAL Y K+ + ++ VL Q+W PV   G+ VL T  QPF LD     L  YR +S+ Y+
Sbjct  1     MMQALRYFKELT-EQHVLAQVWAPVKNGGQYVLTTSGQPFVLDPNSNGLLQYRTVSLMYK  59

Query  839   FPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
             F V+ ++  ++GLPGRVF  K+PEWTP+VQ +  +EYPR+ HA  Y+V+GT A+PVF+  
Sbjct  60    FSVDGENDGDLGLPGRVFRQKLPEWTPNVQYYSSKEYPRLSHALHYNVQGTLALPVFEPS  119

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEI  1195
              ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S++ + +N++ C+  +Q  L EI
Sbjct  120   RQSCVGVVELIMTSQKINYAPEVDKVCKALEAVNLKSSEVLDHQNIQICNEGHQNALAEI  179

Query  1196  LEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHSDENLLR------CVSTVDSACYI  1345
             LE+L   C THKLPLAQTWVPC  +       G++ S  +         C+ST D+A Y+
Sbjct  180   LEILTVVCETHKLPLAQTWVPCKHRNILAYGGGMKKSCTSFYGSCMGQVCMSTTDAAFYV  239

Query  1346  ADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQA  1525
              D  + GFHEAC+EHHL KG GV GRAF+++  CFS DI  F KTEYPL HYAR+F L +
Sbjct  240   VDAHMWGFHEACTEHHLQKGQGVAGRAFLSHGSCFSRDIIKFRKTEYPLVHYARMFGLTS  299

Query  1526  AVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqelee  1705
               A+ LRST TGS D++LEFFLP       E   +L SL   ++   +            
Sbjct  300   CFAVCLRSTHTGSDDYILEFFLPPSITDSREQDTLLDSLLGSMKQHFR------------  347

Query  1706  ettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEK  1885
                  S KVA    +   + V  +K ++      EG+  +S+        M +    N+ 
Sbjct  348   -----SLKVASGKGLEEERSVEIIKISADDNLELEGVKISSA--------METPVGNNDL  394

Query  1886  PS--ELLYKRLPEFVS-------GSGLSFDSTSGEGSAQNVRRAGDKK-----RMKAEKT  2023
             P+  E L++   E  S         G +   T G  S  +V   G KK     R K EK+
Sbjct  395   PNGVEKLHQDSQEQQSIVEIDGQKDGENVLKTDGTHSTLSVPDKGMKKPLERRRGKTEKS  454

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I+L++LQQYFAGSLKDAAKSLG+
Sbjct  455   ISLEVLQQYFAGSLKDAAKSLGI  477



>ref|XP_010267557.1| PREDICTED: protein NLP6-like isoform X1 [Nelumbo nucifera]
Length=1023

 Score =   369 bits (946),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 230/607 (38%), Positives = 335/607 (55%), Gaps = 75/607 (12%)
 Frame = +2

Query  383   HSPF---NANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPENLSASQFHTERVQCFG  553
             H+P    ++  L+ PS+ L D + +      +S V    SSLP        H++ +  F 
Sbjct  64    HNPLLFSSSEQLYSPSWALLDADDD------KSGVNHPNSSLPGGPRLVD-HSKLISSF-  115

Query  554   QNGSNAVCSSGLAESSELSRRWWIGPM---------ATTSVMDRLIQALGYIKDFSRDKD  706
                 N    +G    ++  RR    P+           + + +R++QAL Y K+ + ++ 
Sbjct  116   ----NPDSLTGNITGNDDKRRHVPTPVLIPLQENLDGYSVIKERMMQALRYFKELT-EQH  170

Query  707   VLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGR  886
             VL Q+W PV   G+ VL T  QPF LD     L  YR +S+ Y+F V+ ++  ++GLPGR
Sbjct  171   VLAQVWAPVKNGGQYVLTTSGQPFVLDPNSNGLLQYRTVSLMYKFSVDGENDGDLGLPGR  230

Query  887   VFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQK  1066
             VF  K+PEWTP+VQ +  +EYPR+ HA  Y+V+GT A+PVF+   ++C+GV+E+++T+QK
Sbjct  231   VFRQKLPEWTPNVQYYSSKEYPRLSHALHYNVQGTLALPVFEPSRQSCVGVVELIMTSQK  290

Query  1067  VKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLA  1243
             + Y  E+D VCKALE V+L+ S++ + +N++ C+  +Q  L EILE+L   C THKLPLA
Sbjct  291   INYAPEVDKVCKALEAVNLKSSEVLDHQNIQICNEGHQNALAEILEILTVVCETHKLPLA  350

Query  1244  QTWVPCVQQG----KEGLRHSDENLLR------CVSTVDSACYIADPRIQGFHEACSEHH  1393
             QTWVPC  +       G++ S  +         C+ST D+A Y+ D  + GFHEAC+EHH
Sbjct  351   QTWVPCKHRNILAYGGGMKKSCTSFYGSCMGQVCMSTTDAAFYVVDAHMWGFHEACTEHH  410

Query  1394  LLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDF  1573
             L KG GV GRAF+++  CFS DI  F KTEYPL HYAR+F L +  A+ LRST TGS D+
Sbjct  411   LQKGQGVAGRAFLSHGSCFSRDIIKFRKTEYPLVHYARMFGLTSCFAVCLRSTHTGSDDY  470

Query  1574  VLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIR  1753
             +LEFFLP       E   +L SL   ++   +                 S KVA    + 
Sbjct  471   ILEFFLPPSITDSREQDTLLDSLLGSMKQHFR-----------------SLKVASGKGLE  513

Query  1754  IHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPS--ELLYKRLPEFVS  1927
               + V  +K ++      EG+  +S+        M +    N+ P+  E L++   E  S
Sbjct  514   EERSVEIIKISADDNLELEGVKISSA--------METPVGNNDLPNGVEKLHQDSQEQQS  565

Query  1928  -------GSGLSFDSTSGEGSAQNVRRAGDKK-----RMKAEKTITLQILQQYFAGSLKD  2071
                      G +   T G  S  +V   G KK     R K EK+I+L++LQQYFAGSLKD
Sbjct  566   IVEIDGQKDGENVLKTDGTHSTLSVPDKGMKKPLERRRGKTEKSISLEVLQQYFAGSLKD  625

Query  2072  AAKSLGV  2092
             AAKSLG+
Sbjct  626   AAKSLGI  632



>ref|XP_010267558.1| PREDICTED: protein NLP6-like isoform X2 [Nelumbo nucifera]
Length=1010

 Score =   368 bits (945),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 210/507 (41%), Positives = 299/507 (59%), Gaps = 51/507 (10%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R++QAL Y K+ + ++ VL Q+W PV   G+ VL T  QPF LD     L  YR +S
Sbjct  139   IKERMMQALRYFKELT-EQHVLAQVWAPVKNGGQYVLTTSGQPFVLDPNSNGLLQYRTVS  197

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y+F V+ ++  ++GLPGRVF  K+PEWTP+VQ +  +EYPR+ HA  Y+V+GT A+PV
Sbjct  198   LMYKFSVDGENDGDLGLPGRVFRQKLPEWTPNVQYYSSKEYPRLSHALHYNVQGTLALPV  257

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S++ + +N++ C+  +Q  
Sbjct  258   FEPSRQSCVGVVELIMTSQKINYAPEVDKVCKALEAVNLKSSEVLDHQNIQICNEGHQNA  317

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHSDENLLR------CVSTVDS  1333
             L EILE+L   C THKLPLAQTWVPC  +       G++ S  +         C+ST D+
Sbjct  318   LAEILEILTVVCETHKLPLAQTWVPCKHRNILAYGGGMKKSCTSFYGSCMGQVCMSTTDA  377

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GFHEAC+EHHL KG GV GRAF+++  CFS DI  F KTEYPL HYAR+F
Sbjct  378   AFYVVDAHMWGFHEACTEHHLQKGQGVAGRAFLSHGSCFSRDIIKFRKTEYPLVHYARMF  437

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  A+ LRST TGS D++LEFFLP       E   +L SL   ++   +        
Sbjct  438   GLTSCFAVCLRSTHTGSDDYILEFFLPPSITDSREQDTLLDSLLGSMKQHFR--------  489

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
                      S KVA    +   + V  +K ++      EG+  +S+        M +   
Sbjct  490   ---------SLKVASGKGLEEERSVEIIKISADDNLELEGVKISSA--------METPVG  532

Query  1874  QNEKPS--ELLYKRLPEFVS-------GSGLSFDSTSGEGSAQNVRRAGDKK-----RMK  2011
              N+ P+  E L++   E  S         G +   T G  S  +V   G KK     R K
Sbjct  533   NNDLPNGVEKLHQDSQEQQSIVEIDGQKDGENVLKTDGTHSTLSVPDKGMKKPLERRRGK  592

Query  2012  AEKTITLQILQQYFAGSLKDAAKSLGV  2092
              EK+I+L++LQQYFAGSLKDAAKSLG+
Sbjct  593   TEKSISLEVLQQYFAGSLKDAAKSLGI  619



>ref|XP_008777047.1| PREDICTED: protein NLP3-like [Phoenix dactylifera]
Length=956

 Score =   366 bits (939),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 212/511 (41%), Positives = 300/511 (59%), Gaps = 49/511 (10%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ S D+ VL+Q+W P+ +  R  L T  QPF L  +  RL  YR +S
Sbjct  126   IKERMTQALRYFKE-STDQHVLVQVWAPMKKGDRCFLTTSGQPFVLGPQSTRLLQYRTVS  184

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ED +  +GLPGRVF  + PEWTP+VQ +  +EYPR+ HA  Y+V+GT A+PV
Sbjct  185   LMYIFSVDEDGEGYLGLPGRVFRHRQPEWTPNVQYYSSKEYPRLTHALHYNVQGTLALPV  244

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             FD   ++C+GVIE+++T+QK+ Y  E+D VCKAL+ V+LR S+I +  N++  +   Q  
Sbjct  245   FDPSGQSCIGVIELIMTSQKINYAREVDKVCKALQAVNLRSSEILDHPNIQISNEGRQSA  304

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILEVL   C  HKLPLAQ WVPC    +     GL+      D + +   C+ST D 
Sbjct  305   LAEILEVLTVVCEAHKLPLAQAWVPCKCRTILAHGGGLKKICSSFDGSCMGQVCMSTTDV  364

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC EHHL  G GV GRAF   +PCF+ D+T FSK+EYPL HYAR+F
Sbjct  365   AFYVIDAHMWGFREACVEHHLQIGQGVAGRAFALRRPCFAEDVTKFSKSEYPLVHYARMF  424

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L   +AI L+ST +G  D+VLEFFLP DCK+  E + +L S+S +++   +        
Sbjct  425   GLVGCLAICLQSTHSGDDDYVLEFFLPHDCKNLIEQQALLDSISALMKQCFR--------  476

Query  1694  eleeettSPSSKVAKHSDIR--IHKEVPNLKYNSSIG---------PCEEGLSWTSSPML  1840
                      S KV    +++  I  E+ ++  N + G          C+  L  +    +
Sbjct  477   ---------SLKVVSELELQEGISFEIISMFANENHGFEPDHICSQICDAHLHTSPETYI  527

Query  1841  VQESCMSSSAFQNEKPSELLYKRLPEFVS---GSGLSFDSTSGEGSAQNVRR----AGDK  1999
             ++    S +       S +L+  LP   +    S + FDS  G  S   +      A +K
Sbjct  528   LEGHDDSQNEGNVTSDSHVLH--LPTHANAEKASNIHFDSGGGGASTARLSNKNNGAPEK  585

Query  2000  KRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             +R KAEK+I+L++LQQYF+GSLKDAAKSLGV
Sbjct  586   RRGKAEKSISLEVLQQYFSGSLKDAAKSLGV  616



>ref|XP_009412372.1| PREDICTED: protein NLP3-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=871

 Score =   362 bits (930),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 212/499 (42%), Positives = 295/499 (59%), Gaps = 31/499 (6%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ S D  VL+Q+W PV    R VL T  QPF LD +  +L  YR +S
Sbjct  31    IKERMTQALRYFKE-STDHHVLVQVWAPVKNGDRCVLTTLGQPFILDPESTKLLQYRTVS  89

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ED   ++GLPGRVF  ++PEWTP+VQ +  +EY R+ HA  Y+V+GT A+PV
Sbjct  90    LMYIFSVDEDDDADLGLPGRVFTRRMPEWTPNVQYYSSKEYQRLNHALCYNVQGTLALPV  149

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVV  1183
             F+   ++C+GV+EVV+T+QKV Y  E+D VCKALE V+L+ S+I +  NV   +  +Q  
Sbjct  150   FEPSGQSCIGVVEVVMTSQKVNYAYEVDKVCKALEAVNLKSSEILDHPNVLIANDGHQAA  209

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQG--------KEGLRHSDENLLR--CVSTVDS  1333
             L EILE+L   C   KLPLAQTWVPC  Q         K+     D + +   C+ST D 
Sbjct  210   LAEILEILTLVCEAKKLPLAQTWVPCRHQTVLTHGGGPKKICSRFDGSCMGQVCMSTTDV  269

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A YI DP + GF EAC EHHL KG GV G+ F   +PCFS DIT + K+EYPL HYAR+F
Sbjct  270   AFYIIDPHLWGFREACVEHHLQKGQGVAGKTFAQRRPCFSKDITKYCKSEYPLVHYARMF  329

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L   +AI LRS   G  D++LEFFLP DCKSP E + +L S+S +++   Q L+ +TE 
Sbjct  330   GLAGCLAICLRSNHLGDDDYILEFFLPADCKSPGEQQDLLNSISGLLKQCFQNLKFITEV  389

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
             + +   +     +A  S    ++  P L Y+    P  +      S   + E   +  + 
Sbjct  390   KFQGGKSPEVDLIADGS----YELRPRLIYS----PRGDTHVHIPSEANIDEPVDNDDSL  441

Query  1874  QNEKPSELLYKRLPEFVSGSGLS------FDSTSGEGSAQNVRRAGDKKRMKAEKTITLQ  2035
               E  +  L+ +     + S +        DST+ +     +     K+R K EKTI+L+
Sbjct  442   NEENATPDLHGQ--HLATDSNVKKNGNKLLDSTALDNKTSYIPA---KRRGKPEKTISLE  496

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +LQQYF+G+LKDAAKSLGV
Sbjct  497   LLQQYFSGNLKDAAKSLGV  515



>gb|EYU33493.1| hypothetical protein MIMGU_mgv1a000862mg [Erythranthe guttata]
Length=956

 Score =   363 bits (932),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 210/496 (42%), Positives = 307/496 (62%), Gaps = 30/496 (6%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL + KD + + ++L Q+W PV   GR +L T  QPF LD     L  YR IS
Sbjct  134   IKERMTQALRHFKDLT-EHNILAQVWAPVKNGGRYMLTTSGQPFVLDPNSSGLHQYRLIS  192

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ D+  ++GLPGRVF  K+PEWTP+VQ +  +E+PR+ HA  Y+V+GT A+PV
Sbjct  193   LMYMFSVDGDADADLGLPGRVFRQKLPEWTPNVQYYSSKEFPRLNHALNYNVQGTLALPV  252

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I + ++ + C+   Q  
Sbjct  253   FEPSGQSCVGVVELIMTSQKINYAPEVDKVCKALEAVNLKSSEILDHQSPQICNQGRQNA  312

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILEV+   C THKLPLAQTWVPC    V     G + +    D + +   C+ST D 
Sbjct  313   LAEILEVISVVCETHKLPLAQTWVPCRHRSVLANGGGFKKTCSSFDGSCMGRVCMSTTDV  372

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC+EHHL KG GV GRAF ++  CF  DIT F KTEYPL HYAR+F
Sbjct  373   AFYVVDAHMWGFREACAEHHLQKGQGVAGRAFASHNSCFCPDITEFCKTEYPLVHYARMF  432

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L+++ AI LRS  TG+ ++VLEFFLP + +S E+ + +L SL + ++    +L V + +
Sbjct  433   GLRSSFAICLRSNHTGNDEYVLEFFLPLNLESDEDQRNLLDSLLVTMKQHFGSLSVASGK  492

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNL---KYNSSIGPCEEGLSWTSSPMLVQESCMSS  1864
             +L+ E  S     A  +D +++  VP+    + +SS+ P  E L   +   +V     ++
Sbjct  493   DLDHEWRSIEVIKASTADEKLNL-VPDTSPPRLSSSL-PNGETLHLDAFEKVVMSEFNAT  550

Query  1865  SAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQ  2044
             +  +N                G G +    +    A+ V +  ++KR KAEKTI+L++LQ
Sbjct  551   NVKRNGS-------------VGGGPTEVQNATVVEAKEVGKKTERKRGKAEKTISLEVLQ  597

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYFAGSLKDAAKSLGV
Sbjct  598   QYFAGSLKDAAKSLGV  613



>ref|XP_009412368.1| PREDICTED: protein NLP3-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412369.1| PREDICTED: protein NLP3-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412370.1| PREDICTED: protein NLP3-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   362 bits (930),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 212/499 (42%), Positives = 295/499 (59%), Gaps = 31/499 (6%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ S D  VL+Q+W PV    R VL T  QPF LD +  +L  YR +S
Sbjct  116   IKERMTQALRYFKE-STDHHVLVQVWAPVKNGDRCVLTTLGQPFILDPESTKLLQYRTVS  174

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ED   ++GLPGRVF  ++PEWTP+VQ +  +EY R+ HA  Y+V+GT A+PV
Sbjct  175   LMYIFSVDEDDDADLGLPGRVFTRRMPEWTPNVQYYSSKEYQRLNHALCYNVQGTLALPV  234

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVV  1183
             F+   ++C+GV+EVV+T+QKV Y  E+D VCKALE V+L+ S+I +  NV   +  +Q  
Sbjct  235   FEPSGQSCIGVVEVVMTSQKVNYAYEVDKVCKALEAVNLKSSEILDHPNVLIANDGHQAA  294

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQG--------KEGLRHSDENLLR--CVSTVDS  1333
             L EILE+L   C   KLPLAQTWVPC  Q         K+     D + +   C+ST D 
Sbjct  295   LAEILEILTLVCEAKKLPLAQTWVPCRHQTVLTHGGGPKKICSRFDGSCMGQVCMSTTDV  354

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A YI DP + GF EAC EHHL KG GV G+ F   +PCFS DIT + K+EYPL HYAR+F
Sbjct  355   AFYIIDPHLWGFREACVEHHLQKGQGVAGKTFAQRRPCFSKDITKYCKSEYPLVHYARMF  414

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L   +AI LRS   G  D++LEFFLP DCKSP E + +L S+S +++   Q L+ +TE 
Sbjct  415   GLAGCLAICLRSNHLGDDDYILEFFLPADCKSPGEQQDLLNSISGLLKQCFQNLKFITEV  474

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
             + +   +     +A  S    ++  P L Y+    P  +      S   + E   +  + 
Sbjct  475   KFQGGKSPEVDLIADGS----YELRPRLIYS----PRGDTHVHIPSEANIDEPVDNDDSL  526

Query  1874  QNEKPSELLYKRLPEFVSGSGLS------FDSTSGEGSAQNVRRAGDKKRMKAEKTITLQ  2035
               E  +  L+ +     + S +        DST+ +     +     K+R K EKTI+L+
Sbjct  527   NEENATPDLHGQ--HLATDSNVKKNGNKLLDSTALDNKTSYIPA---KRRGKPEKTISLE  581

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             +LQQYF+G+LKDAAKSLGV
Sbjct  582   LLQQYFSGNLKDAAKSLGV  600



>ref|XP_006343818.1| PREDICTED: protein NLP7-like isoform X2 [Solanum tuberosum]
Length=704

 Score =   354 bits (909),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 289/496 (58%), Gaps = 29/496 (6%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ S  + VL QIW PV   GR VL T  QPF LD  C  L  YR +S
Sbjct  199   IKERMTQALRYFKE-STGERVLAQIWAPVKNGGRYVLTTSGQPFVLDPDCNGLHQYRMVS  257

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ ++   +GLPGRV+  K+PEWTP+VQ +  +E+PR+ HA  Y+VRGT A+PV
Sbjct  258   LMYMFSVDGETDGVLGLPGRVYRKKLPEWTPNVQYYSSKEFPRLNHALDYNVRGTLALPV  317

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I +  N + C+   Q  
Sbjct  318   FEPSGQSCVGVLELIMTSQKINYAPEVDKVCKALEAVNLKSSEILDYPNHQICNEGRQNA  377

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILE+L + C T+KLPLAQTWVPC    V     G + S    D + +   C+ST D 
Sbjct  378   LVEILEILTAVCETYKLPLAQTWVPCRHRSVLADGGGFKKSCSSFDGSCMGQVCMSTTDV  437

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC+EHHL KG GV GRA+ + + CF  DI  F KTEYPL HYAR+F
Sbjct  438   AFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQKSCFCEDIGQFCKTEYPLVHYARLF  497

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFL-PRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvte  1690
              L + +AI LRST TG+ D++LEFFL P D    ++   + + L  + Q+          
Sbjct  498   GLSSCLAICLRSTHTGNDDYILEFFLPPNDGDYTDQLALLNSLLLTMKQHF---------  548

Query  1691  qeleeettSPSSKVAKHS--DIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSS  1864
                       S +  +H+   + I K     K  S         S   S  +        
Sbjct  549   ----RSLRVASGEELEHNWGSVEIIKASTEEKLGSRFDSVPTTKSLPQSASVANGRTHPD  604

Query  1865  SAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQ  2044
                + + P  L   +  E V+G+  + +  S   + Q  +++ ++KR KAEKTI+L++LQ
Sbjct  605   LMEEQQSPVALNVAKGAEGVNGTAEAHNHASVPENKQTGKKS-ERKRGKAEKTISLEVLQ  663

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYFAGSLKDAAKSLGV
Sbjct  664   QYFAGSLKDAAKSLGV  679



>gb|KCW68097.1| hypothetical protein EUGRSUZ_F01779 [Eucalyptus grandis]
Length=658

 Score =   353 bits (905),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 206/356 (58%), Positives = 249/356 (70%), Gaps = 11/356 (3%)
 Frame = +2

Query  1052  LTTQKVKYRNELDSVCKALEEVDLRGSKI-SNVRNVKTCHSYQVVLPEILEVLKSACATH  1228
             +TTQK++YR E+ SVCKALE  DLR S++  N+       SY+  +PEI EVL+SAC TH
Sbjct  1     MTTQKIQYRPEIQSVCKALEAFDLRSSEVFGNLSEESHWKSYEAAIPEIREVLRSACETH  60

Query  1229  KLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQGFHEACSEHHLLKGL  1408
              LPLAQTWVPC QQGK G RHS+EN + CVST+D AC++ADP +Q FHEACSEHHLLKG 
Sbjct  61    GLPLAQTWVPCSQQGKGGCRHSNENYVHCVSTIDHACHVADPLLQPFHEACSEHHLLKGQ  120

Query  1409  GVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFF  1588
             GVVGRAF TNQPCFS+DITS  +TEYPLSH+AR+F L AAVAIRLRS  TG+ DFVLEFF
Sbjct  121   GVVGRAFQTNQPCFSSDITSSGRTEYPLSHHARMFGLCAAVAIRLRSIHTGTADFVLEFF  180

Query  1589  LPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEV  1768
             LP DCK  ++ K+ML SLSIIIQ VCQ+LRV+T +ELEEET  P   V   S+ R   E 
Sbjct  181   LPMDCKDHDKQKKMLGSLSIIIQQVCQSLRVITNEELEEETVLPEIPVP--SEGRPQGEW  238

Query  1769  PNLKYNSSIGPC-EEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSF  1945
                  ++ +  C EE LSW++    VQ+S   +SA Q  +  E   ++  +F      S 
Sbjct  239   SLEVESNYLERCSEEDLSWSAHVEKVQQSDTVASATQKARAGESFVEKSLDFGQFQDSST  298

Query  1946  D-----STSGEGSAQNVRR--AGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             +     S  GEG   +  R   GDKKR KAEK ITLQ+L+QYFAGSLKDAAKSLGV
Sbjct  299   ERGEDCSFYGEGRCSDAAREKTGDKKRTKAEKAITLQVLRQYFAGSLKDAAKSLGV  354



>ref|XP_002303671.1| RWP-RK domain-containing family protein [Populus trichocarpa]
 gb|EEE78650.1| RWP-RK domain-containing family protein [Populus trichocarpa]
Length=953

 Score =   359 bits (921),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 208/494 (42%), Positives = 282/494 (57%), Gaps = 44/494 (9%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ S ++ VL Q+W PV   G+ VL T  QPF LD     L  YR +S
Sbjct  139   IKERMTQALRYFKE-STEQHVLAQVWAPVKNGGQHVLTTSGQPFVLDPHSNGLHQYRMVS  197

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ +S   +GLPGRVF  K PEWTP+VQ +  +EY R+ HA RY+VRGT A+PV
Sbjct  198   LMYMFSVDGESDRELGLPGRVFRQKSPEWTPNVQYYSSKEYSRLDHALRYNVRGTLALPV  257

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++ +QK+ Y  E+D VCKALE V+L+ S+I +  +++ C+   Q  
Sbjct  258   FEPSGQSCVGVLELIMNSQKINYAPEVDKVCKALEAVNLKSSEILDPPSIQICNEGRQNA  317

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHS------DENLLRCVSTVDS  1333
             L EILE+L   C THKLPLAQTWVPC+ +       GL+ S      + N   C+ST D 
Sbjct  318   LSEILEILTMVCETHKLPLAQTWVPCIHRSVLTYGGGLKKSCTSFDGNCNGQVCMSTTDV  377

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D R+ GF EAC EHHL KG GV GRAF++   CF  DIT F KTEYPL HYAR+F
Sbjct  378   AFYVVDARMWGFREACLEHHLQKGQGVAGRAFLSQNSCFCPDITQFCKTEYPLVHYARMF  437

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  AI LRS+ TG  D++LEFFLP       E K  L S+   ++   Q        
Sbjct  438   GLTSCFAIFLRSSYTGDDDYILEFFLPPSITDSHEQKTFLGSILATMKQDFQ--------  489

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIG-PCEEGLSWTSSPMLVQESCMSSSA  1870
                      S KVA   D+     V  ++  ++    C +    T SP            
Sbjct  490   ---------SLKVASGMDLEEEGFVEMIEATTNGRLECIQIPQPTKSP-----------P  529

Query  1871  FQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQY  2050
               N  P+E   +++    +      D     G     ++  ++KR KAEKTI+L++LQQY
Sbjct  530   GDNMLPNEGHIEQIDSEKNKLMFDLDVIKNGG---RTKKPTERKRGKAEKTISLEVLQQY  586

Query  2051  FAGSLKDAAKSLGV  2092
             FAGSLKDAAK LGV
Sbjct  587   FAGSLKDAAKRLGV  600



>emb|CDP12190.1| unnamed protein product [Coffea canephora]
Length=994

 Score =   360 bits (923),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 212/512 (41%), Positives = 296/512 (58%), Gaps = 48/512 (9%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P    ++ +++ QAL ++KD S ++ VL Q+WVPV   GR VL T  QPF LD K   L 
Sbjct  135   PDGYCTIKEKMTQALRFLKD-STEQHVLAQVWVPVKNGGRCVLTTSGQPFVLDPKTNGLY  193

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S  Y F V+ ++  ++GLPGRVF  K+PEWTP+VQ +  +EY R+ HA  Y+VRG
Sbjct  194   QYRMVSAMYMFSVDGETDGDLGLPGRVFRQKLPEWTPNVQYYSSKEYTRLNHALHYNVRG  253

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH  1168
             T A+PVF+   + C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S++ +   ++ C+
Sbjct  254   TLALPVFEPSGQNCVGVLELIMTSQKINYAPEVDKVCKALEAVNLKSSEVLDQPMIQVCN  313

Query  1169  -SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--C  1315
                Q  L EIL +L   C THKLPLAQTWVPC    V     GLR +    D + +   C
Sbjct  314   EDRQNALTEILGILTEICETHKLPLAQTWVPCRHRSVLANGGGLRKTCSSFDGSCMGQIC  373

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST D A Y+ D  I GF EAC+EHHL KG GV GRAF  +  CF  D+T F KTEYPL 
Sbjct  374   MSTTDVAFYVVDAHIWGFREACAEHHLQKGQGVAGRAFAFHNLCFCEDVTQFCKTEYPLV  433

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             HYAR+F L +  AI LRST TG  D+VLEFFLP   +     + +L SL + ++      
Sbjct  434   HYARMFGLSSCFAICLRSTHTGDDDYVLEFFLPPSIRDHTGQRALLDSLLVTMKQHLG--  491

Query  1676  rvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQES-  1852
                            S ++A  ++++  ++  +++   S+     G    S P L Q S 
Sbjct  492   ---------------SLRIASGNELQ--QDWRSVEIVKSL----VGEKLDSGPKLFQASK  530

Query  1853  -CMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSA-----------QNVRRAGD  1996
                +S+A    +  +L    L     G   + D   G G+A           ++  +  +
Sbjct  531   PATTSTALTVPEMLQLDSIELQRPTLGDNCANDVAHGSGAARVQNAVSIAENKDTGKKTE  590

Query  1997  KKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             +KR KAEKTI+L +LQQYFAGSLKDAAKSLGV
Sbjct  591   RKRGKAEKTISLDVLQQYFAGSLKDAAKSLGV  622



>ref|XP_010912370.1| PREDICTED: LOW QUALITY PROTEIN: protein NLP3-like [Elaeis guineensis]
Length=974

 Score =   358 bits (919),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 209/509 (41%), Positives = 298/509 (59%), Gaps = 50/509 (10%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL + K+ S D+ VL+Q+W P+ +  R  L T  QPF LD +  RL  YR +S
Sbjct  149   IKERMTQALRHFKE-STDQHVLVQVWAPMKKGDRCFLTTSGQPFVLDPQSTRLLQYRTVS  207

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ED + ++GLPGRV+  ++PEWTP+VQ +  +EYPR+ HA  Y+V+G+ A+PV
Sbjct  208   VMYIFSVDEDGEGSLGLPGRVYRHRLPEWTPNVQYYSSKEYPRLAHALNYNVQGSLALPV  267

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+V+T  K+ Y  E+D VCKAL+ V+L+ S+I +  N++  +   Q  
Sbjct  268   FEPSGQSCVGVVELVMTLPKINYAREVDKVCKALQAVNLKSSEILDHPNIQISNEGRQEA  327

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILEVL   C   KLPLAQTWVPC    +     GL+      D + +   C+ST D 
Sbjct  328   LAEILEVLTVVCEAQKLPLAQTWVPCKRRTILAHGGGLKKICSSFDGSCMGQVCMSTTDV  387

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC EHHL  G GV GRAF   +PCF+ D+T FSK+EYPL HYAR+F
Sbjct  388   AFYVIDAHMWGFREACVEHHLQIGQGVAGRAFALRKPCFAEDVTKFSKSEYPLVHYARMF  447

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L   +AI L+ST +G  D++LEFFLP DCK   E + +L S+S +++   +        
Sbjct  448   GLVGCLAICLQSTHSGDDDYILEFFLPHDCKYLIEQQALLDSISALMKQCFR--------  499

Query  1694  eleeettSPSSKVAKHSDIRIHK----EVPNLKYNSSIG---------PCEEGLSWTSSP  1834
                      S KV   SD+ + K    E+ N+  N + G          C+  L   +SP
Sbjct  500   ---------SLKVV--SDLELQKGISFEIINMFANENHGFEPKHICNQICDSHL--YASP  546

Query  1835  MLVQESCMSSSAFQNEKPSELLYKRLPEFVS---GSGLSFDSTSGEGSAQNVRRAGDKKR  2005
                       S  +    S+   +  P   +    S + FDS     S +N   A +K+R
Sbjct  547   ETYTLEGYDDSQNEGNVTSDSRVQHFPTHANAEKASNIHFDSAGSLLSNRN-NGAPEKRR  605

Query  2006  MKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
              KAEK+I+L++LQQYF+GSLKDAAKSLGV
Sbjct  606   GKAEKSISLEVLQQYFSGSLKDAAKSLGV  634



>ref|XP_009803235.1| PREDICTED: protein NLP7-like isoform X2 [Nicotiana sylvestris]
Length=1010

 Score =   358 bits (920),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 213/519 (41%), Positives = 304/519 (59%), Gaps = 47/519 (9%)
 Frame = +2

Query  602   ELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQ  781
             EL+ R +  P  +  + +R+ QAL Y K+ + ++ VL Q+W PV   GR VL T  QPF 
Sbjct  137   ELAPRDY--PNGSCIIKERMTQALRYFKESTGER-VLAQVWAPVKDAGRYVLTTSGQPFV  193

Query  782   LDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVG  961
             LD  C  L  YR +S+ Y F  + ++   +GLPGRVF  K+PEWTP+VQ +  +E+PR+ 
Sbjct  194   LDPDCNGLHQYRTVSLMYMFAADGETGGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRLD  253

Query  962   HAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKIS  1141
             HA  Y+VRGT A+PVF+   ++CLGV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I 
Sbjct  254   HALHYNVRGTLALPVFEPSGQSCLGVLELIMTSQKINYAAEVDKVCKALETVNLKSSEIL  313

Query  1142  NVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----  1294
             +  N + C+   Q  L EILE+L + C T++LPLAQTWVPC    V     GL+ S    
Sbjct  314   DHPNTQICNEGRQNALVEILEILTAVCETYQLPLAQTWVPCRHRSVLADGGGLKKSCSSF  373

Query  1295  DENLLR--CVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITS  1468
             D + +   C+ST D A Y+ D  + GF EAC+EHHL KG GV GRA+ + + CF  DIT 
Sbjct  374   DGSCMGQICMSTTDVAFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQKSCFCEDITQ  433

Query  1469  FSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSI  1648
             F KTEYPL HYAR+F L +  AI LRS+ TG+ D++LEFFLP +     + + +L SL +
Sbjct  434   FCKTEYPLVHYARLFGLTSCFAICLRSSHTGNDDYILEFFLPPNSGDYSDQQALLNSLLL  493

Query  1649  IIQNVCQtlrvvteqeleeettSPSSKVAKH--SDIRIHKEVPNLKYNSSIGPCEEGLSW  1822
              ++   ++L +             S +  +H  S + I K     K ++      +  S 
Sbjct  494   TMKQHFRSLSIA------------SGEELEHDWSSVEIIKASMEEKIDA------KPESV  535

Query  1823  TSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQN--------  1978
              +   L Q + + +     +   E  +    +   G+G    S SG G A N        
Sbjct  536   PAPKSLPQPTRLPNGRTHLDPLGEQQFSVESDVAKGAG----SKSGTGEAPNHISPSDNK  591

Query  1979  -VRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                +  ++KR KAEKTI+L++LQQYFAGSLKDAAKSLGV
Sbjct  592   PTGKKSERKRGKAEKTISLEVLQQYFAGSLKDAAKSLGV  630



>ref|XP_001770664.1| predicted protein [Physcomitrella patens]
 gb|EDQ64488.1| predicted protein [Physcomitrella patens]
Length=799

 Score =   353 bits (906),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 216/506 (43%), Positives = 295/506 (58%), Gaps = 44/506 (9%)
 Frame = +2

Query  644   SVMDRLIQALGYIKDFSRDKDVLIQIWVPV-NRDGRRVLVTGDQPFQLDLKCPRLAHYRD  820
             S+ DR++QAL  I       DVL Q+W+PV   D + VL T +QPF L+ K   +  YR 
Sbjct  8     SLKDRMMQALRLIGRSC--VDVLAQVWMPVRTTDNQTVLSTREQPFVLERKTDHMWTYRS  65

Query  821   ISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAV  1000
             IS NY F V   +    GLPGRV+L +VPEWTP+VQ +   EY RV HA   DV+GT AV
Sbjct  66    ISENYVFAV---TGGFPGLPGRVYLQQVPEWTPNVQFYSDHEYLRVKHAMACDVKGTLAV  122

Query  1001  PVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVK-TCHSYQ  1177
             PVF+ GSR CL VIE+V+  +KV+Y  E+D +C+AL+ V+L  S    +  ++      +
Sbjct  123   PVFEAGSRNCLAVIELVMKAEKVQYAPEIDIICRALQAVNLSCSDGMELPALEFRTQGRR  182

Query  1178  VVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLR---------------  1312
             V L EI EVL + C TH LPLAQTWVP      E   ++ ++ +                
Sbjct  183   VALAEISEVLTAVCETHNLPLAQTWVPGSHHSLEKPSNNKKSRIESGGNSKSSGGSYSSS  242

Query  1313  --CVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEY  1486
               C+ T D   Y+ D ++ GF +AC EH L KG GV G+AF +NQP F +D+ ++SK +Y
Sbjct  243   RVCLRTGDGPHYVKDSKMWGFRQACLEHFLEKGQGVPGKAFASNQPAFESDVKNYSKIKY  302

Query  1487  PLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVC  1666
             PL HYA++F L AAVAIRLRS  TG+ DFVLEFFLP +C S  + + ML SLSI +Q VC
Sbjct  303   PLGHYAQLFGLTAAVAIRLRSIHTGTDDFVLEFFLPVNCTSSNDQQVMLNSLSITMQRVC  362

Query  1667  QtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQ  1846
             ++LR VT++E  +E  + +++    ++  + K +  L+   S G                
Sbjct  363   RSLRTVTDKEFADEVKAATAEEKADAESTLSKAMDPLEDQGSGGA---------------  407

Query  1847  ESCMSSSAFQNEKPSELLYKRL---PEFVSGSGLS-FDSTSGEGSAQNVRRAGDKKRMKA  2014
              S M SS  +N    + L ++L   P+  S S L    S + + +A N  R  DK+R   
Sbjct  408   -SAMGSSFSENATEGDHLQEKLAQDPQVASASSLQRSQSVASKNNAANPNRKLDKRRGTT  466

Query  2015  EKTITLQILQQYFAGSLKDAAKSLGV  2092
             EKTI L +LQQYFAGSLKDAAKS+GV
Sbjct  467   EKTIGLDVLQQYFAGSLKDAAKSIGV  492



>ref|XP_009605047.1| PREDICTED: protein NLP7 [Nicotiana tomentosiformis]
Length=1014

 Score =   358 bits (919),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 210/506 (42%), Positives = 297/506 (59%), Gaps = 49/506 (10%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y+K+ + ++ VL Q+W PV   GR +L T  QPF LD  C  L  YR +S
Sbjct  160   IKERMTQALRYLKESTGER-VLAQVWAPVKNGGRYMLTTSGQPFVLDPDCNGLHQYRMVS  218

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ ++   +GLPGRV+  K+PEWTP+VQ +  +E+PR+ HA  Y+VRGT A+PV
Sbjct  219   LMYMFAVDGETDGVLGLPGRVYRKKLPEWTPNVQYYSSKEFPRLNHALHYNVRGTLALPV  278

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I + +N + C+   Q  
Sbjct  279   FEPSGQSCVGVLEIIMTSQKINYAPEVDRVCKALEAVNLKSSEILDHQNTQICNEGRQNA  338

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILE+L + C T+KLPLAQTWVPC    V     GL+ S    D + +   C+ST D 
Sbjct  339   LVEILEILTAVCETYKLPLAQTWVPCRHRSVLADGGGLKKSCSSFDGSCMGQVCMSTTDV  398

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             + Y+ D  + GF EAC+EHHL KG GV GRA+ + + CF  DI  F KTEYPL HYAR+F
Sbjct  399   SFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQKSCFCEDIRLFCKTEYPLVHYARLF  458

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  AI LRST TG+ D++LEFFLP +     +   +L SL + ++   +        
Sbjct  459   GLSSCFAICLRSTYTGNDDYILEFFLPPNDGDYNDQLALLNSLLLTMKQHFR--------  510

Query  1694  eleeettSPSSKVAKHSDIRIHK----EVPNLKYNSSIGPCEEGLSWTSSP----MLVQE  1849
                      S +VA   ++  H     EV        +G   E +  T SP     +V  
Sbjct  511   ---------SLRVASGEELE-HDWGSVEVIKASMEDKLGSRLESVPTTKSPPQPASVVNG  560

Query  1850  SCMSSSAFQNEKPSELLYKRLPEFVSGSG-----LSFDSTSGEGSAQNVRRAGDKKRMKA  2014
                     + + P EL   ++ E V+G+       SF    G G      +  ++KR KA
Sbjct  561   RVPPDLMEEQQAPVELNVAKVAEGVNGTAEAHNHASFSENKGTG------KKSERKRGKA  614

Query  2015  EKTITLQILQQYFAGSLKDAAKSLGV  2092
             EKTI+L++LQQYFAGSLKDAAKSLGV
Sbjct  615   EKTISLEVLQQYFAGSLKDAAKSLGV  640



>ref|XP_009599821.1| PREDICTED: protein NLP6-like isoform X2 [Nicotiana tomentosiformis]
Length=1007

 Score =   357 bits (917),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 211/507 (42%), Positives = 296/507 (58%), Gaps = 39/507 (8%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P  +  + +R+ QAL Y K+ + ++ VL Q+W PV   GR VL T  QPF LD  C  L 
Sbjct  141   PNGSCIIKERMTQALRYFKESTGER-VLAQVWAPVKDAGRYVLTTSGQPFVLDPDCNGLH  199

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S+ Y F  + ++   +GLPGRVF  K+PEWTP+VQ +  +E+PR+ HA  Y+VRG
Sbjct  200   QYRTVSLMYMFAADGETGGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRLDHALHYNVRG  259

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH  1168
             T A+PVF+   ++CLGV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I +  N + C+
Sbjct  260   TLALPVFEPSGQSCLGVLELIMTSQKINYAAEVDKVCKALETVNLKSSEILDHPNTQICN  319

Query  1169  -SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--C  1315
                Q  L EILE+L + C T++LPLAQTWVPC    V     GL+ S    D + +   C
Sbjct  320   EGRQNALVEILEILTAVCETYQLPLAQTWVPCRHRSVLADGGGLKKSCSSFDGSCMGQIC  379

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST D A Y+ D  + GF EAC+EHHL KG GV GRA+ + + CF  DIT F KTEYPL 
Sbjct  380   MSTTDVAFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQKSCFCEDITQFCKTEYPLV  439

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             HYAR+F L +  AI LRS+ TG+ D++LEFFLP +     + + +L SL + ++   ++L
Sbjct  440   HYARLFGLTSCFAICLRSSHTGNDDYILEFFLPPNSGDYSDQQALLNSLLLTMKQHFRSL  499

Query  1676  rvvte-------qeleeettSPSSKV-AKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSS  1831
              + +          +E    S   K+ AK   +   K +P         P      WT  
Sbjct  500   SIASGGELEHDWSSVEIIKASIEEKIDAKPESVSAPKSLPQ--------PTRLPNGWTHL  551

Query  1832  PMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMK  2011
               L ++     S       S+      P  VS S    +  +G+ S        ++KR K
Sbjct  552   DPLGEQQFSVESDVAKGAGSKCGTGEAPNHVSPSD---NKPTGKKS--------ERKRGK  600

Query  2012  AEKTITLQILQQYFAGSLKDAAKSLGV  2092
             AEKTI+L++LQQYFAGSLKDAAKSLGV
Sbjct  601   AEKTISLEVLQQYFAGSLKDAAKSLGV  627



>ref|XP_011022461.1| PREDICTED: protein NLP7-like isoform X2 [Populus euphratica]
Length=872

 Score =   354 bits (909),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 212/507 (42%), Positives = 286/507 (56%), Gaps = 41/507 (8%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P     + +R+ QAL Y K+ S ++ VL Q+W PV   G+ VL T  QPF LD     L 
Sbjct  6     PDGYCMIKERMTQALRYFKE-STEQHVLAQVWAPVKNGGQHVLTTSGQPFVLDPHSNGLH  64

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S+ Y F V+ +S   +GLPGRVF  K PEWTP+VQ +  +EY R+ HA RY+VRG
Sbjct  65    QYRMVSLMYMFSVDGESDRELGLPGRVFKQKSPEWTPNVQYYSSKEYSRLDHALRYNVRG  124

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH  1168
             T A+PVF+   ++C+GV+E+V+ +QK+ Y  E+D VCKALE V+L+ S+I +  +++ C+
Sbjct  125   TLALPVFEPSGQSCVGVLELVMNSQKINYAPEVDKVCKALEAVNLKSSEILDPPSIQICN  184

Query  1169  -SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHS------DENLLRC  1315
                Q  L EILE+L   C THKLPLAQTWVPC+ +       GL+ S      + N   C
Sbjct  185   EGRQNALSEILEILTMVCETHKLPLAQTWVPCMHRSVLTFGGGLKKSCTSFDGNCNGQVC  244

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST D A Y+ D  + GF EAC EHHL KG GV GRAF++   CF  DIT F KTEYPL 
Sbjct  245   MSTTDVAFYVVDAHMWGFREACLEHHLQKGQGVAGRAFLSQNSCFCPDITQFCKTEYPLV  304

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             HYAR+F L +  AI LRS+ TG  D++LEFFLP       E K  L S+   ++   Q  
Sbjct  305   HYARMFGLTSCFAIFLRSSYTGDDDYILEFFLPPSITDSHEQKTFLGSILATMKQDFQ--  362

Query  1676  rvvteqeleeettSPSSKVAKHSDIRIHK--EVPNLKYNSSIGPCEEGLSWTSSP----M  1837
                            S KVA   D+      E+     N  +  C +    T SP    +
Sbjct  363   ---------------SLKVASGMDLEEEGFVEMIEAATNGRL-ECIQIPQPTKSPPGDNI  406

Query  1838  LVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFD--STSGEGSAQNVRRAGDKKRMK  2011
             L  E  +      N + ++L+         GS +  D   T      +  ++  ++KR K
Sbjct  407   LPNEGHIEQI---NSEKNKLMLDLDVIKNGGSAVQADRRQTPSHPEKKETKKPTERKRGK  463

Query  2012  AEKTITLQILQQYFAGSLKDAAKSLGV  2092
             AEKTI+L +LQQYFAGSLK+AAK LGV
Sbjct  464   AEKTISLGVLQQYFAGSLKEAAKRLGV  490



>emb|CDY17536.1| BnaC03g65270D [Brassica napus]
Length=618

 Score =   347 bits (889),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 225/610 (37%), Positives = 330/610 (54%), Gaps = 87/610 (14%)
 Frame = +2

Query  338   EGCWLETTDGSEF----FQHSPFNANALFEPSYVLPDLEPNNGELMKESEVERKKSSLPE  505
             +GCWLETTDG        Q +P + N           L  NN   +   +     S  P+
Sbjct  37    DGCWLETTDGKSLKRTTGQAAPSSTN-----------LNDNNNSFLYGYQFAENPS--PD  83

Query  506   NLSASQFHTE---------RVQCFGQNGSNAVCSSGLAESSELSRRWWIGPMAT----TS  646
             ++S  +   +         +++       N +     A  S    R WI P  +    +S
Sbjct  84    HISNKETLRKFPSITSGLLKIEDLTNQPMNQLPFEQSAAMSSSQGRLWIAPRTSQGPSSS  143

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             V DRL                               L T + P   + K   L  YRD+S
Sbjct  144   VKDRL-----------------------------NFLTTLEHPHFFNPKYTSLKRYRDVS  174

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             ++Y F  +E S+E+VGLPGRVFLGK+PEWTPDV+ F+ EEYPR+  AQ+ DVRG+ A+PV
Sbjct  175   VSYNFLADEGSKESVGLPGRVFLGKLPEWTPDVRFFRSEEYPRIKEAQKCDVRGSLALPV  234

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSK--ISNVRNVKTCHS--Y  1174
             F++ S TCLGV+E+V TTQK+ Y+ EL+++CKALE V+LR S    S  +  +  ++  Y
Sbjct  235   FERSSGTCLGVLEIVTTTQKMNYKPELENICKALEAVNLRSSANLKSPSKEFQKVYNQFY  294

Query  1175  QVVLPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADP  1354
               +LPE+ + L+  C ++ LPLA TW  C +QGK+G RHSDEN+ +CVST++SAC++ D 
Sbjct  295   SAILPEVTDFLRWVCRSYDLPLALTWALCARQGKDGSRHSDENISQCVSTINSACFVLDE  354

Query  1355  RIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAA-V  1531
             +   F EACSEHHLL+G G+VG+AF   +  F  ++T+FSKT YPL+H+A I  L AA +
Sbjct  355   QSHHFLEACSEHHLLQGEGIVGKAFKATKLFFVPEVTTFSKTNYPLAHHANISGLHAAFL  414

Query  1532  AIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeet  1711
             A+ L++   GS +FVLEFF P+ C   E  + +L SLS+ +Q   ++L +V ++ELE E 
Sbjct  415   AVPLKNKFNGSVEFVLEFFFPKSCLDTEAQQEILKSLSVTLQQDFRSLNLVIDKELELEV  474

Query  1712  tSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCE----EGLSWTSSPMLVQESCMSSS---A  1870
               P  +    S+    K + + +   ++ P E    E  SW S  +   E     S    
Sbjct  475   VFPVREELLFSE----KPLIDAETGENLKPLEEISQEDSSWISHMIKANEKGKGVSLSWE  530

Query  1871  FQNEKPSELLYKRLPEFVSGSG-----LSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQ  2035
             +Q ++P E       EF+  SG     L  D+     ++ +  R G+K+R K EKT  L+
Sbjct  531   YQKKEPKE-------EFMLTSGWDNSNLLSDAEQFHKASNSGLRPGEKRRAKTEKTTGLE  583

Query  2036  ILQQYFAGSL  2065
             +L+QYFA SL
Sbjct  584   VLRQYFAESL  593



>ref|XP_002299449.1| RWP-RK domain-containing family protein [Populus trichocarpa]
 gb|EEE84254.1| RWP-RK domain-containing family protein [Populus trichocarpa]
Length=915

 Score =   353 bits (907),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 205/493 (42%), Positives = 283/493 (57%), Gaps = 36/493 (7%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ +AL + K+ S ++ +L Q+W PV   GR  L T  QPF +D     L  YR +S
Sbjct  96    IKERMTRALRHFKE-STEQHILAQVWAPVKNGGRYALTTSGQPFVIDPHSNGLHQYRMVS  154

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y+F V+ +S   +GLPGRVF  K+PEWTP+VQ +  +EY R+ HA  Y+VRGT A+PV
Sbjct  155   LMYKFSVDGESDGELGLPGRVFRQKLPEWTPNVQYYSSKEYSRLDHALHYNVRGTVALPV  214

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++T+QK+ Y  E+D VCKALE VDL+ S+I +  + + C+   Q  
Sbjct  215   FEPSGQSCVGVVELIMTSQKINYAPEVDKVCKALEAVDLKSSEILDPPSTQICNEGRQNA  274

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHS------DENLLRCVSTVDS  1333
             L EILE+L   C THKLPLAQTWVPC+ +       GL+ S        N   C+ST D 
Sbjct  275   LAEILEILTMVCETHKLPLAQTWVPCMHRSVLAYGGGLKKSCTSFDGSCNGQVCMSTTDV  334

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC EHHL KG GV GRAF ++  CF  DIT F KTEYPL HYAR+F
Sbjct  335   AFYVVDAHMWGFREACLEHHLQKGQGVAGRAFFSHNLCFCPDITQFCKTEYPLVHYARMF  394

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  AI LRS+ TG  D++LEFFLP       E K +L S+  I++   Q        
Sbjct  395   GLTSCFAICLRSSYTGDDDYILEFFLPPSFTDSREWKTLLGSILAIMKQDFQ--------  446

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
                      S +VA   D+   +    +   S+ G  +  L     P   + S    +A 
Sbjct  447   ---------SLQVASGMDLEEEEGFVEMIQVSTNGRLDLRLECIQIPQSTK-SPPDDNAL  496

Query  1874  QNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYF  2053
              N  P   +Y    + +    L  D     G  +  ++  ++KR KAEK I+L++LQQYF
Sbjct  497   LN-GPIVQIYPEKKQLM----LDLDVIK-NGGKKETKKPKERKRGKAEKMISLEVLQQYF  550

Query  2054  AGSLKDAAKSLGV  2092
              GSLKDAAKSLGV
Sbjct  551   TGSLKDAAKSLGV  563



>ref|XP_011022460.1| PREDICTED: protein NLP7-like isoform X1 [Populus euphratica]
Length=975

 Score =   355 bits (910),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 211/501 (42%), Positives = 285/501 (57%), Gaps = 41/501 (8%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ S ++ VL Q+W PV   G+ VL T  QPF LD     L  YR +S
Sbjct  115   IKERMTQALRYFKE-STEQHVLAQVWAPVKNGGQHVLTTSGQPFVLDPHSNGLHQYRMVS  173

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ +S   +GLPGRVF  K PEWTP+VQ +  +EY R+ HA RY+VRGT A+PV
Sbjct  174   LMYMFSVDGESDRELGLPGRVFKQKSPEWTPNVQYYSSKEYSRLDHALRYNVRGTLALPV  233

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+V+ +QK+ Y  E+D VCKALE V+L+ S+I +  +++ C+   Q  
Sbjct  234   FEPSGQSCVGVLELVMNSQKINYAPEVDKVCKALEAVNLKSSEILDPPSIQICNEGRQNA  293

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHS------DENLLRCVSTVDS  1333
             L EILE+L   C THKLPLAQTWVPC+ +       GL+ S      + N   C+ST D 
Sbjct  294   LSEILEILTMVCETHKLPLAQTWVPCMHRSVLTFGGGLKKSCTSFDGNCNGQVCMSTTDV  353

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC EHHL KG GV GRAF++   CF  DIT F KTEYPL HYAR+F
Sbjct  354   AFYVVDAHMWGFREACLEHHLQKGQGVAGRAFLSQNSCFCPDITQFCKTEYPLVHYARMF  413

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  AI LRS+ TG  D++LEFFLP       E K  L S+   ++   Q        
Sbjct  414   GLTSCFAIFLRSSYTGDDDYILEFFLPPSITDSHEQKTFLGSILATMKQDFQ--------  465

Query  1694  eleeettSPSSKVAKHSDIRIHK--EVPNLKYNSSIGPCEEGLSWTSSP----MLVQESC  1855
                      S KVA   D+      E+     N  +  C +    T SP    +L  E  
Sbjct  466   ---------SLKVASGMDLEEEGFVEMIEAATNGRL-ECIQIPQPTKSPPGDNILPNEGH  515

Query  1856  MSSSAFQNEKPSELLYKRLPEFVSGSGLSFD--STSGEGSAQNVRRAGDKKRMKAEKTIT  2029
             +      N + ++L+         GS +  D   T      +  ++  ++KR KAEKTI+
Sbjct  516   IEQI---NSEKNKLMLDLDVIKNGGSAVQADRRQTPSHPEKKETKKPTERKRGKAEKTIS  572

Query  2030  LQILQQYFAGSLKDAAKSLGV  2092
             L +LQQYFAGSLK+AAK LGV
Sbjct  573   LGVLQQYFAGSLKEAAKRLGV  593



>ref|XP_009773779.1| PREDICTED: protein NLP7 [Nicotiana sylvestris]
Length=1021

 Score =   355 bits (910),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 208/493 (42%), Positives = 305/493 (62%), Gaps = 23/493 (5%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y+K+ + ++ VL Q+W PV    R +L T  QPF LD  C  L  YR +S
Sbjct  167   IKERMTQALRYLKESTGER-VLAQVWAPVKNGSRYMLTTSGQPFVLDPDCNGLHQYRMVS  225

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ ++   +GLPGRV+  K+PEWTP+VQ +  +E+PR+ HA  Y+VRGT A+PV
Sbjct  226   LMYMFAVDGETDGVLGLPGRVYRKKLPEWTPNVQYYSSKEFPRLNHALHYNVRGTLALPV  285

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I +  N + C+   Q  
Sbjct  286   FEPSGQSCVGVLEIIMTSQKINYAPEVDRVCKALEAVNLKSSEILDHPNTQICNEGRQNA  345

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILE+L + C T+KLPLAQTWVPC    V     GL+ S    D + +   C+ST D 
Sbjct  346   LVEILEILTAVCETYKLPLAQTWVPCRHRSVLADGGGLKKSCSSFDGSCMGQVCMSTTDV  405

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             + Y+ D  + GF EAC+EHHL KG GV GRA+ + + CF  DI  F KTEYPL HYAR+F
Sbjct  406   SFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQKSCFCEDIRLFCKTEYPLVHYARLF  465

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  AI LRST TG+ D++LEFFLP +     +   +L SL + ++   ++LRV + +
Sbjct  466   GLSSCFAICLRSTYTGNDDYILEFFLPPNDGDYNDQLALLNSLLLTMKQHFRSLRVASGE  525

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
             ELE +  S     A   D ++   + ++    S+      ++    P L++E        
Sbjct  526   ELEHDWGSVEVIKASTED-KLGSRLESVPTTKSLPQPASVVNGRVPPDLMEE--------  576

Query  1874  QNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYF  2053
               E P EL   ++ E V+G+  + +  S   + + + +  ++KR KAEKTI+L++LQQYF
Sbjct  577   -QESPVELNVAKVAEGVNGTAEAHNHASFSEN-KGIGKKSERKRGKAEKTISLEVLQQYF  634

Query  2054  AGSLKDAAKSLGV  2092
             AGSLKDAAKSLGV
Sbjct  635   AGSLKDAAKSLGV  647



>ref|XP_006476342.1| PREDICTED: protein NLP7-like [Citrus sinensis]
Length=998

 Score =   354 bits (908),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 216/517 (42%), Positives = 290/517 (56%), Gaps = 53/517 (10%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P     + +R+ QAL Y KD S ++ VL Q+WVPV   GR VL T  QPF LD     L 
Sbjct  124   PDGYCMIKERITQALRYFKD-STEQHVLAQVWVPVKVGGRYVLTTSGQPFVLDPHSNGLH  182

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S+ Y F V+ +S   +GLPGRVF  K+PEWTP+VQ +  +EY R+ HA  ++VRG
Sbjct  183   QYRMVSLMYMFSVDGESDGELGLPGRVFWQKLPEWTPNVQYYSSKEYSRLDHALHHNVRG  242

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH  1168
             T A+PVF+   ++C+ VIE+++T+QK+ Y  E+D VCKALE V+L+ S+I +  + + C+
Sbjct  243   TMALPVFEPSGQSCVAVIELIMTSQKINYAPEVDKVCKALEAVNLKSSEILDYPSTQICN  302

Query  1169  -SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHSDENL------LRC  1315
                Q  L EILE+L   C THKLPLAQTWVPC    V     GL+ S  ++        C
Sbjct  303   EGRQNALAEILEILSVVCETHKLPLAQTWVPCRHRSVLAYGGGLKKSCSSIDGSCMGQVC  362

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST D A Y+ D  + GF EAC EHHL KG GV GRAF +   CF  DIT F KTEYPL 
Sbjct  363   MSTTDVAFYVVDGHMWGFREACVEHHLQKGQGVAGRAFFSLSSCFCKDITQFCKTEYPLV  422

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             HYAR+F L +  AI LRST TG  D++LEFFLP       E + +L S+   ++   Q  
Sbjct  423   HYARMFGLTSCFAICLRSTYTGDDDYILEFFLPPAITDSYEQQTLLGSILATMKQHFQ--  480

Query  1676  rvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESC  1855
                            S KVA  S I +  +   ++        ++ L+     + + +S 
Sbjct  481   ---------------SLKVA--SGIDLEDDEGTIEIIEGEATADKKLNLRMESIRIPQSV  523

Query  1856  MSSS---AFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNV---------------  1981
              S     A  N    EL    +PE       +FD  +  G+A NV               
Sbjct  524   RSPPQPHALPNG--GELGQLDIPE--QQLMENFDYMNSRGNAVNVGGNDNPVSLLENKNT  579

Query  1982  RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R+  ++KR K EK+I+L++LQQYFAGSLKDAAKSLGV
Sbjct  580   RKLSERKRGKTEKSISLEVLQQYFAGSLKDAAKSLGV  616



>gb|KDO76615.1| hypothetical protein CISIN_1g0021441mg, partial [Citrus sinensis]
Length=876

 Score =   351 bits (900),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 215/517 (42%), Positives = 289/517 (56%), Gaps = 53/517 (10%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P     + +R+ QAL Y KD S ++ VL Q+WVPV   GR VL T  QPF LD     L 
Sbjct  2     PDGYCMIKERITQALRYFKD-STEQHVLAQVWVPVKVGGRYVLTTSGQPFVLDPHSNGLH  60

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S+ Y F V+ +S   +GLPGRVF  K+PEWTP+VQ +  +EY R+ HA  ++VRG
Sbjct  61    QYRMVSLMYMFSVDGESDGELGLPGRVFWQKLPEWTPNVQYYSSKEYSRLDHALHHNVRG  120

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH  1168
             T A+PVF+   ++C+ VIE+++T+QK+ Y  E+D VCKALE V+L+ S+I +  + + C+
Sbjct  121   TMALPVFEPSGQSCVAVIELIMTSQKINYAPEVDKVCKALEAVNLKSSEILDYPSTQICN  180

Query  1169  -SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHSDENL------LRC  1315
                Q  L EILE+L   C THKLPLAQTWVPC    V     GL+ S  ++        C
Sbjct  181   EGRQNALAEILEILSVVCETHKLPLAQTWVPCRHRSVLAYGGGLKKSCSSIDGSCMGQVC  240

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST D A Y+ D  + GF EAC EHHL K  GV GRAF +   CF  DIT F KTEYPL 
Sbjct  241   MSTTDVAFYVVDGHMWGFREACVEHHLQKDQGVAGRAFFSLSSCFCKDITQFCKTEYPLV  300

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             HYAR+F L +  AI LRST TG  D++LEFFLP       E + +L S+   ++   Q  
Sbjct  301   HYARMFGLTSCFAICLRSTYTGDDDYILEFFLPPAITDSYEQQTLLGSILATMKQHFQ--  358

Query  1676  rvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESC  1855
                            S KVA  S I +  +   ++        ++ L+     + + +S 
Sbjct  359   ---------------SLKVA--SGIDLEDDEGTIEIIEGEATADKKLNLRMESIRIPQSV  401

Query  1856  MS---SSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNV---------------  1981
              S     A  N    EL    +PE       +FD  +  G+A NV               
Sbjct  402   RSPPQPHALPNG--GELGQLDIPE--QQLMENFDYMNSRGNAVNVGGNDNPVSLLENKNT  457

Query  1982  RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R+  ++KR K EK+I+L++LQQYFAGSLKDAAKSLGV
Sbjct  458   RKLSERKRGKTEKSISLEVLQQYFAGSLKDAAKSLGV  494



>ref|XP_004244640.1| PREDICTED: protein NLP6-like isoform X1 [Solanum lycopersicum]
Length=1008

 Score =   353 bits (907),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 209/511 (41%), Positives = 307/511 (60%), Gaps = 38/511 (7%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P  +  + +R+ QAL Y+K+ S ++ VL Q+W PV   GR VL T  QPF LD +C  L 
Sbjct  132   PEGSCIIKERMTQALRYLKETSGER-VLAQVWAPVKEAGRSVLTTSGQPFVLDPECNGLH  190

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S+ Y F  + ++   +GLPGRVF  K+PEWTP+VQ +  +E+PR+ HA  Y+VRG
Sbjct  191   QYRTVSLMYMFAADGETDGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRLDHALNYNVRG  250

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT--  1162
             T A+PVF+   R+C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S I +  N +   
Sbjct  251   TLALPVFEPSGRSCVGVLELIMTSQKINYAAEVDKVCKALEAVNLKSSDILDHPNTQVYV  310

Query  1163  -------CH-SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----  1294
                    C+   Q  L +ILE+L + C T+KLPLAQTWVPC    V     GLR S    
Sbjct  311   MGYMNQICNEGRQNALVDILEILTAVCETYKLPLAQTWVPCRHRSVLADGGGLRKSCSSF  370

Query  1295  DENLLR--CVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITS  1468
             D + +   C+ST D A Y+ D  + GF +AC+EHHL +G GV GRA+ + + C+  DIT 
Sbjct  371   DGSCMGQICMSTTDVAFYVVDAHMWGFRDACAEHHLQRGQGVAGRAYASRKSCYCEDITQ  430

Query  1469  FSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSI  1648
             F KTEYPL HYAR+F L +  AI LRS+ T + D++LEFFLP +     +   +L SL +
Sbjct  431   FCKTEYPLVHYARMFGLTSCFAICLRSSHTANDDYILEFFLPPNSGDYSDQPALLNSLLL  490

Query  1649  IIQNVCQtlrvvteqeleeettSPS-SKVAKHSDIRIHKE-VPNLKYNSSIGPCEEGLSW  1822
              ++   ++L + + +ELE +  S    + +    I    E VP  K +  +     G  W
Sbjct  491   TMKQHFRSLSIASGEELEHDWGSVEIIQASMEEKIDAKPESVPTAKTSPQLTSLPNG--W  548

Query  1823  TS-SPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDK  1999
                 P+  Q+S + S+  +  + +           SG+G + ++ S   +  + +++ ++
Sbjct  549   VHLDPVGEQQSAVGSNVSKGARST-----------SGTGEAPNNVSNSDNKTSGKKS-ER  596

Query  2000  KRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             KR KAEKTI+L++LQQYFAGSLKDAAKSLGV
Sbjct  597   KRGKAEKTISLEVLQQYFAGSLKDAAKSLGV  627



>ref|XP_006343817.1| PREDICTED: protein NLP7-like isoform X1 [Solanum tuberosum]
Length=1053

 Score =   355 bits (910),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 290/496 (58%), Gaps = 29/496 (6%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ + ++ VL QIW PV   GR VL T  QPF LD  C  L  YR +S
Sbjct  199   IKERMTQALRYFKESTGER-VLAQIWAPVKNGGRYVLTTSGQPFVLDPDCNGLHQYRMVS  257

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ ++   +GLPGRV+  K+PEWTP+VQ +  +E+PR+ HA  Y+VRGT A+PV
Sbjct  258   LMYMFSVDGETDGVLGLPGRVYRKKLPEWTPNVQYYSSKEFPRLNHALDYNVRGTLALPV  317

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I +  N + C+   Q  
Sbjct  318   FEPSGQSCVGVLELIMTSQKINYAPEVDKVCKALEAVNLKSSEILDYPNHQICNEGRQNA  377

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILE+L + C T+KLPLAQTWVPC    V     G + S    D + +   C+ST D 
Sbjct  378   LVEILEILTAVCETYKLPLAQTWVPCRHRSVLADGGGFKKSCSSFDGSCMGQVCMSTTDV  437

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC+EHHL KG GV GRA+ + + CF  DI  F KTEYPL HYAR+F
Sbjct  438   AFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQKSCFCEDIGQFCKTEYPLVHYARLF  497

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFL-PRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvte  1690
              L + +AI LRST TG+ D++LEFFL P D    ++   + + L  + Q+          
Sbjct  498   GLSSCLAICLRSTHTGNDDYILEFFLPPNDGDYTDQLALLNSLLLTMKQHF---------  548

Query  1691  qeleeettSPSSKVAKHS--DIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSS  1864
                       S +  +H+   + I K     K  S         S   S  +        
Sbjct  549   ----RSLRVASGEELEHNWGSVEIIKASTEEKLGSRFDSVPTTKSLPQSASVANGRTHPD  604

Query  1865  SAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQ  2044
                + + P  L   +  E V+G+  + +  S   + Q  +++ ++KR KAEKTI+L++LQ
Sbjct  605   LMEEQQSPVALNVAKGAEGVNGTAEAHNHASVPENKQTGKKS-ERKRGKAEKTISLEVLQ  663

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYFAGSLKDAAKSLGV
Sbjct  664   QYFAGSLKDAAKSLGV  679



>ref|XP_004301816.1| PREDICTED: protein NLP7-like [Fragaria vesca subsp. vesca]
Length=951

 Score =   352 bits (904),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 211/528 (40%), Positives = 292/528 (55%), Gaps = 91/528 (17%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ +AL Y+K+ S D+ VL Q+W PV    R VL T  QPF LD     L  YR +S
Sbjct  119   IKERITRALRYLKE-SSDQHVLAQVWAPVWDGNRYVLTTSGQPFVLDPH-DGLHQYRMVS  176

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ ++   +GLPGRVF  K+PEWTP+VQ +  +EYPR+ HAQ Y+V+GT A+PV
Sbjct  177   LMYMFSVDGENDGVLGLPGRVFQQKLPEWTPNVQYYSIKEYPRLDHAQHYNVQGTLALPV  236

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISN-------VRNVKTC  1165
             F+   R+C+GVIE+++T+QK+ Y  E+D +CKALE V L+ S++ +       +RN    
Sbjct  237   FEPSGRSCIGVIELIMTSQKINYAPEVDKICKALEAVSLKSSEMLDHTSTQIQIRN----  292

Query  1166  HSYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHS----DENLLR--C  1315
                Q  L EILE+L   C THKLPLAQTWVPC+ +       G++ S    D + +   C
Sbjct  293   EGRQTALTEILEILTMVCETHKLPLAQTWVPCMHRNVLAYGGGMKKSCTSFDGSCMEQVC  352

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST D A YI D  + GF EAC EHHL KG GV GRAF++   CF  DI+ F KTEYPL 
Sbjct  353   MSTTDVAVYIVDAHMWGFREACVEHHLQKGQGVAGRAFLSRNACFCRDISQFRKTEYPLV  412

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             HYAR+F L ++ AI L+ST TG+ D++LEFFLP       E + +L S+  I++  CQ  
Sbjct  413   HYARMFRLTSSFAICLQSTHTGNDDYILEFFLPPSITDSSEQQTLLGSILAIVKGHCQ--  470

Query  1676  rvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESC  1855
                                             NLK  S IG  EEG+       +VQ S 
Sbjct  471   --------------------------------NLKVASGIGLAEEGIV-----EIVQASI  493

Query  1856  -------------------MSSSAFQNEKPSELLYKRLPEF-VSGSGLSFDSTSGEGSAQ  1975
                                +  S+  N +    L    P+  V  + ++ +  +     Q
Sbjct  494   NEGLDSRFECIQIPRSVEPLPGSSLPNREEIVHLDPAKPQLMVDINAINDERNAVHKGGQ  553

Query  1976  N---------VRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             N         +++  ++KR K EK+I+L++LQQYFAGSLKDAAKSLGV
Sbjct  554   NNISVPENKDMKKTSERKRGKTEKSISLEVLQQYFAGSLKDAAKSLGV  601



>ref|XP_009393072.1| PREDICTED: protein NLP3-like [Musa acuminata subsp. malaccensis]
Length=963

 Score =   352 bits (904),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 211/496 (43%), Positives = 297/496 (60%), Gaps = 26/496 (5%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ S D+  L+Q+W PV    R VL T  QPF LD +  +L  YR +S
Sbjct  125   IKERMTQALRYFKE-STDQQALVQVWAPVKNGSRCVLTTSGQPFILDPQSTKLLQYRTVS  183

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ED   ++GLPGRVF  ++PEWTP+VQ +  +EY R+ HA  ++V+GT A+PV
Sbjct  184   LMYIFSVDEDDDADMGLPGRVFTKRMPEWTPNVQYYSSKEYQRLNHALLHNVQGTLALPV  243

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCHS-YQVV  1183
             F+    +C+GV+E+V+T+QKV Y  E+D VCKALE V+L+ S+I +  NV   +   Q  
Sbjct  244   FEPSGHSCIGVVEIVMTSQKVNYAYEVDKVCKALEAVNLKSSEILDHPNVVIANDGRQAA  303

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHSDENL------LRCVSTVDS  1333
             L EILE+L   C   KLPLAQTWVPC    V     GL+    +         C+ST D 
Sbjct  304   LAEILEILTVVCEAEKLPLAQTWVPCRHRTVLAHGGGLKKICSSFDGSCAGQVCMSTTDV  363

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A YI D  + GF EAC EHHL KG GV GRAF   + CFS DIT + K++YPL HYAR+F
Sbjct  364   AFYIIDAHLWGFREACVEHHLQKGQGVAGRAFALRRACFSRDITEYCKSDYPLVHYARMF  423

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L   +AI L+S  +G  D++LEFFLP +CKS  E + +L S+S ++    Q+L+V+T  
Sbjct  424   DLAGCLAICLQSIHSGDDDYILEFFLPAECKSSAEQQSLLNSISALLIQCFQSLKVITGV  483

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
             E +E  +     +    +   ++ +P  K+ SS  PC++      + +   E     S  
Sbjct  484   EFQEGISLQLVDLVTDDN---YESIP--KHLSS--PCDDTHKSPETNIYEAED-NDDSRN  535

Query  1874  QNEKPSELLYKRLP--EFVSGSG-LSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQ  2044
             +    S+L  +++     V  +G +  DST+      N  R   K+R KAEK I+L++LQ
Sbjct  536   EGNATSDLDKQQVATDSNVKKNGKIPLDSTA---LTDNTSRTPGKRRGKAEKMISLEVLQ  592

Query  2045  QYFAGSLKDAAKSLGV  2092
             QYF+GSLKDAAKSLGV
Sbjct  593   QYFSGSLKDAAKSLGV  608



>ref|XP_006439289.1| hypothetical protein CICLE_v10018744mg [Citrus clementina]
 gb|ESR52529.1| hypothetical protein CICLE_v10018744mg [Citrus clementina]
Length=911

 Score =   351 bits (901),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 215/517 (42%), Positives = 289/517 (56%), Gaps = 53/517 (10%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P     + +R+ QAL Y KD S ++ VL Q+WVPV   GR VL T  QPF LD     L 
Sbjct  37    PDGYCMIKERITQALRYFKD-STEQHVLAQVWVPVKVGGRYVLTTSGQPFVLDPHSNGLH  95

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S+ Y F V+ +S   +GLPGRVF  K+PEWTP+VQ +  +EY R+ HA  ++VRG
Sbjct  96    QYRMVSLMYMFSVDGESDGELGLPGRVFWQKLPEWTPNVQYYSSKEYSRLDHALHHNVRG  155

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH  1168
             T A+PVF+   ++C+ VIE+++T+QK+ Y  E+D VCKALE V+L+ S+I +  + + C+
Sbjct  156   TMALPVFEPSGQSCVAVIELIMTSQKINYAPEVDKVCKALEAVNLKSSEILDYPSTQICN  215

Query  1169  -SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHSDENL------LRC  1315
                Q  L EILE+L   C THKLPLAQTWVPC    V     GL+ S  ++        C
Sbjct  216   EGRQNALAEILEILSVVCETHKLPLAQTWVPCRHRSVLAYGGGLKKSCSSIDGSCMGQVC  275

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST D A Y+ D  + GF EAC EHHL K  GV GRAF +   CF  DIT F KTEYPL 
Sbjct  276   MSTTDVAFYVVDGHMWGFREACVEHHLQKDQGVAGRAFFSLSSCFCKDITQFCKTEYPLV  335

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             HYAR+F L +  AI LRST TG  D++LEFFLP       E + +L S+   ++   Q  
Sbjct  336   HYARMFGLTSCFAICLRSTYTGDDDYILEFFLPPAITDSYEQQTLLGSILATMKQHFQ--  393

Query  1676  rvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESC  1855
                            S KVA  S I +  +   ++        ++ L+     + + +S 
Sbjct  394   ---------------SLKVA--SGIDLEDDEGTIEIIEGEATADKKLNLRMESIRIPQSV  436

Query  1856  MS---SSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNV---------------  1981
              S     A  N    EL    +PE       +FD  +  G+A NV               
Sbjct  437   RSPPQPHALPNG--GELGQLDIPEQQLME--NFDYMNSRGNAVNVGGNDNPVSLLENKNT  492

Query  1982  RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R+  ++KR K EK+I+L++LQQYFAGSLKDAAKSLGV
Sbjct  493   RKPSERKRGKTEKSISLEVLQQYFAGSLKDAAKSLGV  529



>ref|XP_010233295.1| PREDICTED: protein NLP3-like [Brachypodium distachyon]
Length=901

 Score =   351 bits (900),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 203/499 (41%), Positives = 293/499 (59%), Gaps = 34/499 (7%)
 Frame = +2

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
             +RL  AL Y K+ S D+ +L+Q+W+P     R VL T   PF L  +  +L  YR +S+ 
Sbjct  126   ERLALALSYFKE-STDQHLLVQVWIPTKNGDRYVLTTSGHPFLLAQESIKLVQYRAVSMT  184

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y F V+ ++  ++GLPGRV+  +VPEWTP VQ +   EYPR+ HA  ++V GT A+PVFD
Sbjct  185   YAFSVDGENVHDLGLPGRVYKQRVPEWTPSVQYYSSFEYPRLNHAINHNVHGTVALPVFD  244

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLP  1189
                ++C+GV+E+++T++KV Y +E+D VCKALE V+L+ +KI     V+ C+ S QV L 
Sbjct  245   PSMKSCIGVVELIMTSKKVNYASEVDKVCKALEAVNLKSTKIVEHPCVQICNESRQVALV  304

Query  1190  EILEVLKSACATHKLPLAQTWVPCVQQ---GKEGLRHSDENLLR------CVSTVDSACY  1342
             EILE+L   C   KLPL QTWVPC  Q      G++ S  +         C+ST D A +
Sbjct  305   EILEILTVVCEEFKLPLGQTWVPCKYQSLLAHGGVKRSCLSFGGSCMEEVCISTSDVAFH  364

Query  1343  IADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQ  1522
             I D R+ GF +AC  HHL KG GV G+AF++ +PCFS D++ FSK EYPL HYAR+F+L 
Sbjct  365   IIDARMWGFRDACVAHHLQKGQGVSGKAFISGRPCFSKDVSRFSKMEYPLVHYARMFALA  424

Query  1523  AAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqele  1702
                +I L+S  TG  D++LEFFLP DC+  +E K +L S+ ++++   +TL+V  ++ L 
Sbjct  425   GCFSIYLQSAYTGD-DYILEFFLPPDCREDDEQKALLQSIIVLLRQHLRTLQVAGDKGLN  483

Query  1703  eettSPSSKVAKHSDIRIHKEVPNLKYNSSI---------GPCEEGLSWTSSPMLVQESC  1855
             E      +    H++   +  V +L     I         G   E  +       + ++ 
Sbjct  484   EACLQVDAVTVMHNEETGNTYVQDLNVGGGIHTLLESDMHGGIHESDNRNHKASTMSKNH  543

Query  1856  MSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQ  2035
             + S  +  +KP  +         SGSG S  S   +     VRR G     KAEKTI+L+
Sbjct  544   LLSHDYSGDKPVAI--------PSGSGTSDSSLLYKNKKNPVRRRG-----KAEKTISLE  590

Query  2036  ILQQYFAGSLKDAAKSLGV  2092
             ++QQYF+GSLK AAKSLGV
Sbjct  591   VIQQYFSGSLKSAAKSLGV  609



>ref|XP_002518861.1| transcription factor, putative [Ricinus communis]
 gb|EEF43394.1| transcription factor, putative [Ricinus communis]
Length=1003

 Score =   353 bits (905),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 207/493 (42%), Positives = 288/493 (58%), Gaps = 29/493 (6%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL   KD S ++ VL QIW PV   GR VL T  QPF +D     L  YR +S
Sbjct  151   IKERMTQALRKFKD-STEQHVLAQIWAPVKNGGRYVLTTSGQPFVIDPHSNGLHQYRMVS  209

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F  + +S   +GLPGRVF  K+PEWTP+VQ +  +EY R  HA  Y+V+GT A+PV
Sbjct  210   VMYMFSADGESDGELGLPGRVFRQKLPEWTPNVQYYSSKEYSRRDHALNYNVQGTLALPV  269

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GVIE+++T+QK+ Y  E+D VCKALE V+LR S+I +  + + C+   +  
Sbjct  270   FEPSGQSCVGVIELIMTSQKINYAPEVDKVCKALEAVNLRSSEILDHPSTQICNEGRKNA  329

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQGKEGLRHSDENLLRCVSTVDSACYIADPRIQ  1363
             L EILE+L   C T+KL LAQTW+PC+ +          N   C+ST D A Y+ DP + 
Sbjct  330   LAEILEILTVVCETYKLALAQTWIPCMHRSSCTSFDGSCNGQVCMSTTDLASYVVDPHMW  389

Query  1364  GFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRL  1543
             GF +AC EHHL KG GV GRAF+++  CF  DIT F KTEYPL HYAR+F L    AI L
Sbjct  390   GFRDACLEHHLQKGQGVAGRAFLSHNACFCQDITQFCKTEYPLVHYARLFGLTGCFAICL  449

Query  1544  RSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeet---t  1714
             RS+ TG  D+VLEFFLP       E K +L SL   ++   Q+L V +  +L+EE     
Sbjct  450   RSSYTGDDDYVLEFFLPPTISDSYEQKSLLGSLLATMKQHFQSLNVASGMDLKEEEGFVE  509

Query  1715  SPSSKVAKHSDIRIH----KEVPNLKYNSSIGPCEEGLSWTSS---PMLVQESCMSSSAF  1873
                +  +   D+R+      + PN   N++  P +  ++   S   P++V    + +   
Sbjct  510   IIQTSTSGRLDLRLECIQIPQSPNSPPNTNTFPKDGHVTLPHSSKHPLMVDLDVVDNGG-  568

Query  1874  QNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQILQQYF  2053
              N   +E  +   P   +               +  R+  +KKR KAEK+I+L++LQQYF
Sbjct  569   -NIGHAEGTHTSPPPVEN---------------KGTRKPSEKKRGKAEKSISLEVLQQYF  612

Query  2054  AGSLKDAAKSLGV  2092
             AGSLKDAAKSLGV
Sbjct  613   AGSLKDAAKSLGV  625



>ref|XP_006439290.1| hypothetical protein CICLE_v10018744mg [Citrus clementina]
 gb|ESR52530.1| hypothetical protein CICLE_v10018744mg [Citrus clementina]
Length=943

 Score =   351 bits (901),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 215/517 (42%), Positives = 289/517 (56%), Gaps = 53/517 (10%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P     + +R+ QAL Y KD S ++ VL Q+WVPV   GR VL T  QPF LD     L 
Sbjct  69    PDGYCMIKERITQALRYFKD-STEQHVLAQVWVPVKVGGRYVLTTSGQPFVLDPHSNGLH  127

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S+ Y F V+ +S   +GLPGRVF  K+PEWTP+VQ +  +EY R+ HA  ++VRG
Sbjct  128   QYRMVSLMYMFSVDGESDGELGLPGRVFWQKLPEWTPNVQYYSSKEYSRLDHALHHNVRG  187

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH  1168
             T A+PVF+   ++C+ VIE+++T+QK+ Y  E+D VCKALE V+L+ S+I +  + + C+
Sbjct  188   TMALPVFEPSGQSCVAVIELIMTSQKINYAPEVDKVCKALEAVNLKSSEILDYPSTQICN  247

Query  1169  -SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHSDENL------LRC  1315
                Q  L EILE+L   C THKLPLAQTWVPC    V     GL+ S  ++        C
Sbjct  248   EGRQNALAEILEILSVVCETHKLPLAQTWVPCRHRSVLAYGGGLKKSCSSIDGSCMGQVC  307

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST D A Y+ D  + GF EAC EHHL K  GV GRAF +   CF  DIT F KTEYPL 
Sbjct  308   MSTTDVAFYVVDGHMWGFREACVEHHLQKDQGVAGRAFFSLSSCFCKDITQFCKTEYPLV  367

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtl  1675
             HYAR+F L +  AI LRST TG  D++LEFFLP       E + +L S+   ++   Q  
Sbjct  368   HYARMFGLTSCFAICLRSTYTGDDDYILEFFLPPAITDSYEQQTLLGSILATMKQHFQ--  425

Query  1676  rvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESC  1855
                            S KVA  S I +  +   ++        ++ L+     + + +S 
Sbjct  426   ---------------SLKVA--SGIDLEDDEGTIEIIEGEATADKKLNLRMESIRIPQSV  468

Query  1856  MS---SSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNV---------------  1981
              S     A  N    EL    +PE       +FD  +  G+A NV               
Sbjct  469   RSPPQPHALPNG--GELGQLDIPE--QQLMENFDYMNSRGNAVNVGGNDNPVSLLENKNT  524

Query  1982  RRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             R+  ++KR K EK+I+L++LQQYFAGSLKDAAKSLGV
Sbjct  525   RKPSERKRGKTEKSISLEVLQQYFAGSLKDAAKSLGV  561



>ref|XP_010324647.1| PREDICTED: protein NLP7-like isoform X2 [Solanum lycopersicum]
Length=867

 Score =   349 bits (896),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 207/501 (41%), Positives = 302/501 (60%), Gaps = 38/501 (8%)
 Frame = +2

Query  659   LIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYE  838
             + QAL Y+K+ S ++ VL Q+W PV   GR VL T  QPF LD +C  L  YR +S+ Y 
Sbjct  1     MTQALRYLKETSGER-VLAQVWAPVKEAGRSVLTTSGQPFVLDPECNGLHQYRTVSLMYM  59

Query  839   FPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQG  1018
             F  + ++   +GLPGRVF  K+PEWTP+VQ +  +E+PR+ HA  Y+VRGT A+PVF+  
Sbjct  60    FAADGETDGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRLDHALNYNVRGTLALPVFEPS  119

Query  1019  SRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT---------CH-  1168
              R+C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S I +  N +          C+ 
Sbjct  120   GRSCVGVLELIMTSQKINYAAEVDKVCKALEAVNLKSSDILDHPNTQVYVMGYMNQICNE  179

Query  1169  SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CV  1318
               Q  L +ILE+L + C T+KLPLAQTWVPC    V     GLR S    D + +   C+
Sbjct  180   GRQNALVDILEILTAVCETYKLPLAQTWVPCRHRSVLADGGGLRKSCSSFDGSCMGQICM  239

Query  1319  STVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSH  1498
             ST D A Y+ D  + GF +AC+EHHL +G GV GRA+ + + C+  DIT F KTEYPL H
Sbjct  240   STTDVAFYVVDAHMWGFRDACAEHHLQRGQGVAGRAYASRKSCYCEDITQFCKTEYPLVH  299

Query  1499  YARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlr  1678
             YAR+F L +  AI LRS+ T + D++LEFFLP +     +   +L SL + ++   ++L 
Sbjct  300   YARMFGLTSCFAICLRSSHTANDDYILEFFLPPNSGDYSDQPALLNSLLLTMKQHFRSLS  359

Query  1679  vvteqeleeettSPS-SKVAKHSDIRIHKE-VPNLKYNSSIGPCEEGLSWTS-SPMLVQE  1849
             + + +ELE +  S    + +    I    E VP  K +  +     G  W    P+  Q+
Sbjct  360   IASGEELEHDWGSVEIIQASMEEKIDAKPESVPTAKTSPQLTSLPNG--WVHLDPVGEQQ  417

Query  1850  SCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTIT  2029
             S + S+  +  + +           SG+G + ++ S   +  + +++ ++KR KAEKTI+
Sbjct  418   SAVGSNVSKGARST-----------SGTGEAPNNVSNSDNKTSGKKS-ERKRGKAEKTIS  465

Query  2030  LQILQQYFAGSLKDAAKSLGV  2092
             L++LQQYFAGSLKDAAKSLGV
Sbjct  466   LEVLQQYFAGSLKDAAKSLGV  486



>gb|KFK32160.1| hypothetical protein AALP_AA6G205600 [Arabis alpina]
Length=832

 Score =   348 bits (893),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 204/507 (40%), Positives = 283/507 (56%), Gaps = 44/507 (9%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P +  ++  ++ QAL Y K+ +  + VL Q+W PV   GR VL T  QPF L      L 
Sbjct  96    PDSYCAIKAKMTQALRYFKESTGKQHVLAQVWAPVKNRGRYVLTTSGQPFVLGPNSNGLN  155

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S+ Y F V+ +    +GLPGRVF  K+PEWTP+VQ +  +E+ R+GHA  Y+V+G
Sbjct  156   QYRMVSLTYMFNVDSERDGELGLPGRVFRKKLPEWTPNVQYYSSKEFSRLGHALHYNVQG  215

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH  1168
             T A+PVF+   + C+GV+E+++T+ K+ Y  E++ VCKALE V+L+ S+I N    + C+
Sbjct  216   TLALPVFEPTRQLCVGVVELIMTSPKINYAPEVEKVCKALEAVNLKTSEILNPETTQICN  275

Query  1169  -SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQG--------KEGLRHSDENLLR--C  1315
                Q  L EILE+L   C T+KLPLAQTWVPC  +         K+     D + +   C
Sbjct  276   EGRQNALAEILEILTVVCETYKLPLAQTWVPCRHRSVLAFGGGFKKSCSSFDGSCMGKVC  335

Query  1316  VSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLS  1495
             +ST D A Y+ D  + GF +AC+EHHL KG GV GRAFM+   CF  D+T F KT+YPL 
Sbjct  336   MSTSDLAVYVVDAHVWGFRDACAEHHLQKGQGVAGRAFMSGNLCFCRDVTQFCKTDYPLV  395

Query  1496  HYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQN-----  1660
             HYAR+F L +  A+ L+S+ TG  ++VLEFFLP       E   +L+SL   ++      
Sbjct  396   HYARMFKLASCFAVCLKSSYTGDDEYVLEFFLPPAITDKSEQDCLLSSLFQTMKQHYSSL  455

Query  1661  --VCQtlrvvteqeleeettSPSSKV-AKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSS  1831
               V +T     E  +E    S    V +K   I+IH+  P  K    +   E+ LS  + 
Sbjct  456   KVVSETEFCENEMSIEVVEASEDGMVYSKLEPIQIHRPAPISKDYLQLNVPEQKLSLNTD  515

Query  1832  PMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMK  2011
              M   E       FQ   PS       PE  +G                  +  ++KR K
Sbjct  516   LMENNEVADGFEMFQTLDPS-------PEAKTG------------------KKSERKRGK  550

Query  2012  AEKTITLQILQQYFAGSLKDAAKSLGV  2092
              EKTI+L++LQQYFAGSLKDAAKSLGV
Sbjct  551   TEKTISLEVLQQYFAGSLKDAAKSLGV  577



>ref|XP_007040589.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY25090.1| Transcription factor, putative [Theobroma cacao]
Length=984

 Score =   352 bits (902),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 211/494 (43%), Positives = 292/494 (59%), Gaps = 24/494 (5%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y KD S ++ VL Q+W P+   GR VL T  QPF LD     L  YR +S
Sbjct  121   IKERMTQALRYFKD-STEQHVLAQVWAPIKSGGRYVLTTSGQPFVLDPHSNGLHQYRMVS  179

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ +S   +GLPGRVF  K+PEWTP+VQ +  +EY R+ HA  Y+VRGT A+PV
Sbjct  180   LMYMFSVDGESDGQLGLPGRVFRQKLPEWTPNVQYYSSKEYSRLDHALHYNVRGTLALPV  239

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S I +  + + C+ + Q  
Sbjct  240   FEPSGQSCVGVLELIMTSQKINYAPEVDKVCKALEAVNLKSSDILDPPSTQICNENRQNA  299

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L +ILE+L   C T+KLPLAQTWVPC    V     GL+ S    D + +   C+ST D 
Sbjct  300   LAKILEILTVVCETYKLPLAQTWVPCRHRSVLAYGGGLKKSCTSFDGSCMGQVCMSTTDV  359

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC EHHL KG GV GRAF++   CF  DIT F KTEYPL HYAR+F
Sbjct  360   AFYVVDAHMWGFREACLEHHLQKGQGVAGRAFLSRNSCFCTDITQFCKTEYPLVHYARMF  419

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  AI LRST TG  D+VLEFFLP       E + +L S+   ++   Q+L+V +  
Sbjct  420   RLTSCFAICLRSTYTGDDDYVLEFFLPPAIADSNEQQTLLRSILATMKQHFQSLKVASGA  479

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
             ELE++  S    +   SD R+   + ++    S+           SP     S       
Sbjct  480   ELEDDEGS-IEIIEASSDERLDSRLESIPIPPSV----------KSPPGPNTSPNRGELQ  528

Query  1874  QNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVR-RAGDKKRMKAEKTITLQILQQY  2050
              +    +L+    P    G+ ++  S +     QN   +  ++KR K EK+I+L++LQQY
Sbjct  529   LDSSKQQLIVTFDPATDGGNVVASGSQNPVCLPQNKDVKKSERKRGKTEKSISLEVLQQY  588

Query  2051  FAGSLKDAAKSLGV  2092
             FAGSLKDAAKSLGV
Sbjct  589   FAGSLKDAAKSLGV  602



>ref|XP_008806288.1| PREDICTED: protein NLP3 [Phoenix dactylifera]
Length=977

 Score =   351 bits (900),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 206/514 (40%), Positives = 298/514 (58%), Gaps = 48/514 (9%)
 Frame = +2

Query  635   ATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHY  814
             A+  + +R++QAL Y K+ S D+ VL+Q+W PV +  +  L T  QPF LD +   L  Y
Sbjct  143   ASCVIKERMMQALRYFKE-STDQHVLVQVWAPVKKGDQCFLTTSGQPFVLDPRSTGLLQY  201

Query  815   RDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTF  994
             R +S+ Y F V+EDS   +GLPGRV+  ++PEWTP VQ +  +EY R+ HA  Y+V+GT 
Sbjct  202   RTVSLTYIFSVDEDSGGYLGLPGRVYRYRLPEWTPSVQYYSSKEYLRLAHALNYNVQGTL  261

Query  995   AVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-S  1171
             A+PVF+   ++C+GV+E+V+T+QK+ Y +E+D VCKAL+ V+L+ S+I +  N++  +  
Sbjct  262   ALPVFEPSDQSCVGVVELVMTSQKINYSHEVDIVCKALQTVNLKSSEILDHPNIQISNEG  321

Query  1172  YQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVS  1321
              Q  L EILE+L   C   KLPLAQTWVPC    +     GL+ +    D + +   C+S
Sbjct  322   RQAALAEILEILTVVCEAQKLPLAQTWVPCKHGTILTHGGGLKKNCSSFDGSCMGQVCMS  381

Query  1322  TVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHY  1501
               D A Y+ D  + GF EAC EHHL  G GV GRAF   +PCF+ D+  F K+EYPL HY
Sbjct  382   ATDIAFYVIDAHMWGFREACVEHHLQIGQGVAGRAFALRRPCFAEDVAKFCKSEYPLVHY  441

Query  1502  ARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrv  1681
             A +F L   +AI L+ST +G  D+++EFFLP+DCK+P E + +L S+S +++N  +    
Sbjct  442   AWMFGLVGCLAICLQSTHSGDDDYIVEFFLPQDCKNPVEQRALLDSISTLMKNCFR----  497

Query  1682  vteqeleeettSPSSKVAKHSDIR--IHKEVPNLKYNSSIGPCE---------EGLSWTS  1828
                          S KV    D++  I  EV ++    + G CE         +    TS
Sbjct  498   -------------SLKVVSDLDLQEGISFEVIDMFAYENHG-CEPKHICSQNCDAHVHTS  543

Query  1829  SPMLVQESCMSSSAFQNEKPSELLYKRLPEFVS---GSGLSFDSTSGEGSA---QNVRRA  1990
                 + E     S  +    S+ L + LP   +    S + F S  G  S+    N    
Sbjct  544   PETHIPEG-HDDSQNEGNATSDALKQHLPPHANAERASNIHFVSGIGGASSSLLSNKNNG  602

Query  1991  GDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               +K  KAEK+ +L++LQQYF+GSLKDAAKSLGV
Sbjct  603   APEKSGKAEKSFSLEVLQQYFSGSLKDAAKSLGV  636



>ref|XP_004967359.1| PREDICTED: protein NLP3-like [Setaria italica]
Length=935

 Score =   350 bits (897),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 203/498 (41%), Positives = 292/498 (59%), Gaps = 29/498 (6%)
 Frame = +2

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
             +RL QAL Y K+ S D+ +L+Q+W PV    R VL T  QPF LD +   L  YR +S+ 
Sbjct  128   ERLTQALRYFKE-STDQHLLVQVWAPVKNGDRYVLTTSGQPFVLDHQSIGLIQYRAVSMM  186

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y F V+  +   +GLPGRV+  KVPEWTP+VQ +   EYPR+ HA  Y+V GT A+PVFD
Sbjct  187   YMFSVDGGNVGELGLPGRVYKLKVPEWTPNVQYYSSTEYPRLNHAISYNVHGTVALPVFD  246

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLP  1189
               +++C+ V+E+++T++K+ Y  E+D VCKALE V+L+ ++I +  NV+ C+   Q  L 
Sbjct  247   PSAQSCIAVVELIMTSKKINYACEVDKVCKALEAVNLKSTEILDHPNVQICNEGRQTALV  306

Query  1190  EILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDSAC  1339
             EILE+L   C  HKLPLAQTWVPC    V     GL+ S    D + +   C+ST D A 
Sbjct  307   EILEILTVVCEEHKLPLAQTWVPCKYRSVLAHGGGLKKSCLSFDGSCMGEVCMSTSDVAF  366

Query  1340  YIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSL  1519
             ++ D  + GF +AC EHHL +G GV G AF+T +PCFS DI  F K +YPL HYAR+F L
Sbjct  367   HVIDAHMWGFRDACVEHHLQRGQGVSGNAFITRKPCFSKDIRKFCKIKYPLVHYARMFGL  426

Query  1520  QAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqel  1699
                +AI L+S+ TG  D++LEFFLP DC   +E   +L S+  +++   +         L
Sbjct  427   AGCLAICLQSSYTGHDDYILEFFLPPDCIDEDEQNALLESIFTLMKQCLR--------SL  478

Query  1700  eeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQN  1879
             +    + SS V+      +  E   LK ++     +  L+   SP              N
Sbjct  479   KVVGDADSSWVSLQLSNVLKIENEELKTDAQFDNSDGSLN--GSPEGDTHGGDHKFDNGN  536

Query  1880  EKPSELLYKRL--PEFVSGSGLSFDSTSGEGSA-----QNVRRAGDKKRMKAEKTITLQI  2038
             +K S++    L   ++   +G S    +G G++         +  +++R KAEKTI+L++
Sbjct  537   KKVSDMPEGHLLADDYSQDNGTSASRPNGSGASDSSVLHKTNKPTERRRGKAEKTISLEV  596

Query  2039  LQQYFAGSLKDAAKSLGV  2092
             LQQYF+GSLK+AAKSLGV
Sbjct  597   LQQYFSGSLKNAAKSLGV  614



>ref|XP_009803234.1| PREDICTED: protein NLP7-like isoform X1 [Nicotiana sylvestris]
Length=1019

 Score =   351 bits (901),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 213/528 (40%), Positives = 304/528 (58%), Gaps = 56/528 (11%)
 Frame = +2

Query  602   ELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQ  781
             EL+ R +  P  +  + +R+ QAL Y K+ + ++ VL Q+W PV   GR VL T  QPF 
Sbjct  137   ELAPRDY--PNGSCIIKERMTQALRYFKESTGER-VLAQVWAPVKDAGRYVLTTSGQPFV  193

Query  782   LDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVG  961
             LD  C  L  YR +S+ Y F  + ++   +GLPGRVF  K+PEWTP+VQ +  +E+PR+ 
Sbjct  194   LDPDCNGLHQYRTVSLMYMFAADGETGGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRLD  253

Query  962   HAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKIS  1141
             HA  Y+VRGT A+PVF+   ++CLGV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I 
Sbjct  254   HALHYNVRGTLALPVFEPSGQSCLGVLELIMTSQKINYAAEVDKVCKALETVNLKSSEIL  313

Query  1142  NVRNVKT---------CH-SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKE  1279
             +  N +          C+   Q  L EILE+L + C T++LPLAQTWVPC    V     
Sbjct  314   DHPNTQVYVMGYMNQICNEGRQNALVEILEILTAVCETYQLPLAQTWVPCRHRSVLADGG  373

Query  1280  GLRHS----DENLLR--CVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQ  1441
             GL+ S    D + +   C+ST D A Y+ D  + GF EAC+EHHL KG GV GRA+ + +
Sbjct  374   GLKKSCSSFDGSCMGQICMSTTDVAFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQK  433

Query  1442  PCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEH  1621
              CF  DIT F KTEYPL HYAR+F L +  AI LRS+ TG+ D++LEFFLP +     + 
Sbjct  434   SCFCEDITQFCKTEYPLVHYARLFGLTSCFAICLRSSHTGNDDYILEFFLPPNSGDYSDQ  493

Query  1622  KRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKH--SDIRIHKEVPNLKYNSSI  1795
             + +L SL + ++   ++L +             S +  +H  S + I K     K ++  
Sbjct  494   QALLNSLLLTMKQHFRSLSIA------------SGEELEHDWSSVEIIKASMEEKIDA--  539

Query  1796  GPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQ  1975
                 +  S  +   L Q + + +     +   E  +    +   G+G    S SG G A 
Sbjct  540   ----KPESVPAPKSLPQPTRLPNGRTHLDPLGEQQFSVESDVAKGAG----SKSGTGEAP  591

Query  1976  N---------VRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             N           +  ++KR KAEKTI+L++LQQYFAGSLKDAAKSLGV
Sbjct  592   NHISPSDNKPTGKKSERKRGKAEKTISLEVLQQYFAGSLKDAAKSLGV  639



>ref|XP_008673472.1| PREDICTED: protein NLP3 [Zea mays]
 tpg|DAA52709.1| TPA: hypothetical protein ZEAMMB73_194077 [Zea mays]
Length=916

 Score =   348 bits (894),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 211/534 (40%), Positives = 312/534 (58%), Gaps = 38/534 (7%)
 Frame = +2

Query  566   NAVCSSGLAESSELSRRWWI-------GPMATTSVMDRLIQALGYIKDFSRDKDVLIQIW  724
             N+  SS  AE  ++S RW         G   ++   ++L  AL Y K+ S D+ +L+Q+W
Sbjct  76    NSHTSSKPAE--QISHRWQFHLSLDEDGTDNSSLFKEKLTHALRYFKE-STDQHLLVQVW  132

Query  725   VPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKV  904
              PV    R VL T  QPF LD +   L  YR +S+ Y F V+ ++  ++GLPGRV+  KV
Sbjct  133   APVKNGDRYVLTTSGQPFVLDHQSIGLLQYRAVSMTYMFSVDAENVGDLGLPGRVYKQKV  192

Query  905   PEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNE  1084
             PEWTP+VQ +   EY R+ HA  Y+V GT A+PVFD  + +C+ V+E+++T++K+ Y  E
Sbjct  193   PEWTPNVQYYSSGEYQRLNHAISYNVHGTVALPVFDPSAHSCIAVVELIMTSKKINYACE  252

Query  1085  LDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPC  1261
             +D VCKALE V+L+ ++I +  NV+ C+   Q  L EILE+L   C  HKLPLAQTWVPC
Sbjct  253   VDKVCKALEAVNLKSTEIHDHPNVQICNEGRQAALVEILEILTVVCEEHKLPLAQTWVPC  312

Query  1262  ----VQQGKEGLRHS----DENLLR--CVSTVDSACYIADPRIQGFHEACSEHHLLKGLG  1411
                 V     GL+ S    D + +   C+ST D A ++ D  + GF +AC EHHL +G G
Sbjct  313   KYRSVLAHGGGLKKSCLSFDGSCMGEVCMSTSDVAFHVIDAHMWGFRDACVEHHLQRGQG  372

Query  1412  VVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFL  1591
             V G+AF++++PCFS DI  F K  YPL HYAR+F L    AI L+S+ TG+ D++LEFFL
Sbjct  373   VPGKAFISHKPCFSKDIRKFCKLAYPLVHYARMFGLAGCFAICLQSSYTGNDDYILEFFL  432

Query  1592  PRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVP  1771
             P DC   ++   +L S+  +++   ++L+VV +++L        S V+ H    +  E  
Sbjct  433   PPDCSDEDDQNALLESVLTLMKRCLRSLKVVGDRDL--------SGVSLHLSNVLKLENE  484

Query  1772  NLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRL--PEFVSGSGLSF  1945
               K ++     +  L    SP   +          N+K  ++   +L   +F  G+G S 
Sbjct  485   EFKTDAQFDNSDGSL--CQSPNGDRHGGSHEFDGGNKKVLDVPEGQLLTDDFSQGNGTSA  542

Query  1946  DSTSGEGSA-----QNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                +G G++         +  ++KR KAEKTI+L++LQQYF+GSLK+AAKSLGV
Sbjct  543   GRPNGSGASDSSVLHKTNKPPERKRGKAEKTISLEVLQQYFSGSLKNAAKSLGV  596



>ref|XP_004165968.1| PREDICTED: protein NLP6-like [Cucumis sativus]
Length=1006

 Score =   350 bits (899),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 204/503 (41%), Positives = 287/503 (57%), Gaps = 39/503 (8%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +++ QAL YIK+ S D+ VL Q+W PV   G+ VL T  QPF LD +   L  YR  S
Sbjct  144   IKEKMAQALRYIKE-SSDQHVLAQVWAPVKSGGKLVLSTSGQPFFLDSQSNGLHQYRMAS  202

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + + F ++ D    +GLPGRVF  K+PEWTP+VQ +  +EYPR+ HA  Y+V+GT A+PV
Sbjct  203   LTFSFSLDADQDGYLGLPGRVFQQKLPEWTPNVQYYSSKEYPRLSHALNYNVQGTLALPV  262

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             FD    +CLGV+E+++T+ K+ Y  E+D VCKALE V+L+ S+I +  N + C+   Q  
Sbjct  263   FDPSGHSCLGVLELIMTSPKINYAPEVDKVCKALEAVNLKSSEILDHPNNQICNEGRQNA  322

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILEVL   C TH LPLAQTWVPC    V     GL+ S    D + +   C+S  + 
Sbjct  323   LAEILEVLTVVCETHNLPLAQTWVPCRHRNVLANGGGLKKSCTSFDGSCMGRICMSATEV  382

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF +AC EHHL KG GV GRAF+++  CF  D+T F KTEYPL HYA +F
Sbjct  383   ASYVVDAHMWGFRDACLEHHLQKGQGVSGRAFLSHSSCFCGDVTQFCKTEYPLVHYALMF  442

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L++  +I LRST TG  +++LEFFLP      +E K +L +L   ++    TL      
Sbjct  443   GLKSCFSICLRSTFTGDDEYILEFFLPPSIVDYQEQKNLLGALMATMKKHFYTL------  496

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQ--------E  1849
                        KVA   ++   + +  +   S  G  +    +   P  VQ         
Sbjct  497   -----------KVASGINLEDKEGLVEIIQASRNGGFDSRFEYIQIPRPVQLPPASDAMP  545

Query  1850  SCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQN--VRRAGDKKRMKAEKT  2023
               +  +A +  +   L+    P+  +      +S       QN  V++  ++KR KAEK+
Sbjct  546   KAVEVAALETLEQQSLMVHDAPKDENNGAWDGESHKSVPCPQNKEVKKTSERKRGKAEKS  605

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I+L++LQQYFAGSLKDAAKSLGV
Sbjct  606   ISLEVLQQYFAGSLKDAAKSLGV  628



>ref|XP_004149006.1| PREDICTED: protein NLP6-like [Cucumis sativus]
Length=1006

 Score =   350 bits (899),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 204/503 (41%), Positives = 287/503 (57%), Gaps = 39/503 (8%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +++ QAL YIK+ S D+ VL Q+W PV   G+ VL T  QPF LD +   L  YR  S
Sbjct  144   IKEKMAQALRYIKE-SSDQHVLAQVWAPVKSGGKLVLSTSGQPFFLDSQSNGLHQYRMAS  202

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + + F ++ D    +GLPGRVF  K+PEWTP+VQ +  +EYPR+ HA  Y+V+GT A+PV
Sbjct  203   LTFSFSLDADQDGYLGLPGRVFQQKLPEWTPNVQYYSSKEYPRLSHALNYNVQGTLALPV  262

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             FD    +CLGV+E+++T+ K+ Y  E+D VCKALE V+L+ S+I +  N + C+   Q  
Sbjct  263   FDPSGHSCLGVLELIMTSPKINYAPEVDKVCKALEAVNLKSSEILDHPNNQICNEGRQNA  322

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILEVL   C TH LPLAQTWVPC    V     GL+ S    D + +   C+S  + 
Sbjct  323   LAEILEVLTVVCETHNLPLAQTWVPCRHRNVLANGGGLKKSCTSFDGSCMGRICMSATEV  382

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF +AC EHHL KG GV GRAF+++  CF  D+T F KTEYPL HYA +F
Sbjct  383   ASYVVDAHMWGFRDACLEHHLQKGQGVSGRAFLSHSSCFCGDVTQFCKTEYPLVHYALMF  442

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L++  +I LRST TG  +++LEFFLP      +E K +L +L   ++    TL      
Sbjct  443   GLKSCFSICLRSTFTGDDEYILEFFLPPSIVDYQEQKNLLGALMATMKKHFYTL------  496

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQ--------E  1849
                        KVA   ++   + +  +   S  G  +    +   P  VQ         
Sbjct  497   -----------KVASGINLEDKEGLVEIIQASRNGGFDSRFEYIQIPRPVQLPPASDAMP  545

Query  1850  SCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQN--VRRAGDKKRMKAEKT  2023
               +  +A +  +   L+    P+  +      +S       QN  V++  ++KR KAEK+
Sbjct  546   KAVEVAALETLEQQSLMVHDAPKDENNGAWDGESHKSVPCPQNKEVKKTSERKRGKAEKS  605

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I+L++LQQYFAGSLKDAAKSLGV
Sbjct  606   ISLEVLQQYFAGSLKDAAKSLGV  628



>gb|KGN53434.1| hypothetical protein Csa_4G054800 [Cucumis sativus]
Length=993

 Score =   350 bits (898),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 204/503 (41%), Positives = 287/503 (57%), Gaps = 39/503 (8%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +++ QAL YIK+ S D+ VL Q+W PV   G+ VL T  QPF LD +   L  YR  S
Sbjct  131   IKEKMAQALRYIKE-SSDQHVLAQVWAPVKSGGKLVLSTSGQPFFLDSQSNGLHQYRMAS  189

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + + F ++ D    +GLPGRVF  K+PEWTP+VQ +  +EYPR+ HA  Y+V+GT A+PV
Sbjct  190   LTFSFSLDADQDGYLGLPGRVFQQKLPEWTPNVQYYSSKEYPRLSHALNYNVQGTLALPV  249

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             FD    +CLGV+E+++T+ K+ Y  E+D VCKALE V+L+ S+I +  N + C+   Q  
Sbjct  250   FDPSGHSCLGVLELIMTSPKINYAPEVDKVCKALEAVNLKSSEILDHPNNQICNEGRQNA  309

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILEVL   C TH LPLAQTWVPC    V     GL+ S    D + +   C+S  + 
Sbjct  310   LAEILEVLTVVCETHNLPLAQTWVPCRHRNVLANGGGLKKSCTSFDGSCMGRICMSATEV  369

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF +AC EHHL KG GV GRAF+++  CF  D+T F KTEYPL HYA +F
Sbjct  370   ASYVVDAHMWGFRDACLEHHLQKGQGVSGRAFLSHSSCFCGDVTQFCKTEYPLVHYALMF  429

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L++  +I LRST TG  +++LEFFLP      +E K +L +L   ++    TL      
Sbjct  430   GLKSCFSICLRSTFTGDDEYILEFFLPPSIVDYQEQKNLLGALMATMKKHFYTL------  483

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQ--------E  1849
                        KVA   ++   + +  +   S  G  +    +   P  VQ         
Sbjct  484   -----------KVASGINLEDKEGLVEIIQASRNGGFDSRFEYIQIPRPVQLPPASDAMP  532

Query  1850  SCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQN--VRRAGDKKRMKAEKT  2023
               +  +A +  +   L+    P+  +      +S       QN  V++  ++KR KAEK+
Sbjct  533   KAVEVAALETLEQQSLMVHDAPKDENNGAWDGESHKSVPCPQNKEVKKTSERKRGKAEKS  592

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I+L++LQQYFAGSLKDAAKSLGV
Sbjct  593   ISLEVLQQYFAGSLKDAAKSLGV  615



>ref|XP_011026836.1| PREDICTED: protein NLP7-like isoform X2 [Populus euphratica]
Length=1004

 Score =   350 bits (898),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 206/503 (41%), Positives = 284/503 (56%), Gaps = 41/503 (8%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ +AL + K+ S ++ +L Q+W PV   GR  L T  QPF +D     L  YR +S
Sbjct  136   IKERMTRALRHFKE-STEQHILAQVWAPVKNGGRYALTTSGQPFVIDPHSNGLHQYRMVS  194

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y+F V+ +S   +GLPGRVF  K+PEWTP+VQ +  +EYPR+ HA  Y+VRGT A+PV
Sbjct  195   LMYKFSVDGESDGELGLPGRVFRQKLPEWTPNVQYYSSKEYPRLDHAIHYNVRGTVALPV  254

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++ + K+ Y  E+D VCKALE VDL+ S+I +  + + C+   Q  
Sbjct  255   FEPSGQSCVGVVELIMNSHKINYAPEVDKVCKALEAVDLKSSEILDPPSTQICNEGRQNA  314

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHS------DENLLRCVSTVDS  1333
             L EILE+L   C THKLPLAQTWVPC+ +       GL+ S        N   C+ST D 
Sbjct  315   LAEILEILTMVCETHKLPLAQTWVPCMHRSVLAYGGGLKKSCTSFDGSCNGQVCMSTTDV  374

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC EHHL KG GV GRAF ++  CF  DIT F KTEYPL HYAR+F
Sbjct  375   AFYVVDAHMWGFREACLEHHLQKGQGVAGRAFFSHNLCFCPDITQFRKTEYPLVHYARMF  434

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  AI LRS+ TG  D++LEFFLP       E K +L S+  I++   Q        
Sbjct  435   GLTSCFAICLRSSYTGDDDYILEFFLPPSITDSREWKTLLGSILAIMKQDFQ--------  486

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
                      S KVA   ++   +    +   S+ G  + GL     P   + S    +A 
Sbjct  487   ---------SLKVASGMELEEEEGFVEMIQVSTNGRLDLGLECIQIPQSTK-SPPDDNAL  536

Query  1874  QNEKPSELLYKRLPEFV--------SGSGLSFDSTSGEGS--AQNVRRAGDKKRMKAEKT  2023
              N  P   +Y    + +         GS +  D T    S   +  +   ++KR KAEK 
Sbjct  537   LN-GPIVQIYPEKNQLMFDLDVIKNGGSAVQADVTQTHASLTEKETKMPKERKRGKAEKM  595

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I+L++LQQYF GSLKDAA SLGV
Sbjct  596   ISLEVLQQYFTGSLKDAAMSLGV  618



>ref|XP_008451916.1| PREDICTED: LOW QUALITY PROTEIN: protein NLP7-like [Cucumis melo]
Length=992

 Score =   350 bits (897),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 208/520 (40%), Positives = 291/520 (56%), Gaps = 43/520 (8%)
 Frame = +2

Query  608   SRRWWIGPMATTS----VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQP  775
             S  W I P         + +++ QAL YIK+ S D+ VL Q+W PV   G+ VL T  QP
Sbjct  114   SSSWGILPSENPDGYCLIKEKMAQALRYIKE-SSDQHVLAQVWAPVKSGGKFVLSTSGQP  172

Query  776   FQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPR  955
             F LD +   L  YR  S+ + F ++ D    +GLPGRVF  K+PEWTP+VQ +  +EYPR
Sbjct  173   FXLDSQSNGLHQYRMASLTFMFSLDADQDGYLGLPGRVFQQKLPEWTPNVQYYSSKEYPR  232

Query  956   VGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSK  1135
             + HA  Y+V+GT A+PVFD    +CLGV+E+++T+ K+ Y  E+D VCKALE V+L+ S+
Sbjct  233   LSHALNYNVQGTLALPVFDPSGHSCLGVLELIMTSPKINYAPEVDKVCKALEAVNLKSSE  292

Query  1136  ISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHS--  1294
             I +  N + C+   Q  L EILEVL   C TH LPLAQTWVPC  +       GL+ S  
Sbjct  293   ILDHPNNQICNEGRQNALAEILEVLTVVCETHNLPLAQTWVPCRHRNVLAYGGGLKKSCT  352

Query  1295  --DENLLR--CVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADI  1462
               D + +   C+S  + A Y+ D  + GF +AC EHHL KG GV GRAF+++  CF  DI
Sbjct  353   SFDGSCMGRICMSATEVASYVVDAHMWGFRDACLEHHLQKGQGVSGRAFLSHSSCFCGDI  412

Query  1463  TSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSL  1642
             T F KTEYPL HYA +F L++  +I LRST TG  +++LEFFLP      +E K +L +L
Sbjct  413   TQFCKTEYPLVHYALMFGLKSCFSICLRSTFTGDDEYILEFFLPPSIVDYQEQKNLLGAL  472

Query  1643  SIIIQNVCQtlrvvteqeleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSW  1822
                ++    TL                 KVA   ++   +    +   S  G  +  L +
Sbjct  473   MATMKKHFYTL-----------------KVASGINLEDKEGFVEIIQASRNGGFDSRLEY  515

Query  1823  TSSPMLVQ--------ESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQN  1978
                P  V+           +  +A +  +   L+    P+  +      +S       QN
Sbjct  516   IQIPQPVELPPASDAMPKAVEVAALETLQQQSLMVHDAPKDENNGAWDGESHKPVPCPQN  575

Query  1979  --VRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               V++  ++KR KAEK+I+L++LQQYFAGSLKDAAKSLGV
Sbjct  576   KEVKKTSERKRGKAEKSISLEVLQQYFAGSLKDAAKSLGV  615



>ref|XP_011026835.1| PREDICTED: protein NLP7-like isoform X1 [Populus euphratica]
Length=1007

 Score =   350 bits (897),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 206/503 (41%), Positives = 284/503 (56%), Gaps = 41/503 (8%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ +AL + K+ S ++ +L Q+W PV   GR  L T  QPF +D     L  YR +S
Sbjct  139   IKERMTRALRHFKE-STEQHILAQVWAPVKNGGRYALTTSGQPFVIDPHSNGLHQYRMVS  197

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y+F V+ +S   +GLPGRVF  K+PEWTP+VQ +  +EYPR+ HA  Y+VRGT A+PV
Sbjct  198   LMYKFSVDGESDGELGLPGRVFRQKLPEWTPNVQYYSSKEYPRLDHAIHYNVRGTVALPV  257

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++ + K+ Y  E+D VCKALE VDL+ S+I +  + + C+   Q  
Sbjct  258   FEPSGQSCVGVVELIMNSHKINYAPEVDKVCKALEAVDLKSSEILDPPSTQICNEGRQNA  317

Query  1184  LPEILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHS------DENLLRCVSTVDS  1333
             L EILE+L   C THKLPLAQTWVPC+ +       GL+ S        N   C+ST D 
Sbjct  318   LAEILEILTMVCETHKLPLAQTWVPCMHRSVLAYGGGLKKSCTSFDGSCNGQVCMSTTDV  377

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC EHHL KG GV GRAF ++  CF  DIT F KTEYPL HYAR+F
Sbjct  378   AFYVVDAHMWGFREACLEHHLQKGQGVAGRAFFSHNLCFCPDITQFRKTEYPLVHYARMF  437

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  AI LRS+ TG  D++LEFFLP       E K +L S+  I++   Q        
Sbjct  438   GLTSCFAICLRSSYTGDDDYILEFFLPPSITDSREWKTLLGSILAIMKQDFQ--------  489

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
                      S KVA   ++   +    +   S+ G  + GL     P   + S    +A 
Sbjct  490   ---------SLKVASGMELEEEEGFVEMIQVSTNGRLDLGLECIQIPQSTK-SPPDDNAL  539

Query  1874  QNEKPSELLYKRLPEFV--------SGSGLSFDSTSGEGS--AQNVRRAGDKKRMKAEKT  2023
              N  P   +Y    + +         GS +  D T    S   +  +   ++KR KAEK 
Sbjct  540   LN-GPIVQIYPEKNQLMFDLDVIKNGGSAVQADVTQTHASLTEKETKMPKERKRGKAEKM  598

Query  2024  ITLQILQQYFAGSLKDAAKSLGV  2092
             I+L++LQQYF GSLKDAA SLGV
Sbjct  599   ISLEVLQQYFTGSLKDAAMSLGV  621



>ref|XP_009599820.1| PREDICTED: protein NLP6-like isoform X1 [Nicotiana tomentosiformis]
Length=1016

 Score =   350 bits (898),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 211/516 (41%), Positives = 296/516 (57%), Gaps = 48/516 (9%)
 Frame = +2

Query  629   PMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLA  808
             P  +  + +R+ QAL Y K+ + ++ VL Q+W PV   GR VL T  QPF LD  C  L 
Sbjct  141   PNGSCIIKERMTQALRYFKESTGER-VLAQVWAPVKDAGRYVLTTSGQPFVLDPDCNGLH  199

Query  809   HYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRG  988
              YR +S+ Y F  + ++   +GLPGRVF  K+PEWTP+VQ +  +E+PR+ HA  Y+VRG
Sbjct  200   QYRTVSLMYMFAADGETGGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRLDHALHYNVRG  259

Query  989   TFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKT--  1162
             T A+PVF+   ++CLGV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I +  N +   
Sbjct  260   TLALPVFEPSGQSCLGVLELIMTSQKINYAAEVDKVCKALETVNLKSSEILDHPNTQVYV  319

Query  1163  -------CH-SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----  1294
                    C+   Q  L EILE+L + C T++LPLAQTWVPC    V     GL+ S    
Sbjct  320   MGYMNQICNEGRQNALVEILEILTAVCETYQLPLAQTWVPCRHRSVLADGGGLKKSCSSF  379

Query  1295  DENLLR--CVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITS  1468
             D + +   C+ST D A Y+ D  + GF EAC+EHHL KG GV GRA+ + + CF  DIT 
Sbjct  380   DGSCMGQICMSTTDVAFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQKSCFCEDITQ  439

Query  1469  FSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSI  1648
             F KTEYPL HYAR+F L +  AI LRS+ TG+ D++LEFFLP +     + + +L SL +
Sbjct  440   FCKTEYPLVHYARLFGLTSCFAICLRSSHTGNDDYILEFFLPPNSGDYSDQQALLNSLLL  499

Query  1649  IIQNVCQtlrvvte-------qeleeettSPSSKV-AKHSDIRIHKEVPNLKYNSSIGPC  1804
              ++   ++L + +          +E    S   K+ AK   +   K +P         P 
Sbjct  500   TMKQHFRSLSIASGGELEHDWSSVEIIKASIEEKIDAKPESVSAPKSLPQ--------PT  551

Query  1805  EEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGEGSAQNVR  1984
                  WT    L ++     S       S+      P  VS S    +  +G+ S     
Sbjct  552   RLPNGWTHLDPLGEQQFSVESDVAKGAGSKCGTGEAPNHVSPSD---NKPTGKKS-----  603

Query  1985  RAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
                ++KR KAEKTI+L++LQQYFAGSLKDAAKSLGV
Sbjct  604   ---ERKRGKAEKTISLEVLQQYFAGSLKDAAKSLGV  636



>ref|XP_006606126.1| PREDICTED: protein NLP7-like isoform X2 [Glycine max]
Length=926

 Score =   348 bits (893),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 210/507 (41%), Positives = 299/507 (59%), Gaps = 49/507 (10%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ + + +VL Q+W PV    R VL T  QPF LD     L  YR +S
Sbjct  62    IKERMTQALRYFKELT-ELNVLAQVWAPVKNGNRYVLTTSGQPFVLDPHSNGLYQYRTVS  120

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ ++  ++GLPGRVF  K+PEWTP+V  +  +EYPR  HAQ Y+VRGT A+PV
Sbjct  121   LMYMFSVDGENDGSLGLPGRVFQQKLPEWTPNVLYYSSKEYPRRDHAQHYNVRGTLALPV  180

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
             F+   ++C+GV+E+++T+QK+ Y  E+D +CKALE V+LR S+I +  + + C+   Q  
Sbjct  181   FEPSIQSCVGVLELIMTSQKINYAPEVDKICKALETVNLRSSEILDHPHTQICNEGRQNA  240

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC-----VQQG---KEGLRHSDENLLR--CVSTVDS  1333
             L EILE+L   C TH LPLAQTW+PC     + QG   K+     D   +   C+ST D 
Sbjct  241   LSEILEILTVVCETHNLPLAQTWIPCKHRSVLAQGGGVKKSCSSFDGRCMGKVCMSTTDI  300

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A YI D  + GF EAC EHHL +G GV GRAF+++  CF ++IT F KT+YPL HYA +F
Sbjct  301   AFYIIDAHLWGFREACVEHHLQQGQGVAGRAFLSHGMCFCSNITQFYKTDYPLVHYALMF  360

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L +  AI LRS+ TG+ D+VLEFFLP       E K +L S+  I++   Q+L + +  
Sbjct  361   GLTSCFAICLRSSHTGNDDYVLEFFLPPRITHIHEQKTLLGSILAIMKQHFQSLHIASGV  420

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMSSSAF  1873
             E E+     S ++ + +  R+H  + ++   SSI          S P       M     
Sbjct  421   EPEDG----SIEIIEATIERVHTRLESIPIASSI---------KSPPRPDTSPNMGEEVP  467

Query  1874  QNEKPSE---LLYKRLPEFVSGSGLSFDSTSGEGSA-----------QNVRRAGDKKRMK  2011
             Q+  PSE   L+Y    +  +G  L      GE +A           +N+ +  ++KR K
Sbjct  468   QD--PSEQQILMYCN--DINNGGSL------GENAARNIDHMPSLETKNINKPLERKRGK  517

Query  2012  AEKTITLQILQQYFAGSLKDAAKSLGV  2092
              EK+I+L++LQ+YFAGSLKDAAKSLGV
Sbjct  518   TEKSISLEVLQRYFAGSLKDAAKSLGV  544



>ref|XP_009599822.1| PREDICTED: protein NLP6-like isoform X3 [Nicotiana tomentosiformis]
Length=971

 Score =   349 bits (895),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 215/525 (41%), Positives = 300/525 (57%), Gaps = 50/525 (10%)
 Frame = +2

Query  602   ELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQ  781
             EL+ R +  P  +  + +R+ QAL Y K+ S  + VL Q+W PV   GR VL T  QPF 
Sbjct  89    ELAPRDY--PNGSCIIKERMTQALRYFKE-STGERVLAQVWAPVKDAGRYVLTTSGQPFV  145

Query  782   LDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVG  961
             LD  C  L  YR +S+ Y F  + ++   +GLPGRVF  K+PEWTP+VQ +  +E+PR+ 
Sbjct  146   LDPDCNGLHQYRTVSLMYMFAADGETGGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRLD  205

Query  962   HAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKIS  1141
             HA  Y+VRGT A+PVF+   ++CLGV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I 
Sbjct  206   HALHYNVRGTLALPVFEPSGQSCLGVLELIMTSQKINYAAEVDKVCKALETVNLKSSEIL  265

Query  1142  NVRNVKT---------CH-SYQVVLPEILEVLKSACATHKLPLAQTWVPC----VQQGKE  1279
             +  N +          C+   Q  L EILE+L + C T++LPLAQTWVPC    V     
Sbjct  266   DHPNTQVYVMGYMNQICNEGRQNALVEILEILTAVCETYQLPLAQTWVPCRHRSVLADGG  325

Query  1280  GLRHS----DENLLR--CVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQ  1441
             GL+ S    D + +   C+ST D A Y+ D  + GF EAC+EHHL KG GV GRA+ + +
Sbjct  326   GLKKSCSSFDGSCMGQICMSTTDVAFYVVDAHMWGFREACAEHHLQKGQGVAGRAYASQK  385

Query  1442  PCFSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEH  1621
              CF  DIT F KTEYPL HYAR+F L +  AI LRS+ TG+ D++LEFFLP +     + 
Sbjct  386   SCFCEDITQFCKTEYPLVHYARLFGLTSCFAICLRSSHTGNDDYILEFFLPPNSGDYSDQ  445

Query  1622  KRMLTSLSIIIQNVCQtlrvvte-------qeleeettSPSSKV-AKHSDIRIHKEVPNL  1777
             + +L SL + ++   ++L + +          +E    S   K+ AK   +   K +P  
Sbjct  446   QALLNSLLLTMKQHFRSLSIASGGELEHDWSSVEIIKASIEEKIDAKPESVSAPKSLPQ-  504

Query  1778  KYNSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTS  1957
                    P      WT    L ++     S       S+      P  VS S    +  +
Sbjct  505   -------PTRLPNGWTHLDPLGEQQFSVESDVAKGAGSKCGTGEAPNHVSPSD---NKPT  554

Query  1958  GEGSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             G+ S        ++KR KAEKTI+L++LQQYFAGSLKDAAKSLGV
Sbjct  555   GKKS--------ERKRGKAEKTISLEVLQQYFAGSLKDAAKSLGV  591



>ref|XP_010473720.1| PREDICTED: protein NLP6 [Camelina sativa]
Length=854

 Score =   346 bits (888),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 210/523 (40%), Positives = 293/523 (56%), Gaps = 48/523 (9%)
 Frame = +2

Query  581   SGLAESSELSRRWWIGPMATTSVMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLV  760
             SGL  SSE        P +  ++  ++ QAL + K+ +  + +L Q+W PV   GR VL 
Sbjct  99    SGLMPSSENQD----NPDSYCAIKAKMTQALRFFKESTGQQHLLAQVWAPVKNRGRYVLT  154

Query  761   TGDQPFQLDLKCPRLAHYRDISINYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKR  940
             T  QPF L      L  YR +S+ Y F ++ +   ++GLPGRVF  K+PEWTP+VQ +  
Sbjct  155   TSGQPFVLAPNSNGLHQYRMVSLTYMFSLDGERDGDLGLPGRVFRKKLPEWTPNVQYYSS  214

Query  941   EEYPRVGHAQRYDVRGTFAVPVFDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVD  1120
             +E+ R+GHA  Y+V+GT A+PVF+   + C+GV+E+++T+ K+ Y  E++ VCKALE V+
Sbjct  215   KEFSRLGHALHYNVQGTLALPVFEPSRQLCVGVVELIMTSPKINYAPEVEKVCKALEAVN  274

Query  1121  LRGSKISNVRNVKTCH-SYQVVLPEILEVLKSACATHKLPLAQTWVPCVQQG--------  1273
             L+ S+I N    + C+   Q  L EILE+L   C T+KLPLAQTWVPC  +         
Sbjct  275   LKTSEILNHETTQICNEGRQNALAEILEILTVVCETYKLPLAQTWVPCRHRSVLAFGGGF  334

Query  1274  KEGLRHSDENLLR--CVSTVDSACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPC  1447
             K+     D + +   C+ST D A Y+ D  + GF +AC+EHHL KG GV GRAF++   C
Sbjct  335   KKSCSSFDGSCMGKVCMSTSDLAVYVVDAHVWGFRDACAEHHLQKGQGVAGRAFLSGNLC  394

Query  1448  FSADITSFSKTEYPLSHYARIFSLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKR  1627
             FS D+T F KT+YPL HYAR+F L +  A+ L+ST TG  ++VLEFFLP       E   
Sbjct  395   FSRDVTRFCKTDYPLVHYARMFKLTSCFAVCLKSTFTGDDEYVLEFFLPPAITDESEQDF  454

Query  1628  MLTSLSIIIQN-------VCQtlrvvteqeleeettSPSSKV-AKHSDIRIHKEVPNLKY  1783
             +L SL   ++        V +T     E  LE    S    V +K   IRIH+  P  K 
Sbjct  455   LLGSLFQTMKQHYSSLKVVSETELCENEISLEVVEASEDGMVYSKLEPIRIHRPAPISKD  514

Query  1784  NSSIGPCEEGLSWTSSPMLVQESCMSSSAFQNEKPSELLYKRLPEFVSGSGLSFDSTSGE  1963
                +   E+ LS  S  M   E       FQ  +P       L E               
Sbjct  515   YLELNAPEQKLSLNSDLMENNEVADGFERFQTLEP-------LSE---------------  552

Query  1964  GSAQNVRRAGDKKRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
               A+ V+++ ++KR K EKTI++++LQQYFAGSLKDAAKSLGV
Sbjct  553   --AKTVKKS-ERKRGKTEKTISIEVLQQYFAGSLKDAAKSLGV  592



>ref|XP_010695590.1| PREDICTED: protein NLP7 [Beta vulgaris subsp. vulgaris]
Length=1003

 Score =   349 bits (895),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 203/497 (41%), Positives = 289/497 (58%), Gaps = 32/497 (6%)
 Frame = +2

Query  647   VMDRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDIS  826
             + +R+ QAL Y K+ +    +L QIW PV      VL T  QPF L      L  YR +S
Sbjct  161   IKERMTQALRYFKESTEQNQILAQIWAPVKSGDHYVLTTSGQPFVLGPHSNGLNQYRTVS  220

Query  827   INYEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPV  1006
             + Y F V+ +S   +GLPGRVF  K+PEWTP+VQ +  +EYPRV HA+ Y+VRGT A+PV
Sbjct  221   LMYMFSVDGESVTTLGLPGRVFRQKLPEWTPNVQYYTSKEYPRVNHAKHYNVRGTLALPV  280

Query  1007  FDQGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVV  1183
              +   ++C+GV+E+++T+QK+ Y  E+D VCKALE V+L+ S+I +  N++ C+   Q  
Sbjct  281   LEPSGQSCVGVLELIMTSQKINYAPEVDKVCKALEAVNLKSSEILDHPNIQICNEGRQNA  340

Query  1184  LPEILEVLKSACATHKLPLAQTWVPC----VQQGKEGLRHS----DENLLR--CVSTVDS  1333
             L EILEVL   C T+K+PLAQTWVPC    V     GL+ S    D + +   C+ST D 
Sbjct  341   LAEILEVLTEVCETYKIPLAQTWVPCRHRSVLAYGGGLKKSCSSFDGSCMGQVCMSTTDV  400

Query  1334  ACYIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIF  1513
             A Y+ D  + GF EAC+EHHL KG GV GR+F ++   F  DI+ F K EYPL HYAR+F
Sbjct  401   AFYVVDAHMWGFREACAEHHLQKGQGVAGRSFSSHGLTFCRDISQFCKIEYPLVHYARMF  460

Query  1514  SLQAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteq  1693
              L  + AI LRS  TG  D++LEFFLP       E   +L S+   ++   Q L V + +
Sbjct  461   RLTGSFAICLRSKHTGDDDYILEFFLPLSLTDSAEQLNLLDSILATMKQDLQNLMVASGR  520

Query  1694  eleeettSPSSKVAKHSDIRIHKEVPNLKYNSSIG-PCEEGLSWTSSPMLVQESCMSSSA  1870
              L               + + H E+  +  + ++G   E  LS  + P+   E+   +  
Sbjct  521   TL--------------EEEKKHMEIIEVSVDENLGLQLESNLS--TKPLPATETINGALP  564

Query  1871  FQNEKPSELL---YKRLPEFVSGSGLSFDSTSGEGSAQNVRRAGDKKRMKAEKTITLQIL  2041
                   S+L+    +   + V+G+G S +  +     +  ++  ++KR KAEK I+L++L
Sbjct  565   PIKNSQSQLVETDARNAGKSVAGAGASQNGIT-TTEHKETKKTSERKRGKAEKQISLEVL  623

Query  2042  QQYFAGSLKDAAKSLGV  2092
             QQYFAGSLKDAAKSLGV
Sbjct  624   QQYFAGSLKDAAKSLGV  640



>ref|XP_010107269.1| Protein NLP7 [Morus notabilis]
 gb|EXC14463.1| Protein NLP7 [Morus notabilis]
Length=1042

 Score =   349 bits (895),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 212/511 (41%), Positives = 292/511 (57%), Gaps = 61/511 (12%)
 Frame = +2

Query  653   DRLIQALGYIKDFSRDKDVLIQIWVPVNRDGRRVLVTGDQPFQLDLKCPRLAHYRDISIN  832
             +R+ QAL Y+K+ S D+ VL QIW PV    R VL T  QPF LD     L  YR  S+ 
Sbjct  176   ERMTQALRYLKE-STDQHVLAQIWAPVKSGCRYVLTTSGQPFVLDPDSNGLHQYRMASVM  234

Query  833   YEFPVEEDSQENVGLPGRVFLGKVPEWTPDVQLFKREEYPRVGHAQRYDVRGTFAVPVFD  1012
             Y F V+  +   +GLPGRVF  K+PEWTP+VQ +   EYPR+ HAQ Y+VRG+ A+PVF+
Sbjct  235   YMFSVD-GANGVLGLPGRVFRQKLPEWTPNVQYYSIREYPRLDHAQHYNVRGSLALPVFE  293

Query  1013  QGSRTCLGVIEVVLTTQKVKYRNELDSVCKALEEVDLRGSKISNVRNVKTCH-SYQVVLP  1189
                ++C+GV+E+++T++K+ Y  E+D VCKALE V+LR ++I +  + + C+   Q  L 
Sbjct  294   PSGQSCIGVLELIMTSEKINYAPEVDKVCKALEAVNLRSAEILDHTSPQICNEGRQNALT  353

Query  1190  EILEVLKSACATHKLPLAQTWVPCVQQG----KEGLRHSDENL------LRCVSTVDSAC  1339
             EILE+L +AC THKLP+AQTWVPC+ +       GL+ S  ++        C+ST D A 
Sbjct  354   EILEILTAACETHKLPMAQTWVPCMHRNVLAYGGGLKKSCTSIDGSCMGRVCMSTTDVAF  413

Query  1340  YIADPRIQGFHEACSEHHLLKGLGVVGRAFMTNQPCFSADITSFSKTEYPLSHYARIFSL  1519
             YI D  + GF EAC EHHL KG GV GRAF++   CF  DIT F K +YPL HYAR+F L
Sbjct  414   YIVDAHMWGFREACLEHHLQKGQGVAGRAFLSRNSCFCGDITQFCKNDYPLVHYARMFEL  473

Query  1520  QAAVAIRLRSTCTGSTDFVLEFFLPRDCKSPEEHKRMLTSLSIIIQNVCQtlrvvteqel  1699
              +  AI L+S+ TG+ ++VLEFFLP    +P E + +L SL   ++   Q          
Sbjct  474   TSCFAICLQSSHTGNDNYVLEFFLPPTITNPSEQQALLGSLFATMKKHFQ----------  523

Query  1700  eeettSPSSKVAKHSDIRIHKEVPNLKYNSSIGPCEEGLSWTSSPMLVQESCMS---SSA  1870
                    S KVA    +     V  +K +       EG   T   + V +S  S    SA
Sbjct  524   -------SLKVASGYGLEEEGFVEVIKVSEM-----EGHVSTLERIQVAQSAESPPRPSA  571

Query  1871  FQNEKPSELLYKRLPEFVSGSGLSFDSTSGEG-----------------SAQNVRRAGDK  1999
               N    E+  + L    S   L+ DS++  G                   ++ ++  ++
Sbjct  572   LANG--GEMAQRDL----SKQQLTADSSAANGVHDAVLDGGNMNQVPNPENRDTKKPSER  625

Query  2000  KRMKAEKTITLQILQQYFAGSLKDAAKSLGV  2092
             KR K EK+I+L++LQQYFAGSLKDAAKSLGV
Sbjct  626   KRGKTEKSISLEVLQQYFAGSLKDAAKSLGV  656



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6337946833044