BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18613_g1_i2 len=3788 path=[3988:0-3755 8033:3756-3787]

Length=3788
                                                                      Score     E

ref|XP_009598024.1|  PREDICTED: DNA mismatch repair protein MSH6       1636   0.0      
ref|XP_011079564.1|  PREDICTED: DNA mismatch repair protein MSH6       1562   0.0      
gb|EYU46804.1|  hypothetical protein MIMGU_mgv1a000294mg               1556   0.0      
ref|XP_009802974.1|  PREDICTED: DNA mismatch repair protein MSH6       1555   0.0      
gb|AAT67045.1|  DNA mismatch repair protein                            1542   0.0      Petunia x hybrida [garden petunia]
ref|XP_004229396.2|  PREDICTED: uncharacterized protein LOC101243927   1537   0.0      
ref|XP_006349194.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1528   0.0      
ref|XP_002275930.1|  PREDICTED: DNA mismatch repair protein MSH6       1485   0.0      Vitis vinifera
emb|CBI36942.3|  unnamed protein product                               1457   0.0      
ref|XP_007051089.1|  MUTS isoform 1                                    1454   0.0      
emb|CDP17077.1|  unnamed protein product                               1452   0.0      
gb|KDP28248.1|  hypothetical protein JCGZ_14019                        1450   0.0      
ref|XP_004300462.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...   1435   0.0      
ref|XP_009378706.1|  PREDICTED: DNA mismatch repair protein MSH6       1434   0.0      
ref|XP_008235198.1|  PREDICTED: DNA mismatch repair protein MSH6       1434   0.0      
ref|XP_007201220.1|  hypothetical protein PRUPE_ppa000344mg            1428   0.0      
ref|XP_006444483.1|  hypothetical protein CICLE_v10018525mg            1424   0.0      
gb|KDO87011.1|  hypothetical protein CISIN_1g000778mg                  1424   0.0      
ref|XP_006492326.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1424   0.0      
ref|XP_011041329.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1422   0.0      
ref|XP_002515294.1|  ATP binding protein, putative                     1415   0.0      Ricinus communis
ref|XP_010087248.1|  DNA mismatch repair protein Msh6-1                1415   0.0      
ref|XP_010259326.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1414   0.0      
ref|XP_011041321.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1413   0.0      
ref|XP_002320307.2|  DNA mismatch repair protein MSH6-1                1412   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004494416.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1402   0.0      
ref|XP_010038284.1|  PREDICTED: DNA mismatch repair protein MSH6       1399   0.0      
emb|CAN78918.1|  hypothetical protein VITISV_032225                    1391   0.0      Vitis vinifera
ref|XP_006604739.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1390   0.0      
gb|KHN43463.1|  DNA mismatch repair protein Msh6-1                     1384   0.0      
ref|XP_007163172.1|  hypothetical protein PHAVU_001G212500g            1381   0.0      
gb|AES82183.2|  DNA mismatch repair MSH3-like protein                  1374   0.0      
ref|XP_008451484.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1367   0.0      
ref|XP_004136154.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1359   0.0      
ref|XP_003625965.1|  DNA mismatch repair protein Msh6-1                1357   0.0      
ref|XP_010932609.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...   1352   0.0      
ref|XP_010679365.1|  PREDICTED: DNA mismatch repair protein MSH6       1351   0.0      
emb|CDX91808.1|  BnaC03g31100D                                         1350   0.0      
ref|XP_010456087.1|  PREDICTED: DNA mismatch repair protein MSH6       1349   0.0      
ref|XP_006396405.1|  hypothetical protein EUTSA_v10028364mg            1347   0.0      
ref|XP_009134448.1|  PREDICTED: DNA mismatch repair protein MSH6       1345   0.0      
emb|CDX90956.1|  BnaA03g26360D                                         1345   0.0      
ref|XP_008800758.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1343   0.0      
ref|XP_010429135.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1340   0.0      
ref|XP_010422644.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1338   0.0      
ref|XP_010422643.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1338   0.0      
ref|XP_010556698.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1337   0.0      
ref|XP_010556697.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1337   0.0      
ref|NP_192116.1|  DNA mismatch repair protein MSH6                     1334   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK30776.1|  hypothetical protein AALP_AA6G024700                   1333   0.0      
ref|NP_001190656.1|  DNA mismatch repair protein MSH6                  1330   0.0      
ref|XP_002874942.1|  hypothetical protein ARALYDRAFT_912022            1320   0.0      
ref|XP_006286904.1|  hypothetical protein CARUB_v10000048mg            1315   0.0      
gb|AAB57798.1|  AGAA.3                                                 1312   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286903.1|  hypothetical protein CARUB_v10000048mg            1310   0.0      
ref|XP_009401272.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1291   0.0      
gb|KDO87012.1|  hypothetical protein CISIN_1g000778mg                  1256   0.0      
gb|KDO87013.1|  hypothetical protein CISIN_1g000778mg                  1256   0.0      
ref|XP_006841417.1|  hypothetical protein AMTR_s00003p00029910         1252   0.0      
ref|XP_010259327.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1248   0.0      
ref|XP_009401273.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1233   0.0      
ref|XP_004956779.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1208   0.0      
ref|XP_008345257.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1206   0.0      
ref|XP_003576514.1|  PREDICTED: DNA mismatch repair protein MSH6       1206   0.0      
gb|KDO87014.1|  hypothetical protein CISIN_1g000778mg                  1205   0.0      
ref|XP_010259328.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1199   0.0      
ref|XP_006661208.1|  PREDICTED: DNA mismatch repair protein MSH6-...   1199   0.0      
gb|EAZ44682.1|  hypothetical protein OsJ_29308                         1196   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800759.1|  PREDICTED: DNA mismatch repair protein MSH6 ...   1195   0.0      
dbj|BAD36244.1|  putative mismatch binding protein Mus3                1195   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008652696.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...   1184   0.0      
ref|XP_008369112.1|  PREDICTED: DNA mismatch repair protein MSH6       1177   0.0      
dbj|BAK02401.1|  predicted protein                                     1175   0.0      
gb|EAZ09056.1|  hypothetical protein OsI_31317                         1163   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007051090.1|  MUTS isoform 2                                    1157   0.0      
gb|EPS69161.1|  hypothetical protein M569_05605                        1019   0.0      
ref|XP_002311781.2|  hypothetical protein POPTR_0008s19530g            1011   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO87015.1|  hypothetical protein CISIN_1g000778mg                   986   0.0      
ref|XP_002981472.1|  hypothetical protein SELMODRAFT_114224             963   0.0      
ref|XP_002970000.1|  hypothetical protein SELMODRAFT_410679             962   0.0      
ref|XP_002460193.1|  hypothetical protein SORBIDRAFT_02g024370          788   0.0      Sorghum bicolor [broomcorn]
gb|KHN19219.1|  DNA mismatch repair protein Msh6-1                      778   0.0      
gb|AAF35250.1|AF227632_1  mismatch binding protein Mus3                 761   0.0      Zea mays [maize]
gb|EMS59892.1|  DNA mismatch repair protein Msh6-1                      684   0.0      
ref|XP_005644720.1|  hypothetical protein COCSUDRAFT_18682              686   0.0      
gb|EMT09462.1|  DNA mismatch repair protein Msh6-1                      659   0.0      
ref|XP_001418476.1|  predicted protein                                  670   0.0      Ostreococcus lucimarinus CCE9901
emb|CEF98388.1|  DNA mismatch repair protein MutS-homologue MSH6        662   0.0      
ref|XP_002953223.1|  hypothetical protein VOLCADRAFT_105835             665   0.0      
ref|XP_005152105.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    652   0.0      
ref|XP_009498652.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    649   0.0      
gb|KFW73771.1|  DNA mismatch repair protein Msh6                        649   0.0      
ref|XP_009498577.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    649   0.0      
ref|XP_010013366.1|  PREDICTED: DNA mismatch repair protein Msh6        647   0.0      
ref|XP_009955505.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    647   0.0      
ref|XP_009955504.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    647   0.0      
ref|XP_009703449.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    647   0.0      
ref|XP_009703448.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    647   0.0      
gb|KFQ00736.1|  DNA mismatch repair protein Msh6                        647   0.0      
ref|XP_009469486.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    647   0.0      
ref|XP_009469485.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    647   0.0      
ref|XP_009893116.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    646   0.0      
ref|XP_005895692.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    640   0.0      
ref|XP_008944973.1|  PREDICTED: DNA mismatch repair protein Msh6        645   0.0      
ref|XP_009984584.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    646   0.0      
ref|XP_009984583.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    646   0.0      
ref|XP_010132772.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    646   0.0      
ref|XP_009270965.1|  PREDICTED: DNA mismatch repair protein Msh6        642   0.0      
gb|KFV18064.1|  DNA mismatch repair protein Msh6                        646   0.0      
gb|KFQ20814.1|  DNA mismatch repair protein Msh6                        645   0.0      
gb|KFO88702.1|  DNA mismatch repair protein Msh6                        646   0.0      
gb|KFM03114.1|  DNA mismatch repair protein Msh6                        642   0.0      
ref|XP_010132771.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    645   0.0      
ref|XP_005229333.1|  PREDICTED: DNA mismatch repair protein Msh6        645   0.0      
ref|XP_008529698.1|  PREDICTED: DNA mismatch repair protein Msh6        644   0.0      
ref|XP_009560846.1|  PREDICTED: DNA mismatch repair protein Msh6        644   0.0      
ref|XP_005440331.1|  PREDICTED: DNA mismatch repair protein Msh6        644   0.0      
ref|XP_010307417.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    644   0.0      
ref|XP_010307416.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    644   0.0      
gb|KFO77406.1|  DNA mismatch repair protein Msh6                        644   0.0      
ref|XP_005391051.1|  PREDICTED: DNA mismatch repair protein Msh6        645   0.0      
emb|CCA22891.1|  PREDICTED: similar to G/T mismatch binding prote...    642   0.0      
ref|XP_007942603.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
gb|KFQ88383.1|  DNA mismatch repair protein Msh6                        644   0.0      
ref|XP_004328246.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    642   0.0      
ref|XP_010292690.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    643   0.0      
ref|XP_010292689.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    643   0.0      
gb|KFO14162.1|  DNA mismatch repair protein Msh6                        644   0.0      
gb|KFW62049.1|  DNA mismatch repair protein Msh6                        644   0.0      
gb|KFQ82192.1|  DNA mismatch repair protein Msh6                        643   0.0      
ref|XP_009331892.1|  PREDICTED: DNA mismatch repair protein Msh6        643   0.0      
ref|XP_008499374.1|  PREDICTED: DNA mismatch repair protein Msh6        643   0.0      
ref|XP_004686277.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    642   0.0      
ref|XP_009935608.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    643   0.0      
ref|XP_009935609.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    642   0.0      
ref|XP_010003282.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    642   0.0      
ref|XP_005980707.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
ref|XP_004265022.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    641   0.0      
ref|XP_007111684.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    643   0.0      
ref|XP_010003283.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    642   0.0      
ref|XP_009805637.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    642   0.0      
ref|XP_009805636.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    642   0.0      
ref|XP_009869985.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    640   0.0      
ref|XP_010003281.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    642   0.0      
ref|XP_010614100.1|  PREDICTED: DNA mismatch repair protein Msh6        642   0.0      
gb|KFU95180.1|  DNA mismatch repair protein Msh6                        642   0.0      
gb|KFQ48090.1|  DNA mismatch repair protein Msh6                        642   0.0      
emb|CCI45044.1|  unnamed protein product                                640   0.0      
ref|XP_009869984.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    640   0.0      
ref|XP_005324540.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    638   0.0      
ref|XP_004436727.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    641   0.0      
gb|KFV49979.1|  DNA mismatch repair protein Msh6                        642   0.0      
ref|XP_003417633.2|  PREDICTED: DNA mismatch repair protein Msh6        643   0.0      
ref|XP_006216496.1|  PREDICTED: DNA mismatch repair protein Msh6-...    635   0.0      
ref|XP_002935421.2|  PREDICTED: DNA mismatch repair protein Msh6        644   0.0      
ref|XP_009487242.1|  PREDICTED: DNA mismatch repair protein Msh6        641   0.0      
ref|XP_009584805.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    641   0.0      
ref|XP_009584804.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    641   0.0      
gb|KFP47728.1|  DNA mismatch repair protein Msh6                        642   0.0      
ref|XP_009076584.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    641   0.0      
ref|XP_006185841.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    635   0.0      
gb|KFV98003.1|  DNA mismatch repair protein Msh6                        642   0.0      
ref|XP_005895691.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    640   0.0      
gb|EDM02631.1|  rCG61559                                                644   0.0      Rattus norvegicus [brown rat]
ref|XP_007111682.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    643   0.0      
ref|XP_006164752.1|  PREDICTED: DNA mismatch repair protein Msh6        643   0.0      
ref|XP_009904180.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    640   0.0      
ref|XP_008569880.1|  PREDICTED: DNA mismatch repair protein Msh6        640   0.0      
ref|XP_009904173.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    640   0.0      
ref|XP_005354777.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_006239797.2|  PREDICTED: DNA mismatch repair protein Msh6        645   0.0      
gb|KFV62076.1|  DNA mismatch repair protein Msh6                        640   0.0      
ref|XP_005508183.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_005508182.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_005662624.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_010126363.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_008698065.1|  PREDICTED: DNA mismatch repair protein Msh6        639   0.0      
ref|XP_005324539.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_007460044.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    638   0.0      
ref|XP_007942602.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    638   0.0      
ref|XP_008160380.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|XP_010126364.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_009646497.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_009646495.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_009646496.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
gb|KFP45611.1|  DNA mismatch repair protein Msh6                        639   0.0      
gb|EMC84167.1|  DNA mismatch repair protein Msh6                        639   0.0      
gb|KFQ05143.1|  DNA mismatch repair protein Msh6                        639   0.0      
ref|XP_003787948.1|  PREDICTED: DNA mismatch repair protein Msh6-...    632   0.0      
gb|KFP10594.1|  DNA mismatch repair protein Msh6                        639   0.0      
ref|XP_006880967.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    635   0.0      
ref|XP_006736892.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    632   0.0      
ref|XP_005709474.1|  PREDICTED: LOW QUALITY PROTEIN: mutS homolog 6     639   0.0      
ref|XP_007190110.1|  PREDICTED: DNA mismatch repair protein Msh6        641   0.0      
ref|XP_004877705.1|  PREDICTED: DNA mismatch repair protein Msh6-...    642   0.0      
ref|XP_004839467.1|  PREDICTED: DNA mismatch repair protein Msh6-...    641   0.0      
ref|XP_006225732.2|  PREDICTED: DNA mismatch repair protein Msh6        643   0.0      
ref|XP_009972937.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    638   0.0      
ref|XP_004328245.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    641   0.0      
ref|XP_004403448.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
gb|EHA98524.1|  DNA mismatch repair protein Msh6                        641   0.0      
ref|XP_010362592.1|  PREDICTED: DNA mismatch repair protein Msh6        637   0.0      
ref|XP_004265021.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    640   0.0      
ref|XP_010172797.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
ref|XP_006880966.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    636   0.0      
ref|XP_004686276.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    640   0.0      
ref|XP_004482463.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    640   0.0      
ref|XP_010172796.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
ref|XP_003922807.1|  PREDICTED: DNA mismatch repair protein Msh6        640   0.0      
ref|XP_009688453.1|  PREDICTED: DNA mismatch repair protein Msh6        637   0.0      
gb|KFV75249.1|  DNA mismatch repair protein Msh6                        638   0.0      
pdb|2O8B|B  Chain B, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND ...    630   0.0      
ref|XP_005980706.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
gb|KFZ48495.1|  DNA mismatch repair protein Msh6                        637   0.0      
ref|XP_007084766.1|  PREDICTED: DNA mismatch repair protein Msh6        637   0.0      
ref|XP_006048108.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    636   0.0      
ref|XP_004436726.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
gb|ELR56463.1|  DNA mismatch repair protein Msh6                        639   0.0      
ref|XP_010836952.1|  PREDICTED: DNA mismatch repair protein Msh6        639   0.0      
ref|XP_006839497.1|  PREDICTED: DNA mismatch repair protein Msh6-...    635   0.0      
ref|XP_531814.2|  PREDICTED: DNA mismatch repair protein Msh6           637   0.0      Canis lupus familiaris [dogs]
ref|XP_005895689.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|NP_001179666.1|  DNA mismatch repair protein Msh6                   639   0.0      
ref|XP_004590720.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    635   0.0      
ref|XP_003984017.1|  PREDICTED: DNA mismatch repair protein Msh6        639   0.0      
ref|XP_005212721.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
gb|EOB06796.1|  DNA mismatch repair protein Msh6                        636   0.0      
ref|NP_001268422.1|  DNA mismatch repair protein Msh6 isoform 3         629   0.0      
ref|XP_005895690.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    639   0.0      
ref|XP_005662623.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    638   0.0      
ref|XP_006216495.1|  PREDICTED: DNA mismatch repair protein Msh6-...    635   0.0      
ref|XP_005354776.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    638   0.0      
ref|XP_003354884.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    638   0.0      
ref|XP_010200882.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    635   0.0      
ref|XP_008160379.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    634   0.0      
ref|XP_007460043.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    638   0.0      
ref|XP_005012145.1|  PREDICTED: DNA mismatch repair protein Msh6        636   0.0      
ref|XP_005864869.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    634   0.0      
ref|XP_010200881.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    635   0.0      
ref|XP_004029255.1|  PREDICTED: DNA mismatch repair protein Msh6        634   0.0      
ref|XP_003473125.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    637   0.0      
ref|XP_004618660.1|  PREDICTED: DNA mismatch repair protein Msh6        637   0.0      
ref|XP_005324537.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
ref|XP_005324538.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
ref|XP_003262610.1|  PREDICTED: DNA mismatch repair protein Msh6        635   0.0      
ref|XP_003787949.1|  PREDICTED: DNA mismatch repair protein Msh6-...    633   0.0      
ref|NP_001268421.1|  DNA mismatch repair protein Msh6 isoform 2         633   0.0      
ref|XP_004369538.1|  PREDICTED: DNA mismatch repair protein Msh6        637   0.0      
ref|XP_007942601.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
ref|XP_004627799.1|  PREDICTED: DNA mismatch repair protein Msh6        636   0.0      
ref|XP_006736891.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|XP_006083436.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|XP_002912469.1|  PREDICTED: DNA mismatch repair protein Msh6-...    637   0.0      
dbj|BAG65496.1|  unnamed protein product                                628   0.0      Homo sapiens [man]
ref|XP_007942600.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    637   0.0      
ref|XP_006185840.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    634   0.0      
ref|XP_005264328.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    634   0.0      
ref|XP_006269601.1|  PREDICTED: DNA mismatch repair protein Msh6        632   0.0      
ref|XP_010704786.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    634   0.0      
ref|XP_006736890.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|XP_010704785.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|XP_009918569.1|  PREDICTED: DNA mismatch repair protein Msh6        631   0.0      
ref|XP_010576155.1|  PREDICTED: DNA mismatch repair protein Msh6        631   0.0      
ref|XP_010982329.1|  PREDICTED: DNA mismatch repair protein Msh6        633   0.0      
ref|XP_004023308.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    635   0.0      
ref|XP_006048106.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    635   0.0      
ref|XP_004403447.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    635   0.0      
gb|EHH22110.1|  hypothetical protein EGK_05312                          632   0.0      
ref|XP_006048107.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    635   0.0      
ref|XP_006880965.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    635   0.0      
ref|XP_010181851.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    632   0.0      
ref|XP_010181850.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    632   0.0      
ref|XP_010209974.1|  PREDICTED: DNA mismatch repair protein Msh6        630   0.0      
ref|XP_007537087.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    631   0.0      
ref|XP_009091923.1|  PREDICTED: DNA mismatch repair protein Msh6        632   0.0      
ref|XP_005491528.1|  PREDICTED: DNA mismatch repair protein Msh6        632   0.0      
gb|KFQ34770.1|  DNA mismatch repair protein Msh6                        632   0.0      
ref|XP_004752920.1|  PREDICTED: DNA mismatch repair protein Msh6        635   0.0      
ref|XP_006839496.1|  PREDICTED: DNA mismatch repair protein Msh6-...    634   0.0      
ref|XP_004590719.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    634   0.0      
ref|XP_004660205.1|  PREDICTED: DNA mismatch repair protein Msh6        634   0.0      
ref|NP_000170.1|  DNA mismatch repair protein Msh6 isoform 1            634   0.0      
ref|XP_010391828.1|  PREDICTED: DNA mismatch repair protein Msh6        631   0.0      
gb|AAL87401.1|  mutS homolog 6 (E. coli)                                634   0.0      
ref|XP_010966051.1|  PREDICTED: DNA mismatch repair protein Msh6        631   0.0      
gb|KFO56685.1|  DNA mismatch repair protein Msh6                        631   0.0      
ref|XP_002906424.1|  DNA mismatch repair protein Msh6, putative         630   0.0      
ref|XP_008628596.1|  PREDICTED: DNA mismatch repair protein Msh6        631   0.0      
ref|XP_009235600.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    630   0.0      
gb|AAB47425.1|  bacterial MutS homolog                                  634   0.0      
ref|XP_005864868.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|XP_008252658.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|XP_008160378.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
dbj|BAC40242.1|  unnamed protein product                                633   0.0      
ref|XP_006083435.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|XP_006083434.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|XP_005575996.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    629   0.0      
ref|XP_002709926.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    633   0.0      
ref|NP_034960.1|  DNA mismatch repair protein Msh6                      632   0.0      
dbj|BAA23674.1|  GTBP-N                                                 632   0.0      
ref|XP_008978971.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    623   0.0      
gb|EDL38637.1|  mCG15886                                                633   0.0      
ref|XP_003787947.1|  PREDICTED: DNA mismatch repair protein Msh6-...    632   0.0      
ref|XP_003908683.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    632   0.0      
ref|XP_007968897.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    632   0.0      
ref|XP_006736889.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    632   0.0      
ref|NP_001253005.1|  DNA mismatch repair protein Msh6                   632   0.0      
ref|XP_002118131.1|  hypothetical protein TRIADDRAFT_33687              620   0.0      
ref|XP_006986582.1|  PREDICTED: DNA mismatch repair protein Msh6        632   0.0      
gb|KGL75242.1|  DNA mismatch repair protein Msh6                        630   0.0      
gb|EHH55558.1|  hypothetical protein EGM_04790                          628   0.0      
gb|ETO66438.1|  hypothetical protein F444_16366                         629   0.0      
gb|ETK77910.1|  hypothetical protein L915_15936                         629   0.0      
gb|AAC53034.1|  G/T-mismatch binding protein                            631   0.0      
ref|XP_008974503.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    629   0.0      
gb|ETP07553.1|  hypothetical protein F441_16227                         629   0.0      
ref|XP_005575997.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    629   0.0      
ref|XP_005043031.1|  PREDICTED: DNA mismatch repair protein Msh6        629   0.0      
ref|XP_006909673.1|  PREDICTED: DNA mismatch repair protein Msh6        631   0.0      
gb|ETI37644.1|  hypothetical protein F443_16397                         628   0.0      
ref|XP_007626984.1|  PREDICTED: DNA mismatch repair protein Msh6        628   0.0      
ref|XP_006014788.1|  PREDICTED: DNA mismatch repair protein Msh6        626   0.0      
ref|XP_003822731.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    629   0.0      
ref|XP_007537084.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    630   0.0      
ref|XP_002812092.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    630   0.0      
ref|XP_008911498.1|  hypothetical protein PPTG_16016                    628   0.0      
ref|XP_007537086.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    630   0.0      
ref|XP_005575995.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    629   0.0      
ref|XP_005523320.1|  PREDICTED: DNA mismatch repair protein Msh6        627   0.0      
ref|XP_007537085.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    629   0.0      
ref|XP_008821267.1|  PREDICTED: DNA mismatch repair protein Msh6        629   0.0      
gb|ETM37702.1|  hypothetical protein L914_15765                         627   0.0      
gb|EKC25057.1|  DNA mismatch repair protein Msh6                        629   0.0      
ref|XP_005575994.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    629   0.0      
ref|XP_009440710.1|  PREDICTED: DNA mismatch repair protein Msh6        629   0.0      
ref|XP_002196049.2|  PREDICTED: DNA mismatch repair protein Msh6        628   0.0      
ref|XP_419359.3|  PREDICTED: DNA mismatch repair protein Msh6           627   0.0      
ref|XP_007638490.1|  PREDICTED: DNA mismatch repair protein Msh6        624   0.0      
ref|XP_003758343.1|  PREDICTED: DNA mismatch repair protein Msh6        628   0.0      
ref|XP_007434749.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    620   0.0      
ref|NP_001089247.1|  mutS homolog 6                                     625   0.0      
ref|XP_005999349.1|  PREDICTED: DNA mismatch repair protein Msh6        626   0.0      
ref|XP_004699805.1|  PREDICTED: DNA mismatch repair protein Msh6        625   0.0      
ref|XP_008068714.1|  PREDICTED: DNA mismatch repair protein Msh6        625   0.0      
ref|XP_001382177.2|  PREDICTED: DNA mismatch repair protein Msh6        629   0.0      
ref|XP_003964252.1|  PREDICTED: DNA mismatch repair protein Msh6-...    620   0.0      
ref|XP_007968898.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    618   0.0      
ref|XP_007968896.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    619   0.0      
ref|XP_009182420.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    619   0.0      
ref|XP_008428142.1|  PREDICTED: DNA mismatch repair protein Msh6        616   0.0      
ref|XP_010728752.1|  PREDICTED: DNA mismatch repair protein Msh6        615   0.0      
ref|XP_007064961.1|  PREDICTED: DNA mismatch repair protein Msh6        611   0.0      
gb|ETE73130.1|  DNA mismatch repair protein Msh6                        612   0.0      
ref|XP_007546282.1|  PREDICTED: DNA mismatch repair protein Msh6        612   0.0      
ref|XP_003441053.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    612   0.0      
ref|XP_005474077.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    612   0.0      
ref|XP_002508822.1|  predicted protein                                  613   0.0      
ref|XP_006131820.1|  PREDICTED: DNA mismatch repair protein Msh6        609   0.0      
ref|XP_005806875.1|  PREDICTED: DNA mismatch repair protein Msh6-...    612   0.0      
emb|CDQ79615.1|  unnamed protein product                                611   0.0      
ref|XP_005308108.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    610   0.0      
ref|XP_010776276.1|  PREDICTED: DNA mismatch repair protein Msh6        611   0.0      
ref|XP_004556098.1|  PREDICTED: DNA mismatch repair protein Msh6-...    610   0.0      
ref|XP_004556097.1|  PREDICTED: DNA mismatch repair protein Msh6-...    609   0.0      
ref|XP_008100917.1|  PREDICTED: DNA mismatch repair protein Msh6        608   0.0      
ref|XP_008281190.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    609   0.0      
ref|XP_008281189.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    609   0.0      
ref|XP_008612866.1|  hypothetical protein SDRG_08747                    604   0.0      
ref|XP_005426282.1|  PREDICTED: DNA mismatch repair protein Msh6        603   0.0      
gb|KDO29230.1|  hypothetical protein SPRG_05442                         600   0.0      
ref|XP_004077496.1|  PREDICTED: DNA mismatch repair protein Msh6-...    606   0.0      
ref|XP_006638840.1|  PREDICTED: DNA mismatch repair protein Msh6-...    605   0.0      
ref|XP_005737128.1|  PREDICTED: DNA mismatch repair protein Msh6-...    605   0.0      
ref|XP_005737127.1|  PREDICTED: DNA mismatch repair protein Msh6-...    605   0.0      
ref|XP_005915505.1|  PREDICTED: DNA mismatch repair protein Msh6-...    605   0.0      
ref|XP_005915504.1|  PREDICTED: DNA mismatch repair protein Msh6-...    605   0.0      
ref|XP_008869574.1|  hypothetical protein H310_06332                    592   0.0      
ref|XP_009839367.1|  hypothetical protein H257_13519                    598   0.0      
ref|XP_001946118.2|  PREDICTED: DNA mismatch repair protein Msh6        597   0.0      
ref|NP_878280.1|  DNA mismatch repair protein Msh6                      602   0.0      
ref|XP_006800871.1|  PREDICTED: DNA mismatch repair protein Msh6-...    600   0.0      
ref|XP_006800870.1|  PREDICTED: DNA mismatch repair protein Msh6-...    600   0.0      
gb|AAL04170.1|AF412834_1  mismatch repair protein Msh6                  599   0.0      
emb|CBJ25567.1|  MutS protein homolog 6                                 597   0.0      
ref|XP_008320483.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    596   0.0      
ref|XP_010899450.1|  PREDICTED: DNA mismatch repair protein Msh6        595   0.0      
gb|AGH55779.1|  MSH6                                                    581   0.0      
gb|ELV12486.1|  DNA mismatch repair protein Msh6                        592   0.0      
ref|XP_007111683.1|  PREDICTED: DNA mismatch repair protein Msh6 ...    592   0.0      
ref|XP_002426429.1|  conserved hypothetical protein                     590   0.0      
ref|XP_002602365.1|  hypothetical protein BRAFLDRAFT_283756             590   0.0      
ref|XP_009052104.1|  hypothetical protein LOTGIDRAFT_143393             589   0.0      
gb|EPY80326.1|  DNA mismatch repair protein Msh6                        584   0.0      
ref|XP_010157051.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    584   0.0      
ref|XP_008933063.1|  PREDICTED: DNA mismatch repair protein Msh6        578   0.0      
ref|XP_003699487.1|  PREDICTED: probable DNA mismatch repair prot...    572   2e-179   
gb|EZA53100.1|  putative DNA mismatch repair protein Msh6               569   9e-178   
gb|ESA09896.1|  hypothetical protein GLOINDRAFT_348440                  569   1e-177   
ref|XP_001600292.1|  PREDICTED: probable DNA mismatch repair prot...    567   4e-177   
ref|XP_392346.4|  PREDICTED: probable DNA mismatch repair protein...    565   9e-177   
ref|XP_003689671.1|  PREDICTED: probable DNA mismatch repair prot...    565   1e-176   
ref|XP_004365686.1|  mismatch repair protein Msh6                       570   3e-176   
ref|XP_003395049.1|  PREDICTED: probable DNA mismatch repair prot...    563   5e-176   
gb|ETN62362.1|  DNA mismatch repair protein mut                         564   8e-176   
gb|EFW40290.2|  mismatch repair protein Msh6                            569   9e-176   
ref|XP_003492265.1|  PREDICTED: probable DNA mismatch repair prot...    563   1e-175   
gb|EFN63608.1|  Probable DNA mismatch repair protein Msh6               561   3e-175   
ref|XP_006616033.1|  PREDICTED: probable DNA mismatch repair prot...    560   1e-174   
gb|ELU18588.1|  hypothetical protein CAPTEDRAFT_139957                  563   2e-174   
tpg|DAA61384.1|  TPA: hypothetical protein ZEAMMB73_756272              547   3e-174   
ref|XP_009009263.1|  hypothetical protein HELRODRAFT_187909             565   6e-174   
gb|KFB35004.1|  hypothetical protein ZHAS_00000820                      558   3e-173   
ref|XP_005105604.1|  PREDICTED: DNA mismatch repair protein Msh6-...    560   1e-172   
ref|XP_001863325.1|  DNA mismatch repair protein MSH6                   554   1e-172   
ref|XP_001661901.1|  DNA mismatch repair protein muts                   553   5e-172   
ref|XP_008558479.1|  PREDICTED: probable DNA mismatch repair prot...    553   6e-172   
gb|EFN84313.1|  Probable DNA mismatch repair protein Msh6               553   7e-172   
ref|XP_971522.2|  PREDICTED: probable DNA mismatch repair protein...    552   8e-172   
ref|XP_011056156.1|  PREDICTED: probable DNA mismatch repair prot...    552   1e-171   
ref|XP_003742162.1|  PREDICTED: DNA mismatch repair protein Msh6-...    551   3e-171   
emb|CCD78830.1|  hypothetical protein Smp_042670.2                      550   3e-171   
gb|EFX80747.1|  putative MSH6, mismatch repair ATPase                   554   1e-170   
ref|XP_007895097.1|  PREDICTED: DNA mismatch repair protein Msh6        551   3e-170   
gb|KDR17272.1|  DNA mismatch repair protein Msh6                        554   3e-170   
ref|XP_009176126.1|  hypothetical protein T265_11255                    549   6e-170   
gb|EFA11424.1|  hypothetical protein TcasGA2_TC013601                   546   9e-170   
ref|XP_005181193.1|  PREDICTED: probable DNA mismatch repair prot...    548   1e-169   
ref|XP_002126574.2|  PREDICTED: DNA mismatch repair protein Msh6        548   2e-169   
ref|XP_312887.5|  AGAP003190-PA                                         548   2e-168   
emb|CCD78831.1|  hypothetical protein Smp_042670.1                      540   7e-168   
ref|NP_648755.1|  Msh6                                                  543   1e-167   
emb|CDJ85851.1|  DNA mismatch repair protein MutS domain containi...    540   8e-167   
ref|XP_002095136.1|  GE19856                                            540   2e-166   
ref|XP_002084936.1|  GD12570                                            540   2e-166   
gb|KFD57294.1|  hypothetical protein M513_01805                         539   2e-166   
ref|XP_002030569.1|  GM24498                                            540   2e-166   
ref|XP_004337484.1|  MutS domain V domain containing protein            538   2e-166   
ref|XP_001958088.1|  GF10737                                            538   1e-165   
ref|XP_007238510.1|  PREDICTED: DNA mismatch repair protein Msh6-...    540   2e-165   
ref|XP_797647.3|  PREDICTED: DNA mismatch repair protein Msh6-like      541   2e-164   
emb|CDS15819.1|  dna mismatch repair protein msh6                       534   4e-164   
ref|XP_001973060.1|  GG13556                                            533   4e-164   
emb|CDW86252.1|  dna repair                                             532   5e-164   
gb|KFH66766.1|  DNA mismatch repair protein MSH6                        533   7e-163   
emb|CDJ03351.1|  dna mismatch repair protein msh6                       530   2e-162   
ref|XP_004522344.1|  PREDICTED: probable DNA mismatch repair prot...    527   1e-161   
gb|KGB34492.1|  DNA mismatch repair protein Msh6                        525   3e-161   
ref|XP_008558477.1|  PREDICTED: probable DNA mismatch repair prot...    524   7e-161   
ref|XP_008558478.1|  PREDICTED: probable DNA mismatch repair prot...    524   7e-161   
ref|XP_002048220.1|  GJ11467                                            524   2e-160   
ref|XP_001353167.1|  GA20021                                            523   4e-160   
ref|XP_002068471.1|  GK20488                                            521   1e-159   
emb|CDW51812.1|  DNA mismatch repair protein Msh6                       514   1e-159   
gb|EUB63669.1|  DNA mismatch repair protein Msh6                        520   6e-159   
gb|ERG86268.1|  dna mismatch repair protein msh6                        518   1e-157   
gb|EJY65086.1|  MutS domain III family protein                          516   1e-157   
gb|EMT09463.1|  DNA mismatch repair protein Msh6-1                      506   2e-157   
ref|XP_002007712.1|  GI12236                                            514   1e-156   
gb|ERL84752.1|  hypothetical protein D910_02177                         510   2e-156   
gb|EGT38526.1|  hypothetical protein CAEBREN_00497                      511   3e-156   
emb|CAG09472.1|  unnamed protein product                                513   3e-156   
ref|XP_007513008.1|  DNA mismatch repair protein MutS                   515   1e-155   
ref|XP_001985388.1|  GH17031                                            510   2e-155   
emb|CEG72318.1|  hypothetical protein RMATCC62417_07899                 508   3e-155   
emb|CEI86399.1|  hypothetical protein RMCBS344292_00840                 506   1e-154   
ref|XP_007585514.1|  putative dna mismatch repair protein               508   1e-154   
ref|XP_003139141.1|  hypothetical protein LOAG_03556                    507   4e-154   
ref|XP_009515465.1|  hypothetical protein PHYSODRAFT_353490             495   4e-153   
ref|XP_007875139.1|  hypothetical protein PNEG_03083                    501   2e-152   
gb|EGT56909.1|  CBN-MSH-6 protein                                       502   3e-152   
gb|KHJ98645.1|  MutS domain V protein                                   500   4e-152   
gb|EFA80990.1|  Muts-like protein                                       502   4e-152   
gb|EPZ31646.1|  DNA mismatch repair protein MutS-like domain-cont...    494   9e-152   
gb|EPB93010.1|  hypothetical protein HMPREF1544_00084                   499   1e-151   
gb|EKG21378.1|  hypothetical protein MPH_01370                          500   1e-151   
emb|CBK24521.2|  unnamed protein product                                501   2e-151   
emb|CDI95603.1|  dna mismatch repair protein msh6                       500   3e-151   
dbj|GAM20051.1|  hypothetical protein SAMD00019534_032260               495   3e-150   
ref|XP_002151866.1|  DNA mismatch repair protein Msh6, putative         496   5e-150   
ref|NP_491163.1|  Protein MSH-6                                         495   8e-150   
dbj|GAA82773.1|  DNA mismatch repair protein Msh6                       496   9e-150   
gb|KFX48239.1|  DNA mismatch repair protein msh6                        495   1e-149   
gb|EHA20568.1|  hypothetical protein ASPNIDRAFT_50490                   493   4e-149   
gb|EME48689.1|  hypothetical protein DOTSEDRAFT_141977                  488   8e-149   
gb|KEY76060.1|  DNA mismatch repair protein Msh6                        493   1e-148   
ref|XP_751995.1|  DNA mismatch repair protein Msh6                      493   1e-148   
gb|EDP50209.1|  DNA mismatch repair protein Msh6, putative              493   1e-148   
ref|XP_002480846.1|  DNA mismatch repair protein Msh6, putative         491   2e-148   
ref|XP_001267191.1|  DNA mismatch repair protein Msh6, putative         492   2e-148   
gb|AEB20401.1|  msh6                                                    491   3e-148   
ref|XP_007777918.1|  DNA mismatch repair protein MSH6                   491   5e-148   
ref|XP_003115157.1|  CRE-MSH-6 protein                                  489   8e-148   
ref|XP_001271724.1|  DNA mismatch repair protein Msh6, putative         490   9e-148   
ref|XP_003856303.1|  hypothetical protein MYCGRDRAFT_98500              490   9e-148   
ref|XP_001401672.2|  DNA mismatch repair protein Msh6                   490   1e-147   
emb|CAK44621.1|  unnamed protein product                                489   1e-147   
ref|XP_505910.1|  YALI0F26499p                                          488   2e-147   
ref|XP_006677525.1|  hypothetical protein BATDEDRAFT_86831              489   2e-147   
ref|XP_002615944.1|  hypothetical protein CLUG_04826                    491   3e-147   
gb|EEH18065.2|  hypothetical protein PABG_00628                         489   4e-147   



>ref|XP_009598024.1| PREDICTED: DNA mismatch repair protein MSH6 [Nicotiana tomentosiformis]
Length=1306

 Score =  1636 bits (4236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 833/1157 (72%), Positives = 972/1157 (84%), Gaps = 2/1157 (0%)
 Frame = +1

Query  172   ESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWI  351
             +SSYGQE++ +R+KVYWPLDK WYEGCVKSFD  SG+HLV+YDD++EEM++L++E+IEW+
Sbjct  90    KSSYGQEIVGKRVKVYWPLDKTWYEGCVKSFDSASGEHLVKYDDDDEEMIDLAEEKIEWV  149

Query  352   ETPVVTKFRRLRRlkvvddekeeeldgiesggddsededwennaneeaeedegCPadmdl  531
                   K RRLR+  VV++ +EEE    +    + + ED +   N + +  E    D D+
Sbjct  150   VEAPTKKLRRLRKSLVVEEAEEEEEKLEDLESVEDDSEDEDWGKNADKQVSEDEDVDEDM  209

Query  532   eaedddiddNGLRRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTA  711
             + E ++    G R  K+   K    RKRK  EG+KL S+ +KK K+  + +S  SK   A
Sbjct  210   DLEVEEDAAAGSRSRKASADKVVVSRKRKSGEGVKLSSSSSKKSKTVADKRSANSKVDNA  269

Query  712   TGGVKVIESVTNNLECVKASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdV  891
               GV   E V  N +CV+  N D++L   + +RF  RE EK  FLGK R+DA+RR  GD 
Sbjct  270   VNGVNGKELVKTNEDCVRPINNDNVLLCGAVDRFGQREAEKFPFLGKNRKDANRRSLGDA  329

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             NYD +TLYLP +FLKGL+GGQRQWWEFKS HMDKVLFFKMGKFYEL+EMDAHIG KEL L
Sbjct  330   NYDPKTLYLPPNFLKGLTGGQRQWWEFKSNHMDKVLFFKMGKFYELYEMDAHIGTKELHL  389

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKRE  1248
             QYMKGEQPHCGFPEKNFSMN EKLARKGYRVLVVEQ ETPEQLE RR+ KGSKDKVV+RE
Sbjct  390   QYMKGEQPHCGFPEKNFSMNVEKLARKGYRVLVVEQTETPEQLETRRREKGSKDKVVRRE  449

Query  1249  ICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQ  1428
             ICAV+TKGTLTEGEML  +PDASY++AVTES QT+  Q G+RTYGVC+VD+ TSKVI+GQ
Sbjct  450   ICAVVTKGTLTEGEMLAANPDASYMMAVTESSQTAVLQ-GKRTYGVCMVDITTSKVIIGQ  508

Query  1429  FAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEK  1608
             F DDSDCS+LC LL E RPVEIIKPAKLLS ETERVL RHTRNPLVNELVP+SEFWDAE+
Sbjct  509   FEDDSDCSALCCLLSELRPVEIIKPAKLLSLETERVLLRHTRNPLVNELVPVSEFWDAER  568

Query  1609  TISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALS  1788
             TI EVK +Y+ +++  +  S NE + H S + +   +   LP+VL ELVN G NG+YALS
Sbjct  569   TICEVKAIYRNMSSPQLSSSPNEMESHESTTSEEYGERNLLPDVLCELVNLGGNGSYALS  628

Query  1789  ALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNC  1968
             ALGG L+YLKQAFLD SLLKFA FELLP S F    QKP MVLDAAALENLEIFENS+N 
Sbjct  629   ALGGALYYLKQAFLDESLLKFATFELLPLSGFCDSTQKPNMVLDAAALENLEIFENSRNG  688

Query  1969  GSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKE  2148
              SSGTLYAQ+NHC+TAFGKR+LR+WLARPLYH E+I+ERQDAVAGLKG+NLP VLEFRKE
Sbjct  689   DSSGTLYAQINHCITAFGKRMLRSWLARPLYHPESIRERQDAVAGLKGLNLPFVLEFRKE  748

Query  2149  LSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLG  2328
             LSRLPDMERLLA++F SSEANGRNANKV+LYEDAAKKQLQ+F+SALRGCE+MV+AC SLG
Sbjct  749   LSRLPDMERLLARLFGSSEANGRNANKVILYEDAAKKQLQEFVSALRGCESMVHACSSLG  808

Query  2329  ATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               L+NTDSKLL  LLTPGKGLPDV  ++K FKD FDWVEAN+SGRIIP EGVDEEYDAAC
Sbjct  809   VILENTDSKLLCHLLTPGKGLPDVDSILKHFKDAFDWVEANNSGRIIPHEGVDEEYDAAC  868

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKG  2688
               ++++EL L+KHLKEQ+KL GD+SI+YVTVGKDAYLLEVPE LC  +P+EYELQSSKKG
Sbjct  869   KQVQEIELKLSKHLKEQRKLLGDSSIDYVTVGKDAYLLEVPECLCRSIPKEYELQSSKKG  928

Query  2689  YFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLIS  2868
             YFRYWNPV++KL+GELSQA++E+ESKLKSILQRLIGRFCEHH+ WREL+S  AELDVLIS
Sbjct  929   YFRYWNPVLKKLIGELSQADSEKESKLKSILQRLIGRFCEHHNKWRELVSITAELDVLIS  988

Query  2869  LSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAG  3048
             LSIASDYYEGPTCRP+I+ +PS+D+VP L A++LGHP+L++DSLDKG FVSN+V+LGG  
Sbjct  989   LSIASDYYEGPTCRPNIKSVPSEDDVPVLHAENLGHPVLKSDSLDKGTFVSNNVSLGGPP  1048

Query  3049  HSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMA  3228
             ++SFILLTGPNMGGKSTLLRQVC+AVILAQ+GADVPA+SFDLSPVDRIFVRMGAKDHIMA
Sbjct  1049  NASFILLTGPNMGGKSTLLRQVCMAVILAQIGADVPASSFDLSPVDRIFVRMGAKDHIMA  1108

Query  3229  GQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMF  3408
             GQSTFLTELLETASMLS A+RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMF
Sbjct  1109  GQSTFLTELLETASMLSLASRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMF  1168

Query  3409  STHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAG  3588
             STHYHRL+IDYQ+D +VSLCHMAC +G+G GGL EVTFLY+LT G CP+SYGVNVARLAG
Sbjct  1169  STHYHRLSIDYQKDSRVSLCHMACQVGKGSGGLAEVTFLYRLTPGACPKSYGVNVARLAG  1228

Query  3589  LPDNVLEKAAAKSREFE  3639
             LPD VL++AAAKS EFE
Sbjct  1229  LPDGVLQRAAAKSEEFE  1245



>ref|XP_011079564.1| PREDICTED: DNA mismatch repair protein MSH6 [Sesamum indicum]
Length=1339

 Score =  1562 bits (4044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 841/1223 (69%), Positives = 970/1223 (79%), Gaps = 21/1223 (2%)
 Frame = +1

Query  109   LGSKSNKPLLVIGP-----SP-TPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDK  270
             L SK  KP+LVIG      SP  P S + SYG EV+ RRI+VYWPLDK WYEGCVKSFDK
Sbjct  105   LQSKRKKPVLVIGANLASSSPGNPTSDKKSYGAEVVERRIRVYWPLDKSWYEGCVKSFDK  164

Query  271   ISGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRRlkvvddekeeeldgiesggd  450
             ISGKHLVQYDD EEEMLNL +E+I+WIE P     ++LRRL+ +   ++EE D +    D
Sbjct  165   ISGKHLVQYDDAEEEMLNLLEEKIQWIEEPAK---KKLRRLRRISVVEDEEEDDLNELQD  221

Query  451   dsededwennaneeaeedegCPadmdleaedddiddNGLRRGKSGISKKAELRKRKFTEG  630
             DS+DEDW     +E  EDE C         +D   +N    G+ G+ KK    KRK +  
Sbjct  222   DSDDEDWGEKEEKEVTEDEDC--------LEDMDSENEEESGRGGVGKKTNSSKRKASGR  273

Query  631   LKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTN-NLECVKASNGDDILTGNSAE  807
              K  S   KK K G   +++ S    A    K  E     + +  K S  D    G++AE
Sbjct  274   GKTESIARKKSKIGVELENSVSTVSFAGNSEKRNEPTARISADGGKVSLRDSPTVGDAAE  333

Query  808   RFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             RF  RE EKL FL   RRDA+RRRPGD NYD RTLYLP +F+K L+GGQRQWWEFKSKHM
Sbjct  334   RFVTREAEKLPFLEVDRRDANRRRPGDANYDPRTLYLPPEFVKSLTGGQRQWWEFKSKHM  393

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             DKVLFFKMGKFYELFEMDAH+GAKEL LQYMKGEQPHCGFPEKNFSMN EKLARKGYRVL
Sbjct  394   DKVLFFKMGKFYELFEMDAHVGAKELGLQYMKGEQPHCGFPEKNFSMNVEKLARKGYRVL  453

Query  1168  VVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESC  1344
             VVEQ ETPEQLELRR+ KGSKDKVVKREICAV++KGTLTEGE L+ +PDASYL+AVTESC
Sbjct  454   VVEQTETPEQLELRRREKGSKDKVVKREICAVVSKGTLTEGESLSTNPDASYLMAVTESC  513

Query  1345  QTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHE  1524
             Q SANQ G    GVCVVDVATSK+ILGQF DD+DCSSLC LL E RPVEIIKP KLL  E
Sbjct  514   QVSANQQGVHILGVCVVDVATSKIILGQFRDDADCSSLCCLLAELRPVEIIKPTKLLCPE  573

Query  1525  TERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESI  1704
             TE+ L RHTRNPLVNEL+P SEFW+AEKTI EV ++YQR+ +     +  E  L P +S 
Sbjct  574   TEKALFRHTRNPLVNELIPFSEFWNAEKTICEVTSIYQRIGDHACFSAAVETALQPCDSS  633

Query  1705  DNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHF  1884
               D     LP+VLS L+N GE+G+ ALSALGGTLFYL+QAFLD +LL+FA+FELLP S F
Sbjct  634   LEDGNRNCLPDVLSNLINVGEDGSQALSALGGTLFYLRQAFLDETLLRFAKFELLPCSGF  693

Query  1885  GMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYH  2064
             G I QKPYMVLDAAALENLEIFENS+N  SSGTLYAQ+NHC TAFGKRLLRTWLARPLYH
Sbjct  694   GEITQKPYMVLDAAALENLEIFENSRNGDSSGTLYAQVNHCGTAFGKRLLRTWLARPLYH  753

Query  2065  LEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYE  2244
             LE+IKERQDA+A LKGVN P VL FRKELS+LPDMERLLA+IFA SEANGR ANKVVLYE
Sbjct  754   LESIKERQDAIAELKGVNKPYVLGFRKELSKLPDMERLLARIFAGSEANGRKANKVVLYE  813

Query  2245  DAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFK  2424
             DAAKK+LQ+FISALRGCE M++AC S GA L+N +S+LLH LL PG G+PDV+ +++ FK
Sbjct  814   DAAKKKLQEFISALRGCEIMIHACSSFGAILENVESRLLHHLLLPGAGVPDVQSILRHFK  873

Query  2425  DGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVG  2604
             + FDW EAN SGR+IP EG D EYDAAC  ++ +E +L KHLKEQ+KL GD SI YVT+G
Sbjct  874   EAFDWEEANHSGRVIPREGADLEYDAACQVVKDIESNLRKHLKEQRKLLGDASICYVTIG  933

Query  2605  KDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQ  2784
             KDAYLLEVPESL   +P+EYEL+SSKKG++RYW PVI+KL+GELSQAE+E+ESKLKSILQ
Sbjct  934   KDAYLLEVPESLSPSIPKEYELRSSKKGFYRYWTPVIKKLIGELSQAESEKESKLKSILQ  993

Query  2785  RLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAK  2964
             RLIGRFCE+H+ WR+L+S +AELDVLISLSIAS+YYEG TCRP +      D VP L AK
Sbjct  994   RLIGRFCENHNKWRQLVSAVAELDVLISLSIASEYYEGKTCRP-VLSASHSDEVPFLSAK  1052

Query  2965  SLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVG  3144
             SLGHP+LR+D+L +G FV+ND  LGG+G++S I+LTGPNMGGKSTLLRQVCLAVILAQ+G
Sbjct  1053  SLGHPVLRSDTLAEGTFVTNDFKLGGSGNASVIVLTGPNMGGKSTLLRQVCLAVILAQIG  1112

Query  3145  ADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGR  3324
             ADVPA SF LSP+DRIFVRMGAKDHIMAG STFLTELLETASMLSSATRNSLVALDELGR
Sbjct  1113  ADVPAESFALSPIDRIFVRMGAKDHIMAGHSTFLTELLETASMLSSATRNSLVALDELGR  1172

Query  3325  GTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGG  3504
             GTSTSDGQAIA SVLEHFVH V+CRGMFSTHYHRLAIDYQ+D +V+LCHMAC +G G+ G
Sbjct  1173  GTSTSDGQAIAASVLEHFVHTVKCRGMFSTHYHRLAIDYQKDPKVALCHMACRVGTGVAG  1232

Query  3505  LEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYgnnkgsrgnssk  3684
             LEEVTFLYKLT G CP+SYGVNVARLAGLPD+VL++A AKS+EFEG Y   +     SS+
Sbjct  1233  LEEVTFLYKLTPGACPKSYGVNVARLAGLPDSVLQRATAKSQEFEGSY-GKRVGVNLSSQ  1291

Query  3685  nWDEKAIEVIRSLMHLADYNERH  3753
              W++ A  VI++LM +A  N  H
Sbjct  1292  RWEDTASLVIKNLMEIAASNNCH  1314



>gb|EYU46804.1| hypothetical protein MIMGU_mgv1a000294mg [Erythranthe guttata]
Length=1287

 Score =  1556 bits (4028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 820/1218 (67%), Positives = 958/1218 (79%), Gaps = 30/1218 (2%)
 Frame = +1

Query  109   LGSKSNKPLLVIGPS--------PTPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSF  264
             L SK  KPLL+I P+         +  S + SYG E++ RR+KVYWPLDK WYEGCVKSF
Sbjct  66    LQSKRKKPLLIISPNLASSSSPPESRSSDKKSYGAEIVARRVKVYWPLDKSWYEGCVKSF  125

Query  265   DKISGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRRlkvvddekeeeldgiesg  444
             DKISGKH VQYDD +EEMLNLS+E+IE IE P   K RRLRR+ VVD+E+EEE D  E  
Sbjct  126   DKISGKHCVQYDDADEEMLNLSEEKIELIEEPAKKKLRRLRRISVVDEEEEEEDDLKELE  185

Query  445   gddsededwennaneeaeedegCPadmdleaedddiddNGLRRGKSGISKKAELRKRKFT  624
              D  +++        +  EDE C        E+ D++      G+  I KK   RK K  
Sbjct  186   DDSDDEDWVIKADENKTLEDEDC-------LEEMDLEVEDEESGRGDIGKKFNSRKLKVD  238

Query  625   EGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASNGDDILTGNSA  804
             EG ++VS   KK K+GG  KS+ SKAP A    K++  +            D    G+ A
Sbjct  239   EGEQMVSVSNKKRKTGGECKSSASKAPFAGDAEKLVSPL------------DSSKVGDDA  286

Query  805   ERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKH  984
             ERF +RE +K GF+ K R+DA+ RRPGDVNYDSRTLYLP  F+KGL+GGQRQWWEFK+KH
Sbjct  287   ERFVLREADKFGFVEKNRKDAEGRRPGDVNYDSRTLYLPPSFVKGLTGGQRQWWEFKAKH  346

Query  985   MDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRV  1164
             MDKVLFFKMGKFYELFEMDAH+GAKEL LQYMKGEQPHCGFPEKNFSMN EKLARKGYRV
Sbjct  347   MDKVLFFKMGKFYELFEMDAHVGAKELGLQYMKGEQPHCGFPEKNFSMNVEKLARKGYRV  406

Query  1165  LVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTES  1341
             LVVEQ ETP+QLE+RR+ KGSKDKVVKREICAV++KGTLTEGE L+ +PDASYLIAVTES
Sbjct  407   LVVEQTETPDQLEVRRREKGSKDKVVKREICAVVSKGTLTEGETLSTNPDASYLIAVTES  466

Query  1342  CQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSH  1521
             CQ SAN+ G   +G+CVVDVATSK+ILGQ  DD+DCSSLC LL E RPVEIIKPAKLL  
Sbjct  467   CQISANEKGVHEFGICVVDVATSKIILGQLKDDADCSSLCCLLSELRPVEIIKPAKLLCP  526

Query  1522  ETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSES  1701
             ETE+ L RHTRNPLVNEL+P SEFWDAEKTI+E+  +YQR+++       NE+ +  S S
Sbjct  527   ETEKALIRHTRNPLVNELIPFSEFWDAEKTINEIMGIYQRVSDRSCISEVNESLVQSSNS  586

Query  1702  IDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSH  1881
                +    +LP+VLS LV+AGENG+ ALSALGGTLFYL+QAFLD +LL+FA+FELLP S 
Sbjct  587   SLKNDGTNSLPDVLSNLVSAGENGSQALSALGGTLFYLRQAFLDETLLRFAKFELLPSSG  646

Query  1882  FGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLY  2061
             FG I QKP+MVLDAAALENLEIFENS+N  SSGTLYAQ+NHC TAFGKRLLRTWLARPLY
Sbjct  647   FGEITQKPHMVLDAAALENLEIFENSRNGDSSGTLYAQLNHCATAFGKRLLRTWLARPLY  706

Query  2062  HLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLY  2241
             H+E IKERQ+A+A LKGVN P VL FRKELS+LPDMERLLA+ FA SEANGRNANKVVLY
Sbjct  707   HIEPIKERQNAIAELKGVNQPYVLTFRKELSKLPDMERLLARTFAGSEANGRNANKVVLY  766

Query  2242  EDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQF  2421
             ED AKK+LQ+FISALRGCE M +AC SLGA L+N  S+LLH LL PG G+PDV  +++ F
Sbjct  767   EDTAKKKLQEFISALRGCEAMTHACSSLGAILENVQSRLLHHLLMPGTGIPDVHSILQHF  826

Query  2422  KDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTV  2601
             KD FDW EAN SGRIIP EG D EYDAAC  ++ +E +L KHLKEQ +L G+ SI YVT+
Sbjct  827   KDAFDWEEANHSGRIIPREGADIEYDAACQIVKDIESNLKKHLKEQCRLLGNASICYVTI  886

Query  2602  GKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSIL  2781
             GKDAYLLEVPESL + +P+EYEL+SSKKG+ RYW PVI+ L+GELSQAE+ERE KLKSIL
Sbjct  887   GKDAYLLEVPESLSQSIPKEYELRSSKKGFSRYWTPVIKNLLGELSQAESERELKLKSIL  946

Query  2782  QRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVA  2961
             QRLI RFCE+H+ WR+++STIAELD LISLSIAS+YYEG TCRP I         P L A
Sbjct  947   QRLIARFCENHAKWRQMVSTIAELDCLISLSIASEYYEGKTCRP-ILSTSHPLEEPRLSA  1005

Query  2962  KSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQV  3141
             KSLGHP+LR+D+L +G FV+NDVTLGG GH+SFILLTGPNMGGKST LRQVCLAVILAQ+
Sbjct  1006  KSLGHPVLRSDALSEGTFVTNDVTLGGPGHASFILLTGPNMGGKSTFLRQVCLAVILAQI  1065

Query  3142  GADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELG  3321
             GA+VPA SF LSP+DRIFVRMGAKD IMAG STFLTELLET+SML+SAT NSLVALDELG
Sbjct  1066  GANVPAESFVLSPIDRIFVRMGAKDQIMAGHSTFLTELLETSSMLASATCNSLVALDELG  1125

Query  3322  RGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLG  3501
             RGTSTSDGQAIA SVLEHFV  V+CRG+FSTHYHRLA+DYQ D +VSLCHMAC + +G+ 
Sbjct  1126  RGTSTSDGQAIASSVLEHFVRTVKCRGLFSTHYHRLAVDYQRDPKVSLCHMACQVEKGVD  1185

Query  3502  GLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYgnnkgsrgnss  3681
             G++EV FLYKLT G CP+SYGVNVARLAGLPD VL+KA  KS+EFE  Y   +      S
Sbjct  1186  GVDEVIFLYKLTPGACPKSYGVNVARLAGLPDTVLQKATTKSQEFELSY-GKRLKPNFCS  1244

Query  3682  knWDEKAIEVIRSLMHLA  3735
             + W++ A  +I +L+ +A
Sbjct  1245  QRWEDDAYLIIENLIKIA  1262



>ref|XP_009802974.1| PREDICTED: DNA mismatch repair protein MSH6 [Nicotiana sylvestris]
Length=1314

 Score =  1555 bits (4026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 777/1027 (76%), Positives = 891/1027 (87%), Gaps = 2/1027 (0%)
 Frame = +1

Query  562   GLRRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESV  741
             G R  K+G  K    RKRK  EG+KL S+ +KK K+  + KS  SK   A  GV   E V
Sbjct  230   GSRSRKAGADKVVVSRKRKSGEGVKLSSSSSKKSKTLADKKSANSKVDNAVNGVNGKELV  289

Query  742   TNNLECVKASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLP  921
               N +CV+ +N D++L   +A+RF  RE EK  F+ K R+DA+RR PGD NYD +TLYLP
Sbjct  290   KTNEDCVRPTNNDNVLLCGAADRFGQREAEKFPFVAKDRKDANRRSPGDANYDPKTLYLP  349

Query  922   SDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHC  1101
              +FLKGL+GGQRQWWEFKSKHMDKVLFFKMGKFYEL+EMDAHIG KEL LQYMKGEQPHC
Sbjct  350   PNFLKGLTGGQRQWWEFKSKHMDKVLFFKMGKFYELYEMDAHIGTKELHLQYMKGEQPHC  409

Query  1102  GFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTL  1278
             GFPEKNFSMN EKLARKGYRVLVVEQ ETPEQLE RR+ KGSKDKVV+REICAV+TKGTL
Sbjct  410   GFPEKNFSMNVEKLARKGYRVLVVEQTETPEQLETRRREKGSKDKVVRREICAVVTKGTL  469

Query  1279  TEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcssl  1458
             TEGEML  +PDASY++AVTES QT+  Q G+RTYGVC+VD+ TSKVI+GQF DDSDCS+L
Sbjct  470   TEGEMLAANPDASYMMAVTESSQTAVLQ-GKRTYGVCMVDITTSKVIIGQFEDDSDCSAL  528

Query  1459  csllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQ  1638
             C LL E RPVEIIKPAKLLS ETERVL R+TRNPLVNELVP+SEFWDAE+TI EVK +Y+
Sbjct  529   CCLLSELRPVEIIKPAKLLSLETERVLLRYTRNPLVNELVPVSEFWDAERTICEVKAIYR  588

Query  1639  RLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLK  1818
              +++ P+  S NE + H S + +   +   LP+VL ELVN G NG+YALSALGG L+YLK
Sbjct  589   NMSSPPLTSSPNEMESHESTTSEEYGERNLLPDVLCELVNLGRNGSYALSALGGALYYLK  648

Query  1819  QAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQM  1998
             QAFLD SLLKFA+FE LP S F    QKP M LDAAALENLEIFENS++  SSGTLYAQ+
Sbjct  649   QAFLDESLLKFAKFEPLPLSGFCDSTQKPNMALDAAALENLEIFENSRDGDSSGTLYAQI  708

Query  1999  NHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERL  2178
             NHC+TAFGKR+LR+WLARPLYH E+I+ERQDAVAGLKG+NLP VLEFRKELSRLPDMERL
Sbjct  709   NHCITAFGKRMLRSWLARPLYHPESIRERQDAVAGLKGLNLPFVLEFRKELSRLPDMERL  768

Query  2179  LAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKL  2358
             LA++F SSEANGRNANKV+LYEDAAKKQLQ+F+SALRGCE+MV+AC SLG  L+N DSKL
Sbjct  769   LARLFGSSEANGRNANKVILYEDAAKKQLQEFVSALRGCESMVHACSSLGVILENMDSKL  828

Query  2359  LHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSL  2538
             L+ LLTPGKGLPDV  ++K FKD FDWVEAN+SGRIIP EGVDEEYDAAC  L+++EL L
Sbjct  829   LYYLLTPGKGLPDVDSILKHFKDAFDWVEANNSGRIIPHEGVDEEYDAACKQLQEIELKL  888

Query  2539  AKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIR  2718
             +KHLKEQ+KL GD+SI+YVTVGKDAYLLEVPE LC  +P+EYELQSSKKGYFRYWNPV++
Sbjct  889   SKHLKEQRKLLGDSSIDYVTVGKDAYLLEVPECLCRSIPKEYELQSSKKGYFRYWNPVLK  948

Query  2719  KLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEG  2898
             KL+GELSQA++E+ESKLKSILQRLIGRFCEHH+ WREL+S  AELDVLISLSIASDYYEG
Sbjct  949   KLIGELSQADSEKESKLKSILQRLIGRFCEHHNKWRELVSITAELDVLISLSIASDYYEG  1008

Query  2899  PTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGP  3078
             PTCRP+I+ +PS+D+VP L A++LGHP+L++DSLDKGAFVSN+V+LGG  ++SFILLTGP
Sbjct  1009  PTCRPNIKSVPSEDDVPVLHAENLGHPVLKSDSLDKGAFVSNNVSLGGPPNASFILLTGP  1068

Query  3079  NMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELL  3258
             NMGGKSTLLRQVC+AVILAQ+GADVPA+SFDLSPVDRIFVRMGAKDHIMAGQSTFLTELL
Sbjct  1069  NMGGKSTLLRQVCMAVILAQIGADVPASSFDLSPVDRIFVRMGAKDHIMAGQSTFLTELL  1128

Query  3259  ETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAID  3438
             ETASMLS A+RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRL+ID
Sbjct  1129  ETASMLSLASRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLSID  1188

Query  3439  YQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAA  3618
             YQ+D +VSLCHMAC +G+G GGLEEVTFLY+LT G CP+SYGVNVARLAGLPD VL++AA
Sbjct  1189  YQKDSRVSLCHMACQVGKGSGGLEEVTFLYRLTPGACPKSYGVNVARLAGLPDGVLQRAA  1248

Query  3619  AKSREFE  3639
             AKS EFE
Sbjct  1249  AKSEEFE  1255


 Score =   107 bits (267),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYGQE++ +R+KVYWPLD+ WYEGCVKSFD +SG+HLV+YDD +EEM++L++E+IE +  
Sbjct  98   SYGQEIVGKRVKVYWPLDRTWYEGCVKSFDGVSGEHLVKYDDGDEEMIDLAEEKIELVVE  157

Query  358  PVVTKFRRLRR  390
                K RRLR+
Sbjct  158  APARKLRRLRK  168



>gb|AAT67045.1| DNA mismatch repair protein [Petunia x hybrida]
Length=1303

 Score =  1542 bits (3993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 767/1027 (75%), Positives = 880/1027 (86%), Gaps = 1/1027 (0%)
 Frame = +1

Query  562   GLRRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESV  741
             G RRGK+    KA  RKRK ++ +K+  + +K  K+  + +S  +K  +A  G+   E V
Sbjct  216   GSRRGKASGKNKALSRKRKTSDVVKVTPSSSKGSKNVVDKRSVNNKVESAVNGINGKEPV  275

Query  742   TNNLECVKASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLP  921
             T N++C +ASN D+ L   +A+RF  RE EK  FLG+ R+D + R P D NYD RTLYLP
Sbjct  276   TTNVDCARASNNDNALLCGAADRFGQREAEKFPFLGRNRKDVNGRSPEDANYDPRTLYLP  335

Query  922   SDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHC  1101
              +FLKGL+GGQRQWWEFKSKHMDKVLFFKMGKFYEL+EMDAHIGA EL LQYMKGEQPHC
Sbjct  336   PNFLKGLTGGQRQWWEFKSKHMDKVLFFKMGKFYELYEMDAHIGANELHLQYMKGEQPHC  395

Query  1102  GFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTL  1278
             GFPEKNFSMN EKLARKGYRVLVVEQ ETPEQLE+RR+ KGSKDKVV+RE+CAV+TKGTL
Sbjct  396   GFPEKNFSMNVEKLARKGYRVLVVEQTETPEQLEIRRREKGSKDKVVRREVCAVVTKGTL  455

Query  1279  TEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcssl  1458
             TEGEML  +PDASYL+AVTES QT+A Q G+ TYGVC+VD+ TSK+ILGQF DDSDCS+L
Sbjct  456   TEGEMLAANPDASYLMAVTESFQTAAYQQGKHTYGVCMVDITTSKIILGQFEDDSDCSAL  515

Query  1459  csllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQ  1638
             C LL E RPVE+IKPAKLLS ETERV+ RHTRNPLVNELVPLSEFWDAE+TISEVK +Y+
Sbjct  516   CCLLSELRPVEVIKPAKLLSLETERVMLRHTRNPLVNELVPLSEFWDAERTISEVKRIYR  575

Query  1639  RLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLK  1818
              ++++P+  S N    H + + + D Q   LP+VL ELVN GENG+YALSALGGTL+YLK
Sbjct  576   NMSSSPLSSSPNGMGAHENNTSEEDGQRDFLPDVLYELVNLGENGSYALSALGGTLYYLK  635

Query  1819  QAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQM  1998
             QAFLD SLLKFA+FELLP S F    QKP MVLDAAALENLEIFENS+N  SSGTLYAQ+
Sbjct  636   QAFLDESLLKFAKFELLPLSGFCDSTQKPNMVLDAAALENLEIFENSRNGDSSGTLYAQV  695

Query  1999  NHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERL  2178
             NHC+T FGKR+LR+WLARPLYH E+I+ERQDAV+GLKG+NLP VLEFRKELSRLPDMERL
Sbjct  696   NHCMTPFGKRMLRSWLARPLYHPESIRERQDAVSGLKGLNLPFVLEFRKELSRLPDMERL  755

Query  2179  LAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKL  2358
             LA++F SSEANGRNANKV LYEDAAKKQLQ+FISALRGCE+M  AC SLG  L+NTDSKL
Sbjct  756   LARLFGSSEANGRNANKVTLYEDAAKKQLQEFISALRGCESMARACSSLGVILENTDSKL  815

Query  2359  LHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSL  2538
             L+ LLTPGKGLPDV   +K FKD FDWVEAN+ GRIIP EGVDEEYD AC  + +VEL L
Sbjct  816   LYHLLTPGKGLPDVDSFLKHFKDAFDWVEANNLGRIIPHEGVDEEYDTACKQVHEVELKL  875

Query  2539  AKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIR  2718
             +KHLKEQ+KL GD+SI+YVTVGKDAY LEVPE LC  +P+EYELQSSKKGYFRYWNPV++
Sbjct  876   SKHLKEQRKLLGDSSIDYVTVGKDAYPLEVPECLCRSIPKEYELQSSKKGYFRYWNPVLK  935

Query  2719  KLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEG  2898
             KL+GE+SQA +E+ESKLKSILQ +  RFCEHH  WREL+   AELDVLISLSIASDYYEG
Sbjct  936   KLLGEVSQASSEKESKLKSILQEVDRRFCEHHDKWRELVRITAELDVLISLSIASDYYEG  995

Query  2899  PTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGP  3078
             PTCRP+I+ + SQD+VP L+A++LGHP+LR+DSLDKG FVSN+V+LGG  ++SFILLTGP
Sbjct  996   PTCRPNIKSITSQDDVPVLLAENLGHPVLRSDSLDKGTFVSNNVSLGGPANASFILLTGP  1055

Query  3079  NMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELL  3258
             NMGGKSTLLRQVCLAVILAQVGADVPA+SFDLSPVDRIFVRMGAKDHIMAGQSTFLTE+L
Sbjct  1056  NMGGKSTLLRQVCLAVILAQVGADVPASSFDLSPVDRIFVRMGAKDHIMAGQSTFLTEIL  1115

Query  3259  ETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAID  3438
             ETASMLS A+RNSLVALDELGRGTSTSDGQAIAESVLEHFVH VQCRGMFSTHYHRL+ID
Sbjct  1116  ETASMLSLASRNSLVALDELGRGTSTSDGQAIAESVLEHFVHNVQCRGMFSTHYHRLSID  1175

Query  3439  YQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAA  3618
             YQ+D +VSLCHM C +G+G G LEEVTFLY+LT G CP+SYGVNVARLAGLPD+VL+KAA
Sbjct  1176  YQKDSRVSLCHMGCQVGKGSGDLEEVTFLYRLTPGACPKSYGVNVARLAGLPDDVLQKAA  1235

Query  3619  AKSREFE  3639
             AKS EFE
Sbjct  1236  AKSEEFE  1242


 Score =   100 bits (250),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYGQEV+++R+KVYWPLDK WYEG VKSFD  SGKHLV+YDD EEEM+ L++E+IEW+E 
Sbjct  82   SYGQEVVDKRVKVYWPLDKNWYEGFVKSFDSASGKHLVEYDDGEEEMIELAEEKIEWVEE  141

Query  358  PVVTKFRRLRR  390
                KFRRLRR
Sbjct  142  APARKFRRLRR  152



>ref|XP_004229396.2| PREDICTED: uncharacterized protein LOC101243927 [Solanum lycopersicum]
Length=2996

 Score =  1537 bits (3980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 780/1052 (74%), Positives = 899/1052 (85%), Gaps = 2/1052 (0%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASN  774
             K   RKRK  EG KL  + +KK K+  + +S  SK  +A  GV   E    N +C KASN
Sbjct  1919  KVVARKRKTGEGEKLTPSSSKKSKTLADKRSANSKMDSAVIGVNGKEPTATNEDCAKASN  1978

Query  775   GDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQ  954
               ++L   +A+RF  RE +K  FLGK R+DA+RR P D +YD RT+YLP +FLKGL+GGQ
Sbjct  1979  NVNVLLCGAADRFGQRETQKFPFLGKDRKDANRRSPDDADYDPRTIYLPPNFLKGLTGGQ  2038

Query  955   RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNA  1134
             RQWWEFKSKHMDKVLFFKMGKFYEL+EMDAHIGA+EL LQYMKGEQPHCGFPEKNFSMN 
Sbjct  2039  RQWWEFKSKHMDKVLFFKMGKFYELYEMDAHIGAQELHLQYMKGEQPHCGFPEKNFSMNV  2098

Query  1135  EKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPD  1311
             EKLARKGYRVLVVEQ ETPEQLE RR++ GSKDKVV+REICAV+TKGTLTEGEML  +PD
Sbjct  2099  EKLARKGYRVLVVEQTETPEQLENRRREMGSKDKVVRREICAVVTKGTLTEGEMLAANPD  2158

Query  1312  ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVE  1491
             ASYL+AVTES  T+A Q  +RTYGVC+VD++T +VI+GQF DDSDCS+LC LL E RPVE
Sbjct  2159  ASYLMAVTESSLTAAFQQEKRTYGVCMVDISTGRVIIGQFEDDSDCSALCCLLSELRPVE  2218

Query  1492  IIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQ  1671
             IIKPAKLLS ETERVL RHTRNPLVNELVPLSEFWDAE+TI EVK +Y+ ++ + +  S 
Sbjct  2219  IIKPAKLLSLETERVLMRHTRNPLVNELVPLSEFWDAERTICEVKGLYRNMSLSLLSSSP  2278

Query  1672  NEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKF  1851
             N+   H S + + D +   LP+VL EL+N G NG+YALSALGG L+YLKQAFLD SLLKF
Sbjct  2279  NDMGTHESTASEEDGERNFLPDVLCELINLGGNGSYALSALGGVLYYLKQAFLDESLLKF  2338

Query  1852  AEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRL  2031
             A+FELLP S F    QK  MVLDAAALENLEIFENS+N  SSGTLYAQ+NHC+TAFGKR+
Sbjct  2339  AKFELLPLSGFCDGTQKWNMVLDAAALENLEIFENSRNGDSSGTLYAQINHCITAFGKRM  2398

Query  2032  LRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEAN  2211
             LR+WLARPLY  E+I+ERQDAVAGLKG NLP VLEFRKELSRLPDMERLLA++F SSEAN
Sbjct  2399  LRSWLARPLYRPESIRERQDAVAGLKGPNLPSVLEFRKELSRLPDMERLLARLFGSSEAN  2458

Query  2212  GRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGL  2391
             GRNANKV LYEDAAKKQLQ+FISALRGCE+MV AC SLG  L NTDSKLLH LLT G GL
Sbjct  2459  GRNANKVTLYEDAAKKQLQEFISALRGCESMVQACSSLGVILGNTDSKLLHHLLTLGNGL  2518

Query  2392  PDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLF  2571
             PDV  V+K FKD FDWVEA++SGRIIP EGVDEEYDAAC  +++VEL LAKHLKEQ+KL 
Sbjct  2519  PDVDSVLKHFKDAFDWVEASNSGRIIPHEGVDEEYDAACKQVQEVELKLAKHLKEQRKLL  2578

Query  2572  GDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAET  2751
             GD+SI+YVT+GKDAYLLEVPESLC   P+EYELQSSKKGYFRYWNP+++KL+GELS A++
Sbjct  2579  GDSSIDYVTIGKDAYLLEVPESLCRSTPKEYELQSSKKGYFRYWNPILKKLIGELSHADS  2638

Query  2752  ERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELP  2931
             E+ESKLKSIL+RLIGRFCEHH+ WREL+ST AELDVLISLSIASDYYEGPTCRP+I+ +P
Sbjct  2639  EKESKLKSILRRLIGRFCEHHNKWRELVSTTAELDVLISLSIASDYYEGPTCRPNIKSVP  2698

Query  2932  SQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQ  3111
             SQD+VP L+A++LGHP+LR+DSLDKG FVSN+V+LGG  ++SFILLTGPNMGGKSTLLRQ
Sbjct  2699  SQDDVPVLLAENLGHPVLRSDSLDKGTFVSNNVSLGGPPNASFILLTGPNMGGKSTLLRQ  2758

Query  3112  VCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATR  3291
             VC+AVILAQVGADVPA+SFD+SPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS A+R
Sbjct  2759  VCMAVILAQVGADVPASSFDISPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSMASR  2818

Query  3292  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCH  3471
             NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRL+IDYQ+D +VSLCH
Sbjct  2819  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLSIDYQKDSRVSLCH  2878

Query  3472  MACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYg  3651
             MAC IG+G GGLEEVTFLY+LT G CP+SYGVNVARLAGLPD+VL +AAAKS   E +YG
Sbjct  2879  MACQIGKGSGGLEEVTFLYRLTPGACPKSYGVNVARLAGLPDDVLHRAAAKSEALE-LYG  2937

Query  3652  nnkgsrgnssknWDEKAIEVIRSLMHLADYNE  3747
             +NK S  N S+N   K   ++++L++L ++N+
Sbjct  2938  HNKQSEENPSENLTGKTAILLQNLINLVEHNK  2969


 Score =   109 bits (273),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  178   SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
             SYGQEV+++R+KVYWPLDK WYEGCVKSFD  SG+HLV+YDD +EEM++L++E+IEW++ 
Sbjct  1780  SYGQEVVDKRVKVYWPLDKIWYEGCVKSFDSSSGEHLVKYDDGDEEMIDLAEEKIEWVKA  1839

Query  358   PV  363
             PV
Sbjct  1840  PV  1841



>ref|XP_006349194.1| PREDICTED: DNA mismatch repair protein MSH6-like [Solanum tuberosum]
Length=1308

 Score =  1528 bits (3956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 783/1052 (74%), Positives = 901/1052 (86%), Gaps = 2/1052 (0%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASN  774
             K   RKRK  EG KL  + +KK K+  + +S  SK  +A  GV   E V    +C KASN
Sbjct  232   KVVARKRKTGEGEKLTPSSSKKSKTVSDKRSANSKMDSAVIGVNGKEPVATKEDCAKASN  291

Query  775   GDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQ  954
              D++L   +A+RF  RE +K  FLGK R+DA+RR PGD NYD RT+YLP +FLKGL+GGQ
Sbjct  292   NDNVLLCGAADRFGQRETQKFPFLGKDRKDANRRSPGDANYDPRTIYLPLNFLKGLTGGQ  351

Query  955   RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNA  1134
             RQWWEFKSKHMDKVLFFKMGKFYEL+EMDAHIGA+EL LQYMKGEQPHCGFPEKNFSMN 
Sbjct  352   RQWWEFKSKHMDKVLFFKMGKFYELYEMDAHIGAQELHLQYMKGEQPHCGFPEKNFSMNV  411

Query  1135  EKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPD  1311
             EKLARKGYRVLVVEQ ETPEQLE RR++ GSKDKVV+REICAV+TKGTLTEGEML  +PD
Sbjct  412   EKLARKGYRVLVVEQTETPEQLENRRREMGSKDKVVRREICAVVTKGTLTEGEMLAANPD  471

Query  1312  ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVE  1491
             ASYL+AVTES  T A Q  +RTYGVC+VD++T K+I+GQF DDSDCS+LC LL E RPVE
Sbjct  472   ASYLMAVTESFLTDAFQQEKRTYGVCLVDISTGKIIIGQFEDDSDCSALCCLLSELRPVE  531

Query  1492  IIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQ  1671
             IIKPAKLLSHETERVL RHTRNPLVNELVPLSEFWDAE+TI EVK +Y+ ++ + +  S 
Sbjct  532   IIKPAKLLSHETERVLMRHTRNPLVNELVPLSEFWDAERTICEVKGVYRNMSLSLLSSSP  591

Query  1672  NEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKF  1851
             NE   H S + + D +   LP+ L EL+N G NG+YALSALGG L+YLKQAFLD SLLKF
Sbjct  592   NEMGTHESTASEEDGERNFLPDALCELINLGGNGSYALSALGGVLYYLKQAFLDESLLKF  651

Query  1852  AEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRL  2031
             A+FELLP S F    QK  MVLDAAALENLEIFENS+N  SSGTLYAQ+NHC+TAFGKR+
Sbjct  652   AKFELLPLSGFCDGTQKWNMVLDAAALENLEIFENSRNGDSSGTLYAQINHCITAFGKRM  711

Query  2032  LRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEAN  2211
             LR+WLARPLY  E+I+ERQDAVAGLKG+NLP VLEFRKELSRLPDMERLLA++F SSEAN
Sbjct  712   LRSWLARPLYRPESIRERQDAVAGLKGLNLPSVLEFRKELSRLPDMERLLARLFGSSEAN  771

Query  2212  GRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGL  2391
             GRNANKV LYEDAAKKQLQ+FISALRGCE+MV+AC SLG  L NTDSKLLH LLT G GL
Sbjct  772   GRNANKVTLYEDAAKKQLQEFISALRGCESMVHACSSLGVILGNTDSKLLHHLLTLGNGL  831

Query  2392  PDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLF  2571
             PDV  V+K FKD FDWVEAN+SGRIIP EGVDEEYDAAC  +++VE  L+KHLKEQ+KL 
Sbjct  832   PDVDSVLKHFKDAFDWVEANNSGRIIPHEGVDEEYDAACKQVQEVEHKLSKHLKEQRKLL  891

Query  2572  GDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAET  2751
             GD+SI+YVT+GKDAYLLEVPESLC  +P+EYELQSSKKGYFRYWNPV++KL+GELS A++
Sbjct  892   GDSSIDYVTIGKDAYLLEVPESLCRSIPKEYELQSSKKGYFRYWNPVLKKLIGELSHADS  951

Query  2752  ERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELP  2931
             E+ESKLKSIL+RLIGRFCEHH+ WREL+S  AELDVLISLSIASDYYEGPTCRP+I+ +P
Sbjct  952   EKESKLKSILRRLIGRFCEHHNKWRELVSITAELDVLISLSIASDYYEGPTCRPNIKSMP  1011

Query  2932  SQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQ  3111
             SQD+VP L+A++LGHP+LR+DSLDKG FVSN+V+LGG  ++SFILLTGPNMGGKSTLLRQ
Sbjct  1012  SQDDVPVLLAENLGHPVLRSDSLDKGTFVSNNVSLGGPPNASFILLTGPNMGGKSTLLRQ  1071

Query  3112  VCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATR  3291
             VC+AVILAQVGADVPA+SFD+SPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS A+R
Sbjct  1072  VCMAVILAQVGADVPASSFDISPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSMASR  1131

Query  3292  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCH  3471
             NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRL+IDYQ+D +VSLCH
Sbjct  1132  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLSIDYQKDSRVSLCH  1191

Query  3472  MACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYg  3651
             MAC IG+G GGLEEVTFLY+LT G CP+SYGVNVARLAGLPD+VL++AAAKS   E +YG
Sbjct  1192  MACQIGKGSGGLEEVTFLYRLTPGACPKSYGVNVARLAGLPDDVLQRAAAKSEALE-IYG  1250

Query  3652  nnkgsrgnssknWDEKAIEVIRSLMHLADYNE  3747
             +NK S  N S+N   K   ++++L++L  +N+
Sbjct  1251  HNKQSEENPSENLTGKIATLLQNLINLIVHNK  1282


 Score =   111 bits (277),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYGQEV+++R+KVYWPLDK WYEGCVKSFD  SG+HLV+YDD +EEM++LS+E+IEW++ 
Sbjct  93   SYGQEVVDKRVKVYWPLDKIWYEGCVKSFDSSSGEHLVKYDDGDEEMIDLSEEKIEWVKA  152

Query  358  PV  363
            PV
Sbjct  153  PV  154



>ref|XP_002275930.1| PREDICTED: DNA mismatch repair protein MSH6 [Vitis vinifera]
Length=1297

 Score =  1485 bits (3845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 751/1026 (73%), Positives = 869/1026 (85%), Gaps = 18/1026 (2%)
 Frame = +1

Query  577   KSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLE  756
             K G SKK + +KRK      + S K +K  SGG  K+T          V  +E +  N E
Sbjct  222   KKGQSKKVDPKKRKAVGEGTMGSGKRRK-SSGGAEKNTFK--------VSSVEPM-KNAE  271

Query  757   CVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFL  933
               KAS+  D++L G++ ERF  RE EKL FLG  R+DA RR PGD NYD RTLYLP +FL
Sbjct  272   SRKASDILDNVLPGDALERFGAREAEKLPFLGGERKDAKRRCPGDANYDPRTLYLPPNFL  331

Query  934   KGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPE  1113
             K L+GGQRQWWEFKS+HMDKV+FFKMGKFYELFEMDAHIGAKELDLQYMKG QPHCGFPE
Sbjct  332   KNLTGGQRQWWEFKSRHMDKVIFFKMGKFYELFEMDAHIGAKELDLQYMKGGQPHCGFPE  391

Query  1114  KNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGE  1290
             KNFS+N EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE
Sbjct  392   KNFSINVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGE  451

Query  1291  MLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsll  1470
             ML+ +PDASYL+AVTESCQ       ER++GVCVVDVATS++ILGQF DDS+CS+LC LL
Sbjct  452   MLSANPDASYLMAVTESCQ-----FEERSFGVCVVDVATSRIILGQFRDDSECSTLCCLL  506

Query  1471  YEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNN  1650
              E RPVEIIKPA LLS ETER L RHTR+PLVNELVP+SEFWD++KT+SE++++Y+  N+
Sbjct  507   SELRPVEIIKPANLLSPETERALMRHTRSPLVNELVPISEFWDSKKTVSEIRSVYRCFND  566

Query  1651  TPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFL  1830
               +  S NEA+L    S   +  L  LP++LS+LVNAGE+G+ ALSALGGTLFYLKQAF+
Sbjct  567   LSVSGSLNEANLSVKGSFVEEDPL-GLPDILSKLVNAGESGSLALSALGGTLFYLKQAFM  625

Query  1831  DVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCV  2010
             D +LL+FA+FEL P+S    I  KPYMVLDAAALENLEIFENS+   SSGTLYAQ+NHCV
Sbjct  626   DETLLRFAKFELFPYSGVSDIFHKPYMVLDAAALENLEIFENSRKGDSSGTLYAQLNHCV  685

Query  2011  TAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQI  2190
             TAFGKRLL+TWLARPLYHL++I+ERQDAVAGL+GVNLP  LEFRKELSRLPDMERLLA+I
Sbjct  686   TAFGKRLLKTWLARPLYHLDSIRERQDAVAGLRGVNLPSALEFRKELSRLPDMERLLARI  745

Query  2191  FASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDL  2370
             FASSEANGRNANKVV YEDAAKKQLQ+FISALRGCE M  AC SLG  L+N +S LLH L
Sbjct  746   FASSEANGRNANKVVFYEDAAKKQLQEFISALRGCELMTQACSSLGVILENVESGLLHHL  805

Query  2371  LTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHL  2550
             LTPGKGLPD+  VI  FK+ FDWVEAN+SGRIIP EGVD+EYD+AC +++++EL L KHL
Sbjct  806   LTPGKGLPDIHSVINHFKEAFDWVEANNSGRIIPHEGVDKEYDSACKTVKEIELRLKKHL  865

Query  2551  KEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMG  2730
             KEQQKL GD SIN+VT+GK+AYLLEVPESL   +P++YEL+SSKKG+FRYW P I+K +G
Sbjct  866   KEQQKLLGDASINFVTIGKEAYLLEVPESLRGNIPRDYELRSSKKGFFRYWTPNIKKFLG  925

Query  2731  ELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCR  2910
             ELS AE+E+ESKL+SILQRLI RFCEHH  WR+L+S+ AELDVLISL+IA+DYYEGPTCR
Sbjct  926   ELSHAESEKESKLRSILQRLISRFCEHHDKWRQLVSSTAELDVLISLAIANDYYEGPTCR  985

Query  2911  PHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGG  3090
             P I  L + + VPC  AKSLGHP+LR+DSL KG FV ND+T+GG+ H+ FILLTGPNMGG
Sbjct  986   PVISGLSNSNEVPCFTAKSLGHPVLRSDSLGKGTFVPNDITIGGSDHACFILLTGPNMGG  1045

Query  3091  KSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETAS  3270
             KSTLLRQVCLAVILAQVGADVPA SF+LSPVDRIFVRMGAKD+IMAGQSTFLTEL ETAS
Sbjct  1046  KSTLLRQVCLAVILAQVGADVPAESFELSPVDRIFVRMGAKDNIMAGQSTFLTELSETAS  1105

Query  3271  MLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQED  3450
             ML+SAT NSLVALDELGRGTSTSDGQAIAESVLEHFVHKV+CRGMFSTHYHRLA+DY+++
Sbjct  1106  MLTSATCNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVRCRGMFSTHYHRLAVDYKKN  1165

Query  3451  RQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSR  3630
              +VSLCHMAC +G+G+GG+EEVTFLY+L  G CP+SYGVNVARLAGLP++VL+KAAAKSR
Sbjct  1166  SKVSLCHMACQVGKGVGGVEEVTFLYRLRPGACPKSYGVNVARLAGLPNSVLQKAAAKSR  1225

Query  3631  EFEGVY  3648
             E EG+Y
Sbjct  1226  EIEGIY  1231


 Score =   122 bits (305),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 5/85 (6%)
 Frame = +1

Query  115  SKSNKPLLVIGPS-----PTPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISG  279
            +K  KPLLVIGPS      TP +   SYG+EV+NRR+KVYWPLDK WY GCVKSFD+++G
Sbjct  65   AKLRKPLLVIGPSKTTSPSTPVTGSKSYGEEVVNRRVKVYWPLDKSWYVGCVKSFDELTG  124

Query  280  KHLVQYDDEEEEMLNLSQERIEWIE  354
            +HLVQYDD +EE L+L +E+IEW+E
Sbjct  125  EHLVQYDDADEETLDLGKEKIEWVE  149



>emb|CBI36942.3| unnamed protein product [Vitis vinifera]
Length=1237

 Score =  1457 bits (3772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 740/1026 (72%), Positives = 852/1026 (83%), Gaps = 48/1026 (5%)
 Frame = +1

Query  577   KSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLE  756
             K G SKK + +KRK      + S K +K  SGG  K+T          V  +E +  N E
Sbjct  192   KKGQSKKVDPKKRKAVGEGTMGSGKRRK-SSGGAEKNTFK--------VSSVEPM-KNAE  241

Query  757   CVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFL  933
               KAS+  D++L G++ ERF  RE EKL FLG  R+DA RR PGD NYD RTLYLP +FL
Sbjct  242   SRKASDILDNVLPGDALERFGAREAEKLPFLGGERKDAKRRCPGDANYDPRTLYLPPNFL  301

Query  934   KGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPE  1113
             K L+GGQRQWWEFKS+HMDKV+FFKMGKFYELFEMDAHIGAKELDLQYMKG QPHCGFPE
Sbjct  302   KNLTGGQRQWWEFKSRHMDKVIFFKMGKFYELFEMDAHIGAKELDLQYMKGGQPHCGFPE  361

Query  1114  KNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGE  1290
             KNFS+N EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE
Sbjct  362   KNFSINVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGE  421

Query  1291  MLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsll  1470
             ML+ +PDASYL+AVTESCQ       ER++GVCVVDVATS++ILGQF DDS+CS+LC LL
Sbjct  422   MLSANPDASYLMAVTESCQ-----FEERSFGVCVVDVATSRIILGQFRDDSECSTLCCLL  476

Query  1471  YEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNN  1650
              E RPVEIIKPA LLS ETER L RHTR+PLVNELVP+SEFWD++KT+SE++++Y+  N+
Sbjct  477   SELRPVEIIKPANLLSPETERALMRHTRSPLVNELVPISEFWDSKKTVSEIRSVYRCFND  536

Query  1651  TPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFL  1830
                                              LVNAGE+G+ ALSALGGTLFYLKQAF+
Sbjct  537   L-------------------------------SLVNAGESGSLALSALGGTLFYLKQAFM  565

Query  1831  DVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCV  2010
             D +LL+FA+FEL P+S    I  KPYMVLDAAALENLEIFENS+   SSGTLYAQ+NHCV
Sbjct  566   DETLLRFAKFELFPYSGVSDIFHKPYMVLDAAALENLEIFENSRKGDSSGTLYAQLNHCV  625

Query  2011  TAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQI  2190
             TAFGKRLL+TWLARPLYHL++I+ERQDAVAGL+GVNLP  LEFRKELSRLPDMERLLA+I
Sbjct  626   TAFGKRLLKTWLARPLYHLDSIRERQDAVAGLRGVNLPSALEFRKELSRLPDMERLLARI  685

Query  2191  FASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDL  2370
             FASSEANGRNANKVV YEDAAKKQLQ+FISALRGCE M  AC SLG  L+N +S LLH L
Sbjct  686   FASSEANGRNANKVVFYEDAAKKQLQEFISALRGCELMTQACSSLGVILENVESGLLHHL  745

Query  2371  LTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHL  2550
             LTPGKGLPD+  VI  FK+ FDWVEAN+SGRIIP EGVD+EYD+AC +++++EL L KHL
Sbjct  746   LTPGKGLPDIHSVINHFKEAFDWVEANNSGRIIPHEGVDKEYDSACKTVKEIELRLKKHL  805

Query  2551  KEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMG  2730
             KEQQKL GD SIN+VT+GK+AYLLEVPESL   +P++YEL+SSKKG+FRYW P I+K +G
Sbjct  806   KEQQKLLGDASINFVTIGKEAYLLEVPESLRGNIPRDYELRSSKKGFFRYWTPNIKKFLG  865

Query  2731  ELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCR  2910
             ELS AE+E+ESKL+SILQRLI RFCEHH  WR+L+S+ AELDVLISL+IA+DYYEGPTCR
Sbjct  866   ELSHAESEKESKLRSILQRLISRFCEHHDKWRQLVSSTAELDVLISLAIANDYYEGPTCR  925

Query  2911  PHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGG  3090
             P I  L + + VPC  AKSLGHP+LR+DSL KG FV ND+T+GG+ H+ FILLTGPNMGG
Sbjct  926   PVISGLSNSNEVPCFTAKSLGHPVLRSDSLGKGTFVPNDITIGGSDHACFILLTGPNMGG  985

Query  3091  KSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETAS  3270
             KSTLLRQVCLAVILAQVGADVPA SF+LSPVDRIFVRMGAKD+IMAGQSTFLTEL ETAS
Sbjct  986   KSTLLRQVCLAVILAQVGADVPAESFELSPVDRIFVRMGAKDNIMAGQSTFLTELSETAS  1045

Query  3271  MLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQED  3450
             ML+SAT NSLVALDELGRGTSTSDGQAIAESVLEHFVHKV+CRGMFSTHYHRLA+DY+++
Sbjct  1046  MLTSATCNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVRCRGMFSTHYHRLAVDYKKN  1105

Query  3451  RQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSR  3630
              +VSLCHMAC +G+G+GG+EEVTFLY+L  G CP+SYGVNVARLAGLP++VL+KAAAKSR
Sbjct  1106  SKVSLCHMACQVGKGVGGVEEVTFLYRLRPGACPKSYGVNVARLAGLPNSVLQKAAAKSR  1165

Query  3631  EFEGVY  3648
             E EG+Y
Sbjct  1166  EIEGIY  1171


 Score =   121 bits (303),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 5/81 (6%)
 Frame = +1

Query  127  KPLLVIGPS-----PTPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            KPLLVIGPS      TP +   SYG+EV+NRR+KVYWPLDK WY GCVKSFD+++G+HLV
Sbjct  39   KPLLVIGPSKTTSPSTPVTGSKSYGEEVVNRRVKVYWPLDKSWYVGCVKSFDELTGEHLV  98

Query  292  QYDDEEEEMLNLSQERIEWIE  354
            QYDD +EE L+L +E+IEW+E
Sbjct  99   QYDDADEETLDLGKEKIEWVE  119



>ref|XP_007051089.1| MUTS isoform 1 [Theobroma cacao]
 gb|EOX95246.1| MUTS isoform 1 [Theobroma cacao]
Length=1316

 Score =  1454 bits (3764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 739/1031 (72%), Positives = 846/1031 (82%), Gaps = 14/1031 (1%)
 Frame = +1

Query  565   LRRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVT  744
             ++  K   S K E +KRK + G KL S   KK K+  N    + K       V ++E V 
Sbjct  235   MKISKRKSSGKTEAKKRKASGGGKLES--GKKSKTNANVSKQELK-------VSLVEPV-  284

Query  745   NNLECVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYL  918
               +E  KASNG D+ L G+++ERF  RE EKL FL    R    R+   DVNY+ +TLYL
Sbjct  285   KKIESDKASNGFDNALVGDASERFGKREAEKLHFLTPKERRDANRKRPEDVNYNPKTLYL  344

Query  919   PSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPH  1098
             P DFLK LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPH
Sbjct  345   PLDFLKSLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPH  404

Query  1099  CGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGT  1275
             CGFPE+NFSMN EKLARKGYRVLVVEQ ETPEQLELRRK KG+KDKVVKREICAV+TKGT
Sbjct  405   CGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGAKDKVVKREICAVVTKGT  464

Query  1276  LTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcss  1455
             LTEGEML+ +PD SYL+AVTE CQ+S NQ  +R +GVC VDVATS++ILGQF DD +CS 
Sbjct  465   LTEGEMLSANPDPSYLMAVTECCQSSTNQNEDRIFGVCAVDVATSRIILGQFGDDFECSG  524

Query  1456  lcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMY  1635
             LCSLL E RPVEIIKP KLLS ETER + RHTRN LVNELVP +EFWDA KT+ EVK +Y
Sbjct  525   LCSLLAELRPVEIIKPTKLLSLETERAMLRHTRNLLVNELVPSAEFWDAGKTVCEVKTIY  584

Query  1636  QRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYL  1815
             +R+N+     S N    + + S + D     LP +LS L++AG +G+ ALSALGGTL+YL
Sbjct  585   KRINDQSAARSVNHVGPNAANSCEGDGSC-CLPAILSNLLSAGADGSLALSALGGTLYYL  643

Query  1816  KQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQ  1995
             KQAFLD +LL+FA+FE LP S F  IAQ PYM+LDAAALENLEIFENS+N  SSGTLYAQ
Sbjct  644   KQAFLDETLLRFAKFESLPSSGFSGIAQNPYMLLDAAALENLEIFENSRNGDSSGTLYAQ  703

Query  1996  MNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMER  2175
             +NHCVTAFGKRLL+TWLARPLYH++ IKERQDAVAGLKG NL   LEFRK LSRLPDMER
Sbjct  704   LNHCVTAFGKRLLKTWLARPLYHVDLIKERQDAVAGLKGENLSYALEFRKALSRLPDMER  763

Query  2176  LLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSK  2355
             LLA+IFASS+A GRNANKV+LYEDAAKKQLQ+FISALR CE MV AC SLG  L+N +S 
Sbjct  764   LLARIFASSKAIGRNANKVILYEDAAKKQLQEFISALRCCELMVQACSSLGVILENVEST  823

Query  2356  LLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELS  2535
              LH LLT GKGLP++  ++K FKD FDWV+AN+SGRIIP EGVD EYD+AC  ++++E S
Sbjct  824   QLHHLLTAGKGLPNIHSILKHFKDAFDWVDANNSGRIIPHEGVDMEYDSACERVKEIESS  883

Query  2536  LAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVI  2715
             L KHLKEQ+KL GD+SI YVTVGKD YLLEVPE+L   VP++YEL+SSKKG+FRYW   I
Sbjct  884   LTKHLKEQRKLLGDSSITYVTVGKDVYLLEVPENLRGSVPRDYELRSSKKGFFRYWTQYI  943

Query  2716  RKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYE  2895
             +K++GELSQAE+E+E  LK+ILQRLIG+FCE H+ WR+L+ST AELDVLISL+IASD+YE
Sbjct  944   KKVIGELSQAESEKEMALKNILQRLIGQFCEDHNKWRQLVSTTAELDVLISLAIASDFYE  1003

Query  2896  GPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTG  3075
             GPTCRP I      + VPCL AKSLGHPILR+DSL  GAFV ND+T+GG+GH+SFILLTG
Sbjct  1004  GPTCRPLILGSSCSNEVPCLSAKSLGHPILRSDSLGNGAFVPNDITIGGSGHASFILLTG  1063

Query  3076  PNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTEL  3255
             PNMGGKSTLLRQVCLAVILAQVGADVPA  F LSPVDRIFVRMGAKDHIMAGQSTFLTEL
Sbjct  1064  PNMGGKSTLLRQVCLAVILAQVGADVPAEHFKLSPVDRIFVRMGAKDHIMAGQSTFLTEL  1123

Query  3256  LETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAI  3435
              ETA MLSSAT++SLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLA+
Sbjct  1124  SETALMLSSATQHSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAV  1183

Query  3436  DYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKA  3615
             DY+ + +VSLCHMAC +G G+ G+EEVTFLY+LT G CP+SYGVNVARLAGLPD+VL  A
Sbjct  1184  DYENNSKVSLCHMACQVGNGVAGVEEVTFLYRLTTGACPKSYGVNVARLAGLPDSVLLTA  1243

Query  3616  AAKSREFEGVY  3648
             AAKSREFE  Y
Sbjct  1244  AAKSREFESAY  1254


 Score =   122 bits (306),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 3/83 (4%)
 Frame = +1

Query  115  SKSNKPLLVIG--PSPTPDS-TESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKH  285
            SK  KPLLVIG  PSPTP +  + SYG+EV+++RI+VYWPLDK WYEG VKSFDK SG+H
Sbjct  70   SKLKKPLLVIGQTPSPTPSTPADKSYGKEVVDKRIRVYWPLDKAWYEGVVKSFDKESGRH  129

Query  286  LVQYDDEEEEMLNLSQERIEWIE  354
            LVQYDD EEE L+L +E+IEWI+
Sbjct  130  LVQYDDAEEEELDLGKEKIEWIK  152



>emb|CDP17077.1| unnamed protein product [Coffea canephora]
Length=1300

 Score =  1452 bits (3760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/1053 (71%), Positives = 860/1053 (82%), Gaps = 2/1053 (0%)
 Frame = +1

Query  610   KRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASNGDDIL  789
             KRK     KL +  +KKIK+ G+ +   SK      G  +IE   NN+   K  +     
Sbjct  232   KRKMGGAAKLGANSSKKIKNVGDTEQIDSKISCHVKGENLIEPAGNNVISEKGIDSCRTS  291

Query  790   TGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
                + ERF  RE  KL FLGK RRDA+RRRPG V+YD +TLYLP +FLK LS GQRQWW+
Sbjct  292   IDVAEERFGAREAGKLWFLGKDRRDANRRRPGHVDYDPKTLYLPPEFLKRLSDGQRQWWD  351

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
             FKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKG+QPHCGFPEKNFSMN EKLAR
Sbjct  352   FKSKHMDKVMFFKMGKFYELFEMDAHVGAKELDLQYMKGDQPHCGFPEKNFSMNVEKLAR  411

Query  1150  KGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLI  1326
             KGYRVLVVEQ ETPEQLE+RR++ GSKDKVVKREICAV+TKGTLTEGEML+ +PDA+YL+
Sbjct  412   KGYRVLVVEQTETPEQLEMRRREMGSKDKVVKREICAVVTKGTLTEGEMLSANPDAAYLM  471

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
             ++ E+  +S NQL +  +GVCVVDVATSK++LGQF DDSDCS LC LL E RPVEI+KPA
Sbjct  472   SLIENFPSSGNQLAQPIFGVCVVDVATSKIMLGQFRDDSDCSILCCLLSELRPVEIVKPA  531

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
             KLLS ETER+L RHTRNPL+NEL+PLSEFWD EKTI+EV  ++QR+NN     SQ+ A  
Sbjct  532   KLLSPETERLLLRHTRNPLINELLPLSEFWDGEKTINEVNCIFQRINNQTCSLSQSGAVS  591

Query  1687  HPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFEL  1866
             H  +S   D     LP++L+EL+ AGENG+YALSALGG LFYLK+AFLD SLL+FA+FE 
Sbjct  592   HAIQSSVKDGG-ECLPDILAELLAAGENGSYALSALGGILFYLKKAFLDESLLRFAKFES  650

Query  1867  LPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWL  2046
             LP S  G I+Q PYMVLDAAALENLEIFENS+N  S GTLYAQMNHCVTAFGKRLL+ WL
Sbjct  651   LPCSGLGNISQMPYMVLDAAALENLEIFENSRNGDSFGTLYAQMNHCVTAFGKRLLKKWL  710

Query  2047  ARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNAN  2226
             ARPL H+E I ERQDAVAGLKGVNLP +LEFRKELSRL D+ERLLA+IFASSEA GRNA 
Sbjct  711   ARPLCHVELIHERQDAVAGLKGVNLPFILEFRKELSRLQDVERLLARIFASSEAIGRNAK  770

Query  2227  KVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKL  2406
             KV+LYEDAAKKQLQ+FISALRGCE + +AC SL + L+N DS+LLH LLTPGKGLPDV+ 
Sbjct  771   KVILYEDAAKKQLQEFISALRGCELIYHACSSLASILENVDSRLLHHLLTPGKGLPDVRS  830

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
             V+K FKD FDWVEAN+SGRIIP +G D+EYD AC ++R+VE +L +HLKEQ++L GD S+
Sbjct  831   VMKHFKDAFDWVEANNSGRIIPRKGADKEYDDACKNVREVESNLMEHLKEQRRLLGDASV  890

Query  2587  NYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESK  2766
             NYVTVGKDAYLLEVPESLC   P++YELQSSKKG+FRYW PVI+KL+GELSQAE+E+ESK
Sbjct  891   NYVTVGKDAYLLEVPESLCRRTPRDYELQSSKKGFFRYWTPVIKKLLGELSQAESEKESK  950

Query  2767  LKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNV  2946
             LKSI QRL+GRF  HH+ WR+L+ST AELDVLIS+SIA DYYEG  CRP I    S D V
Sbjct  951   LKSIFQRLVGRFSAHHNMWRQLVSTAAELDVLISISIACDYYEGQACRPIITGSSSPDAV  1010

Query  2947  PCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAV  3126
             PCL AKSLGHP LR+DSL KG FV NDVTLGG+ H+ FILLTGPNMGGKSTLLRQVCLAV
Sbjct  1011  PCLTAKSLGHPTLRSDSLGKGGFVPNDVTLGGSEHAGFILLTGPNMGGKSTLLRQVCLAV  1070

Query  3127  ILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVA  3306
             ILAQVGADVPA SF +SPVDRIFVRMGA+DHIMAGQSTFL ELLETASMLS ATRNS+VA
Sbjct  1071  ILAQVGADVPAQSFVMSPVDRIFVRMGARDHIMAGQSTFLAELLETASMLSLATRNSIVA  1130

Query  3307  LDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHI  3486
             LDELGRGTSTSDGQAIAESVL+HF HKV CRGMFSTHYHRLAIDY+ D +VSL HMAC +
Sbjct  1131  LDELGRGTSTSDGQAIAESVLDHFAHKVHCRGMFSTHYHRLAIDYERDPKVSLFHMACQV  1190

Query  3487  GEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYgnnkgs  3666
             G G+ GLE+VTFLY+LT G CP+SYGVNVARLAGLPD VL+KA  KSR+FE  YG  KG 
Sbjct  1191  GRGIEGLEDVTFLYRLTPGACPKSYGVNVARLAGLPDAVLQKATLKSRDFEETYGRIKGP  1250

Query  3667  rgnssknWDEKAIEVIRSLMHLADYNERHGGCV  3765
             +   S +  E+   V+++L  +   N  H   V
Sbjct  1251  KDIFSTHQKEELKNVMKNLSTIVANNSCHQSAV  1283


 Score =   104 bits (259),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 4/89 (4%)
 Frame = +1

Query  109  LGSKSNKPLLVIGPSPTPDSTE--SSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGK  282
            L ++  KPLLVI PS    S     SYG EV+++RI+VYWPLD+ WY GCVK FD+ISGK
Sbjct  72   LETRPKKPLLVIRPSSPSASASPMKSYGPEVVDKRIRVYWPLDQSWYHGCVKHFDEISGK  131

Query  283  HLVQYDDEEEEMLNLSQERIEWI--ETPV  363
            HLV YDD +EE+LNL++E+IEW   E PV
Sbjct  132  HLVLYDDADEELLNLAEEKIEWPVEEVPV  160



>gb|KDP28248.1| hypothetical protein JCGZ_14019 [Jatropha curcas]
Length=1304

 Score =  1450 bits (3754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 732/1010 (72%), Positives = 841/1010 (83%), Gaps = 17/1010 (2%)
 Frame = +1

Query  649   KAKKIKSGGNNKSTQSKAPTATG-------GVKVIESVTNNLECVKASNG-DDILTGNSA  804
             +++K K+GG  K    K   ++G        V V+E V N     + SNG  D L  +++
Sbjct  242   ESRKRKAGGAAKMDSGKKSKSSGVGSKGEFKVSVVEPVKNKGN--EPSNGIGDALMSDAS  299

Query  805   ERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKH  984
             E+F++RE EKL FLG  RRDA RRRPGD +YD RTLYLP +F+K LSGGQRQWWEFKSKH
Sbjct  300   EKFNLRESEKLWFLGAERRDAKRRRPGDADYDPRTLYLPPNFVKSLSGGQRQWWEFKSKH  359

Query  985   MDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRV  1164
             MDKVLFFKMGKFYELFEMDAH+GAKEL+LQYMKGEQPHCGFPE+NFSMN EKLARKGYRV
Sbjct  360   MDKVLFFKMGKFYELFEMDAHVGAKELNLQYMKGEQPHCGFPERNFSMNVEKLARKGYRV  419

Query  1165  LVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTES  1341
             LVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE+LT SPDASYL+AVTES
Sbjct  420   LVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLTASPDASYLMAVTES  479

Query  1342  CQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSH  1521
             CQ   NQ  E  +G+CVVDVAT+++ LGQF DD +CS+LC LL E RPVEIIKPAK LS 
Sbjct  480   CQNLENQYLEHYFGICVVDVATNRIFLGQFGDDLECSTLCCLLSELRPVEIIKPAKGLSS  539

Query  1522  ETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSES  1701
             ETERV+ RHTRNPLVNEL+P  +FWDAEKTI EVK +Y+ +N        ++ D   +  
Sbjct  540   ETERVMLRHTRNPLVNELIPRLQFWDAEKTIHEVKTIYKHINVQAASELSDKTDTKTTNL  599

Query  1702  IDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSH  1881
              D  +    LP +LSELVN  ENG+ ALSALGGTL+YLKQAFLD +LL+FA+FE LP S 
Sbjct  600   QDGSS---CLPEILSELVNKRENGSLALSALGGTLYYLKQAFLDETLLRFAKFESLPCSD  656

Query  1882  FGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLY  2061
             F  +AQKPYM+LDAAALENLEIFENS+N GSSGTLYAQ+NHCVTAFGKRLL+TWLARPLY
Sbjct  657   FCNVAQKPYMILDAAALENLEIFENSRNGGSSGTLYAQLNHCVTAFGKRLLKTWLARPLY  716

Query  2062  HLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLY  2241
             HL +IK+RQDA++GL+GVN P   EFRK LSRLPDMERLLA+IFASSEANGRNANKV+ Y
Sbjct  717   HLRSIKDRQDAISGLRGVNQPMAQEFRKGLSRLPDMERLLARIFASSEANGRNANKVIFY  776

Query  2242  EDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQF  2421
             EDAAKKQLQ+FISALRGCE M  AC SLG  L N +S  LHDLL PGKGLPD   ++K F
Sbjct  777   EDAAKKQLQEFISALRGCELMAQACSSLGVILQNVESTQLHDLLMPGKGLPDTHSILKHF  836

Query  2422  KDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTV  2601
             KD FDWVEA++SGRIIP +GVD EYD+AC  + ++E SL KHLKEQ+KL GDTSI YVTV
Sbjct  837   KDAFDWVEAHNSGRIIPHKGVDMEYDSACKKITEIETSLTKHLKEQRKLLGDTSITYVTV  896

Query  2602  GKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSIL  2781
             GK+AYLLEVPE L   +P++YEL+SSKKG++RYW P I+K +GEL+Q E+E+ES LKSIL
Sbjct  897   GKEAYLLEVPEHLRGSIPRDYELRSSKKGFYRYWTPNIKKFLGELTQTESEKESTLKSIL  956

Query  2782  QRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN-VPCLV  2958
             QRL+ RFCEHH  WR+L+S   ELDVLISL+ ASD+YEGP CRP I  L S  N VPCL 
Sbjct  957   QRLVRRFCEHHDKWRQLVSATGELDVLISLAFASDFYEGPVCRPVI--LSSTANEVPCLS  1014

Query  2959  AKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQ  3138
             AKSLGHP+LR+DSL KGAFV N++T+GG G +SF+LLTGPNMGGKSTLLRQVCLAVILAQ
Sbjct  1015  AKSLGHPVLRSDSLGKGAFVPNNITIGGNGGASFVLLTGPNMGGKSTLLRQVCLAVILAQ  1074

Query  3139  VGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDEL  3318
             VGADVPA SF+LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLSSATRNSLVALDEL
Sbjct  1075  VGADVPAESFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVALDEL  1134

Query  3319  GRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL  3498
             GRGTSTSDGQAIAESVLEHF+ KVQCRGMFSTHYHRLA+DYQ++ +VSLCHMAC +G+G+
Sbjct  1135  GRGTSTSDGQAIAESVLEHFIQKVQCRGMFSTHYHRLAVDYQKNPEVSLCHMACQVGDGV  1194

Query  3499  GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             G +EEVTFLY+LT G CP+SYGVNVARLAGLPD++L+KAAAKSREFE VY
Sbjct  1195  GEVEEVTFLYRLTPGACPKSYGVNVARLAGLPDSILQKAAAKSREFEAVY  1244


 Score =   122 bits (307),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 6/99 (6%)
 Frame = +1

Query  109  LGSKSNKPLLVIGPSPTPDSTE-----SSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKI  273
            L S + KPLLVIG SP+P  +       SYG+EV+++RIKVYWPLDK WYEGCVKS+D+ 
Sbjct  70   LQSNTRKPLLVIGQSPSPSPSTPATTGQSYGKEVVDKRIKVYWPLDKSWYEGCVKSYDED  129

Query  274  SGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            SGKHLVQYDD EEE+L+L +E+IEW+E  +  KF+RLRR
Sbjct  130  SGKHLVQYDDFEEEVLDLGKEKIEWVEE-IAKKFKRLRR  167



>ref|XP_004300462.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein MSH6-like 
[Fragaria vesca subsp. vesca]
Length=1291

 Score =  1435 bits (3715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 735/1039 (71%), Positives = 830/1039 (80%), Gaps = 63/1039 (6%)
 Frame = +1

Query  667   SGGNN----KSTQSKAPTATGGVKV-IESVTNNLECVKASNGDDILTGNSAERFSMREME  831
             SGG N    K T+S     T G+K  +   T   E  KA NG  I  G+++ERFSMRE E
Sbjct  209   SGGGNLGSAKKTKSGGDVVTNGLKANLTEPTTEAESTKAVNG--IKIGDASERFSMREAE  266

Query  832   KLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKM  1011
             K  FLG+ RRDA +R PGD NYD RTLYLP DFLK LSGGQRQWWEFKSKHMDKVLFFKM
Sbjct  267   KFRFLGEKRRDAKKRCPGDPNYDPRTLYLPPDFLKSLSGGQRQWWEFKSKHMDKVLFFKM  326

Query  1012  GKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETP  1191
             GKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMN EKLARKGYRVLV+EQ ETP
Sbjct  327   GKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNVEKLARKGYRVLVIEQTETP  386

Query  1192  EQLELRRKKG-SKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLG  1368
             EQ+E+RRK+G SKDKVVKRE+CAV+TKGTLTEGEML+ +PDASYL+AVTE+ Q   NQ  
Sbjct  387   EQMEVRRKEGGSKDKVVKREVCAVVTKGTLTEGEMLSANPDASYLMAVTETSQNLVNQNA  446

Query  1369  ERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRH  1548
             ER +GVCVVDVATS+VILGQF DD +CS+L  LL E RPVE++KPA+LLS E E+VL RH
Sbjct  447   ERVFGVCVVDVATSRVILGQFPDDLECSALSCLLSELRPVELVKPAELLSPEAEKVLLRH  506

Query  1549  TRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRN  1728
             TRNPLVNELVPL EFWDAEKT+ EVK+ Y R ++     SQ E D               
Sbjct  507   TRNPLVNELVPLLEFWDAEKTVCEVKSTYSRADD-----SQMEED-----------GFSC  550

Query  1729  LPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPY  1908
             LP+VLSEL+ A ENG  ALSALGG LFYLKQAFL+ +LL+FA+FELLP S FG I  KPY
Sbjct  551   LPDVLSELIGARENGICALSALGGALFYLKQAFLEETLLRFAKFELLPSSGFGGIISKPY  610

Query  1909  MVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQ  2088
             MVLDAAALENLEIFENS+N  SSGT+YAQ+NHCVTAFGKRLL+TWLARPLYH+E+IKERQ
Sbjct  611   MVLDAAALENLEIFENSRNGDSSGTMYAQLNHCVTAFGKRLLKTWLARPLYHVESIKERQ  670

Query  2089  DAV---------------------------------------AGLKGVNLPGVLEFRKEL  2151
             DAV                                       A L G+NLP  L+FRK +
Sbjct  671   DAVSSLRVNAIDYFFFFFSVFPLRYPDAMPPFGLRCHMISKLASLXGINLPHALDFRKSM  730

Query  2152  SRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGA  2331
             +++PDMERLLA++FASS+A GRNANKVVLYEDAAKKQLQ+FISALRGC+ M  A  SLGA
Sbjct  731   AKIPDMERLLARVFASSKARGRNANKVVLYEDAAKKQLQEFISALRGCDLMATAICSLGA  790

Query  2332  TLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACG  2511
              L+N +S+ LH LLTPGKGL +V  V+K FKDGFDWVEANSSGRIIP EGVD EYD+ACG
Sbjct  791   NLENVESQQLHHLLTPGKGLSNVNSVLKHFKDGFDWVEANSSGRIIPREGVDNEYDSACG  850

Query  2512  SLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGY  2691
              ++++E     +LKEQ+KL GD SI YVT+GKD YLLEVPESL   VPQ+YEL+SSKKG+
Sbjct  851   KVKEIESHFMMYLKEQRKLLGDKSITYVTIGKDTYLLEVPESLGGSVPQDYELRSSKKGF  910

Query  2692  FRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISL  2871
             FRYW P I+K + ELSQAE+ERES LK+ILQRLIG+FCEHH  WR+L+S  AELDVLISL
Sbjct  911   FRYWTPNIKKSLTELSQAESERESSLKNILQRLIGQFCEHHIKWRQLVSVTAELDVLISL  970

Query  2872  SIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGH  3051
             +IASDYYEGPTCRP I      + VP   AKSLGHP++R+DSL KG FV N++TLGG GH
Sbjct  971   AIASDYYEGPTCRPVIMSSSDTEEVPLFSAKSLGHPVIRSDSLGKGTFVPNNITLGGTGH  1030

Query  3052  SSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAG  3231
             +SFILLTGPNMGGKSTLLRQVCLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKDHIM G
Sbjct  1031  ASFILLTGPNMGGKSTLLRQVCLAVILAQLGADVPAESFELSPVDRIFVRMGAKDHIMVG  1090

Query  3232  QSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFS  3411
             QSTFLTEL ETA+MLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV CRGMFS
Sbjct  1091  QSTFLTELSETATMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVHCRGMFS  1150

Query  3412  THYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGL  3591
             THYHRLA+DYQ + QVSLCHMAC +G G  G+EEVTFLY+LT G CP+SYGVNVARLAGL
Sbjct  1151  THYHRLAVDYQNNSQVSLCHMACRVGNGDEGVEEVTFLYRLTRGACPKSYGVNVARLAGL  1210

Query  3592  PDNVLEKAAAKSREFEGVY  3648
             P +VL+KAAAKSREFE  Y
Sbjct  1211  PISVLQKAAAKSREFEAAY  1229


 Score = 90.5 bits (223),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +1

Query  181  YGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIETP  360
            YG+EV+ +RIKV WP D+ WY+GCVKSF+K    HL+QYDD +EE LNLS E+ E ++  
Sbjct  62   YGEEVVGKRIKVLWPADRAWYKGCVKSFNKEKTSHLIQYDDGDEEELNLSLEKFELLQD-  120

Query  361  VVTKFRRLRR  390
             VT  +RLRR
Sbjct  121  TVTNLKRLRR  130



>ref|XP_009378706.1| PREDICTED: DNA mismatch repair protein MSH6 [Pyrus x bretschneideri]
Length=1303

 Score =  1434 bits (3712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 727/1033 (70%), Positives = 839/1033 (81%), Gaps = 21/1033 (2%)
 Frame = +1

Query  559   NGLRRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVK-VIE  735
             N  +RG SG        KRK + G  L S  AKK K GGN             G+K V  
Sbjct  238   NKRKRGDSG-------GKRKLSGGGSLGS--AKKTKCGGN---------VGMNGLKGVSP  279

Query  736   SVTNNLECVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTL  912
               T N E   A+NG D +L+G+++ RFS+RE EKL FLG+ R DA RR  GD NYD RTL
Sbjct  280   EPTPNAEGTNATNGMDTVLSGDASSRFSLREAEKLHFLGEQRMDAKRRSLGDANYDPRTL  339

Query  913   YLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQ  1092
             YLP  FLK LSGGQRQWWEFKSKHMDKV+FFKMGKFYELFEMDAHIGAKEL LQYMKGEQ
Sbjct  340   YLPPGFLKSLSGGQRQWWEFKSKHMDKVIFFKMGKFYELFEMDAHIGAKELGLQYMKGEQ  399

Query  1093  PHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITK  1269
             PHCGFPEKNFSMN EKLARKGYRVLVVEQ ETPEQ++LRRKK GS DKVVKREICAV+TK
Sbjct  400   PHCGFPEKNFSMNVEKLARKGYRVLVVEQTETPEQMDLRRKKDGSIDKVVKREICAVVTK  459

Query  1270  GTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdc  1449
             GTLTEGEML+ +PDASYL+AVTE+ Q  AN+  ER +GVCVVDVATS+VILGQF DD +C
Sbjct  460   GTLTEGEMLSANPDASYLMAVTENSQNLANENAERVFGVCVVDVATSRVILGQFGDDLEC  519

Query  1450  sslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKN  1629
             S+L  LL E RPVEI+KPA LLS ETE+VL RHTR+PLVNELVP+ EF DAE+T+ EV++
Sbjct  520   SALSCLLSELRPVEIVKPANLLSPETEKVLIRHTRSPLVNELVPVLEFMDAERTVQEVRS  579

Query  1630  MYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLF  1809
             +Y+R ++  +  S  +A  H S+S   +     LP+VLSE+V AGENG  ALSALGG LF
Sbjct  580   IYRRADDQLVSGSPKKASFHGSDSHLEEDGYGCLPDVLSEMVRAGENGICALSALGGALF  639

Query  1810  YLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLY  1989
             YLKQAFLD ++L+FA+FELLP S FG    KPYMVLD+AALENLEIFEN++N  SSGTLY
Sbjct  640   YLKQAFLDETILRFAKFELLPSSGFGDTVSKPYMVLDSAALENLEIFENNRNGDSSGTLY  699

Query  1990  AQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDM  2169
             AQ+NHCVT FGKRLLRTWLARPLYH+E IK+RQDAVA L+GVNLP  LEFRK +SRLPDM
Sbjct  700   AQLNHCVTGFGKRLLRTWLARPLYHVEFIKQRQDAVASLRGVNLPYALEFRKAISRLPDM  759

Query  2170  ERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTD  2349
             ERLL ++F+SS A GRNA KVV YEDAAKKQLQ+FISALRGCE M   C SL   L+N +
Sbjct  760   ERLLVRVFSSSNACGRNAKKVVFYEDAAKKQLQEFISALRGCELMAQTCCSLKVILENVE  819

Query  2350  SKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVE  2529
             S  LH LLT GKGLPDV  V+K FKD FDWVEAN+SGRIIP EGVD EYD+AC  ++++E
Sbjct  820   SAQLHHLLTLGKGLPDVNSVLKHFKDAFDWVEANNSGRIIPHEGVDIEYDSACEKVKEIE  879

Query  2530  LSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNP  2709
               L KHL+EQ+KL GD SI YVTVGKD+YLLE+PESLC  +P +YEL+SSKKG+ RYW P
Sbjct  880   SHLTKHLQEQRKLLGDKSITYVTVGKDSYLLEMPESLCSCIPPDYELRSSKKGFSRYWTP  939

Query  2710  VIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDY  2889
              I+K + ELSQAET++ES LKSILQRLIGRFCEH   WR+L+S  AE+DVLISL+IASDY
Sbjct  940   DIKKSLTELSQAETDKESSLKSILQRLIGRFCEHRLKWRQLVSVTAEIDVLISLAIASDY  999

Query  2890  YEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILL  3069
             +EGP+C+P +      + VP   A SLGHP+LR+DSL KGAFVSND+++GG+GH+SFILL
Sbjct  1000  FEGPSCQPVVMSSSCSNEVPRFSATSLGHPVLRSDSLGKGAFVSNDISIGGSGHASFILL  1059

Query  3070  TGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLT  3249
             TGPNMGGKSTL+RQVCLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKD+IM GQSTFLT
Sbjct  1060  TGPNMGGKSTLIRQVCLAVILAQLGADVPAESFELSPVDRIFVRMGAKDNIMVGQSTFLT  1119

Query  3250  ELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRL  3429
             EL ETA+MLS ATRNSLVALDELGRGTSTSDGQAIAESVLEHF++KVQCRGMFSTHYHRL
Sbjct  1120  ELSETATMLSLATRNSLVALDELGRGTSTSDGQAIAESVLEHFIYKVQCRGMFSTHYHRL  1179

Query  3430  AIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLE  3609
             A+DYQ + +VSLCHMAC +G G GG+EEVTFLY+L  G CP+SYGVN+ARLAGLP +VL+
Sbjct  1180  AVDYQNNSKVSLCHMACQVGNGDGGVEEVTFLYRLNPGACPKSYGVNIARLAGLPISVLK  1239

Query  3610  KAAAKSREFEGVY  3648
             KA AKSREFE  Y
Sbjct  1240  KATAKSREFEATY  1252


 Score = 84.0 bits (206),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 60/92 (65%), Gaps = 12/92 (13%)
 Frame = +1

Query  148  PSPTP----DSTESSY-------GQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQ  294
            PSPT     DS  SS        G E + +RIKVYWPLD  WYEG VK F+K SGKHLVQ
Sbjct  79   PSPTTPLPLDSKPSSKTNPKKSNGHEAVGKRIKVYWPLDDNWYEGYVKCFNKHSGKHLVQ  138

Query  295  YDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            YDD EEEML+L  E+IEW+    V  F+RLRR
Sbjct  139  YDDAEEEMLDLEMEKIEWVPE-TVKIFKRLRR  169



>ref|XP_008235198.1| PREDICTED: DNA mismatch repair protein MSH6 [Prunus mume]
Length=1274

 Score =  1434 bits (3711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 720/1000 (72%), Positives = 835/1000 (84%), Gaps = 7/1000 (1%)
 Frame = +1

Query  655   KKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASNG-DDILTGNSAERFSMREME  831
             +K+K GGN  S +      T   K +   T N E  K +NG + +++G+++ RF +RE E
Sbjct  220   RKVKGGGNLGSAKK-----TKCDKDVMEPTPNAESTKVANGMNTVVSGDASARFIVREAE  274

Query  832   KLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKM  1011
             KL FLG+GRRDA +R PGD NYD RTLYLP DFLK LSGGQRQWWEFKSKHMDKVLFFKM
Sbjct  275   KLHFLGEGRRDAKKRFPGDANYDPRTLYLPPDFLKSLSGGQRQWWEFKSKHMDKVLFFKM  334

Query  1012  GKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETP  1191
             GKFYELFEMDAHIGAKEL LQYMKGEQPHCGFPEKNFSMN EKLARKGYRVLV+EQ ETP
Sbjct  335   GKFYELFEMDAHIGAKELGLQYMKGEQPHCGFPEKNFSMNVEKLARKGYRVLVIEQTETP  394

Query  1192  EQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLG  1368
             EQ+ELRRK+ GSKDKVVKREICAV+TKGTLTEGEML+ +PDASYL+AVTE+ Q  ANQ  
Sbjct  395   EQMELRRKEDGSKDKVVKREICAVVTKGTLTEGEMLSANPDASYLMAVTENSQNVANQNT  454

Query  1369  ERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRH  1548
             ER +GVCVVDVATS+VILGQF DD +CS+L  LL E RPVEIIKP KLL  ETE+VL RH
Sbjct  455   ERIFGVCVVDVATSRVILGQFGDDLECSALSCLLSELRPVEIIKPVKLLGPETEKVLLRH  514

Query  1549  TRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRN  1728
             TR+PLVNELVPL EFWDAE+T  E++ +Y+   +  +  S   ++LH ++S   +  L  
Sbjct  515   TRSPLVNELVPLLEFWDAERTAQEIRRIYRCTVDQLVSGSPKTSNLHSNDSHLEEDDLGC  574

Query  1729  LPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPY  1908
             LP+VLSEL+  GENG  ALSALGG LFYLKQAFLD +LL+FA+FELLP S FG I  KPY
Sbjct  575   LPDVLSELMRTGENGICALSALGGVLFYLKQAFLDETLLRFAKFELLPSSGFGDIVSKPY  634

Query  1909  MVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQ  2088
             MVLD+AALENLEIFENS+N  SSGT+YAQ+NHCVT FGKRLL+TWLARPLYH+E IKERQ
Sbjct  635   MVLDSAALENLEIFENSRNGDSSGTIYAQLNHCVTGFGKRLLKTWLARPLYHVELIKERQ  694

Query  2089  DAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQ  2268
             DAVA L+GVNLP  LEFRK +SRLPDMERLLA++F+SS+A GRNANKVVLYEDAAKKQLQ
Sbjct  695   DAVASLQGVNLPYALEFRKAMSRLPDMERLLARVFSSSKACGRNANKVVLYEDAAKKQLQ  754

Query  2269  QFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEA  2448
             +FISAL GCE MV  C SLG  L++ +S+ LH LLTPG+GLPDV  ++K FKD FDWV+A
Sbjct  755   EFISALHGCELMVQTCCSLGVILEHVESRQLHHLLTPGQGLPDVNSILKHFKDAFDWVQA  814

Query  2449  NSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEV  2628
             NSSGRIIP EGVD EYD++C  ++++E  L K+L+EQ++L G+ SI YVTVGKD+YLLEV
Sbjct  815   NSSGRIIPHEGVDIEYDSSCEKVKEIESHLTKYLQEQRRLLGNKSITYVTVGKDSYLLEV  874

Query  2629  PESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCE  2808
             PESL   +P++YEL SSKKG FRYW P I+K +  LS+AET +ES LKSIL RLIG+FCE
Sbjct  875   PESLRGSIPRDYELCSSKKGIFRYWTPNIKKSLTGLSEAETGKESSLKSILHRLIGQFCE  934

Query  2809  HHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILR  2988
             HH  WR+L+S  AELDVLISL+IASDY+EGP+CRP I      + VP   AKSLGHP+L+
Sbjct  935   HHLKWRQLVSVTAELDVLISLAIASDYFEGPSCRPVIMSSSCTNEVPHFSAKSLGHPVLK  994

Query  2989  TDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASF  3168
             +DSL KG FVSND+T+GG+GH+SFILLTGPNMGGKSTLLRQVCLA ILAQ+GADVPA SF
Sbjct  995   SDSLGKGTFVSNDITIGGSGHASFILLTGPNMGGKSTLLRQVCLAAILAQLGADVPAESF  1054

Query  3169  DLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQ  3348
             +LSPVDRIFVRMGA+DHIM GQSTFLTEL ETA+MLSSATRNSLVALDELGRGTSTSDGQ
Sbjct  1055  ELSPVDRIFVRMGARDHIMVGQSTFLTELSETATMLSSATRNSLVALDELGRGTSTSDGQ  1114

Query  3349  AIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLY  3528
             AIAESVLEHFV+KVQCRGMFSTHYHRLA+DYQ + +VSLCHMAC +G G GG+EEVTFLY
Sbjct  1115  AIAESVLEHFVYKVQCRGMFSTHYHRLAVDYQSNPEVSLCHMACQVGNGDGGVEEVTFLY  1174

Query  3529  KLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             +LT G CP+SYGVN+ARLAGLP +VL+KAAAKSREFE  Y
Sbjct  1175  RLTPGACPKSYGVNIARLAGLPISVLQKAAAKSREFEATY  1214


 Score =   102 bits (255),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = +1

Query  148  PSP--TPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEML  321
            PSP  +    + S+GQEV+ +RI+VYWPLD  WYEG VK F K +GKHLVQYDD EEE+L
Sbjct  56   PSPLQSKPKPKKSHGQEVVGKRIRVYWPLDNIWYEGYVKLFSKDNGKHLVQYDDAEEELL  115

Query  322  NLSQERIEWIETPVVTKFRRLRR  390
            +L +E+IEW++  V T  +RLRR
Sbjct  116  DLGKEKIEWVQETVKT-LKRLRR  137



>ref|XP_007201220.1| hypothetical protein PRUPE_ppa000344mg [Prunus persica]
 gb|EMJ02419.1| hypothetical protein PRUPE_ppa000344mg [Prunus persica]
Length=1263

 Score =  1428 bits (3697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 716/1000 (72%), Positives = 834/1000 (83%), Gaps = 7/1000 (1%)
 Frame = +1

Query  655   KKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASNG-DDILTGNSAERFSMREME  831
             +K+K GGN  S +      T   K +   T N+E +K +NG + +++G+++ RF +RE E
Sbjct  220   RKLKGGGNLGSAKK-----TKCDKDVMEPTPNVESMKVANGMNTVVSGDASARFIVREAE  274

Query  832   KLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKM  1011
             KL FLG+ RRDA +R PGD NYD RTLYLP DFLK LSGGQRQWWEFKSKHMDKVLFFKM
Sbjct  275   KLHFLGEVRRDAKKRFPGDANYDPRTLYLPPDFLKSLSGGQRQWWEFKSKHMDKVLFFKM  334

Query  1012  GKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETP  1191
             GKFYELFEMDAHIGAKEL LQYMKGEQPHCGFPEKNFSMN EKLARKGYRVLV+EQ ETP
Sbjct  335   GKFYELFEMDAHIGAKELGLQYMKGEQPHCGFPEKNFSMNVEKLARKGYRVLVIEQTETP  394

Query  1192  EQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLG  1368
             EQ+ELRRK+ GSKDKVVKREICAV+TKGTLTEGEML+ +PDASYL+AVTE+ Q  ANQ  
Sbjct  395   EQMELRRKEDGSKDKVVKREICAVVTKGTLTEGEMLSANPDASYLMAVTENSQNVANQNT  454

Query  1369  ERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRH  1548
             ER +GVCVVDVATS+VILGQF DD +CS+L  LL E RPVEIIKP KLL  ETE+VL RH
Sbjct  455   ERIFGVCVVDVATSRVILGQFGDDLECSALSCLLSELRPVEIIKPVKLLGPETEKVLLRH  514

Query  1549  TRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRN  1728
             TR+PLVNELVPL EFWDAE+T  E++ +Y+   +  +  S   ++LH  +S   +  L  
Sbjct  515   TRSPLVNELVPLLEFWDAERTAQEIRRIYRCTVDQLVSGSPKTSNLHSDDSHLEEDDLGC  574

Query  1729  LPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPY  1908
             LP+VLSEL+  GENG  ALSALGG LFYLKQAFLD +LL+FA+FELLP S FG I  KPY
Sbjct  575   LPDVLSELMRTGENGICALSALGGVLFYLKQAFLDETLLRFAKFELLPSSGFGDIVSKPY  634

Query  1909  MVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQ  2088
             MVLD+AALENLEIFENS+N  SSGT+YAQ+NHCVT FGKRLL+TWLARPLYH+E IKERQ
Sbjct  635   MVLDSAALENLEIFENSRNGDSSGTIYAQLNHCVTGFGKRLLKTWLARPLYHVELIKERQ  694

Query  2089  DAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQ  2268
             DAVA L+GVNLP  LEFRK ++RLPDMERLLA++F+SS+A GRNANKVVLYEDAAKKQLQ
Sbjct  695   DAVASLQGVNLPYALEFRKAMTRLPDMERLLARVFSSSKACGRNANKVVLYEDAAKKQLQ  754

Query  2269  QFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEA  2448
             +FISAL GCE MV  C SLG  L++ +S+ LH LLTPG+GLPDV  ++K FKD FDWV+A
Sbjct  755   EFISALHGCELMVQICCSLGVILEHVESRQLHHLLTPGQGLPDVNSILKHFKDAFDWVQA  814

Query  2449  NSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEV  2628
             NSSGRIIP EGVD EYD++C  ++++E  L K+L+EQ++L G+ SI Y TVGKD+YLLEV
Sbjct  815   NSSGRIIPHEGVDIEYDSSCEKVKEIESHLTKYLQEQRRLLGNKSITYATVGKDSYLLEV  874

Query  2629  PESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCE  2808
             PESL   +P++YEL SSKKG FRYW P I+K + ELS+AET +ES LKSIL RLIG+FCE
Sbjct  875   PESLRGSIPRDYELCSSKKGIFRYWTPNIKKSLTELSEAETGKESSLKSILHRLIGQFCE  934

Query  2809  HHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILR  2988
             HH  WR+L+S  AELDVLISL+IASDY+EGP+CRP I      + VP   AKSLGHP+L+
Sbjct  935   HHLKWRQLVSVTAELDVLISLAIASDYFEGPSCRPVIMSSSCTNEVPHFSAKSLGHPVLK  994

Query  2989  TDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASF  3168
             +DSL KG FVSND+T+GG+GH+SFILLTGPNMGGKSTLLRQVCLA ILAQ+GADVPA SF
Sbjct  995   SDSLGKGTFVSNDITIGGSGHASFILLTGPNMGGKSTLLRQVCLAAILAQLGADVPAESF  1054

Query  3169  DLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQ  3348
             +LSPVDRIFVRMGA+DHIM GQSTFLTEL ETA+MLS +TRNSLVALDELGRGTSTSDGQ
Sbjct  1055  ELSPVDRIFVRMGARDHIMVGQSTFLTELSETATMLSYSTRNSLVALDELGRGTSTSDGQ  1114

Query  3349  AIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLY  3528
             AIAESVLEHFV+KVQCRGMFSTHYHRLA+DYQ + +VSLCHMAC +G G GG+EEVTFLY
Sbjct  1115  AIAESVLEHFVYKVQCRGMFSTHYHRLAVDYQNNPEVSLCHMACQVGNGDGGVEEVTFLY  1174

Query  3529  KLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             +LT G CP+SYGVN+ARLAGLP +VL+KAAAKSREFE  Y
Sbjct  1175  RLTPGACPKSYGVNIARLAGLPISVLQKAAAKSREFEATY  1214


 Score = 89.7 bits (221),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 68/100 (68%), Gaps = 10/100 (10%)
 Frame = +1

Query  118  KSNKPLLVIGPSP---TPDSTES------SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDK  270
            ++  P    GPSP   TP   +S      S+GQEV+ +RI+VYWPLD  WYEG VK F K
Sbjct  41   QTQNPNPCPGPSPSHTTPSPLQSKPKPKKSHGQEVVGKRIRVYWPLDNIWYEGYVKLFSK  100

Query  271  ISGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
             +GKHLVQYDD EEE+L+L +E+IEW++  V T  +RLRR
Sbjct  101  DNGKHLVQYDDAEEELLDLGEEKIEWVQETVKT-LKRLRR  139



>ref|XP_006444483.1| hypothetical protein CICLE_v10018525mg [Citrus clementina]
 gb|ESR57723.1| hypothetical protein CICLE_v10018525mg [Citrus clementina]
Length=1288

 Score =  1424 bits (3687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/964 (74%), Positives = 827/964 (86%), Gaps = 7/964 (1%)
 Frame = +1

Query  763   KASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKG  939
             K SNG D+ + G+ +ERFS RE +K  FLG   RDA RRRPGDV YD RTLYLP DFL+ 
Sbjct  267   KLSNGFDNPVMGDVSERFSAREADKFHFLGPDLRDAKRRRPGDVYYDPRTLYLPPDFLRN  326

Query  940   LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKN  1119
             LS GQ+QWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPE+N
Sbjct  327   LSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERN  386

Query  1120  FSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEML  1296
             FSMN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE+L
Sbjct  387   FSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELL  446

Query  1297  TVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYE  1476
             + +PDASYL+A+TES Q+ A+Q  +R +G+CVVDVATS++ILGQ  DD DCS LC LL E
Sbjct  447   SANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSE  506

Query  1477  FRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTP  1656
              RPVEIIKPA +LS ETER + RHTRNPLVN+LVPLSEFWDAE T+ E+KN+Y R+    
Sbjct  507   LRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAE-  565

Query  1657  IPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDV  1836
                S N+AD + + S      L  LP++LSEL++ G++G+  LSALGGTLFYLK++FLD 
Sbjct  566   ---SLNKADSNVANSQAEGDGLTCLPDILSELISTGDSGSQVLSALGGTLFYLKKSFLDE  622

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             +LL+FA+FELLP S FG +A+KPYMVLDA ALENLE+FENS++  SSGTLYAQ+NHCVTA
Sbjct  623   TLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTA  682

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
             FGKRLLRTWLARPLY+   I+ERQDAVAGL+GVN P  LEFRK LSRLPDMERLLA++FA
Sbjct  683   FGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA  742

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             SSEANGRN+NKVVLYEDAAKKQLQ+FISAL GCE M  AC SLGA L+NT+S+ LH +LT
Sbjct  743   SSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILT  802

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PGKGLP +  ++K FKD FDWVEAN+SGRIIP  GVD +YD+AC  ++++E SL KHLKE
Sbjct  803   PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKE  862

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GDTSI YVT+GKD YLLEVPESL   VP++YEL+SSKKG+FRYW P I+KL+GEL
Sbjct  863   QRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGEL  922

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPH  2916
             SQAE+E+ES LKSILQRLIG+FCEHH+ WR++++  AELD LISL+IASD+YEGPTCRP 
Sbjct  923   SQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPV  982

Query  2917  IRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKS  3096
             I +  S +  P + AKSLGHP+LR+DSL KG FV ND+T+GG G++SFILLTGPNMGGKS
Sbjct  983   ILDSCSNEE-PYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKS  1041

Query  3097  TLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASML  3276
             TLLRQVCLAVILAQVGADVPA  F++SPVDRIFVRMGAKDHIMAGQSTFLTEL ETA ML
Sbjct  1042  TLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALML  1101

Query  3277  SSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQ  3456
             SSATRNSLV LDELGRGTSTSDGQAIAESVLEHFVHKVQCRG+FSTHYHRLA+DY++D +
Sbjct  1102  SSATRNSLVVLDELGRGTSTSDGQAIAESVLEHFVHKVQCRGLFSTHYHRLAVDYKKDPR  1161

Query  3457  VSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             VSLCHMAC +G G+GG+EEVTFLY+L+ G CP+SYGVNVARLAG+PD VL+KA AKS EF
Sbjct  1162  VSLCHMACQVGNGVGGVEEVTFLYRLSPGACPKSYGVNVARLAGIPDKVLQKAVAKSTEF  1221

Query  3637  EGVY  3648
             E +Y
Sbjct  1222  EAIY  1225


 Score =   107 bits (266),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYG++VL +RI+VYWPLDK WYEGCVKSFDK   KHLVQYDD E+E+L+L +E+IEW++ 
Sbjct  100  SYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQE  159

Query  358  PVVTKFRRLRR  390
              V+  +RLRR
Sbjct  160  S-VSLLKRLRR  169



>gb|KDO87011.1| hypothetical protein CISIN_1g000778mg [Citrus sinensis]
Length=1288

 Score =  1424 bits (3686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 713/964 (74%), Positives = 827/964 (86%), Gaps = 7/964 (1%)
 Frame = +1

Query  763   KASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKG  939
             K SNG D+ + G+ +ERFS RE +K  FLG  RRDA RRRPGDV YD RTLYLP DFL+ 
Sbjct  267   KLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRN  326

Query  940   LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKN  1119
             LS GQ+QWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPE+N
Sbjct  327   LSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERN  386

Query  1120  FSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEML  1296
             FSMN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE+L
Sbjct  387   FSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELL  446

Query  1297  TVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYE  1476
             + +PDASYL+A+TES Q+ A+Q  +R +G+CVVDVATS++ILGQ  DD DCS LC LL E
Sbjct  447   SANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSE  506

Query  1477  FRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTP  1656
              RPVEIIKPA +LS ETER + RHTRNPLVN+LVPLSEFWDAE T+ E+KN+Y R+    
Sbjct  507   LRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAE-  565

Query  1657  IPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDV  1836
                S N+AD + + S      L  LP +LSEL++ G++G+  LSALGGTLFYLK++FLD 
Sbjct  566   ---SLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDE  622

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             +LL+FA+FELLP S FG +A+KPYMVLDA ALENLE+FENS++  SSGTLYAQ+NHCVTA
Sbjct  623   TLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTA  682

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
             FGKRLLRTWLARPLY+   I+ERQDAVAGL+GVN P  LEFRK LSRLPDMERLLA++FA
Sbjct  683   FGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA  742

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             SSEANGRN+NKVVLYEDAAKKQLQ+FISAL GCE M  AC SLGA L+NT+S+ LH +LT
Sbjct  743   SSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILT  802

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PGKGLP +  ++K FKD FDWVEAN+SGRIIP  GVD +YD+AC  ++++E SL KHLKE
Sbjct  803   PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKE  862

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GDTSI YVT+GKD YLLEVPESL   VP++YEL+SSKKG+FRYW P I+KL+GEL
Sbjct  863   QRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGEL  922

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPH  2916
             SQAE+E+ES LKSILQRLIG+FCEHH+ WR++++  AELD LISL+IASD+YEGPTCRP 
Sbjct  923   SQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPV  982

Query  2917  IRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKS  3096
             I +  S +  P + AKSLGHP+LR+DSL KG FV ND+T+GG G++SFILLTGPNMGGKS
Sbjct  983   ILDSCSNEE-PYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKS  1041

Query  3097  TLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASML  3276
             TLLRQVCLAVILAQVGADVPA  F++SPVDRIFVRMGAKDHIMAGQSTFLTEL ETA ML
Sbjct  1042  TLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALML  1101

Query  3277  SSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQ  3456
             SSATRNSLV LDELGRGTSTSDGQAIAESVLEHFVHKVQCRG+FSTHYHRLA+DY++D +
Sbjct  1102  SSATRNSLVVLDELGRGTSTSDGQAIAESVLEHFVHKVQCRGLFSTHYHRLAVDYKKDPR  1161

Query  3457  VSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             VSLCHMAC +G G+GG+EEVTFLY+L+ G CP+SYGVNVARLAG+PD VL+KA AKS EF
Sbjct  1162  VSLCHMACQVGNGVGGVEEVTFLYRLSPGACPKSYGVNVARLAGIPDKVLQKAVAKSTEF  1221

Query  3637  EGVY  3648
             E +Y
Sbjct  1222  EAIY  1225


 Score =   107 bits (266),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYG++VL +RI+VYWPLDK WYEGCVKSFDK   KHLVQYDD E+E+L+L +E+IEW++ 
Sbjct  100  SYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQE  159

Query  358  PVVTKFRRLRR  390
              V+  +RLRR
Sbjct  160  S-VSLLKRLRR  169



>ref|XP_006492326.1| PREDICTED: DNA mismatch repair protein MSH6-like [Citrus sinensis]
Length=1288

 Score =  1424 bits (3685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 713/964 (74%), Positives = 827/964 (86%), Gaps = 7/964 (1%)
 Frame = +1

Query  763   KASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKG  939
             K SNG D+ + G+ +ERFS RE +K  FLG  RRDA RRRPGDV YD RTLYLP DFL+ 
Sbjct  267   KLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRN  326

Query  940   LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKN  1119
             LS GQ+QWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPE+N
Sbjct  327   LSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERN  386

Query  1120  FSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEML  1296
             FSMN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE+L
Sbjct  387   FSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELL  446

Query  1297  TVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYE  1476
             + +PDASYL+A+TES Q+ A+Q  +R +G+CVVDVATS++ILGQ  DD DCS LC LL E
Sbjct  447   SANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSE  506

Query  1477  FRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTP  1656
              RPVEIIKPA +LS ETER + RHTRNPLVN+LVPLSEFWDAE T+ E+KN+Y R+    
Sbjct  507   LRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAE-  565

Query  1657  IPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDV  1836
                S N+AD + + S      L  LP +LSEL++ G++G+  LSALGGTLFYLK++FLD 
Sbjct  566   ---SLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDE  622

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             +LL+FA+FELLP S FG +A+KPYMVLDA ALENLE+FENS++  SSGTLYAQ+NHCVTA
Sbjct  623   TLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTA  682

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
             FGKRLLRTWLARPLY+   I+ERQDAVAGL+GVN P  LEFRK LSRLPDMERLLA++FA
Sbjct  683   FGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA  742

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             SSEANGRN+NKVVLYEDAAKKQLQ+FISAL GCE M  AC SLGA L+NT+S+ LH +LT
Sbjct  743   SSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILT  802

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PGKGLP +  ++K FKD FDWVEAN+SGRIIP  GVD +YD+AC  ++++E SL KHLKE
Sbjct  803   PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKE  862

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GDTSI YVT+GKD YLLEVPESL   VP++YEL+SSKKG+FRYW P I+KL+GEL
Sbjct  863   QRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGEL  922

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPH  2916
             SQAE+E+ES LKSILQRLIG+FCEHH+ WR++++  AELD LISL+IASD+YEGPTCRP 
Sbjct  923   SQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPV  982

Query  2917  IRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKS  3096
             I +  S +  P + AKSLGHP+LR+DSL KG FV ND+T+GG G++SFILLTGPNMGGKS
Sbjct  983   ILDSCSNEE-PYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKS  1041

Query  3097  TLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASML  3276
             TLLRQVCLAVILAQVGADVPA  F++SPVDRIFVRMGAKDHIMAGQSTFLTEL ETA ML
Sbjct  1042  TLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALML  1101

Query  3277  SSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQ  3456
             SSATRNSLV LDELGRGTSTSDGQAIAESVLEHFVHKVQCRG+FSTHYHRLA+DY++D +
Sbjct  1102  SSATRNSLVVLDELGRGTSTSDGQAIAESVLEHFVHKVQCRGLFSTHYHRLAVDYKKDPR  1161

Query  3457  VSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             VSLCHMAC +G G+GG+EEVTFLY+L+ G CP+SYGVNVARLAG+PD VL+KA AKS EF
Sbjct  1162  VSLCHMACQVGNGVGGVEEVTFLYRLSPGACPKSYGVNVARLAGIPDKVLQKAVAKSTEF  1221

Query  3637  EGVY  3648
             E +Y
Sbjct  1222  EAIY  1225


 Score =   107 bits (266),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYG++VL +RI+VYWPLDK WYEGCVKSFDK   KHLVQYDD E+E+L+L +E+IEW++ 
Sbjct  100  SYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQE  159

Query  358  PVVTKFRRLRR  390
              V+  +RLRR
Sbjct  160  S-VSLLKRLRR  169



>ref|XP_011041329.1| PREDICTED: DNA mismatch repair protein MSH6-like isoform X2 [Populus 
euphratica]
Length=1299

 Score =  1422 bits (3682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 728/1018 (72%), Positives = 841/1018 (83%), Gaps = 17/1018 (2%)
 Frame = +1

Query  607   RKRKFT-EGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKV--IESVTNNLECVKASNG  777
             RKRK + EG KL     KK KSGG+          +TGGVKV  +E V N    V     
Sbjct  237   RKRKASGEGGKL--DLGKKGKSGGD---------ASTGGVKVSVVEPVKNKENGV-FDGF  284

Query  778   DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQR  957
             D+ L  +++ERFS RE EK  FLG+ RRDA RRRPGDV+YD RTLYLP++F K L+GGQR
Sbjct  285   DNALMTDASERFSTREAEKFPFLGRERRDAKRRRPGDVDYDPRTLYLPAEFAKSLTGGQR  344

Query  958   QWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAE  1137
             QWWEFKSKHMDKVLFFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPEKNFS+N E
Sbjct  345   QWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPEKNFSLNVE  404

Query  1138  KLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDA  1314
             KLARKGYR+LVVEQ ETPEQLELRRK KGSKDKVVKREICAVITKGTLTEGE+ + +PDA
Sbjct  405   KLARKGYRILVVEQTETPEQLELRRKEKGSKDKVVKREICAVITKGTLTEGELPSANPDA  464

Query  1315  SYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEI  1494
             SYL+A+TES Q+ ANQ  ER +GVCVVDV T ++ILGQF DD++CS  C LL E RPVEI
Sbjct  465   SYLMALTESRQSLANQGLERIFGVCVVDVTTIRIILGQFGDDAECSLFCCLLSELRPVEI  524

Query  1495  IKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQN  1674
             +KPAK+LS ETERV+ RHTRNPLVNEL PLSEFWD EKT+ EVK +Y+R+ +       N
Sbjct  525   VKPAKMLSSETERVMVRHTRNPLVNELAPLSEFWDTEKTVQEVKTIYKRVGDLSASGPLN  584

Query  1675  EADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFA  1854
             ++DL  +     + +   LP++LSE VN GENG+ ALSALGG L+YLKQAFL+ +LL+FA
Sbjct  585   KSDLDTTNLNVEEYRPSCLPSILSEFVNKGENGSLALSALGGALYYLKQAFLEETLLRFA  644

Query  1855  EFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLL  2034
             +FE LP S F  +A+KPYM+LDAAALENLEIFENS+N  +SGTLYAQ+NHCVTAFGKRLL
Sbjct  645   KFESLPCSDFCDVAKKPYMILDAAALENLEIFENSRNGDTSGTLYAQLNHCVTAFGKRLL  704

Query  2035  RTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANG  2214
             +TWLARPLYHLE+IK+RQDAVAGL+GVN P +LEF+K LS LPD+ERLLA+IF++SEANG
Sbjct  705   KTWLARPLYHLESIKDRQDAVAGLRGVNQPMMLEFQKVLSGLPDIERLLARIFSTSEANG  764

Query  2215  RNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLP  2394
             RNA KVVLYEDAAKKQLQ+FISALRGCE +  AC SL   L+N +S  LH LLTPGKGLP
Sbjct  765   RNAYKVVLYEDAAKKQLQEFISALRGCELVAQACSSLAVILENVESGRLHHLLTPGKGLP  824

Query  2395  DVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFG  2574
             D+  ++K FK  FDWVEAN+SGRIIP EGVD EYD+AC  +++VE SLA+HLKEQQKL G
Sbjct  825   DILPILKHFKSAFDWVEANNSGRIIPHEGVDVEYDSACERVKEVESSLARHLKEQQKLLG  884

Query  2575  DTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
             D SI YVTVGK+AYLLEVPE L   +P++YEL+SSKKG++RYW P I+K +GELSQAE+E
Sbjct  885   DKSITYVTVGKEAYLLEVPEHLRGSIPRDYELRSSKKGFYRYWTPSIKKFLGELSQAESE  944

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             +E  LKSILQRLI RFC++H  WR+L+S  AELDVLISL+IASD+YEGP C P I     
Sbjct  945   KELALKSILQRLIVRFCKYHDKWRQLVSATAELDVLISLAIASDFYEGPACHPTIVGSSL  1004

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQV  3114
                VPCL AK LGHP+LR+DSL KGAFV ND+++G +G +SFILLTGPNMGGKSTLLRQV
Sbjct  1005  SSEVPCLSAKKLGHPVLRSDSLGKGAFVPNDISIGASGCASFILLTGPNMGGKSTLLRQV  1064

Query  3115  CLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRN  3294
             CLAVILAQ+GADVPA SF+LSPVDRIFVRMG KDHIMAGQSTFLTEL ETA MLSSAT N
Sbjct  1065  CLAVILAQIGADVPAESFELSPVDRIFVRMGGKDHIMAGQSTFLTELSETALMLSSATCN  1124

Query  3295  SLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHM  3474
             SLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLA+DYQ+D +VSL HM
Sbjct  1125  SLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAVDYQKDSKVSLYHM  1184

Query  3475  ACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             +C +G G  G+EEV FLY+L  G CP+SYGVNVARLAGLPD++L  AAAKSREFE VY
Sbjct  1185  SCQVGNG-AGVEEVAFLYRLRPGACPKSYGVNVARLAGLPDSILHNAAAKSREFEAVY  1241


 Score =   129 bits (323),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTPD-STESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  ST   YG+E + RR++VYWPLDK WYEG VKS+D  S KHL+
Sbjct  74   SKPKKPLLVIGQTPSPSPSTVGVYGKEAVERRVRVYWPLDKSWYEGLVKSYDDESKKHLI  133

Query  292  QYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            QYDD EEE+L+LS E+IEW+E P V KF+RLRR
Sbjct  134  QYDDCEEELLDLSNEKIEWVE-PCVKKFKRLRR  165



>ref|XP_002515294.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47278.1| ATP binding protein, putative [Ricinus communis]
Length=1306

 Score =  1415 bits (3663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 721/986 (73%), Positives = 822/986 (83%), Gaps = 7/986 (1%)
 Frame = +1

Query  706   TATGGVKV--IESVTN--NLECVKASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadr  873
              + G VKV  IE V +  N  C    NG+  +  +++ERFSMRE EK+ FLG  RRDA R
Sbjct  262   VSEGAVKVSFIEPVKDGGNGFCNGLGNGNASIN-DASERFSMREAEKMWFLGAERRDAKR  320

Query  874   rrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIG  1053
             +RPGD +YD RTLYLP  F+K LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAH+G
Sbjct  321   KRPGDADYDPRTLYLPPSFVKSLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHVG  380

Query  1054  AKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKD  1230
             AKELDLQYMKGEQPHCGFPE+ FSMN EKL RKGYRVLV+EQ ETPEQLELRRK KGSKD
Sbjct  381   AKELDLQYMKGEQPHCGFPERIFSMNVEKLTRKGYRVLVIEQTETPEQLELRRKEKGSKD  440

Query  1231  KVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             KVVKREICAV+TKGTLTEGE+LT +PDASYL+AVTES Q    Q  E T+G+CV DVATS
Sbjct  441   KVVKREICAVVTKGTLTEGELLTANPDASYLMAVTESQQNLEGQNFEPTFGICVADVATS  500

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             ++ILGQF DDS+CSSLC LL E RPVEIIKPAK LS ETER+L RHTRNPLVN+LVPLSE
Sbjct  501   RIILGQFVDDSECSSLCRLLSELRPVEIIKPAKSLSSETERLLLRHTRNPLVNDLVPLSE  560

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGEN  1770
             FWDAEKT+ EVK +Y+ +++     S N+ D   +     +     LP +L ELVN G+N
Sbjct  561   FWDAEKTVHEVKIIYKHISDQSASRSLNKEDKDTANLQFTEEGPSCLPEILLELVNKGDN  620

Query  1771  GTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIF  1950
             G  ALSALGGTL+YLKQAFLD +LL+FA+FE LP S F  +AQKPYM+LDAAALENLEIF
Sbjct  621   GRLALSALGGTLYYLKQAFLDETLLRFAKFESLPCSDFCDVAQKPYMILDAAALENLEIF  680

Query  1951  ENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGV  2130
             ENS+N G SGTLYAQ+NHCVTAFGKRLL+TWLARPLYHL +I +RQDAVAGL+GVN P  
Sbjct  681   ENSRNGGLSGTLYAQLNHCVTAFGKRLLKTWLARPLYHLRSIVDRQDAVAGLRGVNQPAT  740

Query  2131  LEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVN  2310
             LEFRK LSRLPDMERL+A+IFASSEANGRNANKV+LYEDAAKK LQ+FISALRGCE M  
Sbjct  741   LEFRKALSRLPDMERLIARIFASSEANGRNANKVILYEDAAKKLLQEFISALRGCELMEQ  800

Query  2311  ACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDE  2490
             AC SL   L+N +S+ LH LLTPGK  P +  ++K FK+ FDWVEAN+SGR+IP EGVD 
Sbjct  801   ACSSLAVILENVESRQLHHLLTPGKSRPHIHSILKHFKEAFDWVEANNSGRVIPHEGVDI  860

Query  2491  EYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYEL  2670
             EYD+AC  LR +E SL KHLKEQQK+ GD SI YVTVGK+AYLLEVPE     +P++YEL
Sbjct  861   EYDSACEKLRVIESSLTKHLKEQQKILGDKSIMYVTVGKEAYLLEVPEHFRGSIPRDYEL  920

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +SSKKG++RYW P I+KL+GELSQAE+E+E  LK+ILQRLI +FCEHH  WR+L S  AE
Sbjct  921   RSSKKGFYRYWTPSIKKLLGELSQAESEKELALKNILQRLIVQFCEHHDKWRQLNSATAE  980

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVLISL+IASD+YEG  CRP I    S   +PC  AKSLGHPIL++DSL KGAFV NDV
Sbjct  981   LDVLISLAIASDFYEGQACRPVILG-SSSSEMPCFSAKSLGHPILKSDSLGKGAFVPNDV  1039

Query  3031  TLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
             ++GG+  +SFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPA SF+LSPVDRIFVRMGA
Sbjct  1040  SIGGSDGASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAESFELSPVDRIFVRMGA  1099

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
             KDHIMAGQSTFLTEL ETA MLSSATRNSLV LDELGRGTSTSDGQAIAESVLEHFVH+V
Sbjct  1100  KDHIMAGQSTFLTELSETALMLSSATRNSLVTLDELGRGTSTSDGQAIAESVLEHFVHRV  1159

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVN  3570
             QCRGMFSTHYHRL++DYQ+D +VSLCHMAC +G G+G +EEVTFLY+LT G CP+SYGVN
Sbjct  1160  QCRGMFSTHYHRLSVDYQKDPKVSLCHMACQVGRGVGEVEEVTFLYRLTPGACPKSYGVN  1219

Query  3571  VARLAGLPDNVLEKAAAKSREFEGVY  3648
             VARLAGLPD +L+KAAAKSREFE +Y
Sbjct  1220  VARLAGLPDPILQKAAAKSREFEVIY  1245


 Score =   122 bits (305),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 8/99 (8%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTPDSTE-------SSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKI  273
            SK+ KPLLVIG +PTP  +        +S+G+EV+ +R+KVYWPLDK WYEGCVKS+D+ 
Sbjct  74   SKTKKPLLVIGKTPTPSPSPSMPRVMANSFGKEVVEKRVKVYWPLDKTWYEGCVKSYDED  133

Query  274  SGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            SGKHLVQYDD EEE+L+L  E+IEW+E   VTKF+RLRR
Sbjct  134  SGKHLVQYDDFEEEVLDLGNEKIEWVEES-VTKFKRLRR  171



>ref|XP_010087248.1| DNA mismatch repair protein Msh6-1 [Morus notabilis]
 gb|EXB28598.1| DNA mismatch repair protein Msh6-1 [Morus notabilis]
Length=1302

 Score =  1415 bits (3662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 722/1022 (71%), Positives = 835/1022 (82%), Gaps = 25/1022 (2%)
 Frame = +1

Query  589   SKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKA  768
             S K E RKRK     KL S K  K   GG + S       A   V ++E   NN+E  KA
Sbjct  243   SGKGETRKRKVGGEGKLGSAKKAK---GGEDVSK------AGFKVSLVEPANNNVESGKA  293

Query  769   SNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLS  945
             SN  +  L G+++ERFSMRE +KL FLG+ RRD+ RRRPGD +YD RTLYLP DF+K LS
Sbjct  294   SNAINTALPGDASERFSMREAKKLRFLGEERRDSKRRRPGDPDYDPRTLYLPPDFVKSLS  353

Query  946   GGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS  1125
              GQRQWW+FKSKHMDKVLFFKMGKFYELFEMDAH GAKELDLQYMKGEQPHCGFPE+NFS
Sbjct  354   DGQRQWWDFKSKHMDKVLFFKMGKFYELFEMDAHTGAKELDLQYMKGEQPHCGFPERNFS  413

Query  1126  MNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTV  1302
             MN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGEML+ 
Sbjct  414   MNLEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGEMLSA  473

Query  1303  SPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             +PDASYL+AVTESCQ       +R +GVCVVDVATS+VILGQF DDS+CS+L  LL E R
Sbjct  474   NPDASYLMAVTESCQNV-----DRIFGVCVVDVATSRVILGQFNDDSECSALSCLLSELR  528

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             PVEI+KPAK LS ETE+VL RHTR+PLVNELVP+ EFWDAEKT+ EVK++Y+  ++  + 
Sbjct  529   PVEIVKPAKQLSLETEKVLLRHTRSPLVNELVPVLEFWDAEKTVREVKSIYECASDQSVS  588

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                +  ++H   S   D  L  LP+VL++LV AGE+ +YALSALGGTLFYLKQAFLD +L
Sbjct  589   KCSSRENIHSVNSCIEDDGLAFLPDVLADLVRAGEDSSYALSALGGTLFYLKQAFLDETL  648

Query  1843  LKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFG  2022
             L+FA+FELLP S FG +  KPY+VLD+AALENLEIFENS+N   +GTLYAQ+NHCVTAFG
Sbjct  649   LRFAKFELLPSSGFGDVISKPYLVLDSAALENLEIFENSRNGDLTGTLYAQLNHCVTAFG  708

Query  2023  KRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS  2202
             KRLL+TWLARP +H+E+IKERQ+AVA L+G NLP  LE+RK LSRLPDMERLLA +F+ S
Sbjct  709   KRLLKTWLARPPFHVESIKERQEAVASLRGTNLPFSLEYRKALSRLPDMERLLACVFSIS  768

Query  2203  EANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPG  2382
             EANGRNA+KVVLYEDAAKKQLQ+F SAL GCE M  AC SLGA L+N D + L  LLTPG
Sbjct  769   EANGRNASKVVLYEDAAKKQLQEFTSALHGCELMAQACSSLGAILENVDCRQLRHLLTPG  828

Query  2383  KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQ  2562
              G PD+  V+  FKD FDWVEANSSGRIIP EG D EYD+AC  ++++E SL K+LKEQ+
Sbjct  829   SGFPDINPVLTHFKDAFDWVEANSSGRIIPREGADFEYDSACKRVKEIETSLTKYLKEQR  888

Query  2563  KLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQ  2742
             KL GDTSI YVTVGK+ YLLEVPESL   VP++YEL+SSK+G+FRYW P I+ L+GELSQ
Sbjct  889   KLLGDTSITYVTVGKETYLLEVPESLRGHVPRDYELRSSKRGFFRYWTPNIKNLLGELSQ  948

Query  2743  AETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIR  2922
             AE+E+ES LK+ILQRLIG+FCEHH  WR+L+S  AELDVLISL+IASD+YEGPTC+P I 
Sbjct  949   AESEKESSLKNILQRLIGQFCEHHVKWRQLVSITAELDVLISLAIASDFYEGPTCQPVIL  1008

Query  2923  ELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTL  3102
                  D+VP   AKSLGHP+LR+DSL KG+FV ND+T+GG+G+ SFILLTGPNMGGKST 
Sbjct  1009  SSSCTDDVPSFAAKSLGHPVLRSDSLGKGSFVPNDITIGGSGNPSFILLTGPNMGGKSTF  1068

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             LR         Q+GADVPA  F+LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLSS
Sbjct  1069  LR---------QLGADVPAERFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETAVMLSS  1119

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             ATR+SLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLA+DYQ+D +V 
Sbjct  1120  ATRSSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAVDYQKDPKVL  1179

Query  3463  LCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEG  3642
             L HMAC +G G+GG+EEVTFLY+LT G CP+SYGVNVARLAGL D+VL+ A AKSREFE 
Sbjct  1180  LSHMACQVGRGVGGIEEVTFLYRLTAGACPKSYGVNVARLAGLSDSVLQNATAKSREFEA  1239

Query  3643  VY  3648
             +Y
Sbjct  1240  MY  1241


 Score =   120 bits (300),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 7/97 (7%)
 Frame = +1

Query  118  KSNKPLLVIGP------SPTPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISG  279
            K  KPLLVIG       SP   ++E  +G+EV+ +RIKVYWPLDK WYEG V+SFDK SG
Sbjct  76   KLKKPLLVIGGASPLSLSPLTPASEKFHGEEVVGKRIKVYWPLDKSWYEGFVRSFDKDSG  135

Query  280  KHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            KHLVQYDD EEE + L++E+IEWIE   V KF+RLRR
Sbjct  136  KHLVQYDDGEEESVELAKEKIEWIEE-TVRKFKRLRR  171



>ref|XP_010259326.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X1 [Nelumbo 
nucifera]
Length=1312

 Score =  1414 bits (3659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 732/1018 (72%), Positives = 852/1018 (84%), Gaps = 11/1018 (1%)
 Frame = +1

Query  610   KRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTAT--GGVKVIESVTN-NLECVKASNGD  780
             KRK  E  K+ S   KKIKS GN +         T   G +++E+ ++ N   V    G+
Sbjct  239   KRKNFEWDKVGS--GKKIKSVGNVEKGVLNVTKVTLDSGSRLVEAASDANRRYVSHITGN  296

Query  781   DILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQ  960
               LTG+SAERF++R+ EKL FLG+GRRD++RRRPGD NYD +TLYLPSDFLK LSGGQRQ
Sbjct  297   -TLTGDSAERFALRDAEKLRFLGEGRRDSERRRPGDANYDPKTLYLPSDFLKSLSGGQRQ  355

Query  961   WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEK  1140
             WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS+N EK
Sbjct  356   WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSLNVEK  415

Query  1141  LARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDAS  1317
             LARKGYRVLVVEQ ETPEQLELRRK KG KDKVVKREICAV+TKGTLTEGEM++V+PDAS
Sbjct  416   LARKGYRVLVVEQTETPEQLELRRKEKGCKDKVVKREICAVVTKGTLTEGEMMSVNPDAS  475

Query  1318  YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEII  1497
             YL+AV+E CQ S  Q  +   GVCVVDV+TS+ +LGQF DD + +SLCSLL E RPVEII
Sbjct  476   YLMAVSEGCQISGKQKEDVVIGVCVVDVSTSRFMLGQFGDDMERNSLCSLLSELRPVEII  535

Query  1498  KPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNE  1677
             KPA +LS ETE+VL  HTR+PL+N+LVP+ EFWDAEKTI+EV+ +Y+ LN + +  S NE
Sbjct  536   KPAHVLSPETEKVLLTHTRSPLINDLVPVLEFWDAEKTINEVRRIYKHLNQS-VSGSVNE  594

Query  1678  ADLHPSE-SIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFA  1854
             A L  S  S+ +D     LP+VLSELV+ G+NG+ ALSA GG LFYL+QA LD +LL+FA
Sbjct  595   ASLGNSAFSVGSDGS-GCLPDVLSELVSMGDNGSCALSAFGGCLFYLRQALLDETLLRFA  653

Query  1855  EFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLL  2034
             +FELLP S F  I QK YMVLDAAAL NLEIFEN+KN GSSGTLYAQ+NHCVTAFGKRLL
Sbjct  654   KFELLPCSGFHDIPQKSYMVLDAAALVNLEIFENNKNGGSSGTLYAQLNHCVTAFGKRLL  713

Query  2035  RTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANG  2214
             ++WLARPLYH+  I+ERQ+AVAGLKGV LP  +EFRKE+SRL DMERLLA++FA+SEANG
Sbjct  714   KSWLARPLYHVVLIRERQNAVAGLKGV-LPTAVEFRKEMSRLQDMERLLARLFANSEANG  772

Query  2215  RNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLP  2394
             RNANKVVLYEDAAKKQLQ+F +ALRGCE MV AC SLGA LD+  S LL  LLTPGKGLP
Sbjct  773   RNANKVVLYEDAAKKQLQEFTTALRGCELMVQACTSLGAILDSVKSHLLQHLLTPGKGLP  832

Query  2395  DVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFG  2574
             DV  ++K FKD FDW+EA+ +GRIIP EGVD EYD+AC  + ++E S  KHLKEQ+K+ G
Sbjct  833   DVHSILKHFKDAFDWIEADKTGRIIPHEGVDVEYDSACKKVEEIESSFLKHLKEQRKVLG  892

Query  2575  DTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
             D SI YVTVGK++YLLEVPES+   VP++YEL+SS+KG+FRYW P ++KL+GELSQAE E
Sbjct  893   DVSIKYVTVGKESYLLEVPESMQRTVPRDYELRSSRKGFFRYWTPTVKKLLGELSQAEAE  952

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             +ESKLKSILQ+LIG FCEHH  WR+L+ST AELDVLISL+IASDYYEG TC+P I  L  
Sbjct  953   KESKLKSILQKLIGHFCEHHIKWRQLVSTTAELDVLISLAIASDYYEGATCQPIISGLSC  1012

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQV  3114
                +PCL AK LGHP+LR+D+L KG FV NDV +GG+G  SFILLTGPNMGGKSTL+RQV
Sbjct  1013  STEMPCLSAKGLGHPVLRSDALGKGTFVPNDVCIGGSGSPSFILLTGPNMGGKSTLIRQV  1072

Query  3115  CLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRN  3294
             CLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKDHIM+GQSTF+TEL ETASMLSSATRN
Sbjct  1073  CLAVILAQLGADVPAESFELSPVDRIFVRMGAKDHIMSGQSTFMTELSETASMLSSATRN  1132

Query  3295  SLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHM  3474
             SLV+LDELGRGTSTSDGQAIAESVLEHFV K+QCRGMFSTHYHRL+++YQ+D +VSLCHM
Sbjct  1133  SLVSLDELGRGTSTSDGQAIAESVLEHFVQKIQCRGMFSTHYHRLSVNYQKDPKVSLCHM  1192

Query  3475  ACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             AC +G+  G +EEVTFLY+LT G CP+SYGVNVARLAGLPD VL+KAAAKSREFE +Y
Sbjct  1193  ACQVGKRTGDVEEVTFLYRLTPGACPKSYGVNVARLAGLPDMVLQKAAAKSREFEAIY  1250


 Score =   115 bits (289),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 72/104 (69%), Gaps = 14/104 (13%)
 Frame = +1

Query  115  SKSNKPLLVIGPSP-------------TPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCV  255
            +K  KP LV+G SP             TP S +  YG+EV+ +R++VYWPLDK WYEGCV
Sbjct  65   TKQRKPPLVVGSSPSRSPLTPLSEAVTTPVSGKKLYGEEVVGKRLRVYWPLDKSWYEGCV  124

Query  256  KSFDKISGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLR  387
            KSF+K +GKHLVQYDD EEE+L+L  E++EW +  V + FRRLR
Sbjct  125  KSFNKKTGKHLVQYDDAEEEVLDLGVEKVEWTKGEVRS-FRRLR  167



>ref|XP_011041321.1| PREDICTED: DNA mismatch repair protein MSH6-like isoform X1 [Populus 
euphratica]
Length=1313

 Score =  1413 bits (3658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 728/1032 (71%), Positives = 841/1032 (81%), Gaps = 31/1032 (3%)
 Frame = +1

Query  607   RKRKFT-EGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKV--IESVTNNLECVKASNG  777
             RKRK + EG KL     KK KSGG+          +TGGVKV  +E V N    V     
Sbjct  237   RKRKASGEGGKL--DLGKKGKSGGD---------ASTGGVKVSVVEPVKNKENGV-FDGF  284

Query  778   DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQR  957
             D+ L  +++ERFS RE EK  FLG+ RRDA RRRPGDV+YD RTLYLP++F K L+GGQR
Sbjct  285   DNALMTDASERFSTREAEKFPFLGRERRDAKRRRPGDVDYDPRTLYLPAEFAKSLTGGQR  344

Query  958   QWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAE  1137
             QWWEFKSKHMDKVLFFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPEKNFS+N E
Sbjct  345   QWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPEKNFSLNVE  404

Query  1138  KLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDA  1314
             KLARKGYR+LVVEQ ETPEQLELRRK KGSKDKVVKREICAVITKGTLTEGE+ + +PDA
Sbjct  405   KLARKGYRILVVEQTETPEQLELRRKEKGSKDKVVKREICAVITKGTLTEGELPSANPDA  464

Query  1315  SYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEI  1494
             SYL+A+TES Q+ ANQ  ER +GVCVVDV T ++ILGQF DD++CS  C LL E RPVEI
Sbjct  465   SYLMALTESRQSLANQGLERIFGVCVVDVTTIRIILGQFGDDAECSLFCCLLSELRPVEI  524

Query  1495  IKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQN  1674
             +KPAK+LS ETERV+ RHTRNPLVNEL PLSEFWD EKT+ EVK +Y+R+ +       N
Sbjct  525   VKPAKMLSSETERVMVRHTRNPLVNELAPLSEFWDTEKTVQEVKTIYKRVGDLSASGPLN  584

Query  1675  EADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFA  1854
             ++DL  +     + +   LP++LSE VN GENG+ ALSALGG L+YLKQAFL+ +LL+FA
Sbjct  585   KSDLDTTNLNVEEYRPSCLPSILSEFVNKGENGSLALSALGGALYYLKQAFLEETLLRFA  644

Query  1855  EFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLL  2034
             +FE LP S F  +A+KPYM+LDAAALENLEIFENS+N  +SGTLYAQ+NHCVTAFGKRLL
Sbjct  645   KFESLPCSDFCDVAKKPYMILDAAALENLEIFENSRNGDTSGTLYAQLNHCVTAFGKRLL  704

Query  2035  RTWLARPLYHLEAIKERQDAVAGLK--------------GVNLPGVLEFRKELSRLPDME  2172
             +TWLARPLYHLE+IK+RQDAVAGL+              GVN P +LEF+K LS LPD+E
Sbjct  705   KTWLARPLYHLESIKDRQDAVAGLRVSFHLHSDIIANFQGVNQPMMLEFQKVLSGLPDIE  764

Query  2173  RLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDS  2352
             RLLA+IF++SEANGRNA KVVLYEDAAKKQLQ+FISALRGCE +  AC SL   L+N +S
Sbjct  765   RLLARIFSTSEANGRNAYKVVLYEDAAKKQLQEFISALRGCELVAQACSSLAVILENVES  824

Query  2353  KLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVEL  2532
               LH LLTPGKGLPD+  ++K FK  FDWVEAN+SGRIIP EGVD EYD+AC  +++VE 
Sbjct  825   GRLHHLLTPGKGLPDILPILKHFKSAFDWVEANNSGRIIPHEGVDVEYDSACERVKEVES  884

Query  2533  SLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPV  2712
             SLA+HLKEQQKL GD SI YVTVGK+AYLLEVPE L   +P++YEL+SSKKG++RYW P 
Sbjct  885   SLARHLKEQQKLLGDKSITYVTVGKEAYLLEVPEHLRGSIPRDYELRSSKKGFYRYWTPS  944

Query  2713  IRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYY  2892
             I+K +GELSQAE+E+E  LKSILQRLI RFC++H  WR+L+S  AELDVLISL+IASD+Y
Sbjct  945   IKKFLGELSQAESEKELALKSILQRLIVRFCKYHDKWRQLVSATAELDVLISLAIASDFY  1004

Query  2893  EGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLT  3072
             EGP C P I        VPCL AK LGHP+LR+DSL KGAFV ND+++G +G +SFILLT
Sbjct  1005  EGPACHPTIVGSSLSSEVPCLSAKKLGHPVLRSDSLGKGAFVPNDISIGASGCASFILLT  1064

Query  3073  GPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTE  3252
             GPNMGGKSTLLRQVCLAVILAQ+GADVPA SF+LSPVDRIFVRMG KDHIMAGQSTFLTE
Sbjct  1065  GPNMGGKSTLLRQVCLAVILAQIGADVPAESFELSPVDRIFVRMGGKDHIMAGQSTFLTE  1124

Query  3253  LLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLA  3432
             L ETA MLSSAT NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLA
Sbjct  1125  LSETALMLSSATCNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLA  1184

Query  3433  IDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEK  3612
             +DYQ+D +VSL HM+C +G G  G+EEV FLY+L  G CP+SYGVNVARLAGLPD++L  
Sbjct  1185  VDYQKDSKVSLYHMSCQVGNG-AGVEEVAFLYRLRPGACPKSYGVNVARLAGLPDSILHN  1243

Query  3613  AAAKSREFEGVY  3648
             AAAKSREFE VY
Sbjct  1244  AAAKSREFEAVY  1255


 Score =   129 bits (323),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTPD-STESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  ST   YG+E + RR++VYWPLDK WYEG VKS+D  S KHL+
Sbjct  74   SKPKKPLLVIGQTPSPSPSTVGVYGKEAVERRVRVYWPLDKSWYEGLVKSYDDESKKHLI  133

Query  292  QYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            QYDD EEE+L+LS E+IEW+E P V KF+RLRR
Sbjct  134  QYDDCEEELLDLSNEKIEWVE-PCVKKFKRLRR  165



>ref|XP_002320307.2| DNA mismatch repair protein MSH6-1 [Populus trichocarpa]
 gb|EEE98622.2| DNA mismatch repair protein MSH6-1 [Populus trichocarpa]
Length=1293

 Score =  1412 bits (3655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 733/1019 (72%), Positives = 840/1019 (82%), Gaps = 28/1019 (3%)
 Frame = +1

Query  607   RKRKFT-EGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKV--IESVTNNLECVKASNG  777
             RKRK + EG KL     KK KSGG+          +TGGVKV  +E V N    V   NG
Sbjct  240   RKRKASGEGGKL--DLGKKGKSGGD---------ASTGGVKVSVVEPVKNKENGV--FNG  286

Query  778   -DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQ  954
              ++ L  +++ERFS RE EK  FLG+ RRDA RRRPGDV+YD RTLYLP++F K L+GGQ
Sbjct  287   FENALMTDASERFSTREAEKFPFLGRERRDAKRRRPGDVDYDPRTLYLPAEFAKSLTGGQ  346

Query  955   RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNA  1134
             RQWWEFKSKHMDKVLFFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPEKNFS+N 
Sbjct  347   RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPEKNFSLNV  406

Query  1135  EKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPD  1311
             EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAVITKGTLTEGE L+ +PD
Sbjct  407   EKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVITKGTLTEGEFLSANPD  466

Query  1312  ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVE  1491
             ASYL+A+TES Q+ ANQ  ER +GVCVVDV TS++ILGQF DD++CSSLC LL E RPVE
Sbjct  467   ASYLMALTESSQSLANQGLERIFGVCVVDVTTSRIILGQFGDDAECSSLCCLLSELRPVE  526

Query  1492  IIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQ  1671
             I+KPAK+LS ETERV+ RHTRNPLVNEL PLSEFWDAE+T+ EVK +Y+ + +       
Sbjct  527   IVKPAKMLSSETERVMVRHTRNPLVNELAPLSEFWDAERTVQEVKTIYKHIGDLSASGPL  586

Query  1672  NEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKF  1851
             N+ DL  +     + +   LP++LSE VN GENG+ ALSALGG L+YLKQAFLD +LL+F
Sbjct  587   NKTDLDTTNLNVGEYRPSCLPSILSEFVNKGENGSLALSALGGALYYLKQAFLDETLLRF  646

Query  1852  AEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRL  2031
             A+FE LP S F  +A+KPYM+LDAAALENLEIFENS+N  +SGTLYAQ+NHCVTAFGKRL
Sbjct  647   AKFESLPCSDFCEVAKKPYMILDAAALENLEIFENSRNGDTSGTLYAQLNHCVTAFGKRL  706

Query  2032  LRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEAN  2211
             L+TWLARPLYHLE+IK+RQDAVAGL+GVN P +LEF+K LS LPD+ERLLA+IF++SEAN
Sbjct  707   LKTWLARPLYHLESIKDRQDAVAGLRGVNQPMMLEFQKVLSGLPDIERLLARIFSTSEAN  766

Query  2212  GRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGL  2391
             GRNANKVVLYEDAAKKQLQ+FISALRGCE +  AC SL   L+N +S  LH LLTPGKGL
Sbjct  767   GRNANKVVLYEDAAKKQLQEFISALRGCELVAQACSSLAVILENVESGRLHHLLTPGKGL  826

Query  2392  PDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLF  2571
             PD+  ++K FK  FDWVEAN+SGRIIP EGVD E+D+AC  +++VE SLA+HLKEQQKL 
Sbjct  827   PDILPILKHFKSAFDWVEANNSGRIIPHEGVDVEFDSACEKVKEVESSLARHLKEQQKLL  886

Query  2572  GDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAET  2751
             GD SI YVTVGK+AYLLEVPE L   VP        K G  RYW P I+K +GELSQAE+
Sbjct  887   GDKSITYVTVGKEAYLLEVPEHLRASVP-------IKAG--RYWTPSIKKFLGELSQAES  937

Query  2752  ERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELP  2931
             E+ES LKSILQRLI RFC++H  WR+L+S  AELDVLISL+IASD+YEGP C P I    
Sbjct  938   EKESALKSILQRLIVRFCKYHDKWRQLVSATAELDVLISLAIASDFYEGPACCPTIVGSS  997

Query  2932  SQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQ  3111
                 VPCL AK LGHP+LR+DSL KGAFV ND+++GG+G +SFILLTGPNMGGKSTLLRQ
Sbjct  998   LSSQVPCLSAKKLGHPVLRSDSLGKGAFVPNDISIGGSGRASFILLTGPNMGGKSTLLRQ  1057

Query  3112  VCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATR  3291
             VCLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLSSAT 
Sbjct  1058  VCLAVILAQIGADVPAESFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATC  1117

Query  3292  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCH  3471
             NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLA+DYQ+D +VSL H
Sbjct  1118  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAVDYQKDSKVSLYH  1177

Query  3472  MACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             M+C +G G+ G+EEVTFLY+L  G CP+SYGVNVARLAGLPD++L  AAAKSREFE VY
Sbjct  1178  MSCQVGNGV-GVEEVTFLYRLRPGACPKSYGVNVARLAGLPDSILHNAAAKSREFEAVY  1235


 Score =   127 bits (318),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTPDSTESS-YGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  ++   YG+E + RR++VYWPLDK WYEG VKS+D  S KHL+
Sbjct  74   SKPKKPLLVIGQTPSPSPSKVGVYGKEAVERRVRVYWPLDKSWYEGLVKSYDDESKKHLI  133

Query  292  QYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            QYDD EEE+L+L+ E+IEW+E P V KF+RLRR
Sbjct  134  QYDDSEEELLDLNNEKIEWVE-PCVKKFKRLRR  165



>ref|XP_004494416.1| PREDICTED: DNA mismatch repair protein MSH6-like [Cicer arietinum]
Length=1301

 Score =  1402 bits (3628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/1059 (67%), Positives = 849/1059 (80%), Gaps = 33/1059 (3%)
 Frame = +1

Query  577   KSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGN-NKSTQSKAPTATGGVKVIESVTNNL  753
             K   + K E +KRK  E  K  S  AKK +SG   N+     +P        +E V NNL
Sbjct  242   KGKTNGKVEPKKRKLGEAAK--SEPAKKSRSGTEVNRVAVKLSP--------LEHV-NNL  290

Query  754   ECVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDF  930
             E  K S+G D++ TG+++ERF+ RE +K  FL + R+DA+RR PGD NYDSRTLY+P DF
Sbjct  291   EVKKTSDGADNVPTGDASERFASREAQKFRFLREDRKDANRRHPGDENYDSRTLYVPPDF  350

Query  931   LKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFP  1110
             L+ L+ GQRQWW+FKSKHMDKVLFFKMGKFYELFEMDAH+GAKEL LQYMKGEQPHCGFP
Sbjct  351   LRSLTEGQRQWWDFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELTLQYMKGEQPHCGFP  410

Query  1111  EKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEG  1287
             E+NFS N EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVV+REICAV++KGTLT+G
Sbjct  411   ERNFSTNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVRREICAVVSKGTLTDG  470

Query  1288  EMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsl  1467
             E ++ +P+A+YL+A+TE      N++ ERTYGVCVVDV TS+VI+GQF DDS+CS LC +
Sbjct  471   EFMSANPEAAYLMALTEHHGNHPNEMSERTYGVCVVDVTTSRVIIGQFNDDSECSHLCCI  530

Query  1468  lYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLN  1647
             L E RPVEI+KPAK+LS ETERVL +HTRNPLVNEL+P+ EFWDA+KT+ ++K +Y    
Sbjct  531   LSEIRPVEIVKPAKILSAETERVLLKHTRNPLVNELIPIVEFWDADKTVDQLKRIYG---  587

Query  1648  NTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAF  1827
                          H ++  D D  L  LP+VL ELV  G N   ALSALGG L+YLKQAF
Sbjct  588   -------------HNNDVSDQDGGLDCLPDVLLELVKTGHNSRSALSALGGALYYLKQAF  634

Query  1828  LDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHC  2007
             LD  LL+FA+FELLP S F   A KPYMVLDAAALENLEIFENS+N  SSGTLYAQ+N C
Sbjct  635   LDEQLLRFAQFELLPCSVFSGFASKPYMVLDAAALENLEIFENSRNGESSGTLYAQLNQC  694

Query  2008  VTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQ  2187
             VTAFGKRLL++WLARPL H+E+IKERQ+AVAGLKGVNLP  LEFRKELS+LPDMERLLA+
Sbjct  695   VTAFGKRLLKSWLARPLCHVESIKERQEAVAGLKGVNLPHALEFRKELSKLPDMERLLAR  754

Query  2188  IFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHD  2367
             +F++S+A+GRNANKVVLYEDA+KKQLQ+FISALRG E M  AC SL   L++  S+ L  
Sbjct  755   VFSTSDASGRNANKVVLYEDASKKQLQEFISALRGLEVMAQACLSLSVILNDVKSRQLSH  814

Query  2368  LLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKH  2547
             LLTPGKGLPDV + +  FKD FDWVEAN+SGRIIP EG D EYD+AC +++++E SL KH
Sbjct  815   LLTPGKGLPDVCMDLNHFKDAFDWVEANNSGRIIPHEGADIEYDSACKAVKEIESSLLKH  874

Query  2548  LKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLM  2727
             LKEQ+KL G TSI+YV +GKD YLLEVPE+LC+ +P++YEL+SSKKG+ RYW P I+ L+
Sbjct  875   LKEQRKLLGGTSISYVNIGKDTYLLEVPENLCQNIPRDYELRSSKKGFSRYWTPDIKSLL  934

Query  2728  GELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTC  2907
              ELS AE+ERES LKS LQRLIGRFCEHH+ W++L+S  AELDVLI+L+IASDYYEGP C
Sbjct  935   RELSGAESERESLLKSTLQRLIGRFCEHHTQWKQLVSATAELDVLINLAIASDYYEGPKC  994

Query  2908  RPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMG  3087
             RP        +  P L AKSLGHP++R+DSL KGAFV ND+T+GG  H+SFILLTGPNMG
Sbjct  995   RPSFVGTLCTNEAPYLYAKSLGHPVIRSDSLGKGAFVPNDITIGGPDHASFILLTGPNMG  1054

Query  3088  GKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETA  3267
             GKSTLLRQVC+AVILAQVGADVPA SF+LSPVDRIFVRMGA+D+IMAGQSTFLTEL ETA
Sbjct  1055  GKSTLLRQVCMAVILAQVGADVPAESFELSPVDRIFVRMGARDNIMAGQSTFLTELSETA  1114

Query  3268  SMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQE  3447
             +MLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH V +VQCRG+FSTHYHRLAIDY +
Sbjct  1115  TMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHLVRRVQCRGLFSTHYHRLAIDYLK  1174

Query  3448  DRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKS  3627
             D +V LCHMAC +G G+ GL+EVTFLY+LTLG CP+SYGVNVARLAGLP +VL+KAAAKS
Sbjct  1175  DPKVCLCHMACQVGSGIEGLDEVTFLYRLTLGACPKSYGVNVARLAGLPTSVLQKAAAKS  1234

Query  3628  REFEGVY---gnnkgsrgnssknWDEKAIEVIRSLMHLA  3735
             REFE  Y           + +++W ++ I +I+ L + A
Sbjct  1235  REFEASYGKCRKGSSETNSLNQSWVDEIIVIIQKLNNTA  1273


 Score =   100 bits (248),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 3/91 (3%)
 Frame = +1

Query  127  KPLLVIGPSPTPDSTESS---YGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQY  297
            KPLL+IG SPTP     S   +  +V+ +RIKVYWP+D  WYEG VKSFDK++ KH + Y
Sbjct  72   KPLLIIGASPTPPQPSPSPSPFADQVIGKRIKVYWPIDDAWYEGFVKSFDKLTSKHRIHY  131

Query  298  DDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            DD+EEE ++LS+E+ EWI+     K +RLRR
Sbjct  132  DDDEEESIDLSKEKFEWIQERSSKKLKRLRR  162



>ref|XP_010038284.1| PREDICTED: DNA mismatch repair protein MSH6 [Eucalyptus grandis]
 gb|KCW50108.1| hypothetical protein EUGRSUZ_K03542 [Eucalyptus grandis]
Length=1318

 Score =  1399 bits (3621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 717/1025 (70%), Positives = 832/1025 (81%), Gaps = 11/1025 (1%)
 Frame = +1

Query  589   SKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKA  768
             S K+  +KRK ++G +  S   KK KSG   +   SK      G K       ++   K 
Sbjct  238   SGKSRTKKRKASKGSE--SGSVKKNKSGSGVRDEGSKGSVVVSGNKF---NACSIPAQKT  292

Query  769   SNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLS  945
             +NG    L  +++ERFS RE EKL FLG  RRDA RRR GD ++D RTLYLP DFLK LS
Sbjct  293   TNGLGSSLPTDASERFSSREAEKLHFLGPERRDAKRRRSGDTDFDPRTLYLPPDFLKSLS  352

Query  946   GGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS  1125
             GGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPEKNFS
Sbjct  353   GGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPEKNFS  412

Query  1126  MNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTV  1302
             MN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAVITKGTLT+GEML+ 
Sbjct  413   MNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVITKGTLTDGEMLSA  472

Query  1303  SPDASYLIAVTESCQTSANQL---GERTYGVCVVDVATSKVILGQFAddsdcsslcsllY  1473
             +P+ASYL+AVTESCQT A+Q     ERT GVC+VD ATS++ LGQF DDS+CS+LC LL 
Sbjct  473   NPEASYLMAVTESCQTVADQKDQKAERTLGVCLVDAATSRITLGQFRDDSECSALCCLLS  532

Query  1474  EFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNT  1653
             E RPVEI+KP K LS ETERVL  HTRNPLVNELVP+ EFWDAEKT+ +++ +Y+ +N  
Sbjct  533   ELRPVEIVKPTKGLSAETERVLLTHTRNPLVNELVPVLEFWDAEKTVHQLRTIYKSINGR  592

Query  1654  PIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLD  1833
                 S +E D   + S   D  L NLP  LSELVN+GEN   ALSALGG ++YLKQAFLD
Sbjct  593   SSSVSSDETDTETAASHLKDDGLDNLPEFLSELVNSGENHNLALSALGGAIYYLKQAFLD  652

Query  1834  VSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVT  2013
              +LLKFA FE L  S F  +AQK +M+LDAAALENLE+FEN +N GSSGTLYAQ++HCVT
Sbjct  653   ETLLKFANFESLSCSGFSDVAQK-HMILDAAALENLEVFENGRNGGSSGTLYAQLDHCVT  711

Query  2014  AFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF  2193
             AFGKRLL+TWLARPLYH EAIKERQDA+A LKG N   +L+FRK L RLPDMERLLA+IF
Sbjct  712   AFGKRLLKTWLARPLYHPEAIKERQDAIADLKGENQSFILDFRKVLLRLPDMERLLARIF  771

Query  2194  ASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLL  2373
             +SSEA GRNANKV+LYEDAAKKQLQ+FISALRGCE +V A  SLG  L+NT+S+ L  LL
Sbjct  772   SSSEACGRNANKVILYEDAAKKQLQEFISALRGCELLVEAFSSLGVILENTESRQLVHLL  831

Query  2374  TPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLK  2553
             TPGKGLP+V  +++ FKD FDWVEA++SGRIIP EGVD EYD+AC  ++++E +L KHLK
Sbjct  832   TPGKGLPEVSSILRHFKDAFDWVEASNSGRIIPREGVDMEYDSACNKIKEIESNLMKHLK  891

Query  2554  EQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGE  2733
             EQ+KL G++SI YV +GK++YLLEVPESL   VP +YEL+SSKKG+FRYW P I+KL+ E
Sbjct  892   EQRKLLGESSITYVNIGKESYLLEVPESLRGKVPADYELRSSKKGFFRYWTPKIKKLVSE  951

Query  2734  LSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRP  2913
             LSQAE+E+ES LKSIL RLI RFCEH   WR+LIS+ AE+DVLISL+IA+DYYEGP CRP
Sbjct  952   LSQAESEKESALKSILHRLIRRFCEHQDKWRQLISSTAEMDVLISLAIATDYYEGPACRP  1011

Query  2914  HIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGK  3093
               +        PCL A+ LGHP+LR+DSL KG FV NDV++GG+ ++SFILLTGPNMGGK
Sbjct  1012  VFKVSSDSSKEPCLSAEGLGHPMLRSDSLGKGTFVPNDVSIGGSANASFILLTGPNMGGK  1071

Query  3094  STLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASM  3273
             STLLRQVCLAVILAQ+GADVPA SF LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETASM
Sbjct  1072  STLLRQVCLAVILAQIGADVPAESFQLSPVDRIFVRMGAKDHIMAGQSTFLTELSETASM  1131

Query  3274  LSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDR  3453
             LSSAT NSLVALDELGRGTSTSDGQAIAESVL+HFVHKV C GMFSTHYH LA++Y+ D 
Sbjct  1132  LSSATCNSLVALDELGRGTSTSDGQAIAESVLDHFVHKVHCLGMFSTHYHHLAVNYRNDP  1191

Query  3454  QVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              VSLCHMAC +G+G  G+EEVTFLY+LT G CP+SYGVNVARLAGLP+ +L+KAA++SR+
Sbjct  1192  GVSLCHMACQVGDGADGMEEVTFLYRLTPGPCPKSYGVNVARLAGLPECILQKAASRSRK  1251

Query  3634  FEGVY  3648
             FE  Y
Sbjct  1252  FEHSY  1256


 Score =   102 bits (253),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +1

Query  181  YGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIETP  360
            YG EVL RR++VYWPLD  WYEG V+ FD+ SGKH V+YDD EEE+L+L +E+IEWIE  
Sbjct  106  YGLEVLRRRVRVYWPLDGAWYEGRVERFDEGSGKHRVRYDDAEEELLDLGKEKIEWIEEG  165

Query  361  VVTKFRRLRR  390
             V KF+RLRR
Sbjct  166  -VKKFKRLRR  174



>emb|CAN78918.1| hypothetical protein VITISV_032225 [Vitis vinifera]
Length=1349

 Score =  1391 bits (3601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 728/1073 (68%), Positives = 850/1073 (79%), Gaps = 65/1073 (6%)
 Frame = +1

Query  577   KSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLE  756
             K G SKK + +KRK      + S K +K  SGG  K+T          V  +E +  N E
Sbjct  230   KKGQSKKVDPKKRKAVGEGTMGSGKRRK-SSGGAEKNTFK--------VSSVEPM-KNAE  279

Query  757   CVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFL  933
               KAS+  D++L G++ ERF  RE EKL FLG  R+DA RR PGD NYD RTLYLP +FL
Sbjct  280   SRKASDILDNVLPGDALERFGAREAEKLPFLGGERKDAKRRCPGDANYDPRTLYLPPNFL  339

Query  934   KGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPE  1113
             K L+GGQRQWWEFKS+HMDKV+FFKMGKFYELFEMDAHIGAKELDLQYMK        P 
Sbjct  340   KNLTGGQRQWWEFKSRHMDKVIFFKMGKFYELFEMDAHIGAKELDLQYMKSTSISFMNPF  399

Query  1114  KNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGE  1290
              +  +       +GYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE
Sbjct  400   SSRILTGAPWTVQGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGE  459

Query  1291  MLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsll  1470
             ML+ +PDASYL+AVTESCQ       ER++GVCVVDVATS++ILGQF DDS+CS+LC LL
Sbjct  460   MLSANPDASYLMAVTESCQ-----FEERSFGVCVVDVATSRIILGQFRDDSECSTLCCLL  514

Query  1471  YEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNN  1650
              E RPVEIIKPA LLS ETER L RHTR+PLVNELVP+SEFWD++KT+SE++++Y+  N+
Sbjct  515   SELRPVEIIKPANLLSPETERALMRHTRSPLVNELVPISEFWDSKKTVSEIRSVYRCFND  574

Query  1651  TPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFL  1830
               +  S NEA+L    S   +  L  LP++LS+LVNAGE+G+ ALSALGGTLFYLKQAF+
Sbjct  575   LSVSGSLNEANLSVKXSFVEEDPL-GLPDILSKLVNAGESGSLALSALGGTLFYLKQAFM  633

Query  1831  DVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCV  2010
             D +LL+FA+FEL P+S    I  KPYMVLDAAALENLEIFENS+   SSGTLYAQ+NHCV
Sbjct  634   DETLLRFAKFELFPYSGVSDIFHKPYMVLDAAALENLEIFENSRKGDSSGTLYAQLNHCV  693

Query  2011  TAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQI  2190
             TAFGKRLL+TWLARPLYHL++I+ERQDAVAGL+GVNLP  LEFRKELSRLPDMERLLA+I
Sbjct  694   TAFGKRLLKTWLARPLYHLDSIRERQDAVAGLRGVNLPSALEFRKELSRLPDMERLLARI  753

Query  2191  FASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDL  2370
             FASSEANGRNANKVV YEDAAKKQLQ+FISALRGCE M  AC SLG  L+N +S LLH L
Sbjct  754   FASSEANGRNANKVVFYEDAAKKQLQEFISALRGCELMTQACSSLGVILENVESGLLHHL  813

Query  2371  LTPG------------------------KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCE  2478
             LTPG                        KGLPD+  VI  FK+ FDWVEAN+SGRIIP E
Sbjct  814   LTPGTVGFYVNQIQKSCLASYFLIICAGKGLPDIHSVINHFKEAFDWVEANNSGRIIPHE  873

Query  2479  GVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQ  2658
             GVD+EYD+AC +++++EL L KHLKEQQKL GD SIN+VT+GK+AYLLEVPESL   +P+
Sbjct  874   GVDKEYDSACKTVKEIELRLKKHLKEQQKLLGDASINFVTIGKEAYLLEVPESLRGNIPR  933

Query  2659  EYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELIS  2838
             +YEL+SSKKG+FRYW P I+K +GELS AE+E+ESKLKSILQRLI RFCEHH  WR+L+S
Sbjct  934   DYELRSSKKGFFRYWTPNIKKFLGELSHAESEKESKLKSILQRLISRFCEHHDKWRQLVS  993

Query  2839  TIA--------------------ELDVL-ISLSIASDYYEGPTCRPHIRELPSQDNVPCL  2955
             + A                     +D++ I L+IA+DYYEGPTCRP I  L + + VPC 
Sbjct  994   STAGSHXFTFXYGIGAWFYGYLYHVDLVPILLAIANDYYEGPTCRPVISGLSNSNEVPCF  1053

Query  2956  VAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILA  3135
              AKSLGHP+LR+DSL KG FV ND+T+GG+ H+ FILLTGPNMGGKSTLLRQVCLAVILA
Sbjct  1054  TAKSLGHPVLRSDSLGKGTFVPNDITIGGSDHACFILLTGPNMGGKSTLLRQVCLAVILA  1113

Query  3136  QVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDE  3315
             QVGADVPA SF+LSPVDRIFVRMGAKD+IMAGQSTFLTEL ETASML+SAT NSLVALDE
Sbjct  1114  QVGADVPAESFELSPVDRIFVRMGAKDNIMAGQSTFLTELSETASMLTSATCNSLVALDE  1173

Query  3316  LGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEG  3495
             LGRGTSTSDGQAIAESVLEHFVHKV+CRGMFSTHYHRLA+DY+++ +VSLCHMAC +G+G
Sbjct  1174  LGRGTSTSDGQAIAESVLEHFVHKVRCRGMFSTHYHRLAVDYKKNSKVSLCHMACQVGKG  1233

Query  3496  LGGLEEVTFLYKLTLGTCPRSYGVNVARLAG--LPDNVLEKAAAKSREFEGVY  3648
             +GG+EEVTFLY+L  G CP+SYGVNVARLAG  LP++VL+KAAAKSRE EG+Y
Sbjct  1234  VGGVEEVTFLYRLRPGACPKSYGVNVARLAGKELPNSVLQKAAAKSREIEGIY  1286


 Score =   122 bits (305),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 5/85 (6%)
 Frame = +1

Query  115  SKSNKPLLVIGPS-----PTPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISG  279
            +K  KPLLVIGPS      TP +   SYG+EV+NRR+KVYWPLDK WY GCVKSFD+++G
Sbjct  73   AKLRKPLLVIGPSKTTSPSTPVTGSKSYGEEVVNRRVKVYWPLDKSWYVGCVKSFDELTG  132

Query  280  KHLVQYDDEEEEMLNLSQERIEWIE  354
            +HLVQYDD +EE L+L +E+IEW+E
Sbjct  133  EHLVQYDDADEETLDLGKEKIEWVE  157



>ref|XP_006604739.1| PREDICTED: DNA mismatch repair protein MSH6-like [Glycine max]
Length=1273

 Score =  1390 bits (3598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1022 (69%), Positives = 828/1022 (81%), Gaps = 30/1022 (3%)
 Frame = +1

Query  592   KKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKV-IESVTNNLECVKA  768
             KK E +KRK +   K     AKK KSG              G  K+ +   T+NLE  + 
Sbjct  223   KKVETKKRKLSGTEK--QEPAKKSKSG---------VEVGKGAFKLSVLEPTSNLEIKET  271

Query  769   SNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLS  945
             SNG D++     +ERF++RE +KL FL + RRDA RRRPGD NYDSRT+YLP DFL+ LS
Sbjct  272   SNGTDNVAITEISERFALREAQKLRFLKEDRRDAKRRRPGDENYDSRTIYLPPDFLRSLS  331

Query  946   GGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS  1125
              GQ+QWWEFKSKHMDKVLFFKMGKFYELFEMDAH+GAKELDLQYMKG+QPHCGFPEKNFS
Sbjct  332   DGQKQWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGDQPHCGFPEKNFS  391

Query  1126  MNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTV  1302
             MN EKLARKGYRVLVVEQ +TPEQLELRRK KGSKDKVV+REIC+V+TKGTLT+GE+L+ 
Sbjct  392   MNVEKLARKGYRVLVVEQTDTPEQLELRRKEKGSKDKVVRREICSVVTKGTLTDGELLSA  451

Query  1303  SPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             +P+A+YL+A+TE  +    ++ E  YGVC+VDVATS+VILGQF DD +CS LC +L E R
Sbjct  452   NPEAAYLMALTEHHENHPTEVSEHLYGVCIVDVATSRVILGQFKDDLECSVLCCILSEIR  511

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             PVEI+KPAKLLS ETERVL +HTR+PLVNELVP+ EFWDA+KT+ ++K +Y         
Sbjct  512   PVEIVKPAKLLSAETERVLLKHTRDPLVNELVPIVEFWDADKTVDQLKRIYGNS------  565

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                       ++   N+ +L  LP+VL ELV  G++   ALSALGG L+YL+QAFLD  L
Sbjct  566   ----------NDVSVNNNELDCLPDVLLELVKTGDDSRSALSALGGALYYLRQAFLDERL  615

Query  1843  LKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFG  2022
             L+FA+FELLP S FG +A KPYMVLDAAALENLEIFENS+N  SSGTLYAQ+N CVTAFG
Sbjct  616   LRFAKFELLPCSGFGDLASKPYMVLDAAALENLEIFENSRNGDSSGTLYAQLNQCVTAFG  675

Query  2023  KRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS  2202
             KRLL+TWLARPL H+E++KERQ+AVAGLKGVNLP  LEFRK L +LPDMERLLA+IF+SS
Sbjct  676   KRLLKTWLARPLCHVESVKERQEAVAGLKGVNLPSALEFRKALYKLPDMERLLARIFSSS  735

Query  2203  EANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPG  2382
             EA+GRNAN+VVLYEDA+KKQLQ+FI ALRGCE M  ACFSLG  L +  S+ LH LLTPG
Sbjct  736   EASGRNANRVVLYEDASKKQLQEFILALRGCEQMAQACFSLGVILSHVKSRQLHHLLTPG  795

Query  2383  KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQ  2562
             K LPDV + +  FKD FDWVEAN+SGRIIP EGVD EYD+AC +++++E SL KHLKEQ 
Sbjct  796   KVLPDVCMDLNHFKDAFDWVEANNSGRIIPREGVDTEYDSACKAVKEIESSLLKHLKEQM  855

Query  2563  KLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQ  2742
             KL G TSI YV VGKD YLLEVPE+L + +P++YEL+SS+KG+FRYW+P I+  + ELS 
Sbjct  856   KLLGSTSITYVNVGKDTYLLEVPENLSKNIPRDYELRSSRKGFFRYWSPDIKVFLRELSH  915

Query  2743  AETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIR  2922
             AE+E+ES LKS LQRLIGRFCEHH+ W++L+ST AELDVLISL+IA DYYEGPTCRP   
Sbjct  916   AESEKESLLKSTLQRLIGRFCEHHAKWKQLVSTTAELDVLISLAIAGDYYEGPTCRPSFV  975

Query  2923  ELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTL  3102
                     P L AKSLGHP+LR+D+L KG FV ND+T+GG+ H+SFILLTGPNMGGKSTL
Sbjct  976   GTLCTKEAPYLHAKSLGHPVLRSDTLGKGDFVPNDITIGGSDHASFILLTGPNMGGKSTL  1035

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             LRQVCL VILAQVGADVPA SFDLSPVDRIFVRMGAKD+IMAGQSTFLTEL ETASMLSS
Sbjct  1036  LRQVCLTVILAQVGADVPAESFDLSPVDRIFVRMGAKDNIMAGQSTFLTELSETASMLSS  1095

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT NSLVALDELGRGT+TSDGQAIAESVLEH V KVQCRG+FSTHYHRLA+DY +D +V 
Sbjct  1096  ATCNSLVALDELGRGTATSDGQAIAESVLEHLVRKVQCRGLFSTHYHRLAVDYLKDPKVC  1155

Query  3463  LCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEG  3642
             LCHMAC +G G+ GL+EVTFLY+LT G CP+SYGVNVAR+AGLP +VL+KAAAKSREFE 
Sbjct  1156  LCHMACQVGSGIAGLDEVTFLYRLTPGACPKSYGVNVARIAGLPTSVLQKAAAKSREFEA  1215

Query  3643  VY  3648
              Y
Sbjct  1216  TY  1217


 Score =   111 bits (278),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +1

Query  109  LGSKSNKPLLVIGPSPTPDSTESS-YGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKH  285
            L  K +KPLLVIG S +P S   S Y QE++ RRIKVYWPLDK WYEG VKSFD ++ KH
Sbjct  60   LNPKRSKPLLVIGASTSPPSASPSLYFQELIGRRIKVYWPLDKAWYEGSVKSFDSLTSKH  119

Query  286  LVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            +V+YDD EEE L+LS+E+IEW++     K +RLRR
Sbjct  120  VVRYDDGEEESLDLSKEKIEWLQESSSKKLKRLRR  154



>gb|KHN43463.1| DNA mismatch repair protein Msh6-1 [Glycine soja]
Length=1191

 Score =  1384 bits (3581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/1034 (68%), Positives = 818/1034 (79%), Gaps = 42/1034 (4%)
 Frame = +1

Query  592   KKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKV-IESVTNNLECVKA  768
             KK E +KRK +   K     AKK KSG              G  K+ +   T+NLE  + 
Sbjct  129   KKVETKKRKLSGTEK--QEPAKKSKSG---------VEVGKGAFKLSVLEPTSNLEIKET  177

Query  769   SNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgd------------VNYDSRT  909
             SNG D++     +ERF++RE +KL FL      A                    NYDSRT
Sbjct  178   SNGTDNVAITEISERFALREAQKLRFLKDYHLSAVSVTFSVDRRDAKRRRPGDENYDSRT  237

Query  910   LYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGE  1089
             +YLP DFL+ LS GQ+QWWEFKSKHMDKVLFFKMGKFYELFEMDAH+GAKELDLQYMKG+
Sbjct  238   IYLPPDFLRSLSDGQKQWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGD  297

Query  1090  QPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVIT  1266
             QPHCGFPEKNFSMN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVV+REIC+V+T
Sbjct  298   QPHCGFPEKNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVRREICSVVT  357

Query  1267  KGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsd  1446
             KGTLT+GE+L+ +P+A+YL+A+TE  +    ++ E  YGVC+VDVATS+VILGQF DD +
Sbjct  358   KGTLTDGELLSANPEAAYLMALTEHHENHPTEVSEHLYGVCIVDVATSRVILGQFKDDLE  417

Query  1447  csslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVK  1626
             CS LC +L E RPVEI+KPAKLLS ETERVL +HTR+PLVNELVP+ EFWDA+KT+ ++K
Sbjct  418   CSVLCCILSEIRPVEIVKPAKLLSAETERVLLKHTRDPLVNELVPIVEFWDADKTVDQLK  477

Query  1627  NMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTL  1806
              +Y                   ++   N+ +L  LP+VL ELV  G++   ALSALGG L
Sbjct  478   RIYGNS----------------NDVSVNNNELDCLPDVLLELVKTGDDSRSALSALGGAL  521

Query  1807  FYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             +YL+QAFLD  LL+FA+FELLP S FG +A KPYMVLDAAALENLEIFENS+N  SSGTL
Sbjct  522   YYLRQAFLDERLLRFAKFELLPCSGFGDLASKPYMVLDAAALENLEIFENSRNGDSSGTL  581

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
             YAQ+N CVTAFGKRLL+TWLARPL H+E++KERQ+AVAGLKGVNLP  LEFRK L +LPD
Sbjct  582   YAQLNQCVTAFGKRLLKTWLARPLCHVESVKERQEAVAGLKGVNLPSALEFRKALYKLPD  641

Query  2167  MERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNT  2346
             MERLLA+IF+SSEA+GRNAN+VVLYEDA+KKQLQ+FI ALRGCE M  ACFSLG  L + 
Sbjct  642   MERLLARIFSSSEASGRNANRVVLYEDASKKQLQEFILALRGCEQMAQACFSLGVILSHV  701

Query  2347  DSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKV  2526
              S+ LH LLTPGK LPDV + +  FKD FDWVEAN+SGRIIP EGVD EYD+AC +++++
Sbjct  702   KSRQLHHLLTPGKVLPDVCMDLNHFKDAFDWVEANNSGRIIPREGVDTEYDSACKAVKEI  761

Query  2527  ELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWN  2706
             E SL KHLKEQ KL G TSI YV VGKD YLLEVPE+L + +P++YEL+SS+KG+FRYW+
Sbjct  762   ESSLLKHLKEQMKLLGSTSITYVNVGKDTYLLEVPENLSKNIPRDYELRSSRKGFFRYWS  821

Query  2707  PVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASD  2886
             P I+  + ELS AE+E+ES LKS LQRLIGRFCEHH+ W++L+ST AELDVLISL+IA D
Sbjct  822   PDIKVFLRELSHAESEKESLLKSTLQRLIGRFCEHHAKWKQLVSTTAELDVLISLAIAGD  881

Query  2887  YYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFIL  3066
             YYEGPTCRP           P L AKSLGHP+LR+D+L KG FV ND+T+GG+ H+SFIL
Sbjct  882   YYEGPTCRPSFVGTLCTKEAPYLHAKSLGHPVLRSDTLGKGDFVPNDITIGGSDHASFIL  941

Query  3067  LTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFL  3246
             LTGPNMGGKSTLLRQVCL VILAQVGADVPA SFDLSPVDRIFVRMGAKD+IMAGQSTFL
Sbjct  942   LTGPNMGGKSTLLRQVCLTVILAQVGADVPAESFDLSPVDRIFVRMGAKDNIMAGQSTFL  1001

Query  3247  TELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHR  3426
             TEL ETASMLSSAT NSLVALDELGRGT+TSDGQAIAESVLEH V KVQCRG+FSTHYHR
Sbjct  1002  TELSETASMLSSATCNSLVALDELGRGTATSDGQAIAESVLEHLVRKVQCRGLFSTHYHR  1061

Query  3427  LAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVL  3606
             LA+DY +D +V LCHMAC +G G+ GL+EVTFLY+LT G CP+SYGVNVAR+AGLP +VL
Sbjct  1062  LAVDYLKDPKVCLCHMACQVGSGIAGLDEVTFLYRLTPGACPKSYGVNVARIAGLPTSVL  1121

Query  3607  EKAAAKSREFEGVY  3648
             +KAAAKSREFE  Y
Sbjct  1122  QKAAAKSREFEATY  1135



>ref|XP_007163172.1| hypothetical protein PHAVU_001G212500g [Phaseolus vulgaris]
 gb|ESW35166.1| hypothetical protein PHAVU_001G212500g [Phaseolus vulgaris]
Length=1291

 Score =  1381 bits (3575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/1030 (69%), Positives = 827/1030 (80%), Gaps = 33/1030 (3%)
 Frame = +1

Query  574   GKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVK--VIESVTN  747
              +S   KK E +KRK +   KL     KK KSG              G  K  V+E  TN
Sbjct  230   AESAKGKKTEAKKRKLSATEKL--KPEKKSKSG---------VEVCKGSFKLSVLEPATN  278

Query  748   NLECVK-ASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPS  924
              LE  K +S+ D++    ++ERF+ RE +KL FL   RRDA RRRPGD NYDSRTLYLP 
Sbjct  279   -LEIKKTSSSADNVSFTETSERFACRESQKLRFLKVDRRDAKRRRPGDENYDSRTLYLPP  337

Query  925   DFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCG  1104
             DFL+ LS GQ+QWWEFKSKHMDKVLFFKMGKFYELFEMDAH+G KELDLQYMKG+QPHCG
Sbjct  338   DFLRNLSEGQKQWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGVKELDLQYMKGDQPHCG  397

Query  1105  FPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLT  1281
             FPEKNFSMN EKLARKGYRVLVVEQ ETPEQLE+RRK KGSKDKVV+REICAV+TKGTLT
Sbjct  398   FPEKNFSMNVEKLARKGYRVLVVEQTETPEQLEIRRKEKGSKDKVVRREICAVVTKGTLT  457

Query  1282  EGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslc  1461
             +GE+L+ +P+A+YL+A+ E  +   N++ E TYGVC+VD+ATS+VILGQF DD DCS+LC
Sbjct  458   DGELLSANPEAAYLMALAEHNENLPNEISEHTYGVCIVDIATSRVILGQFKDDLDCSALC  517

Query  1462  sllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQR  1641
             S+L E RPVEI+KPAKLLS ETER L +HTRNPLVNELVP  EFWDA KT+ ++K +Y  
Sbjct  518   SILSEIRPVEIVKPAKLLSAETERALLKHTRNPLVNELVPGVEFWDAGKTVDQLKQIYGN  577

Query  1642  LNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQ  1821
              N+  +                 D  L  LP+VL ELV +G+N   ALSALGG L+YLKQ
Sbjct  578   TNDASV----------------EDNGLNCLPDVLQELVKSGDNSRSALSALGGALYYLKQ  621

Query  1822  AFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             AFLD  LL+FA+FELLP S FG +A K YMVLD AALENLEIFENS+N  SSGTLYAQ+N
Sbjct  622   AFLDERLLRFAQFELLPCSGFGDLASKHYMVLDVAALENLEIFENSRNGDSSGTLYAQLN  681

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLL  2181
              CVT+FGKRLL+TWLARPL H+E+IKERQ+AVAGLKGVNLP  LEFRK LS+LPDMERLL
Sbjct  682   QCVTSFGKRLLKTWLARPLCHVESIKERQEAVAGLKGVNLPSALEFRKALSKLPDMERLL  741

Query  2182  AQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLL  2361
             A+IF SSEA+GRNANKV+LYEDAAKKQLQ+FI+ALRGCE M+ AC SLG  L++  S+ L
Sbjct  742   ARIFCSSEASGRNANKVILYEDAAKKQLQEFIAALRGCEQMLQACSSLGDILNHVQSRQL  801

Query  2362  HDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLA  2541
             H LLTPGKGLPDV + +  FKD FDWVEAN SGRIIP EGVD EY +AC +++ +E SL 
Sbjct  802   HHLLTPGKGLPDVCMELNHFKDAFDWVEANGSGRIIPHEGVDTEYASACKAVKDIESSLL  861

Query  2542  KHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRK  2721
             KHLKEQ++L GDTSI YV+VGKD YLLEVPE+L   +P++YEL+SS+KG+FRYW P I+ 
Sbjct  862   KHLKEQRELLGDTSIAYVSVGKDVYLLEVPENLSRNIPRDYELRSSRKGFFRYWTPDIKI  921

Query  2722  LMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGP  2901
              + ELSQAE ERES LK+ LQRLIGRFCE+H+ W++L+S  AELD+LISL+IA DYYEGP
Sbjct  922   YLKELSQAELERESLLKNTLQRLIGRFCENHTKWKQLVSATAELDLLISLAIAGDYYEGP  981

Query  2902  TCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTL-GGAGHSSFILLTGP  3078
             TCRP           P L AKSLGHP+LR+D+L KGAFV ND+T+ GG+ H+SFILLTGP
Sbjct  982   TCRPTFVGTLCTKEAPYLHAKSLGHPVLRSDTLGKGAFVPNDITIGGGSDHASFILLTGP  1041

Query  3079  NMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELL  3258
             NMGGKSTLLRQVCL VILAQVGADVPA SFDLSPVDRIFVRMGAKD+IMAGQSTFLTEL 
Sbjct  1042  NMGGKSTLLRQVCLTVILAQVGADVPAESFDLSPVDRIFVRMGAKDNIMAGQSTFLTELS  1101

Query  3259  ETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAID  3438
             ETA+MLSSATRNSLVALDELGRGT+TSDGQAIAE+VLEHFV KVQCRG+FSTHYHRLA+D
Sbjct  1102  ETATMLSSATRNSLVALDELGRGTATSDGQAIAEAVLEHFVRKVQCRGLFSTHYHRLAVD  1161

Query  3439  YQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAA  3618
             Y +D +V L HMAC +G G+ GL+EVTFLY+LT G CP+SYGVNVAR+AGLP +VL+KAA
Sbjct  1162  YLKDPKVCLSHMACQVGGGIAGLDEVTFLYRLTPGACPKSYGVNVARIAGLPTSVLQKAA  1221

Query  3619  AKSREFEGVY  3648
             AKS EFE  Y
Sbjct  1222  AKSGEFEASY  1231


 Score = 90.9 bits (224),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +1

Query  109  LGSKSNKPLLVIGPSPTPDSTESS-YGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKH  285
            L  KSNK LLVIG S +P S  SS YG+EV+ +RIKVYWPLDK WYEG + SFDK + KH
Sbjct  64   LNPKSNKSLLVIGSSISPPSASSSLYGKEVVGQRIKVYWPLDKAWYEGSIISFDKNTSKH  123

Query  286  LVQY-DDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            +V+Y DDEEEE LNLS+E+IEW++     K +RLRR
Sbjct  124  VVRYFDDEEEESLNLSEEKIEWLQESSTKKLKRLRR  159



>gb|AES82183.2| DNA mismatch repair MSH3-like protein [Medicago truncatula]
Length=1280

 Score =  1374 bits (3557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/1059 (66%), Positives = 845/1059 (80%), Gaps = 32/1059 (3%)
 Frame = +1

Query  571   RGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGN-NKSTQSKAPTATGGVKVIESVTN  747
             +GK+  S K E +KRK   G K+     KK KSG   N+     +P A           N
Sbjct  224   KGKN--SNKVEPKKRKLGGGAKM--EPMKKSKSGNEVNRVAVKLSPLAP---------LN  270

Query  748   NLECVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPS  924
             NLE  K S+G D++ TG+S+ERF++RE +K  FLGK RRDA RRRPGD NYDSRTLYLP 
Sbjct  271   NLEVRKTSDGADNVATGDSSERFALREAQKFHFLGKDRRDAKRRRPGDENYDSRTLYLPP  330

Query  925   DFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCG  1104
             DF++ LSGGQ+QWWEFKSKHMDKVLFFKMGKFYELFEMDAH+GAKEL+LQYM+GEQPHCG
Sbjct  331   DFVRNLSGGQKQWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELELQYMRGEQPHCG  390

Query  1105  FPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLT  1281
             FPEKNF++N E+LARKGYRVLVVEQ ETPEQ+ELRRK+ GSKDKVV+REICAV++KGTL 
Sbjct  391   FPEKNFTVNVERLARKGYRVLVVEQTETPEQMELRRKESGSKDKVVRREICAVVSKGTLI  450

Query  1282  EGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslc  1461
             +GE ++ +P+A+YL+A+TE C+ + N++ ERTYGVCVVDVATS+VILGQF DDS+CS+LC
Sbjct  451   DGEFMSTNPEAAYLMALTEYCENNPNEMSERTYGVCVVDVATSRVILGQFNDDSECSALC  510

Query  1462  sllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQR  1641
             S+L E RPVEI+KPAKLLS ETER L +HTRNPLVNEL+P  EFWDA+KT+  +K +Y  
Sbjct  511   SILSEIRPVEIVKPAKLLSAETERALLKHTRNPLVNELIPNVEFWDADKTLDHLKRIYG-  569

Query  1642  LNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQ  1821
                            H ++    D  L  LP+VL ELV    +   ALSALGG L+YLKQ
Sbjct  570   ---------------HNNDVSAQDGGLDCLPDVLVELVKTDHDSRSALSALGGALYYLKQ  614

Query  1822  AFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             AFLD  LL+FA+FELLP S F  +A KPYMVLDA ALENLEIFENS+N  SSGTLYAQ+N
Sbjct  615   AFLDEQLLRFAQFELLPCSVFSGLASKPYMVLDAVALENLEIFENSRNGESSGTLYAQLN  674

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLL  2181
              CVTAFGKRLL++WLARPLYH+E+IKERQ+AVAGLKGVNLP  LEFRK LS+LPDMERLL
Sbjct  675   QCVTAFGKRLLKSWLARPLYHVESIKERQEAVAGLKGVNLPHTLEFRKALSKLPDMERLL  734

Query  2182  AQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLL  2361
             A++ +S +A+GRNANKVVLYED++KKQLQ+FISALRG E M  AC SLG  L+N  S+ L
Sbjct  735   ARVLSSRDASGRNANKVVLYEDSSKKQLQEFISALRGLELMAQACLSLGVILNNVKSRQL  794

Query  2362  HDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLA  2541
               LLTPGKGLPDV + +  FKD FDWVEAN+SGRIIP EGVD+EYD+A  ++ ++E SL 
Sbjct  795   SHLLTPGKGLPDVSMDLNHFKDAFDWVEANNSGRIIPHEGVDKEYDSAGKAVNEIESSLL  854

Query  2542  KHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRK  2721
              HLKEQ+KL G TSI+YV +GKD YLLEVPE+L + +P++YE +SSKKG+ RYW P I+ 
Sbjct  855   DHLKEQRKLLGSTSISYVGIGKDTYLLEVPENLSQNIPRDYERRSSKKGFVRYWTPDIKI  914

Query  2722  LMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGP  2901
              + ELS AE+ERE+ LKS  QR+I RFCEHH+ W++L+S  AELDVLI+L+IASDYYEGP
Sbjct  915   FLKELSHAESERETLLKSTFQRMIERFCEHHTQWKQLVSATAELDVLINLAIASDYYEGP  974

Query  2902  TCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPN  3081
             TCRP        +  P + AKSLGHP+LR+D+L K AFV ND+T+GG   +SFILLTGPN
Sbjct  975   TCRPSFVGTLCTNEAPYIYAKSLGHPVLRSDTLGKSAFVPNDITIGGPDQASFILLTGPN  1034

Query  3082  MGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLE  3261
             MGGKSTLLRQVCLAVILAQVGADVP+ SF+LSPVDRIFVRMGA+D+IMAGQSTFLTEL E
Sbjct  1035  MGGKSTLLRQVCLAVILAQVGADVPSESFELSPVDRIFVRMGARDNIMAGQSTFLTELSE  1094

Query  3262  TASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDY  3441
             TA+MLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH V  VQCRG+FSTHYHRLAIDY
Sbjct  1095  TATMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHLVRSVQCRGLFSTHYHRLAIDY  1154

Query  3442  QEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAA  3621
              +D +V L HMAC +G G  GL+EVTFLY+L+ G CP+SYGVNVARLAGLP +VL+KA A
Sbjct  1155  LKDPKVCLAHMACQVGSGNEGLDEVTFLYRLSAGACPKSYGVNVARLAGLPTSVLQKADA  1214

Query  3622  KSREFEGVYgnnkgsrgnssknWDEKAIEVIRSLMHLAD  3738
             KSREFE  YG  +    +S+++W ++ I +++ L + A+
Sbjct  1215  KSREFEATYGKYRTEPNSSNQSWVDEIIVLVQKLNNAAN  1253


 Score =   104 bits (259),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 6/94 (6%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPT--PDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHL  288
            +K +KP LVI   PT  P  ++S +    + +RI+VYWPLD+ WYEG VKSFD ++ KH 
Sbjct  66   NKPHKPRLVIDAPPTISPPPSDSPF----IGKRIRVYWPLDEAWYEGTVKSFDTVTSKHR  121

Query  289  VQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            ++YDD+EEE ++LS+E+IEWI+     K +RLRR
Sbjct  122  IRYDDDEEESIDLSKEKIEWIQDSSSKKLKRLRR  155



>ref|XP_008451484.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X1 [Cucumis 
melo]
 ref|XP_008451485.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X2 [Cucumis 
melo]
Length=1311

 Score =  1367 bits (3537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 721/1060 (68%), Positives = 846/1060 (80%), Gaps = 19/1060 (2%)
 Frame = +1

Query  568   RRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTN  747
             RR + G   + E +KRK + G K V    KKIKS G + ++             + S+  
Sbjct  234   RRKQGG---QVESKKRKMSNGKK-VEVAPKKIKSSGGSVTSGGLQ---------LSSMET  280

Query  748   NLECVKAS--NGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLP  921
              ++   AS   G + +  ++ ERF+ RE EK  FL + R+DA++R PGD +YD +TLYLP
Sbjct  281   KIKSESASVLKGINEIASDALERFNSREAEKFRFLKEDRKDANKRCPGDPDYDPKTLYLP  340

Query  922   SDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHC  1101
               F+K LS GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHC
Sbjct  341   PYFVKNLSDGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHC  400

Query  1102  GFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTL  1278
             GFPE+NFS+N EKLARKGYRVLV+EQ ETPEQLE RRK KGSKDKVVKREICAV+TKGTL
Sbjct  401   GFPERNFSLNVEKLARKGYRVLVIEQTETPEQLERRRKEKGSKDKVVKREICAVVTKGTL  460

Query  1279  TEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcssl  1458
             TEGEML+++PDASYL+AVTE      NQ  ER  GVCVVDVATS+VILGQF DD +CS+L
Sbjct  461   TEGEMLSLNPDASYLMAVTEKFHGLENQQAERILGVCVVDVATSRVILGQFGDDLECSAL  520

Query  1459  csllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQ  1638
             C LL E RPVEIIKPAKLLS ETERVL  HTRNPLVNELVPL EFW+AEKT+ EVK +++
Sbjct  521   CCLLSELRPVEIIKPAKLLSPETERVLLTHTRNPLVNELVPLLEFWNAEKTVQEVKRLFK  580

Query  1639  RLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLK  1818
              + N  +  S +EA L   ++   +  L  LP VLSELV A ENG++ALSALGG LFYLK
Sbjct  581   GIANRSVSGSSSEASLLNDDTPGENDGLSFLPVVLSELVTAQENGSWALSALGGILFYLK  640

Query  1819  QAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQM  1998
             QAFLD +LL+FA+FELLP S F  +  KPYMVLDAAALENLEIFENS+N  SSGTLY+Q+
Sbjct  641   QAFLDETLLRFAKFELLPCSGFSDVISKPYMVLDAAALENLEIFENSRNGDSSGTLYSQL  700

Query  1999  NHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERL  2178
             NHCVTAFGKRLL+TWLARPLY +E+IK RQ AVA L+G NL   LEFRK LS+LPDMERL
Sbjct  701   NHCVTAFGKRLLKTWLARPLYDVESIKARQGAVASLRGDNLSFSLEFRKALSKLPDMERL  760

Query  2179  LAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKL  2358
             LA+IF++SEANGRNA  VVLYEDAAKKQLQ+FISALRGCE M+ AC SL   L + +S+ 
Sbjct  761   LARIFSNSEANGRNAKNVVLYEDAAKKQLQEFISALRGCELMLQACSSLHVILPSVESRR  820

Query  2359  LHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSL  2538
             L+ LLTPG+GLPD+  V+  FKD FDWVEANSSGR+IP EGVD EYD+AC  +++++ SL
Sbjct  821   LNCLLTPGEGLPDLHSVLSHFKDAFDWVEANSSGRVIPREGVDVEYDSACEKIKEIQSSL  880

Query  2539  AKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIR  2718
              KHLKEQ+KL GDTSI YVTVGK+ +LLEVPESL   +PQ YEL+SSKKG+FRYW P I+
Sbjct  881   TKHLKEQRKLLGDTSITYVTVGKETHLLEVPESLQGNIPQTYELRSSKKGFFRYWTPNIK  940

Query  2719  KLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEG  2898
             KL+ ELS AE+E+ES LKSILQRLIG+FCEHH  WR+L+S IAELDVLISL+IASDYYEG
Sbjct  941   KLLVELSLAESEKESSLKSILQRLIGKFCEHHLQWRQLVSAIAELDVLISLAIASDYYEG  1000

Query  2899  PTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGP  3078
              TC+P   +   Q  VP   AK+LGHPILR+DSL +G FV ND+T+GG+G ++FILLTGP
Sbjct  1001  YTCQPLFSKSQCQSEVPRFTAKNLGHPILRSDSLGEGTFVPNDITIGGSG-ANFILLTGP  1059

Query  3079  NMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELL  3258
             NMGGKSTLLRQVCL++ILAQ+GADVPA SF+L+PVDRIFVRMGAKD IM+GQSTFLTEL 
Sbjct  1060  NMGGKSTLLRQVCLSIILAQIGADVPAESFELAPVDRIFVRMGAKDQIMSGQSTFLTELS  1119

Query  3259  ETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAID  3438
             ETA MLSSATRNSLV LDELGRGT+TSDGQAIAESVLEHFV KVQCRG+FSTHYHRLA+ 
Sbjct  1120  ETALMLSSATRNSLVILDELGRGTATSDGQAIAESVLEHFVSKVQCRGVFSTHYHRLALA  1179

Query  3439  YQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAA  3618
             Y +D +VSL HMAC +GEG  GLEEVTFLY+LT GTCP+SYGVNVARLAGLP+ VL +AA
Sbjct  1180  YYKDPRVSLYHMACRVGEGNNGLEEVTFLYRLTPGTCPKSYGVNVARLAGLPNCVLTEAA  1239

Query  3619  AKSREFEGVYgnnkgsrgns--sknWDEKAIEVIRSLMHL  3732
             AKS EFE  YG       ++  +  W +  I +I+ L+ L
Sbjct  1240  AKSMEFEATYGMAGEESEDNLCNHAWVDDTITLIQKLISL  1279


 Score =   108 bits (270),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 67/107 (63%), Gaps = 16/107 (15%)
 Frame = +1

Query  115  SKSNKPLLVIGPSP---------------TPDSTESSYGQEVLNRRIKVYWPLDKCWYEG  249
            SK  KPLLVIG                   PD  E S+G  V+ ++IKVYWPLDK WYEG
Sbjct  60   SKRKKPLLVIGGGAGPFSSSPSPSPGPSSLPDKEEKSHGDGVIGKKIKVYWPLDKTWYEG  119

Query  250  CVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
             VK FD+ +GKHLVQYDD EEEML L  E+IEW+E     KF+RLRR
Sbjct  120  RVKMFDEKAGKHLVQYDDAEEEMLVLGNEKIEWVEES-AKKFKRLRR  165



>ref|XP_004136154.1| PREDICTED: DNA mismatch repair protein MSH6-like [Cucumis sativus]
 gb|KGN45011.1| hypothetical protein Csa_7G407640 [Cucumis sativus]
Length=1307

 Score =  1359 bits (3517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/1028 (69%), Positives = 832/1028 (81%), Gaps = 14/1028 (1%)
 Frame = +1

Query  568   RRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTN  747
             RR + G   + E +KRK + G K V    KKIKS      T      ++   K+    T+
Sbjct  231   RRKQGG---QVESKKRKMSNGKK-VEVAPKKIKSS-GGSVTSGGLQLSSMETKIKSESTS  285

Query  748   NLECVKASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSD  927
              L+      G + +  ++ ERF+ RE EK  FL + R+DA++R PGD +YD +TL+LP  
Sbjct  286   VLK------GINEIASDALERFNSREAEKFRFLKEDRKDANKRCPGDPDYDPKTLHLPPY  339

Query  928   FLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGF  1107
             F+K LS GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKG+QPHCGF
Sbjct  340   FVKNLSDGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGDQPHCGF  399

Query  1108  PEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTE  1284
             PE+NFS+N EKLARKGYRVLV+EQ ETPEQLE RRK KGSKDKVVKREICAV+TKGTLTE
Sbjct  400   PERNFSLNVEKLARKGYRVLVIEQTETPEQLERRRKEKGSKDKVVKREICAVVTKGTLTE  459

Query  1285  GEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcs  1464
             GEML+++PDASYL+AVTE+     NQ  ER  GVCVVDVATS+VILGQF DDS+CS+LC 
Sbjct  460   GEMLSLNPDASYLMAVTENFYGLENQ-QERILGVCVVDVATSRVILGQFGDDSECSALCC  518

Query  1465  llYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRL  1644
             LL E RPVEIIKPAKLLS ETERVL  HTRNPLVNELVPL EFWDAEKT+ EVK +++ +
Sbjct  519   LLSELRPVEIIKPAKLLSPETERVLLTHTRNPLVNELVPLLEFWDAEKTVQEVKRLFKGI  578

Query  1645  NNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQA  1824
              N  +  S +EA L    +   +  L  +P+VLSELV A ENG++ALSALGG LFYLKQA
Sbjct  579   ANRSVSGSSSEASLLNDNAARENDGLSYMPDVLSELVTADENGSWALSALGGILFYLKQA  638

Query  1825  FLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNH  2004
             FLD +LL+FA+FELLP S F  +  KPYMVLDAAALENLEIFENS+N  SSGTLY+Q+NH
Sbjct  639   FLDETLLRFAKFELLPCSGFSDVISKPYMVLDAAALENLEIFENSRNGDSSGTLYSQLNH  698

Query  2005  CVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLA  2184
             CVTAFGKRLL+TWLARPLYH+E+I+ RQ AVA L+G NL   LEFRK LS+LPDMERLLA
Sbjct  699   CVTAFGKRLLKTWLARPLYHVESIEARQGAVASLRGDNLSFSLEFRKALSKLPDMERLLA  758

Query  2185  QIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLH  2364
             +IF++SEANGRNA  VVLYEDAAKKQLQ+FISALRGCE M+ AC SL   L N  S+ L 
Sbjct  759   RIFSNSEANGRNAINVVLYEDAAKKQLQEFISALRGCELMLQACSSLRVILPNVKSRRLD  818

Query  2365  DLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAK  2544
              LLTPG+GLPD+  V+  FKD FDWVEANSSGR+IP EGVD EYD+AC  +R+++ SL K
Sbjct  819   CLLTPGEGLPDLHSVLSHFKDAFDWVEANSSGRVIPREGVDVEYDSACEKIREIQSSLTK  878

Query  2545  HLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKL  2724
             HLKEQ+KL GDTSI YVTVGK+ +LLEVPESL   +PQ YEL+SSKKG+FRYW P I+KL
Sbjct  879   HLKEQRKLLGDTSITYVTVGKETHLLEVPESLQGNIPQTYELRSSKKGFFRYWTPNIKKL  938

Query  2725  MGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPT  2904
             + ELS AE+E+ES LKSILQRLI +FCEHH  WR+L+S IAELDVLISL+IASDYYEG T
Sbjct  939   LAELSLAESEKESSLKSILQRLIRKFCEHHLQWRQLVSAIAELDVLISLAIASDYYEGYT  998

Query  2905  CRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNM  3084
             C+P   +   Q+ VP   AK+LGHPILR+DSL +G FV ND+T+GG+G ++FILLTGPNM
Sbjct  999   CQPLFSKSQCQNEVPRFTAKNLGHPILRSDSLGEGTFVPNDITIGGSG-ANFILLTGPNM  1057

Query  3085  GGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLET  3264
             GGKSTLLRQVCL+VILAQ+GADVPA SF+L+PVDRIFVRMGA+D IM+GQSTFLTEL ET
Sbjct  1058  GGKSTLLRQVCLSVILAQIGADVPAESFELAPVDRIFVRMGARDQIMSGQSTFLTELSET  1117

Query  3265  ASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQ  3444
             A MLSSATRNS+V LDELGRGT+TSDGQAIAESVLEHFV KVQCRG+FSTHYHRLA+ Y 
Sbjct  1118  ALMLSSATRNSVVILDELGRGTATSDGQAIAESVLEHFVSKVQCRGVFSTHYHRLALAYH  1177

Query  3445  EDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAK  3624
             +D +VSL HMAC +GEG  GLEEVTFLY+LT GTCP+SYGVNVARLAGLP+ VL +AAAK
Sbjct  1178  KDPRVSLHHMACRVGEGNNGLEEVTFLYRLTPGTCPKSYGVNVARLAGLPNCVLTEAAAK  1237

Query  3625  SREFEGVY  3648
             S EFE  Y
Sbjct  1238  SMEFEVTY  1245


 Score =   108 bits (271),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 68/104 (65%), Gaps = 13/104 (13%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTP------------DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVK  258
            SK  KPLLVIG    P            D+ E S+G  V+ ++IKVYWPLDK WYEG VK
Sbjct  60   SKRKKPLLVIGGGAPPFSSSSPGSSSLPDAEEKSHGDGVIGKKIKVYWPLDKTWYEGRVK  119

Query  259  SFDKISGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
             FD+ +GKHLVQYDD EEE+L L  E+IEW+E     KF+RLRR
Sbjct  120  MFDEKAGKHLVQYDDAEEELLVLGNEKIEWVEES-AKKFKRLRR  162



>ref|XP_003625965.1| DNA mismatch repair protein Msh6-1 [Medicago truncatula]
Length=1312

 Score =  1357 bits (3513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/1091 (64%), Positives = 845/1091 (77%), Gaps = 64/1091 (6%)
 Frame = +1

Query  571   RGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGN-NKSTQSKAPTATGGVKVIESVTN  747
             +GK+  S K E +KRK   G K+     KK KSG   N+     +P A           N
Sbjct  224   KGKN--SNKVEPKKRKLGGGAKM--EPMKKSKSGNEVNRVAVKLSPLAP---------LN  270

Query  748   NLECVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPS  924
             NLE  K S+G D++ TG+S+ERF++RE +K  FLGK RRDA RRRPGD NYDSRTLYLP 
Sbjct  271   NLEVRKTSDGADNVATGDSSERFALREAQKFHFLGKDRRDAKRRRPGDENYDSRTLYLPP  330

Query  925   DFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCG  1104
             DF++ LSGGQ+QWWEFKSKHMDKVLFFKMGKFYELFEMDAH+GAKEL+LQYM+GEQPHCG
Sbjct  331   DFVRNLSGGQKQWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELELQYMRGEQPHCG  390

Query  1105  FPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLT  1281
             FPEKNF++N E+LARKGYRVLVVEQ ETPEQ+ELRRK+ GSKDKVV+REICAV++KGTL 
Sbjct  391   FPEKNFTVNVERLARKGYRVLVVEQTETPEQMELRRKESGSKDKVVRREICAVVSKGTLI  450

Query  1282  EGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslc  1461
             +GE ++ +P+A+YL+A+TE C+ + N++ ERTYGVCVVDVATS+VILGQF DDS+CS+LC
Sbjct  451   DGEFMSTNPEAAYLMALTEYCENNPNEMSERTYGVCVVDVATSRVILGQFNDDSECSALC  510

Query  1462  sllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQR  1641
             S+L E RPVEI+KPAKLLS ETER L +HTRNPLVNEL+P  EFWDA+KT+  +K +Y  
Sbjct  511   SILSEIRPVEIVKPAKLLSAETERALLKHTRNPLVNELIPNVEFWDADKTLDHLKRIYG-  569

Query  1642  LNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQ  1821
                            H ++    D  L  LP+VL ELV    +   ALSALGG L+YLKQ
Sbjct  570   ---------------HNNDVSAQDGGLDCLPDVLVELVKTDHDSRSALSALGGALYYLKQ  614

Query  1822  AFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             AFLD  LL+FA+FELLP S F  +A KPYMVLDA ALENLEIFENS+N  SSGTLYAQ+N
Sbjct  615   AFLDEQLLRFAQFELLPCSVFSGLASKPYMVLDAVALENLEIFENSRNGESSGTLYAQLN  674

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLK------------------------  2109
              CVTAFGKRLL++WLARPLYH+E+IKERQ+AVAGLK                        
Sbjct  675   QCVTAFGKRLLKSWLARPLYHVESIKERQEAVAGLKVHSLTMHFVFDSDVPLRYSDSFPP  734

Query  2110  --------GVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQL  2265
                     GVNLP  LEFRK LS+LPDMERLLA++ +S +A+GRNANKVVLYED++KKQL
Sbjct  735   RLLDFFFHGVNLPHTLEFRKALSKLPDMERLLARVLSSRDASGRNANKVVLYEDSSKKQL  794

Query  2266  QQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVE  2445
             Q+FISALRG E M  AC SLG  L+N  S+ L  LLTPGKGLPDV + +  FKD FDWVE
Sbjct  795   QEFISALRGLELMAQACLSLGVILNNVKSRQLSHLLTPGKGLPDVSMDLNHFKDAFDWVE  854

Query  2446  ANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLE  2625
             AN+SGRIIP EGVD+EYD+A  ++ ++E SL  HLKEQ+KL G TSI+YV +GKD YLLE
Sbjct  855   ANNSGRIIPHEGVDKEYDSAGKAVNEIESSLLDHLKEQRKLLGSTSISYVGIGKDTYLLE  914

Query  2626  VPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFC  2805
             VPE+L + +P++YE +SSKKG+ RYW P I+  + ELS AE+ERE+ LKS  QR+I RFC
Sbjct  915   VPENLSQNIPRDYERRSSKKGFVRYWTPDIKIFLKELSHAESERETLLKSTFQRMIERFC  974

Query  2806  EHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPIL  2985
             EHH+ W++L+S  AELDVLI+L+IASDYYEGPTCRP        +  P + AKSLGHP+L
Sbjct  975   EHHTQWKQLVSATAELDVLINLAIASDYYEGPTCRPSFVGTLCTNEAPYIYAKSLGHPVL  1034

Query  2986  RTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAAS  3165
             R+D+L K AFV ND+T+GG   +SFILLTGPNMGGKSTLLRQVCLAVILAQVGADVP+ S
Sbjct  1035  RSDTLGKSAFVPNDITIGGPDQASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPSES  1094

Query  3166  FDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDG  3345
             F+LSPVDRIFVRMGA+D+IMAGQSTFLTEL ETA+MLSSATRNSLVALDELGRGTSTSDG
Sbjct  1095  FELSPVDRIFVRMGARDNIMAGQSTFLTELSETATMLSSATRNSLVALDELGRGTSTSDG  1154

Query  3346  QAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFL  3525
             QAIAESVLEH V  VQCRG+FSTHYHRLAIDY +D +V L HMAC +G G  GL+EVTFL
Sbjct  1155  QAIAESVLEHLVRSVQCRGLFSTHYHRLAIDYLKDPKVCLAHMACQVGSGNEGLDEVTFL  1214

Query  3526  YKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYgnnkgsrgnssknWDEKAI  3705
             Y+L+ G CP+SYGVNVARLAGLP +VL+KA AKSREFE  YG  +    +S+++W ++ I
Sbjct  1215  YRLSAGACPKSYGVNVARLAGLPTSVLQKADAKSREFEATYGKYRTEPNSSNQSWVDEII  1274

Query  3706  EVIRSLMHLAD  3738
              +++ L + A+
Sbjct  1275  VLVQKLNNAAN  1285


 Score =   103 bits (258),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 6/94 (6%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPT--PDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHL  288
            +K +KP LVI   PT  P  ++S +    + +RI+VYWPLD+ WYEG VKSFD ++ KH 
Sbjct  66   NKPHKPRLVIDAPPTISPPPSDSPF----IGKRIRVYWPLDEAWYEGTVKSFDTVTSKHR  121

Query  289  VQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            ++YDD+EEE ++LS+E+IEWI+     K +RLRR
Sbjct  122  IRYDDDEEESIDLSKEKIEWIQDSSSKKLKRLRR  155



>ref|XP_010932609.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein MSH6 
[Elaeis guineensis]
Length=1287

 Score =  1352 bits (3499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/1002 (68%), Positives = 816/1002 (81%), Gaps = 7/1002 (1%)
 Frame = +1

Query  652   AKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASNGDDILTGNSAERFSMREME  831
             AKK++  G+ + + SKA  ++     + S++N+       N D  LTG +AERF  RE E
Sbjct  237   AKKVRFDGDGEKSTSKASLSSIRSSTVGSLSNSERGHVLYNLDSTLTGEAAERFGKREAE  296

Query  832   KLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKM  1011
             +  FLG+GR+DA  R+PGD +YD +TLYLP +FL+ LSGGQRQWWEFKS+HMDKVLFFKM
Sbjct  297   RFRFLGQGRKDAHGRQPGDADYDPKTLYLPPEFLRSLSGGQRQWWEFKSRHMDKVLFFKM  356

Query  1012  GKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETP  1191
             GKFYELFEMDAHIG +ELDLQYMKGEQPHCGFPEKNFSM  EKLARKGYRVLVVEQ ETP
Sbjct  357   GKFYELFEMDAHIGVRELDLQYMKGEQPHCGFPEKNFSMQLEKLARKGYRVLVVEQTETP  416

Query  1192  EQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQL-  1365
             EQLELRRK+ GSKDKVVKREICA++TKGTLT+GE L  +PD SYL+++TE+ Q   NQ  
Sbjct  417   EQLELRRKEMGSKDKVVKREICAIVTKGTLTDGESLLTNPDTSYLMSITENGQCFENQKE  476

Query  1366  GERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHR  1545
             GE   G+CVVDV+TSK ++GQF DDSD   LCS+L E RPVEIIKP+K+LS ETERVL  
Sbjct  477   GETIIGLCVVDVSTSKFMIGQFEDDSDRHCLCSILSELRPVEIIKPSKVLSPETERVLRN  536

Query  1546  HTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLR  1725
             +TRNPLVN+LVP +EFWDAEKTI EV+  Y    +  +P S N++     +++ ND+   
Sbjct  537   NTRNPLVNDLVPFTEFWDAEKTIGEVRKYYSL--SRRLPASANDSISANFDNLVNDSL--  592

Query  1726  NLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKP  1905
              LP++L+ELV+AG +G YALSALGG LFYL+QAFLD +LL  A+FE LP S F    Q  
Sbjct  593   ALPDMLAELVSAGNDGLYALSALGGCLFYLRQAFLDETLLNCAKFEPLPCSDFFSTIQNS  652

Query  1906  YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKER  2085
             YM+LDAAALENLEI EN++N G SGTL+AQ++HCV+AFGKRLL+ WLARPLY+  +I ER
Sbjct  653   YMILDAAALENLEILENNRNGGPSGTLFAQLDHCVSAFGKRLLKRWLARPLYNTRSILER  712

Query  2086  QDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQL  2265
             QDA+A +KG+ L   LEFRKELSRLPDMERLLA++FAS  ANGRN+N+VVLYEDAAKKQL
Sbjct  713   QDAIAAMKGIGLSSALEFRKELSRLPDMERLLARLFASCGANGRNSNRVVLYEDAAKKQL  772

Query  2266  QQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVE  2445
             + FI+ALRGC+ MV AC SL   L  T+S LLH LLT GKGLPD+  ++  FKD FDW E
Sbjct  773   RDFIAALRGCQLMVQACSSLSTILSTTESSLLHYLLTRGKGLPDMCSLVSHFKDAFDWSE  832

Query  2446  ANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLE  2625
             A+ SGRIIP EG D EYD AC +++++E +L ++LKEQ+KL GD SINYVTVGKD YLLE
Sbjct  833   ADRSGRIIPHEGGDVEYDLACKTVKEIESALTRYLKEQRKLLGDASINYVTVGKDLYLLE  892

Query  2626  VPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFC  2805
             VPESL   VP++YELQSSKKGYFRYW P I++ + ELSQAE ++ESKLK ILQRLI  F 
Sbjct  893   VPESLRGAVPRDYELQSSKKGYFRYWTPKIKEFLSELSQAEADKESKLKGILQRLIKYFS  952

Query  2806  EHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRE-LPSQDNVPCLVAKSLGHPI  2982
             EHHS WR+L+S  AELDVLISL+IASDYYEGP CRP I E   S D +PCL AKSLGHPI
Sbjct  953   EHHSKWRQLVSVTAELDVLISLAIASDYYEGPACRPVIMERCHSDDKLPCLSAKSLGHPI  1012

Query  2983  LRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAA  3162
             LR+D+L KG+FV NDV++GGAGH++FILLTGPNMGGKSTLLRQVCL+VILAQ+GADVPA 
Sbjct  1013  LRSDALGKGSFVPNDVSIGGAGHANFILLTGPNMGGKSTLLRQVCLSVILAQLGADVPAE  1072

Query  3163  SFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSD  3342
             SF LSPVDRIFVRMGA+DHIMAGQSTFL EL ETASMLSSAT NSLVALDELGRGTSTSD
Sbjct  1073  SFKLSPVDRIFVRMGARDHIMAGQSTFLMELSETASMLSSATHNSLVALDELGRGTSTSD  1132

Query  3343  GQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTF  3522
             GQAIA SVLE+ VH+++CRG+FSTHYHRLA++Y++D +VSLCHMAC +G+G+ GLEEVTF
Sbjct  1133  GQAIAASVLEYLVHRIECRGLFSTHYHRLAVEYEKDTKVSLCHMACQVGKGVSGLEEVTF  1192

Query  3523  LYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             LY+LT G+CP+SYGVNVARLAG+P +VL+ A AKS EFE  Y
Sbjct  1193  LYRLTPGSCPKSYGVNVARLAGIPASVLQTAMAKSSEFEAGY  1234


 Score =   116 bits (291),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 68/97 (70%), Gaps = 6/97 (6%)
 Frame = +1

Query  118  KSNKPLLVIGPSP-----TP-DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISG  279
            K NKPLLVI   P     TP  + E +Y +EV+ RRI+V+WPLDK WYEG VK FD+ SG
Sbjct  65   KKNKPLLVIPSIPASKPRTPLTAGERAYSEEVVGRRIRVFWPLDKAWYEGSVKYFDEASG  124

Query  280  KHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            KHLVQYDD EEE L+L +E+ EW+E     K RRLRR
Sbjct  125  KHLVQYDDAEEESLDLGKEKFEWVEEEPSRKLRRLRR  161



>ref|XP_010679365.1| PREDICTED: DNA mismatch repair protein MSH6 [Beta vulgaris subsp. 
vulgaris]
Length=1301

 Score =  1351 bits (3497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/990 (69%), Positives = 816/990 (82%), Gaps = 4/990 (0%)
 Frame = +1

Query  781   DILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQ  960
             D +  ++ ERF +RE +K  FLGK RRDA RR PGD  YD RTLYLP  FL  L+GGQRQ
Sbjct  291   DGMAVDALERFGIREEQKFPFLGKDRRDAKRRLPGDAGYDPRTLYLPPHFLNKLTGGQRQ  350

Query  961   WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEK  1140
             WWEFKSKHMDKVLFFKMGKFYE+FEMDAHIG KELDLQYMKGEQPHCGFPEKNFS+N EK
Sbjct  351   WWEFKSKHMDKVLFFKMGKFYEIFEMDAHIGVKELDLQYMKGEQPHCGFPEKNFSINVEK  410

Query  1141  LARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDAS  1317
             LARKGYRVLVVEQ ETP+QLE+RRK +GSKDKVVKREICAV+TKGTLTEGEML+ +PDAS
Sbjct  411   LARKGYRVLVVEQTETPDQLEIRRKTEGSKDKVVKREICAVVTKGTLTEGEMLSANPDAS  470

Query  1318  YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEII  1497
             Y+++V ES + S+++     YGVC++DV+TS+VI+GQ  DD +CS+LC LL E RPVEII
Sbjct  471   YIMSVNESPRASSDKEEGHLYGVCLIDVSTSRVIIGQITDDLECSALCCLLSELRPVEII  530

Query  1498  KPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNE  1677
             KPA +LS ETER L R+TRNPL+NELVP  EFWDA++T+ E+++ Y  +N +P   S  E
Sbjct  531   KPANMLSAETERALIRYTRNPLINELVPHVEFWDADRTVHELQSFYSHIN-SPSVSSLEE  589

Query  1678  ADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
                  ++S   D Q   LP+V++EL +AG +G+ ALSALGG+L+YLKQAFLD +LL++A+
Sbjct  590   QVTDATKSNSKDEQCW-LPDVVNELSSAGVDGSLALSALGGSLYYLKQAFLDETLLRYAK  648

Query  1858  FELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLR  2037
             FE LP S F  + +K YMVLDAAALENLEIFENSKN GSSGTLYAQ+NHCVTAFGKRLL+
Sbjct  649   FESLPCSGFCDVFRKSYMVLDAAALENLEIFENSKNGGSSGTLYAQLNHCVTAFGKRLLK  708

Query  2038  TWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGR  2217
              WLARPLYH E+I++RQDA+AGLK  N+   LEFRKE+S+ PDMERLL+++FASSEANGR
Sbjct  709   AWLARPLYHAESIRKRQDAIAGLKA-NISFALEFRKEMSKFPDMERLLSRLFASSEANGR  767

Query  2218  NANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPD  2397
             NANK+VLYEDAAK+QLQ+FIS LRGCE M  AC SL + L+NTDS+LLH LL PGKGLP+
Sbjct  768   NANKIVLYEDAAKQQLQEFISTLRGCEVMTVACSSLSSILNNTDSELLHHLLIPGKGLPN  827

Query  2398  VKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGD  2577
             V  ++K+F+D FDW +ANS+GRIIP EG D EYD+AC  + ++E +L KH+KEQ+ LFG 
Sbjct  828   VSSILKEFRDAFDWADANSTGRIIPLEGGDAEYDSACKKIEEIESNLNKHIKEQKTLFGK  887

Query  2578  TSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETER  2757
               I  VTVGKD YLLEVP+SL   VP++YEL+SSKKG+ RYW P IRK++GEL+Q E  +
Sbjct  888   PLIACVTVGKDRYLLEVPDSLKGNVPKDYELRSSKKGFSRYWTPYIRKMVGELTQVEAVK  947

Query  2758  ESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQ  2937
             ESKLK ILQ LIGRFCEHH+ WR L+S +AELDVLISL I+SDYYEGPTCRP I    + 
Sbjct  948   ESKLKCILQDLIGRFCEHHTKWRNLVSAVAELDVLISLVISSDYYEGPTCRPIISTGFNY  1007

Query  2938  DNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVC  3117
             + VP L AKSLGHPI+++DSL +G FV ND+ +GGA H++FILLTGPNMGGKSTLLRQ+C
Sbjct  1008  NEVPHLEAKSLGHPIIKSDSLGRGTFVPNDINVGGADHATFILLTGPNMGGKSTLLRQIC  1067

Query  3118  LAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNS  3297
             LAVILAQVGADVPA  F+LS VDRIFVRMGAKDHIMAGQSTFLTEL ETASML+SATRNS
Sbjct  1068  LAVILAQVGADVPAEHFELSLVDRIFVRMGAKDHIMAGQSTFLTELSETASMLTSATRNS  1127

Query  3298  LVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMA  3477
             LVALDELGRGTSTSDGQAIAESVLEHFV KVQC GMFSTHYHRLAIDY+ D +VSLCHMA
Sbjct  1128  LVALDELGRGTSTSDGQAIAESVLEHFVRKVQCLGMFSTHYHRLAIDYKRDPKVSLCHMA  1187

Query  3478  CHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYgnn  3657
             C +G+G  G+EEVTFLY+LT G CP+SYGVNVARLAG+PD VL KAAAKSREFE VYG  
Sbjct  1188  CQVGKGDEGVEEVTFLYRLTRGACPKSYGVNVARLAGIPDCVLRKAAAKSREFEAVYGRQ  1247

Query  3658  kgsrgnssknWDEKAIEVIRSLMHLADYNE  3747
             +    N  +N +E+ + + ++L+  +  ++
Sbjct  1248  QKRSNNDVRNREEETVRLFKNLVGFSSSDD  1277


 Score =   114 bits (285),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +1

Query  121  SNKPLLVIGPSPTPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYD  300
            ++KP+LVIG   T +    SYG+EV+++RI+VYWPLD  WYEG VK FDK+ GKHLV+Y+
Sbjct  86   TSKPMLVIGSQTTTNLGSHSYGEEVVSKRIRVYWPLDSVWYEGSVKLFDKVLGKHLVEYE  145

Query  301  DEEEEMLNLSQERIEWIETPVVTKF--RRLRR  390
            D EEEM++LS+E+IEW+   +V K   RRLR+
Sbjct  146  DGEEEMIDLSKEKIEWVGGDLVRKVSKRRLRK  177



>emb|CDX91808.1| BnaC03g31100D [Brassica napus]
Length=1321

 Score =  1350 bits (3493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1021 (67%), Positives = 807/1021 (79%), Gaps = 15/1021 (1%)
 Frame = +1

Query  598   AELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATG-GVKVIESVTNNLECVKASN  774
             A+ RKRK T         ++  K GG  KS   K  T  G    V+E V    E  +   
Sbjct  262   ADSRKRKKT---------SEVAKPGGEKKSKTDKETTFKGFKASVVEPVKQTGEADRVVK  312

Query  775   G--DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSG  948
             G  D++L G++  RF  RE EK  F+G  RRDA RRRP D NYD RTLYLP DF+K L+G
Sbjct  313   GLDDNMLDGDALARFGARESEKFRFMGVDRRDAKRRRPTDENYDPRTLYLPPDFVKRLTG  372

Query  949   GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSM  1128
             GQRQWWEFKSKHMDKV+FFKMGKFYEL+EMDAH+GAKELDL+YMKGEQPHCGFPEKNFS+
Sbjct  373   GQRQWWEFKSKHMDKVIFFKMGKFYELYEMDAHVGAKELDLRYMKGEQPHCGFPEKNFSV  432

Query  1129  NAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVS  1305
             N EKL +KG+RVLVVEQ ETP+QLE RRK KGSKDKVVKREICAV+T+GTLT+GEM+  +
Sbjct  433   NIEKLVQKGFRVLVVEQTETPDQLERRRKEKGSKDKVVKREICAVVTRGTLTDGEMVLTN  492

Query  1306  PDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRP  1485
             PDASYL+A+TE  ++  ++  E  +GVC+VDVAT K+ILGQF DD DCS+L  +L E RP
Sbjct  493   PDASYLMALTEGGESLTDEKAEHNFGVCLVDVATKKIILGQFKDDQDCSALSCVLSEIRP  552

Query  1486  VEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPY  1665
             VEIIKPA +LS  TER + R+TRNPLVN LVPLSEFWDAEKTI EV   Y+ +   P   
Sbjct  553   VEIIKPANMLSSATERTIVRYTRNPLVNNLVPLSEFWDAEKTIHEVGTFYKGIRCEPSSA  612

Query  1666  SQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLL  1845
                E  +    S+ N++    LP +LSEL +  +NG+ ALSALGG ++YL+QAFLD SLL
Sbjct  613   YSGEEKILGDPSL-NESGSSFLPKMLSELASGDKNGSLALSALGGAIYYLRQAFLDESLL  671

Query  1846  KFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGK  2025
             ++A+FE LP+S F    +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N C+TA GK
Sbjct  672   RYAKFESLPYSDFSNFTEKQHMVLDAAALENLEIFENSRNGGVSGTLYAQLNQCITASGK  731

Query  2026  RLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSE  2205
             RLL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+S E
Sbjct  732   RLLKTWLARPLYNPELIKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFSSIE  791

Query  2206  ANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGK  2385
             A+GRN +KVVLYED AKKQLQ+FIS LRGCETMV AC SL  +L +  S+ L  LLTPG+
Sbjct  792   ASGRNGDKVVLYEDVAKKQLQEFISTLRGCETMVEACSSLRTSLTHDKSRRLRHLLTPGQ  851

Query  2386  GLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQK  2565
              LP++   IK FKD FDWVEA+ SGR++P EG DEEYD  C +++++E+SL KHLKEQ+K
Sbjct  852   SLPNISPFIKYFKDAFDWVEAHDSGRVVPHEGADEEYDFTCKTVKELEVSLTKHLKEQRK  911

Query  2566  LFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQA  2745
             L GD SI YVTVGKD YLLEVPESL   +PQ+YEL SSKKG FRYW P I+KL+ EL+QA
Sbjct  912   LLGDASIKYVTVGKDEYLLEVPESLSGSIPQDYELCSSKKGVFRYWTPTIKKLLKELAQA  971

Query  2746  ETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRE  2925
             ++E+ES LKSI QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD YEG  CRP I  
Sbjct  972   KSEKESALKSISQRLIGRFCEHQEEWRQLVSATAELDVLISLAFASDSYEGVRCRPVISS  1031

Query  2926  LPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLL  3105
               S D VP L A  LGHP+LR DSL +G+FV NDV +GG+  +SFILLTGPNMGGKSTLL
Sbjct  1032  SKSVD-VPHLSATGLGHPVLRGDSLGRGSFVPNDVKIGGSKQASFILLTGPNMGGKSTLL  1090

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQVCLAVILAQ+GADVPA +F+LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLSSA
Sbjct  1091  RQVCLAVILAQIGADVPAETFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETAVMLSSA  1150

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             TRNSLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRGMFSTHYHRL++DYQ + QVSL
Sbjct  1151  TRNSLVVLDELGRGTATSDGQAIAESVLEHFIDKVQCRGMFSTHYHRLSMDYQTNPQVSL  1210

Query  3466  CHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             CHM C +GEG GG+EEVTFLY+LT G CP+SYGVNVARLAGLPD+VL++A  KS+EFEG+
Sbjct  1211  CHMGCQVGEGSGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDDVLQRAVIKSQEFEGL  1270

Query  3646  Y  3648
             Y
Sbjct  1271  Y  1271


 Score =   112 bits (281),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +1

Query  118  KSNKPLLVIGPSPTPDS-TESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQ  294
            K  KPLLVIG +P+P   TE++YG EV+ ++++VYWPLDK WYEG V S+DK  GKH+V+
Sbjct  88   KLKKPLLVIGQTPSPPKFTETTYGDEVVGKQVRVYWPLDKKWYEGSVTSYDKGEGKHMVE  147

Query  295  YDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            Y+D EEE L+L +ERIEW +      +F+RLRR
Sbjct  148  YEDGEEESLDLGKERIEWVVGEKSGARFKRLRR  180



>ref|XP_010456087.1| PREDICTED: DNA mismatch repair protein MSH6 [Camelina sativa]
Length=1324

 Score =  1349 bits (3492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/1024 (68%), Positives = 805/1024 (79%), Gaps = 26/1024 (3%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVK--VIESVTNNLECVKA  768
             K + RKRK +E           +   G+ K +++   T   G K  V+E  T  +E VK 
Sbjct  270   KTDSRKRKTSE-----------VTKSGSEKKSRTDKDTILKGFKASVVEPPTKIVEAVKV  318

Query  769   SNG--DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGL  942
              NG  D+IL G++  RF  RE EK  FLG  RRDA RRRP D NYD RTLYLP DF+K L
Sbjct  319   VNGLDDNILDGDALARFGARESEKFRFLGVDRRDAKRRRPTDENYDPRTLYLPPDFVKKL  378

Query  943   SGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNF  1122
             +GGQRQWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELD+QYMKGEQPHCGFPEKNF
Sbjct  379   TGGQRQWWEFKSKHMDKVVFFKMGKFYELFEMDAHVGAKELDIQYMKGEQPHCGFPEKNF  438

Query  1123  SMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLT  1299
             S+N EKL RKGYRVLVVEQ ETP+QLE RRK KGSKDKVVKREICAV+TKGTLT+GEML+
Sbjct  439   SVNIEKLVRKGYRVLVVEQTETPDQLEQRRKEKGSKDKVVKREICAVVTKGTLTDGEMLS  498

Query  1300  VSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEF  1479
              +PDASYL+A+TE  ++  +Q  E  +GVC+VDVAT K++LGQF DD DCS+L  LL E 
Sbjct  499   TNPDASYLMALTEGGESLTDQKAEHIFGVCLVDVATKKIMLGQFKDDRDCSALSCLLSEI  558

Query  1480  RPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPI  1659
             RPVEIIKPAK+LS  TER + R TRNPLVN LVPLSEFWDAEKT+ EV   Y R++  P 
Sbjct  559   RPVEIIKPAKVLSTATERTIVRQTRNPLVNNLVPLSEFWDAEKTMHEVGIFYNRISCQPS  618

Query  1660  -PYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDV  1836
               YS  E  L    S         LP +L+EL    +NG+ ALSALGG ++YL+QAFLD 
Sbjct  619   SAYSSEEKILGDGSSF--------LPKMLTELATEDKNGSLALSALGGAIYYLRQAFLDE  670

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             SLL+FA+FE LP+  F  + +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N CVTA
Sbjct  671   SLLRFAKFEYLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQCVTA  730

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
              GKRLL+ WLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+
Sbjct  731   SGKRLLKAWLARPLYNTELIKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFS  790

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             S EA+GRN +KVVLYED AKK +Q+FIS LRGCETM  AC SL A L +  S+ L  LLT
Sbjct  791   SIEASGRNGDKVVLYEDTAKKLVQEFISTLRGCETMAEACSSLRAILKHDKSRRLLTLLT  850

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PG+ LP++   IK FKD FDWVEA++SGR+IP EG DEEYD AC ++ + E SL KHLKE
Sbjct  851   PGQSLPNISSSIKYFKDAFDWVEAHNSGRVIPHEGADEEYDCACKAVEEFEFSLKKHLKE  910

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GD SINYVTVGKD YLLEVPESL   VP +YEL SSKKG FRYW P I+KL+ EL
Sbjct  911   QRKLLGDASINYVTVGKDEYLLEVPESLSGSVPNDYELCSSKKGVFRYWTPTIKKLLKEL  970

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPH  2916
             SQA +E+ES LKSI QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD YEG  CRP 
Sbjct  971   SQANSEKESALKSISQRLIGRFCEHQEKWRQLVSATAELDVLISLAFASDSYEGVRCRPV  1030

Query  2917  IRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKS  3096
             +    S D+VP L A  LGHP+LR DSL +G+FV N+V +GGA  +SFILLTGPNMGGKS
Sbjct  1031  VSGSRS-DDVPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGAEKASFILLTGPNMGGKS  1089

Query  3097  TLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASML  3276
             TLLRQVCLAVILAQ+GADVPA +F++SPVDRI VRMGAKDHIMAGQSTFLTEL ETA ML
Sbjct  1090  TLLRQVCLAVILAQIGADVPAETFEVSPVDRICVRMGAKDHIMAGQSTFLTELSETAVML  1149

Query  3277  SSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQ  3456
             +SATRNSLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRG+FSTHYHRL++DYQ + +
Sbjct  1150  TSATRNSLVVLDELGRGTATSDGQAIAESVLEHFIDKVQCRGLFSTHYHRLSVDYQTNPK  1209

Query  3457  VSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             VSLCHMAC +GEG+GG+EEVTFLY+LT G CP+SYGVNVARLAGLPD VL++A  KS+EF
Sbjct  1210  VSLCHMACQVGEGIGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDYVLQRAVIKSQEF  1269

Query  3637  EGVY  3648
             E +Y
Sbjct  1270  EALY  1273


 Score =   107 bits (267),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +1

Query  109  LGSKSNKPLLVIGPSPTP-DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKH  285
            + SK  KPLLVIG +P+P  STE +YG EV+ ++++V+WPLDK WY+G V  +DK  GKH
Sbjct  91   IQSKFKKPLLVIGQTPSPPQSTEITYGDEVVGKQVRVFWPLDKRWYDGSVTFYDKGEGKH  150

Query  286  LVQYDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            +V+Y+D EEE L+L +E+IEW +      +F+RLRR
Sbjct  151  VVEYEDGEEESLDLRKEKIEWVVGAKSGDRFKRLRR  186



>ref|XP_006396405.1| hypothetical protein EUTSA_v10028364mg [Eutrema salsugineum]
 gb|ESQ37858.1| hypothetical protein EUTSA_v10028364mg [Eutrema salsugineum]
Length=1336

 Score =  1347 bits (3485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/999 (68%), Positives = 798/999 (80%), Gaps = 5/999 (1%)
 Frame = +1

Query  664   KSGGNNKSTQSKAPTATG-GVKVIESVTNNLECVKASNG--DDILTGNSAERFSMREMEK  834
             KSG   KS   K  T  G    V+E      +  K  NG  D+IL G++  RF  RE EK
Sbjct  290   KSGSEKKSRIDKDTTLKGFKASVVEPANKIEQADKVVNGLDDNILDGDALARFGARESEK  349

Query  835   LGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMG  1014
               FLG  RRDA RRRP D NYD RTLYLP DF+K L+GGQRQWWEFKSKHMDKV+FFKMG
Sbjct  350   FRFLGVDRRDAKRRRPTDENYDPRTLYLPPDFVKKLTGGQRQWWEFKSKHMDKVVFFKMG  409

Query  1015  KFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPE  1194
             KFYELFEMDAH+GAKELDLQYM+GEQPHCGFPEKNFS+N EKL +KGYRVLVVEQ ETP+
Sbjct  410   KFYELFEMDAHVGAKELDLQYMRGEQPHCGFPEKNFSVNIEKLVKKGYRVLVVEQTETPD  469

Query  1195  QLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGE  1371
             QLE RRK KGSKDKVVKREICAV+T+GTLT+GEML  +PDASYL+A+TE  ++  +Q  E
Sbjct  470   QLERRRKEKGSKDKVVKREICAVVTRGTLTDGEMLLTNPDASYLMALTEGGESLTDQRAE  529

Query  1372  RTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHT  1551
               +GVC+VDVAT K+ILGQF DD DCS+L  +L E RPVEIIKPA +LS  TER + RHT
Sbjct  530   HNFGVCLVDVATKKIILGQFKDDQDCSALSCMLSEIRPVEIIKPANVLSSATERTIVRHT  589

Query  1552  RNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNL  1731
             RNPL+N LVPLSEFWDAEKTI EV+  Y+R++  P      E  +    S  N++    L
Sbjct  590   RNPLINNLVPLSEFWDAEKTIHEVEIFYKRISCQPSSAHAGEGKILGDGSFCNESGSSFL  649

Query  1732  PNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYM  1911
             P +LSEL    +NG+ ALSALGG ++YL++AFLD SLL+FA+FE LP   F    +K +M
Sbjct  650   PKMLSELATGDKNGSLALSALGGAIYYLREAFLDESLLRFAKFESLPCCDFNNFTEKQHM  709

Query  1912  VLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQD  2091
             VLDAAALENLEIFENS+N G SGTLYAQ+N CVTA GKRLL+TWLARPLY+ E IKERQD
Sbjct  710   VLDAAALENLEIFENSRNGGFSGTLYAQLNQCVTASGKRLLKTWLARPLYNPELIKERQD  769

Query  2092  AVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQ  2271
             AVA L+G NLP  LEFRK LSRLPDMERL+A+I++S+EA+GRN +KVVLYED AKKQLQ+
Sbjct  770   AVAILRGENLPYSLEFRKALSRLPDMERLIARIYSSTEASGRNGDKVVLYEDVAKKQLQE  829

Query  2272  FISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEAN  2451
             FIS LRGCETMV AC SL   L +  S+ L  LLTPG+ LP+    IK FKD FDWVEA+
Sbjct  830   FISTLRGCETMVEACSSLRVILKHDKSRRLLHLLTPGQSLPNTSSSIKYFKDAFDWVEAH  889

Query  2452  SSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVP  2631
             +SGR++P +G DEEYD  C +++++E +L KHLKEQ+KL GD SINYVTVGKD YLLEVP
Sbjct  890   NSGRVVPHQGADEEYDFTCKTVKELESNLTKHLKEQRKLLGDASINYVTVGKDEYLLEVP  949

Query  2632  ESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEH  2811
             ESL   VPQ+YEL SSKKG FRYW P I+KL+ ELSQA++++ES LK+I QRLIGRFC+H
Sbjct  950   ESLSGSVPQDYELCSSKKGVFRYWTPTIKKLLKELSQAKSDKESALKTISQRLIGRFCKH  1009

Query  2812  HSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRT  2991
                WR+L+S  AELDVLISL+ ASD YEG  CRP I    S D+VP L A  LGHP+LR 
Sbjct  1010  QEEWRQLVSVTAELDVLISLAFASDSYEGVRCRPVISGSTS-DDVPHLSATGLGHPVLRG  1068

Query  2992  DSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFD  3171
             DSL +G+FV N+V  GG+  +SFILLTGPNMGGKSTLLRQVCLAVILAQ+GADVPA +F+
Sbjct  1069  DSLGRGSFVPNNVKTGGSKQASFILLTGPNMGGKSTLLRQVCLAVILAQIGADVPAETFE  1128

Query  3172  LSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQA  3351
             LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLSSATRNSLV LDELGRGT+TSDGQA
Sbjct  1129  LSPVDRIFVRMGAKDHIMAGQSTFLTELSETAVMLSSATRNSLVVLDELGRGTATSDGQA  1188

Query  3352  IAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYK  3531
             IAESVLEHF++KVQCRGMFSTHYHRL++DYQ + +VSLCHMAC +GEG+GG+EEVTFLY+
Sbjct  1189  IAESVLEHFINKVQCRGMFSTHYHRLSMDYQTNPKVSLCHMACQVGEGIGGVEEVTFLYR  1248

Query  3532  LTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             LT G CP+SYGVNVARLAGLPD VLE+A  KS+EFE +Y
Sbjct  1249  LTPGACPKSYGVNVARLAGLPDYVLERAVIKSQEFEALY  1287


 Score =   108 bits (269),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTP-DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  S  ++YG EV+ ++++VYWPLDK WY+G V S++K  GKH+V
Sbjct  97   SKLKKPLLVIGQTPSPPKSAGNTYGDEVVGKQVRVYWPLDKKWYDGIVTSYNKGEGKHVV  156

Query  292  QYDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            +YDD EEE L+L +E+IEW  E     +F+RLRR
Sbjct  157  EYDDGEEESLDLGKEKIEWRAEEKSGLRFKRLRR  190



>ref|XP_009134448.1| PREDICTED: DNA mismatch repair protein MSH6 [Brassica rapa]
Length=1337

 Score =  1345 bits (3481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/1023 (67%), Positives = 806/1023 (79%), Gaps = 16/1023 (2%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVK--VIESVTNNLECVKA  768
             K + RKRK          K  ++   G  K  ++   T   G K  V+E V    E  K 
Sbjct  276   KTDSRKRK----------KTSEVAKPGVEKKIKTDKVTTFKGFKASVVEPVKKIGEADKV  325

Query  769   --SNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGL  942
               S  D++L G++  RF  RE EK  F+G  RRDA RRRP D NYD RTLYLP DF+K L
Sbjct  326   VKSLDDNMLDGDALARFGARESEKFRFMGIDRRDAKRRRPTDENYDPRTLYLPPDFVKRL  385

Query  943   SGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNF  1122
             +GGQRQWWEFKSKHMDKVLFFKMGKFYEL+EMDAH+GAKELDL+YMKGEQPHCGFPEKNF
Sbjct  386   TGGQRQWWEFKSKHMDKVLFFKMGKFYELYEMDAHVGAKELDLRYMKGEQPHCGFPEKNF  445

Query  1123  SMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLT  1299
             S+N EKL +KGYRVLVVEQ ETP+QLE RRK KGSKDKVVKREICAV+T+GTLT+GEM+ 
Sbjct  446   SVNIEKLVQKGYRVLVVEQTETPDQLERRRKEKGSKDKVVKREICAVVTRGTLTDGEMVL  505

Query  1300  VSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEF  1479
              +PDASYL+A+TE  ++  ++  E  +GVC+VDVAT K+ILGQF DD DCS+L  +L E 
Sbjct  506   TNPDASYLMALTEGGESLTDEKAEHNFGVCLVDVATKKIILGQFKDDQDCSALSCVLSEI  565

Query  1480  RPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPI  1659
             RPVE+IKPA  LS  TER + RHTRNPLVN LVPLSEFWDAEKTI E+  +Y+  +  P 
Sbjct  566   RPVEVIKPANALSSATERTIVRHTRNPLVNNLVPLSEFWDAEKTIHEIGILYKGFSCQPS  625

Query  1660  PYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVS  1839
                  E  +     ++N++    LP +LSEL N  ++G+ ALSALGG ++YL+QAFLD S
Sbjct  626   SAYSGEGKVLGDPPLNNESGSSCLPKMLSELANGDKDGSLALSALGGAIYYLRQAFLDES  685

Query  1840  LLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAF  2019
             LL+FA+FE LP+  F     K +MVLDAAALENLEIFENS+N G SGTLYAQ+N C+TA 
Sbjct  686   LLRFAKFESLPYCDFSNFTVKQHMVLDAAALENLEIFENSRNGGVSGTLYAQLNQCITAS  745

Query  2020  GKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFAS  2199
             GKRLL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+S
Sbjct  746   GKRLLKTWLARPLYNPELIKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFSS  805

Query  2200  SEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTP  2379
              EA+GRN +KVVLYED AKKQLQ+FIS LRGCETMV AC SL A+L++ +S+ L  LLTP
Sbjct  806   IEASGRNGDKVVLYEDVAKKQLQEFISTLRGCETMVEACSSLRASLEHDNSRRLRHLLTP  865

Query  2380  GKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQ  2559
             G+ LP++   IK FKD FDWVEA+ SGR++P EG DEEYD  C +++++E+SL KHLKEQ
Sbjct  866   GQSLPNISPFIKYFKDAFDWVEAHDSGRVVPHEGADEEYDFTCKTVKELEVSLTKHLKEQ  925

Query  2560  QKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELS  2739
             +KL GD SI YVTVGKD YLLEVPESL   +PQ+YEL SSKKG FRYW P I+KL+ EL+
Sbjct  926   RKLLGDASIKYVTVGKDEYLLEVPESLSGSIPQDYELCSSKKGVFRYWTPTIKKLLKELA  985

Query  2740  QAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHI  2919
             QA++E+ES LKSI QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD YEG  CRP I
Sbjct  986   QAKSEKESALKSISQRLIGRFCEHQEEWRQLVSATAELDVLISLAFASDSYEGVRCRPVI  1045

Query  2920  RELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKST  3099
                 S D VP L A  LGHP+LR DSL +G+FV NDV +GGA  +SFILLTGPNMGGKST
Sbjct  1046  SSSKSVD-VPHLSATGLGHPVLRGDSLGRGSFVPNDVKIGGAKQASFILLTGPNMGGKST  1104

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             LLRQVCLAVIL+Q+GADVPA +F+L PVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLS
Sbjct  1105  LLRQVCLAVILSQIGADVPAETFELLPVDRIFVRMGAKDHIMAGQSTFLTELSETAVMLS  1164

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
             SATRNSLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRGMFSTHYHRL++DYQ + QV
Sbjct  1165  SATRNSLVVLDELGRGTATSDGQAIAESVLEHFIDKVQCRGMFSTHYHRLSMDYQTNPQV  1224

Query  3460  SLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             SLCHM C +GEG GG+EEVTFLY+LT G CP+SYGVNVARLAGLPD+VL++A  KS+EFE
Sbjct  1225  SLCHMGCQVGEGSGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDDVLQRAVIKSQEFE  1284

Query  3640  GVY  3648
             G+Y
Sbjct  1285  GLY  1287


 Score =   112 bits (280),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +1

Query  118  KSNKPLLVIGPSPTPDS-TESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQ  294
            K  KPLLVIG +P+P   TE++YG EV+ +++++YWPLDK WY+G V S++K  GKH+V+
Sbjct  104  KLKKPLLVIGQTPSPPKFTETTYGDEVVGKQVRIYWPLDKKWYDGSVTSYNKGEGKHVVE  163

Query  295  YDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            Y+D EEE L+L +E+IEW +E   V +F+RLRR
Sbjct  164  YEDGEEESLDLGKEKIEWVVEGDSVNRFKRLRR  196



>emb|CDX90956.1| BnaA03g26360D [Brassica napus]
Length=1337

 Score =  1345 bits (3480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/1022 (67%), Positives = 805/1022 (79%), Gaps = 14/1022 (1%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATG-GVKVIESVTNNLECVKA-  768
             K + RKRK T         ++  K GG  K    K  T  G    V+E V    E  K  
Sbjct  276   KTDSRKRKKT---------SEVAKPGGEKKIKTDKVTTFKGFKASVVEPVKKIGEADKVV  326

Query  769   -SNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLS  945
              S  D++L G++  RF  RE EK  F+G  RRDA RRRP D NYD RTLYLP DF+K L+
Sbjct  327   KSLDDNMLDGDALARFGARESEKFRFMGIDRRDAKRRRPTDENYDPRTLYLPPDFVKRLT  386

Query  946   GGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS  1125
             GGQRQWWEFKSKHMDKVLFFKMGKFYEL+EMDAH+GAKELDL+YMKGEQPHCGFPEKNFS
Sbjct  387   GGQRQWWEFKSKHMDKVLFFKMGKFYELYEMDAHVGAKELDLRYMKGEQPHCGFPEKNFS  446

Query  1126  MNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTV  1302
             +N EKL +KGYRVLVVEQ ETP+QLE RRK KGSKDKVVKREICAV+T+GTLT+GEM+  
Sbjct  447   VNIEKLVQKGYRVLVVEQTETPDQLERRRKEKGSKDKVVKREICAVVTRGTLTDGEMVLT  506

Query  1303  SPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             +P+ASYL+A+TE  ++  ++  E  +GVC+VDVAT K+I+GQF DD DCS+L  +L E R
Sbjct  507   NPEASYLMALTEGGESLTDEKAEHNFGVCLVDVATKKIIIGQFKDDQDCSALSCVLSEIR  566

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             PVE+IKPA  LS  TER + RHTRNPLVN LVPLSEFWDAEKTI E+  +Y+  +  P  
Sbjct  567   PVEVIKPANALSSATERTIVRHTRNPLVNNLVPLSEFWDAEKTIHEIGILYKGFSCQPSS  626

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                 E  +     + N++    LP +LSEL N  ++G+ ALSALGG ++YL+QAFLD SL
Sbjct  627   AYSGEGKVLGDPPLSNESGSSCLPKMLSELANGDKDGSLALSALGGAIYYLRQAFLDESL  686

Query  1843  LKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFG  2022
             L+FA+FE LP+  F     K +MVLDAAALENLEIFENS+N G SGTLYAQ+N C+TA G
Sbjct  687   LRFAKFESLPYCDFSNFTVKQHMVLDAAALENLEIFENSRNGGVSGTLYAQLNQCITASG  746

Query  2023  KRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS  2202
             KRLL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+S 
Sbjct  747   KRLLKTWLARPLYNPELIKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFSSI  806

Query  2203  EANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPG  2382
             EA+GRN +KVVLYED AKKQLQ+FIS LRGCETMV AC SL A+L++ +S+ L  LLTPG
Sbjct  807   EASGRNGDKVVLYEDVAKKQLQEFISTLRGCETMVEACSSLRASLEHDNSRRLRHLLTPG  866

Query  2383  KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQ  2562
             + LP++   IK FKD FDWVEA+ SGR++P EG DEEYD  C +++++E SL KHLKEQ+
Sbjct  867   QSLPNISPFIKYFKDAFDWVEAHDSGRVVPHEGADEEYDFTCKTVKELEGSLTKHLKEQR  926

Query  2563  KLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQ  2742
             KL GD SI YVTVGKD YLLEVPESL   +PQ+YEL SSKKG FRYW P I+KL+ EL+Q
Sbjct  927   KLLGDASIKYVTVGKDEYLLEVPESLSGSIPQDYELCSSKKGVFRYWTPTIKKLLKELAQ  986

Query  2743  AETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIR  2922
             A++E+ES LKSI QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD YEG  CRP I 
Sbjct  987   AKSEKESALKSISQRLIGRFCEHQEEWRQLVSATAELDVLISLAFASDSYEGVRCRPVIS  1046

Query  2923  ELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTL  3102
                S D VP L A  LGHP+LR DSL +G+FV NDV +GGA  +SFILLTGPNMGGKSTL
Sbjct  1047  SSKSVD-VPHLSAHGLGHPVLRGDSLGRGSFVPNDVKIGGAKQASFILLTGPNMGGKSTL  1105

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             LRQVCLAVIL+Q+GADVPA +F+LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLSS
Sbjct  1106  LRQVCLAVILSQIGADVPAETFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETAVMLSS  1165

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             ATRNSLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRGMFSTHYHRL++DYQ + QVS
Sbjct  1166  ATRNSLVVLDELGRGTATSDGQAIAESVLEHFIDKVQCRGMFSTHYHRLSMDYQTNPQVS  1225

Query  3463  LCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEG  3642
             LCHM C +GEG GG+EEVTFLY+LT G CP+SYGVNVARLAGLPD+VL++A  KS+EFEG
Sbjct  1226  LCHMGCQVGEGSGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDDVLQRAVIKSQEFEG  1285

Query  3643  VY  3648
             +Y
Sbjct  1286  LY  1287


 Score =   112 bits (279),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +1

Query  118  KSNKPLLVIGPSPTPDS-TESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQ  294
            K  KPLLVIG +P+P   TE++YG EV+ +++++YWPLDK WY+G V S++K  GKH+V+
Sbjct  104  KLKKPLLVIGQTPSPPKFTETTYGDEVVGKQVRIYWPLDKKWYDGSVTSYNKGEGKHVVE  163

Query  295  YDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            Y+D EEE L+L +E+IEW +E   V +F+RLRR
Sbjct  164  YEDGEEESLDLGKEKIEWVVEGDSVNRFKRLRR  196



>ref|XP_008800758.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X1 [Phoenix 
dactylifera]
Length=1292

 Score =  1343 bits (3477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1019 (67%), Positives = 814/1019 (80%), Gaps = 7/1019 (1%)
 Frame = +1

Query  601   ELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASNGD  780
             E RKRK  E  KL   K  +    G+ + + SKA  +      + S++N          D
Sbjct  217   EYRKRKKIEVAKLDCAKKVRFDGDGDGEKSASKASLSGIRTSTVGSLSNFERGQVLHTLD  276

Query  781   DILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQ  960
               LTG +AERF  RE E+  FLG+GR+DA  R PGD +YD +TLYLP +FL+ LSGGQRQ
Sbjct  277   SSLTGEAAERFGKREAERFRFLGEGRKDAHGRWPGDADYDPKTLYLPPEFLRSLSGGQRQ  336

Query  961   WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEK  1140
             WWEFKSKHMDKVLFFKMGKFYELFEMDAHIG +ELDLQYMKGEQPHCGFPEKNF+MN EK
Sbjct  337   WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGVRELDLQYMKGEQPHCGFPEKNFAMNLEK  396

Query  1141  LARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPDAS  1317
             LARKGYRVLVVEQ ETPEQLELRRK+ GSKDKVVKREICA++TKGTLT+GE L  +PD S
Sbjct  397   LARKGYRVLVVEQTETPEQLELRRKEMGSKDKVVKREICAMVTKGTLTDGESLLANPDTS  456

Query  1318  YLIAVTESCQTSAN-QLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEI  1494
             YL+++TE+CQ   N + GE   G+CVVDV+TSK ++GQF DDSD   LCS+L E RPVEI
Sbjct  457   YLMSITENCQCFENHKKGETIIGLCVVDVSTSKFMIGQFEDDSDRHCLCSILSELRPVEI  516

Query  1495  IKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQN  1674
             IKP+K+LS ETERVL  +TRNPLVN+LVP +EFWDAEK I EV+  Y    +  +P S N
Sbjct  517   IKPSKVLSPETERVLRNNTRNPLVNDLVPFTEFWDAEKAIGEVRKYYSL--SRKLPASAN  574

Query  1675  EADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFA  1854
             ++     E+  +D+    LP V +ELV+AG++G YALSA GG LFYL+QAFLD +LL  A
Sbjct  575   DSISANFENPASDSLA--LPYVFAELVSAGDDGLYALSAFGGCLFYLRQAFLDETLLNCA  632

Query  1855  EFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLL  2034
             +FE LP S F    Q  YM+LDAAALENLEI EN++N G SGTL+AQ++HC+TAFGKRLL
Sbjct  633   KFEPLPCSGFFSTIQNSYMILDAAALENLEILENNRNGGPSGTLFAQLDHCMTAFGKRLL  692

Query  2035  RTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANG  2214
             + WLARPLY+  +I ERQDA+A +KGV L  VLEFRKELSRLPDMERLLA++FAS  ANG
Sbjct  693   KRWLARPLYNTRSIVERQDAIAAMKGVGLAFVLEFRKELSRLPDMERLLARLFASCGANG  752

Query  2215  RNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLP  2394
             RN+N VVLYEDAAKKQL++FI+ALRGC+ MV AC SL   L  T+S LLH LLTPGKGLP
Sbjct  753   RNSNGVVLYEDAAKKQLREFIAALRGCQLMVQACSSLSPILSTTESSLLHHLLTPGKGLP  812

Query  2395  DVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFG  2574
             D+  ++  FKD FDW EA+ SGRIIP EG D EYD AC  ++++E +L ++LKEQ+KL G
Sbjct  813   DMCSLVSHFKDAFDWSEADCSGRIIPHEGGDVEYDLACKRVKEIESALTRYLKEQRKLLG  872

Query  2575  DTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
             D SINYVTVGKD YLLEVPESL   VP +YELQSSKKGYFRYW P I++ + E SQAE +
Sbjct  873   DASINYVTVGKDMYLLEVPESLRGAVPSDYELQSSKKGYFRYWTPKIKEFLSEHSQAEAD  932

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIREL-P  2931
             +ESKLK ILQRLI  F EHHS WR+L+S  AELDVLISL+IASDYYEGP CRP I E+  
Sbjct  933   KESKLKGILQRLIKYFSEHHSKWRQLVSATAELDVLISLAIASDYYEGPACRPFIMEICH  992

Query  2932  SQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQ  3111
             S D +P L AKSLGHPIL++D+L KG+FV NDV++GGAG ++FILLTGPNMGGKSTLLRQ
Sbjct  993   SDDKLPFLSAKSLGHPILQSDALGKGSFVPNDVSIGGAGRANFILLTGPNMGGKSTLLRQ  1052

Query  3112  VCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATR  3291
             VCL+VILAQ+GADVPA SF LSPVDRIFVRMGA+DHI+AGQSTFL EL ETASMLSSAT+
Sbjct  1053  VCLSVILAQIGADVPAESFKLSPVDRIFVRMGARDHIIAGQSTFLMELSETASMLSSATQ  1112

Query  3292  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCH  3471
             NSLVALDELGRGTSTSDGQAIA SVLE+ VH++QCRG+FSTHYHRLA++Y++D +VSLCH
Sbjct  1113  NSLVALDELGRGTSTSDGQAIAASVLEYLVHRIQCRGLFSTHYHRLAVEYEKDAKVSLCH  1172

Query  3472  MACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             MAC +G+G+ GLEEVTFLY+LT G+CP+SYGVNVARLAG+P +VL+ A AKS EFE  Y
Sbjct  1173  MACQVGKGVSGLEEVTFLYRLTPGSCPKSYGVNVARLAGIPASVLQTAMAKSSEFEAGY  1231


 Score =   107 bits (268),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 62/85 (73%), Gaps = 6/85 (7%)
 Frame = +1

Query  118  KSNKPLLVIGPSPT------PDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISG  279
            K NKPLLVI PSP       P + E +  ++V+ RRI+V+WPLDK W+EG VKSFD+ S 
Sbjct  61   KKNKPLLVIPPSPASNPRTPPTARERACSEDVVGRRIRVFWPLDKAWHEGSVKSFDEASR  120

Query  280  KHLVQYDDEEEEMLNLSQERIEWIE  354
            KHLV+YDD EEE LNL +E+ EW+E
Sbjct  121  KHLVEYDDAEEESLNLGKEKFEWVE  145



>ref|XP_010429135.1| PREDICTED: DNA mismatch repair protein MSH6-like [Camelina sativa]
Length=1325

 Score =  1340 bits (3469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/1006 (68%), Positives = 798/1006 (79%), Gaps = 15/1006 (1%)
 Frame = +1

Query  649   KAKKIKSGGNNKSTQSKAPTATGGVK--VIESVTNNLECVKASNG--DDILTGNSAERFS  816
             K+ ++   G+ K +++   T   G K  V+E     +E  K   G  D+IL G++  RF 
Sbjct  280   KSSEVTKSGSEKKSRTDKDTILKGFKASVVEPPKKIVEADKVVKGLDDNILDGDALARFG  339

Query  817   MREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKV  996
              RE EK  FLG  RRDA RRRP D NYD RTLYLP DF+K L+GGQRQWWEFKSKHMDKV
Sbjct  340   ARESEKFRFLGVDRRDAKRRRPTDENYDPRTLYLPPDFVKKLTGGQRQWWEFKSKHMDKV  399

Query  997   LFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVE  1176
             +FFKMGKFYELFEMDAH+GAKELD+QYMKGEQPHCGFPEKNFS+N EKL RKGYRVLVVE
Sbjct  400   VFFKMGKFYELFEMDAHVGAKELDIQYMKGEQPHCGFPEKNFSVNIEKLVRKGYRVLVVE  459

Query  1177  QIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTS  1353
             Q ETP+QL+ RRK KGSKDKVVKREICAV+TKGTLT+GEML+ +PDASYL+A+TE  ++ 
Sbjct  460   QTETPDQLDQRRKEKGSKDKVVKREICAVVTKGTLTDGEMLSTNPDASYLMALTEGGESL  519

Query  1354  ANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETER  1533
              +Q  +  +GVC+VDVAT K++LGQF DD DCS+L  LL E RPVEIIKPAK+LS  TER
Sbjct  520   NDQKADHNFGVCLVDVATKKIMLGQFKDDQDCSALSCLLSEIRPVEIIKPAKVLSSATER  579

Query  1534  VLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPI-PYSQNEADLHPSESIDN  1710
              + R TRNPLVN LVPLSEFWDAEKT+ EV   Y+R++  P   YS  E  L    S   
Sbjct  580   TIVRQTRNPLVNNLVPLSEFWDAEKTMHEVGIFYKRISCQPSSAYSSEEKILGDGSSF--  637

Query  1711  DAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGM  1890
                   LP +L+EL    +NG+ ALSALGG ++YL+QAFLD SLL+FA+FE LP+  F  
Sbjct  638   ------LPKMLTELATEDKNGSLALSALGGAIYYLRQAFLDESLLRFAKFESLPYCDFSN  691

Query  1891  IAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLE  2070
             + +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N CVTA GKRLL+ WLARPLY+ E
Sbjct  692   VYEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQCVTASGKRLLKAWLARPLYNTE  751

Query  2071  AIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDA  2250
              IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+S EA+GRN +KVVLYED 
Sbjct  752   MIKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFSSIEASGRNGDKVVLYEDT  811

Query  2251  AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDG  2430
             AKK +Q+FIS LRGCETM  AC SL A L +  S+ L  LLTPG+ LP++   IK FKD 
Sbjct  812   AKKLVQEFISTLRGCETMAEACSSLRAILKHDKSRRLLTLLTPGQSLPNISSSIKYFKDA  871

Query  2431  FDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKD  2610
             FDWVEA++SGR+IP EG DEEYD AC ++ + E SL KHLKEQ+KL GD SINYVTVGKD
Sbjct  872   FDWVEAHNSGRVIPHEGADEEYDCACKTVEEFESSLKKHLKEQRKLLGDASINYVTVGKD  931

Query  2611  AYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRL  2790
              YLLEVPE L   VP +YEL SSKKG FRYW P I+KL+ ELSQA +E+ES LKSI QRL
Sbjct  932   EYLLEVPEILSGSVPNDYELCSSKKGVFRYWTPTIKKLLKELSQANSEKESALKSISQRL  991

Query  2791  IGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSL  2970
             IGRFCEH   WR+L+ST AELDVLISL+ ASD YEG  CRP +    S D+VP L A  L
Sbjct  992   IGRFCEHQEKWRQLVSTTAELDVLISLAFASDSYEGVRCRPVVSGSTS-DDVPHLSATGL  1050

Query  2971  GHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGAD  3150
             GHP+LR DSL +G+FV N+V +GGA  +SFILLTGPNMGGKSTLLRQVCLAVILAQ+GAD
Sbjct  1051  GHPVLRGDSLGRGSFVPNNVKIGGAEKASFILLTGPNMGGKSTLLRQVCLAVILAQIGAD  1110

Query  3151  VPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGT  3330
             VPA +F++SPVDRI VRMGAKDHIMAGQSTFLTEL ETA ML+SATRNSLV LDELGRGT
Sbjct  1111  VPAETFEVSPVDRICVRMGAKDHIMAGQSTFLTELSETAVMLTSATRNSLVVLDELGRGT  1170

Query  3331  STSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLE  3510
             +TSDGQAIAESVLEHF+ KVQCRG+FSTHYHRL++DYQ + +VSLCHMAC +GEG GG+E
Sbjct  1171  ATSDGQAIAESVLEHFIDKVQCRGLFSTHYHRLSVDYQTNPKVSLCHMACQVGEGSGGVE  1230

Query  3511  EVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             EVTFLY+LT G CP+SYGVNVARLAGLPDNVL++A  KS+EFE +Y
Sbjct  1231  EVTFLYRLTPGACPKSYGVNVARLAGLPDNVLQRAVIKSKEFEALY  1276


 Score =   106 bits (264),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTP-DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  S E +YG EV+ ++++V+WPLDK WY+G V  +DK  GKH+V
Sbjct  93   SKFKKPLLVIGQTPSPPQSAEITYGDEVVGKQVRVFWPLDKKWYDGSVTFYDKGEGKHVV  152

Query  292  QYDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            +Y+D EEE L+L +E+IEW +   +  +F+RLRR
Sbjct  153  EYEDGEEESLDLRKEKIEWVVGEKLGDRFKRLRR  186



>ref|XP_010422644.1| PREDICTED: DNA mismatch repair protein MSH6-like isoform X2 [Camelina 
sativa]
Length=1322

 Score =  1338 bits (3463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1006 (68%), Positives = 797/1006 (79%), Gaps = 14/1006 (1%)
 Frame = +1

Query  649   KAKKIKSGGNNKSTQSKAPTATGGVK--VIESVTNNLECVKASNG--DDILTGNSAERFS  816
             KA ++   G+ K +++   T   G K  V+E     +E  K   G  D IL G++  RF 
Sbjct  275   KASEVTKSGSEKKSRTDKDTILKGFKASVVEPPKKIVEADKVVKGLDDTILDGDALARFG  334

Query  817   MREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKV  996
              RE EK  FLG  RRDA RRRP D NYD RTLYLP DF+K L+GGQRQWWEFKSKHMDKV
Sbjct  335   ARESEKFRFLGVDRRDAKRRRPTDENYDPRTLYLPPDFVKKLTGGQRQWWEFKSKHMDKV  394

Query  997   LFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVE  1176
             +FFKMGKFYELFEMDAH+GAKELD+QYMKGEQPHCGFPEKNFS+N EKL RKGYRVLVVE
Sbjct  395   VFFKMGKFYELFEMDAHVGAKELDIQYMKGEQPHCGFPEKNFSVNIEKLVRKGYRVLVVE  454

Query  1177  QIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTS  1353
             Q ETP+QLE RRK KGSKDKVVKREICAV+TKGTLT+GEML+ +PDASYL+A+TE  ++ 
Sbjct  455   QTETPDQLEQRRKEKGSKDKVVKREICAVVTKGTLTDGEMLSTNPDASYLMALTEGGESL  514

Query  1354  ANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETER  1533
              +Q  E  +GVC+VDVAT K++LGQF DD DCS+L  LL E RPVEIIKPAK+LS  TER
Sbjct  515   TDQKAEHIFGVCLVDVATKKIMLGQFKDDQDCSALSCLLSEIRPVEIIKPAKVLSTATER  574

Query  1534  VLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDND  1713
              + R TRNPLVN LVPLSEFWDAEKT+ EV   Y+R++  P     NE      E I  D
Sbjct  575   TIVRQTRNPLVNNLVPLSEFWDAEKTMHEVGIFYKRISCQPSSAYSNE------EKILGD  628

Query  1714  AQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMI  1893
                  LP +L+EL    +NG+ ALSALGG ++YL+QAFLD SLL+FA+FE LP+  F  +
Sbjct  629   GS-SFLPKMLTELATEDKNGSLALSALGGAIYYLRQAFLDESLLRFAKFEYLPYCDFSNV  687

Query  1894  AQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEA  2073
              +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N CVTA GKRLL+TWLARPLY+ E 
Sbjct  688   NEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQCVTASGKRLLKTWLARPLYNPEM  747

Query  2074  IKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAA  2253
             IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+S EA+GRN +KVVLYED A
Sbjct  748   IKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFSSIEASGRNGDKVVLYEDTA  807

Query  2254  KKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLV-IKQFKDG  2430
             KK +Q+FIS LRGCETM  AC SL A L +  S+ L  LLTPG+ LP++    IK FKD 
Sbjct  808   KKLVQEFISTLRGCETMAEACSSLRAILKHDKSRRLLTLLTPGQSLPNISSSSIKYFKDA  867

Query  2431  FDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKD  2610
             FDWVEA++SGR+IP EG DEEYD AC ++ + E SL KHLKEQ+KL GD SINYVTVGKD
Sbjct  868   FDWVEAHNSGRVIPHEGADEEYDCACKAVEEFESSLKKHLKEQRKLLGDASINYVTVGKD  927

Query  2611  AYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRL  2790
              YLLEVPESL   VP +YEL SSKKG FRYW P I+KL+ ELSQA +E+ES LKSI QRL
Sbjct  928   EYLLEVPESLSGSVPNDYELCSSKKGVFRYWTPTIKKLLKELSQANSEKESALKSISQRL  987

Query  2791  IGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSL  2970
             IGRFCEH   WR+L+S  AELDVLISL+ ASD YEG  CRP +    S D VP L A  L
Sbjct  988   IGRFCEHQEKWRQLVSATAELDVLISLAFASDSYEGVRCRPVVSGSTSAD-VPHLSATGL  1046

Query  2971  GHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGAD  3150
             GHP+LR DSL +G+FV N+V +GGA  +SFILLTGPNMGGKSTLLRQVCLAVILAQ+GAD
Sbjct  1047  GHPVLRGDSLGRGSFVPNNVKIGGAEKASFILLTGPNMGGKSTLLRQVCLAVILAQIGAD  1106

Query  3151  VPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGT  3330
             VPA +F++SPVDRI VRMGAKDHIMAGQSTFLTEL ETA ML+SATRNSLV LDELGRGT
Sbjct  1107  VPAETFEVSPVDRICVRMGAKDHIMAGQSTFLTELSETAVMLTSATRNSLVVLDELGRGT  1166

Query  3331  STSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLE  3510
             +TSDGQAIAESVLEHF+ KVQCRG+FSTHYHRL++DYQ + +VSLCHMAC +GEG+GG+E
Sbjct  1167  ATSDGQAIAESVLEHFIDKVQCRGLFSTHYHRLSVDYQTNPKVSLCHMACQVGEGIGGVE  1226

Query  3511  EVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             EVTFLY+LT G CP+SYGVNVARLAGLPD VL++A  KS+EFE +Y
Sbjct  1227  EVTFLYRLTPGACPKSYGVNVARLAGLPDYVLQRAVTKSQEFEALY  1272


 Score =   104 bits (259),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTP-DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  S E +YG EV+ ++++V+WPLDK WY+G V  +DK  GKH+V
Sbjct  93   SKFKKPLLVIGQTPSPPQSAEITYGDEVVGKQVRVFWPLDKKWYDGSVTFYDKGEGKHVV  152

Query  292  QYDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            +Y+D EEE L+L +E+IEW + T    +F+ LRR
Sbjct  153  EYEDGEEESLDLGKEKIEWVVGTKSGDRFKLLRR  186



>ref|XP_010422643.1| PREDICTED: DNA mismatch repair protein MSH6-like isoform X1 [Camelina 
sativa]
Length=1118

 Score =  1338 bits (3462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1006 (68%), Positives = 797/1006 (79%), Gaps = 14/1006 (1%)
 Frame = +1

Query  649   KAKKIKSGGNNKSTQSKAPTATGGVK--VIESVTNNLECVKASNG--DDILTGNSAERFS  816
             KA ++   G+ K +++   T   G K  V+E     +E  K   G  D IL G++  RF 
Sbjct  71    KASEVTKSGSEKKSRTDKDTILKGFKASVVEPPKKIVEADKVVKGLDDTILDGDALARFG  130

Query  817   MREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKV  996
              RE EK  FLG  RRDA RRRP D NYD RTLYLP DF+K L+GGQRQWWEFKSKHMDKV
Sbjct  131   ARESEKFRFLGVDRRDAKRRRPTDENYDPRTLYLPPDFVKKLTGGQRQWWEFKSKHMDKV  190

Query  997   LFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVE  1176
             +FFKMGKFYELFEMDAH+GAKELD+QYMKGEQPHCGFPEKNFS+N EKL RKGYRVLVVE
Sbjct  191   VFFKMGKFYELFEMDAHVGAKELDIQYMKGEQPHCGFPEKNFSVNIEKLVRKGYRVLVVE  250

Query  1177  QIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTS  1353
             Q ETP+QLE RRK KGSKDKVVKREICAV+TKGTLT+GEML+ +PDASYL+A+TE  ++ 
Sbjct  251   QTETPDQLEQRRKEKGSKDKVVKREICAVVTKGTLTDGEMLSTNPDASYLMALTEGGESL  310

Query  1354  ANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETER  1533
              +Q  E  +GVC+VDVAT K++LGQF DD DCS+L  LL E RPVEIIKPAK+LS  TER
Sbjct  311   TDQKAEHIFGVCLVDVATKKIMLGQFKDDQDCSALSCLLSEIRPVEIIKPAKVLSTATER  370

Query  1534  VLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDND  1713
              + R TRNPLVN LVPLSEFWDAEKT+ EV   Y+R++  P     NE      E I  D
Sbjct  371   TIVRQTRNPLVNNLVPLSEFWDAEKTMHEVGIFYKRISCQPSSAYSNE------EKILGD  424

Query  1714  AQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMI  1893
                  LP +L+EL    +NG+ ALSALGG ++YL+QAFLD SLL+FA+FE LP+  F  +
Sbjct  425   GS-SFLPKMLTELATEDKNGSLALSALGGAIYYLRQAFLDESLLRFAKFEYLPYCDFSNV  483

Query  1894  AQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEA  2073
              +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N CVTA GKRLL+TWLARPLY+ E 
Sbjct  484   NEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQCVTASGKRLLKTWLARPLYNPEM  543

Query  2074  IKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAA  2253
             IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+S EA+GRN +KVVLYED A
Sbjct  544   IKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFSSIEASGRNGDKVVLYEDTA  603

Query  2254  KKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLV-IKQFKDG  2430
             KK +Q+FIS LRGCETM  AC SL A L +  S+ L  LLTPG+ LP++    IK FKD 
Sbjct  604   KKLVQEFISTLRGCETMAEACSSLRAILKHDKSRRLLTLLTPGQSLPNISSSSIKYFKDA  663

Query  2431  FDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKD  2610
             FDWVEA++SGR+IP EG DEEYD AC ++ + E SL KHLKEQ+KL GD SINYVTVGKD
Sbjct  664   FDWVEAHNSGRVIPHEGADEEYDCACKAVEEFESSLKKHLKEQRKLLGDASINYVTVGKD  723

Query  2611  AYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRL  2790
              YLLEVPESL   VP +YEL SSKKG FRYW P I+KL+ ELSQA +E+ES LKSI QRL
Sbjct  724   EYLLEVPESLSGSVPNDYELCSSKKGVFRYWTPTIKKLLKELSQANSEKESALKSISQRL  783

Query  2791  IGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSL  2970
             IGRFCEH   WR+L+S  AELDVLISL+ ASD YEG  CRP +    S D VP L A  L
Sbjct  784   IGRFCEHQEKWRQLVSATAELDVLISLAFASDSYEGVRCRPVVSGSTSAD-VPHLSATGL  842

Query  2971  GHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGAD  3150
             GHP+LR DSL +G+FV N+V +GGA  +SFILLTGPNMGGKSTLLRQVCLAVILAQ+GAD
Sbjct  843   GHPVLRGDSLGRGSFVPNNVKIGGAEKASFILLTGPNMGGKSTLLRQVCLAVILAQIGAD  902

Query  3151  VPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGT  3330
             VPA +F++SPVDRI VRMGAKDHIMAGQSTFLTEL ETA ML+SATRNSLV LDELGRGT
Sbjct  903   VPAETFEVSPVDRICVRMGAKDHIMAGQSTFLTELSETAVMLTSATRNSLVVLDELGRGT  962

Query  3331  STSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLE  3510
             +TSDGQAIAESVLEHF+ KVQCRG+FSTHYHRL++DYQ + +VSLCHMAC +GEG+GG+E
Sbjct  963   ATSDGQAIAESVLEHFIDKVQCRGLFSTHYHRLSVDYQTNPKVSLCHMACQVGEGIGGVE  1022

Query  3511  EVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             EVTFLY+LT G CP+SYGVNVARLAGLPD VL++A  KS+EFE +Y
Sbjct  1023  EVTFLYRLTPGACPKSYGVNVARLAGLPDYVLQRAVTKSQEFEALY  1068



>ref|XP_010556698.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X2 [Tarenaya 
hassleriana]
Length=1116

 Score =  1337 bits (3461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/1019 (66%), Positives = 797/1019 (78%), Gaps = 15/1019 (1%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASN  774
             K E RKRK + G +    K   I      K  ++        +  ++ V  +L+      
Sbjct  95    KTESRKRKASGGAEQGCAKKSSITKDTTPKGFKTSISDPAKKIAEVDKVVKSLD------  148

Query  775   GDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQ  954
               + L   + ERF  RE EKL FLG  RRD +RR P D NYD RTLYLP DF+K L+GGQ
Sbjct  149   -SNTLANEAVERFGAREAEKLRFLGAVRRDVNRRLPTDENYDPRTLYLPPDFVKSLTGGQ  207

Query  955   RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNA  1134
             RQWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPEKNFSMN 
Sbjct  208   RQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPEKNFSMNV  267

Query  1135  EKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPD  1311
             EKLA+KGYRVLVVEQ ETPEQLE RRK KGSKDKVVKRE+CAV+TKGTLTEGEM   +PD
Sbjct  268   EKLAKKGYRVLVVEQTETPEQLEQRRKEKGSKDKVVKREVCAVVTKGTLTEGEMFLTNPD  327

Query  1312  ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVE  1491
             ASYL+A+TE    +     ER +GVC++DVAT +++LGQF DD++CS+L  LL E RPVE
Sbjct  328   ASYLMALTEGDNLTKRN-AERNFGVCLIDVATKRIMLGQFKDDAECSALACLLSEMRPVE  386

Query  1492  IIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQ  1671
             IIKPA +LS ETER++ RHTRNPLVN LVP +E W AEKT+ E++  Y+++        Q
Sbjct  387   IIKPANVLSLETERIIMRHTRNPLVNNLVPHTELWGAEKTLHEMRLFYKKIK------FQ  440

Query  1672  NEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKF  1851
               + L   E I  +     LPN+LSEL NA E+   ALSALGGT++YL+QAFLD +LL+F
Sbjct  441   LSSALLDKEKISGECSSSFLPNLLSELANAEEDSNLALSALGGTIYYLRQAFLDETLLRF  500

Query  1852  AEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRL  2031
             A+FE LP   F  I++K +MVLDAAALENLEIFEN++N GSSGTLY Q+N CVTA GKRL
Sbjct  501   AKFESLPCYDFSNISRKQHMVLDAAALENLEIFENNRNGGSSGTLYEQLNQCVTASGKRL  560

Query  2032  LRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEAN  2211
             L+TWLARPLY+ E IKERQDAVA L+G NL   L+FRK LSRLPDMERLLA++FASSEAN
Sbjct  561   LKTWLARPLYNPELIKERQDAVAELRGENLSYSLDFRKTLSRLPDMERLLARVFASSEAN  620

Query  2212  GRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGL  2391
             GRN +KVVLYEDAAK+QLQ FISALRGCE M  AC S G  L+N +SK L  LL+PG+GL
Sbjct  621   GRNGSKVVLYEDAAKQQLQDFISALRGCEAMTEACSSFGVILENVNSKQLRHLLSPGQGL  680

Query  2392  PDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLF  2571
             P +  +IK+FKD FDW+EA+++GR++P EG D+EYD+AC + +++  SL KHLKEQ+ L 
Sbjct  681   PSISSIIKRFKDAFDWLEAHNTGRVVPREGADKEYDSACKTAKEIVSSLTKHLKEQRNLL  740

Query  2572  GDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAET  2751
             GD SINYVTVGK+ YLLEVPE L   VPQ+YEL SSKKG+FRYW P  +KL+ E SQAE+
Sbjct  741   GDVSINYVTVGKEEYLLEVPECLRGRVPQDYELCSSKKGFFRYWTPTTKKLLKERSQAES  800

Query  2752  ERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELP  2931
             E+ES LK+I QRLI +FCEHH  WR+L+S  AELDVLISL+IASD YEG  CRP I    
Sbjct  801   EKESALKNISQRLIAQFCEHHDKWRQLVSATAELDVLISLAIASDSYEGIRCRPVISGFT  860

Query  2932  SQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQ  3111
             S  N P L A  LGHPILR DSL  G+FV N+V +GGAG +SF+LLTGPNMGGKST LRQ
Sbjct  861   SSANAPYLSATGLGHPILRGDSLGGGSFVPNNVKIGGAGQASFVLLTGPNMGGKSTFLRQ  920

Query  3112  VCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATR  3291
             VCLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLSSATR
Sbjct  921   VCLAVILAQIGADVPAESFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETAVMLSSATR  980

Query  3292  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCH  3471
             NSLVALDELGRGT+TSDGQAIAESVLEHFV++VQCRGMFSTHYHRL++D+Q + +VSL H
Sbjct  981   NSLVALDELGRGTATSDGQAIAESVLEHFVNEVQCRGMFSTHYHRLSVDHQTNPKVSLWH  1040

Query  3472  MACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             M C +G G GG+EEVTFLY+L  G CP+SYGVNVARLAGLPD+VL++A  KSREFE +Y
Sbjct  1041  MGCEVGRGEGGVEEVTFLYRLRPGACPKSYGVNVARLAGLPDSVLKRAVEKSREFEALY  1099



>ref|XP_010556697.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X1 [Tarenaya 
hassleriana]
Length=1265

 Score =  1337 bits (3459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/1019 (66%), Positives = 797/1019 (78%), Gaps = 15/1019 (1%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASN  774
             K E RKRK + G +    K   I      K  ++        +  ++ V  +L+      
Sbjct  244   KTESRKRKASGGAEQGCAKKSSITKDTTPKGFKTSISDPAKKIAEVDKVVKSLDS-----  298

Query  775   GDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQ  954
               + L   + ERF  RE EKL FLG  RRD +RR P D NYD RTLYLP DF+K L+GGQ
Sbjct  299   --NTLANEAVERFGAREAEKLRFLGAVRRDVNRRLPTDENYDPRTLYLPPDFVKSLTGGQ  356

Query  955   RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNA  1134
             RQWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPEKNFSMN 
Sbjct  357   RQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPEKNFSMNV  416

Query  1135  EKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPD  1311
             EKLA+KGYRVLVVEQ ETPEQLE RRK KGSKDKVVKRE+CAV+TKGTLTEGEM   +PD
Sbjct  417   EKLAKKGYRVLVVEQTETPEQLEQRRKEKGSKDKVVKREVCAVVTKGTLTEGEMFLTNPD  476

Query  1312  ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVE  1491
             ASYL+A+TE    +     ER +GVC++DVAT +++LGQF DD++CS+L  LL E RPVE
Sbjct  477   ASYLMALTEGDNLTKRN-AERNFGVCLIDVATKRIMLGQFKDDAECSALACLLSEMRPVE  535

Query  1492  IIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQ  1671
             IIKPA +LS ETER++ RHTRNPLVN LVP +E W AEKT+ E++  Y+++        Q
Sbjct  536   IIKPANVLSLETERIIMRHTRNPLVNNLVPHTELWGAEKTLHEMRLFYKKIK------FQ  589

Query  1672  NEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKF  1851
               + L   E I  +     LPN+LSEL NA E+   ALSALGGT++YL+QAFLD +LL+F
Sbjct  590   LSSALLDKEKISGECSSSFLPNLLSELANAEEDSNLALSALGGTIYYLRQAFLDETLLRF  649

Query  1852  AEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRL  2031
             A+FE LP   F  I++K +MVLDAAALENLEIFEN++N GSSGTLY Q+N CVTA GKRL
Sbjct  650   AKFESLPCYDFSNISRKQHMVLDAAALENLEIFENNRNGGSSGTLYEQLNQCVTASGKRL  709

Query  2032  LRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEAN  2211
             L+TWLARPLY+ E IKERQDAVA L+G NL   L+FRK LSRLPDMERLLA++FASSEAN
Sbjct  710   LKTWLARPLYNPELIKERQDAVAELRGENLSYSLDFRKTLSRLPDMERLLARVFASSEAN  769

Query  2212  GRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGL  2391
             GRN +KVVLYEDAAK+QLQ FISALRGCE M  AC S G  L+N +SK L  LL+PG+GL
Sbjct  770   GRNGSKVVLYEDAAKQQLQDFISALRGCEAMTEACSSFGVILENVNSKQLRHLLSPGQGL  829

Query  2392  PDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLF  2571
             P +  +IK+FKD FDW+EA+++GR++P EG D+EYD+AC + +++  SL KHLKEQ+ L 
Sbjct  830   PSISSIIKRFKDAFDWLEAHNTGRVVPREGADKEYDSACKTAKEIVSSLTKHLKEQRNLL  889

Query  2572  GDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAET  2751
             GD SINYVTVGK+ YLLEVPE L   VPQ+YEL SSKKG+FRYW P  +KL+ E SQAE+
Sbjct  890   GDVSINYVTVGKEEYLLEVPECLRGRVPQDYELCSSKKGFFRYWTPTTKKLLKERSQAES  949

Query  2752  ERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELP  2931
             E+ES LK+I QRLI +FCEHH  WR+L+S  AELDVLISL+IASD YEG  CRP I    
Sbjct  950   EKESALKNISQRLIAQFCEHHDKWRQLVSATAELDVLISLAIASDSYEGIRCRPVISGFT  1009

Query  2932  SQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQ  3111
             S  N P L A  LGHPILR DSL  G+FV N+V +GGAG +SF+LLTGPNMGGKST LRQ
Sbjct  1010  SSANAPYLSATGLGHPILRGDSLGGGSFVPNNVKIGGAGQASFVLLTGPNMGGKSTFLRQ  1069

Query  3112  VCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATR  3291
             VCLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLSSATR
Sbjct  1070  VCLAVILAQIGADVPAESFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETAVMLSSATR  1129

Query  3292  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCH  3471
             NSLVALDELGRGT+TSDGQAIAESVLEHFV++VQCRGMFSTHYHRL++D+Q + +VSL H
Sbjct  1130  NSLVALDELGRGTATSDGQAIAESVLEHFVNEVQCRGMFSTHYHRLSVDHQTNPKVSLWH  1189

Query  3472  MACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             M C +G G GG+EEVTFLY+L  G CP+SYGVNVARLAGLPD+VL++A  KSREFE +Y
Sbjct  1190  MGCEVGRGEGGVEEVTFLYRLRPGACPKSYGVNVARLAGLPDSVLKRAVEKSREFEALY  1248


 Score =   105 bits (262),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = +1

Query  118  KSNKPLLVIGPSPTPD-STESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQ  294
            K  K  L+IG +P+P  S  +SYG EV+ ++++VYWPLDK  Y+GCV S+DK SGKH V+
Sbjct  71   KLRKSPLIIGNTPSPSKSVANSYGHEVVGKKVRVYWPLDKRLYDGCVVSYDKESGKHWVE  130

Query  295  YDDEEEEMLNLSQERIEWIETPVV-TKFRRLRR  390
            YDD EEE LNL +E+IEW+       +F+RLRR
Sbjct  131  YDDGEEESLNLGEEKIEWVMGESAGQRFKRLRR  163



>ref|NP_192116.1| DNA mismatch repair protein MSH6 [Arabidopsis thaliana]
 sp|O04716.2|MSH6_ARATH RecName: Full=DNA mismatch repair protein MSH6; Short=AtMSH6; 
AltName: Full=MutS protein homolog 6 [Arabidopsis thaliana]
 gb|AAC78699.1| G/T DNA mismatch repair enzyme [Arabidopsis thaliana]
 emb|CAB53337.1| mismatch repair protein msh6-1 [Arabidopsis thaliana]
 emb|CAB80700.1| G/T DNA mismatch repair enzyme [Arabidopsis thaliana]
 gb|AEE82119.1| DNA mismatch repair protein MSH6 [Arabidopsis thaliana]
Length=1324

 Score =  1334 bits (3453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/1020 (67%), Positives = 798/1020 (78%), Gaps = 18/1020 (2%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASN  774
             K + RKRK +E  K    K  K  +G   K  ++        +   + V   LE      
Sbjct  271   KTDSRKRKTSEVTKSGGEKKSKTDTGTILKGFKASVVEPAKKIGQADRVVKGLE------  324

Query  775   GDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQ  954
              D++L G++  RF  R+ EK  FLG  RRDA RRRP D NYD RTLYLP DF+K L+GGQ
Sbjct  325   -DNVLDGDALARFGARDSEKFRFLGVDRRDAKRRRPTDENYDPRTLYLPPDFVKKLTGGQ  383

Query  955   RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNA  1134
             RQWWEFK+KHMDKV+FFKMGKFYELFEMDAH+GAKELD+QYMKGEQPHCGFPEKNFS+N 
Sbjct  384   RQWWEFKAKHMDKVVFFKMGKFYELFEMDAHVGAKELDIQYMKGEQPHCGFPEKNFSVNI  443

Query  1135  EKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPD  1311
             EKL RKGYRVLVVEQ ETP+QLE RRK+ GSKDKVVKRE+CAV+TKGTLT+GEML  +PD
Sbjct  444   EKLVRKGYRVLVVEQTETPDQLEQRRKETGSKDKVVKREVCAVVTKGTLTDGEMLLTNPD  503

Query  1312  ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVE  1491
             ASYL+A+TE  ++  N   E  +GVC+VDVAT K+ILGQF DD DCS+L  LL E RPVE
Sbjct  504   ASYLMALTEGGESLTNPTAEHNFGVCLVDVATQKIILGQFKDDQDCSALSCLLSEMRPVE  563

Query  1492  IIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPI-PYS  1668
             IIKPAK+LS+ TER + R TRNPLVN LVPLSEFWD+EKTI EV  +Y+R+N  P   YS
Sbjct  564   IIKPAKVLSYATERTIVRQTRNPLVNNLVPLSEFWDSEKTIYEVGIIYKRINCQPSSAYS  623

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLK  1848
                  L    S         LP +LSEL    +NG+ ALSALGG ++YL+QAFLD SLL+
Sbjct  624   SEGKILGDGSSF--------LPKMLSELATEDKNGSLALSALGGAIYYLRQAFLDESLLR  675

Query  1849  FAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKR  2028
             FA+FE LP+  F  + +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N C+TA GKR
Sbjct  676   FAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQCITASGKR  735

Query  2029  LLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEA  2208
             LL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A++F+S EA
Sbjct  736   LLKTWLARPLYNTELIKERQDAVAILRGENLPYSLEFRKSLSRLPDMERLIARMFSSIEA  795

Query  2209  NGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKG  2388
             +GRN +KVVLYED AKKQ+Q+FIS LRGCETM  AC SL A L +  S+ L  LLTPG+ 
Sbjct  796   SGRNGDKVVLYEDTAKKQVQEFISTLRGCETMAEACSSLRAILKHDTSRRLLHLLTPGQS  855

Query  2389  LPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKL  2568
             LP++   IK FKD FDWVEA++SGR+IP EG DEEYD AC ++ + E SL KHLKEQ+KL
Sbjct  856   LPNISSSIKYFKDAFDWVEAHNSGRVIPHEGADEEYDCACKTVEEFESSLKKHLKEQRKL  915

Query  2569  FGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAE  2748
              GD SINYVTVGKD YLLEVPESL   VP +YEL SSKKG  RYW P I+KL+ ELSQA+
Sbjct  916   LGDASINYVTVGKDEYLLEVPESLSGSVPHDYELCSSKKGVSRYWTPTIKKLLKELSQAK  975

Query  2749  TERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIREL  2928
             +E+ES LKSI QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD YEG  CRP I   
Sbjct  976   SEKESALKSISQRLIGRFCEHQEKWRQLVSATAELDVLISLAFASDSYEGVRCRPVISGS  1035

Query  2929  PSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLR  3108
              S D VP L A  LGHP+LR DSL +G+FV N+V +GGA  +SFILLTGPNMGGKSTLLR
Sbjct  1036  TS-DGVPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGAEKASFILLTGPNMGGKSTLLR  1094

Query  3109  QVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSAT  3288
             QVCLAVILAQ+GADVPA +F++SPVD+I VRMGAKDHIMAGQSTFLTEL ETA ML+SAT
Sbjct  1095  QVCLAVILAQIGADVPAETFEVSPVDKICVRMGAKDHIMAGQSTFLTELSETAVMLTSAT  1154

Query  3289  RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLC  3468
             RNSLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRG FSTHYHRL++DYQ + +VSLC
Sbjct  1155  RNSLVVLDELGRGTATSDGQAIAESVLEHFIEKVQCRGFFSTHYHRLSVDYQTNPKVSLC  1214

Query  3469  HMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             HMAC IGEG+GG+EEVTFLY+LT G CP+SYGVNVARLAGLPD VL++A  KS+EFE +Y
Sbjct  1215  HMACQIGEGIGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDYVLQRAVIKSQEFEALY  1274


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTP-DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  S   +YG EV+ ++++VYWPLDK WY+G V  +DK  GKH+V
Sbjct  97   SKFKKPLLVIGQTPSPPQSVVITYGDEVVGKQVRVYWPLDKKWYDGSVTFYDKGEGKHVV  156

Query  292  QYDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            +Y+D EEE L+L +E+ EW +      +F RL+R
Sbjct  157  EYEDGEEESLDLGKEKTEWVVGEKSGDRFNRLKR  190



>gb|KFK30776.1| hypothetical protein AALP_AA6G024700 [Arabis alpina]
Length=1309

 Score =  1333 bits (3450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1022 (67%), Positives = 799/1022 (78%), Gaps = 16/1022 (2%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATG-GVKVIESVTNNLECVKAS  771
             K E RKRK  E           +KSG   KS   K     G    V+E V    E  +  
Sbjct  250   KTECRKRKSNE----------VVKSGSEKKSKTGKETILKGFKASVVEPVKKIEEADRVV  299

Query  772   NG--DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLS  945
              G  D+IL G++  RF  R+ EK  FL   RRDA RRRP D NYD RTLYLP DF+K L+
Sbjct  300   KGLDDNILDGDALARFGARDSEKFRFLAVDRRDAKRRRPTDENYDPRTLYLPPDFVKRLT  359

Query  946   GGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS  1125
             GGQRQWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPEKNFS
Sbjct  360   GGQRQWWEFKSKHMDKVVFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPEKNFS  419

Query  1126  MNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTV  1302
             +N EKL +KGYRVLVVEQ ETP+QLE RRK KGSKDKVVKRE+CAV+T+GTL +GEML  
Sbjct  420   VNIEKLVQKGYRVLVVEQTETPDQLEQRRKEKGSKDKVVKREVCAVVTRGTLVDGEMLLT  479

Query  1303  SPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             +PDASYL+A+TE  ++  +Q  E  +GVC+VDVAT K+ILGQF DD DCS+L  LL E R
Sbjct  480   NPDASYLLALTEG-ESLTDQKAEHNFGVCLVDVATKKIILGQFKDDLDCSALSCLLSEIR  538

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             PVEIIKPA +LS  TER L R TRNPLVN LVP+SEFWDAEKTI EV   Y+R++  P  
Sbjct  539   PVEIIKPANMLSSVTERTLVRQTRNPLVNNLVPVSEFWDAEKTIHEVGIFYKRISCQPSA  598

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                +E  +    S++N++    LP +LSEL    +NG  ALSALGG ++YLKQAFLD SL
Sbjct  599   ACSDEGKILGDGSLNNESGSSFLPKMLSELATGDKNGGLALSALGGAIYYLKQAFLDESL  658

Query  1843  LKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFG  2022
             L+FA+FE LP   F  + +  +MVLDAAALENLEIFENS+N GSSGTLYAQ+N CVTA G
Sbjct  659   LRFAKFESLPNCDFSNVTENKHMVLDAAALENLEIFENSRNGGSSGTLYAQLNQCVTASG  718

Query  2023  KRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS  2202
             KRLL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+S 
Sbjct  719   KRLLKTWLARPLYNPELIKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFSSI  778

Query  2203  EANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPG  2382
             EA+GRN  KVVLYED AKKQLQ+FIS LRGCETM  AC SL   L + +S+ L  LLTPG
Sbjct  779   EASGRNGAKVVLYEDVAKKQLQEFISTLRGCETMAEACSSLRVILKHDESRRLLHLLTPG  838

Query  2383  KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQ  2562
             + LP++   IK FKD FDWV+A++SGR++P EG D EYD  C +++K+E SL KHLKEQ+
Sbjct  839   QILPNISSSIKYFKDAFDWVDAHNSGRVVPREGADGEYDLTCETVQKLESSLTKHLKEQR  898

Query  2563  KLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQ  2742
             KL GD SINYVTVGKD YLLEVPESL   VPQ+YEL SSKKG FRYW P I+KL+ ELSQ
Sbjct  899   KLLGDASINYVTVGKDEYLLEVPESLSGSVPQDYELCSSKKGVFRYWTPTIKKLLKELSQ  958

Query  2743  AETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIR  2922
             A++E+ES LKSI QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD Y+G  CRP I 
Sbjct  959   AKSEKESALKSISQRLIGRFCEHQENWRQLVSATAELDVLISLAFASDSYDGVRCRPVIL  1018

Query  2923  ELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTL  3102
                S D+V  L A  LGHP+LR DSL +G+FV N+V +GGA  +SFILLTGPNMGGKSTL
Sbjct  1019  GSTS-DDVSHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGANQASFILLTGPNMGGKSTL  1077

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             LRQVCLAVILAQ+GADVPA +F+LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA MLSS
Sbjct  1078  LRQVCLAVILAQIGADVPAETFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETAVMLSS  1137

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             ATR SLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRG+FSTHYHRL++DYQ + +VS
Sbjct  1138  ATRKSLVVLDELGRGTATSDGQAIAESVLEHFIGKVQCRGLFSTHYHRLSMDYQTNPKVS  1197

Query  3463  LCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEG  3642
             LCHMAC +GEG+ G+EEVTFLY+LT G CP+SYGVNVARLAGLPD VL++A  KS++FE 
Sbjct  1198  LCHMACQVGEGISGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDYVLQRAVIKSQDFEL  1257

Query  3643  VY  3648
             +Y
Sbjct  1258  LY  1259


 Score =   102 bits (253),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 70/95 (74%), Gaps = 10/95 (11%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQ  294
            SK  KP+LVIG +P     E +YG+EV+ +R++VYWP+DK WY+G V  +DK  GKH+V+
Sbjct  92   SKFKKPILVIGQTP-----EITYGEEVVGKRVRVYWPIDKKWYDGSVVLYDKSEGKHVVE  146

Query  295  YDDEEEEMLNLSQERIEW---IETPVVTKFRRLRR  390
            YDD EEE L+L +E+IEW   +++ V+  F+RLRR
Sbjct  147  YDDGEEEGLDLVKEKIEWLVGVKSGVM--FKRLRR  179



>ref|NP_001190656.1| DNA mismatch repair protein MSH6 [Arabidopsis thaliana]
 gb|AEE82120.1| DNA mismatch repair protein MSH6 [Arabidopsis thaliana]
Length=1321

 Score =  1330 bits (3442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/1020 (66%), Positives = 790/1020 (77%), Gaps = 21/1020 (2%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASN  774
             K + RKRK +E  K    K  K  +G   K  ++        +   + V   LE      
Sbjct  271   KTDSRKRKTSEVTKSGGEKKSKTDTGTILKGFKASVVEPAKKIGQADRVVKGLE------  324

Query  775   GDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQ  954
              D++L G++  RF  R+ EK  FLG   +          NYD RTLYLP DF+K L+GGQ
Sbjct  325   -DNVLDGDALARFGARDSEKFRFLGVDAKRRRPTDE---NYDPRTLYLPPDFVKKLTGGQ  380

Query  955   RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNA  1134
             RQWWEFK+KHMDKV+FFKMGKFYELFEMDAH+GAKELD+QYMKGEQPHCGFPEKNFS+N 
Sbjct  381   RQWWEFKAKHMDKVVFFKMGKFYELFEMDAHVGAKELDIQYMKGEQPHCGFPEKNFSVNI  440

Query  1135  EKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPD  1311
             EKL RKGYRVLVVEQ ETP+QLE RRK+ GSKDKVVKRE+CAV+TKGTLT+GEML  +PD
Sbjct  441   EKLVRKGYRVLVVEQTETPDQLEQRRKETGSKDKVVKREVCAVVTKGTLTDGEMLLTNPD  500

Query  1312  ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVE  1491
             ASYL+A+TE  ++  N   E  +GVC+VDVAT K+ILGQF DD DCS+L  LL E RPVE
Sbjct  501   ASYLMALTEGGESLTNPTAEHNFGVCLVDVATQKIILGQFKDDQDCSALSCLLSEMRPVE  560

Query  1492  IIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPI-PYS  1668
             IIKPAK+LS+ TER + R TRNPLVN LVPLSEFWD+EKTI EV  +Y+R+N  P   YS
Sbjct  561   IIKPAKVLSYATERTIVRQTRNPLVNNLVPLSEFWDSEKTIYEVGIIYKRINCQPSSAYS  620

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLK  1848
                  L    S         LP +LSEL    +NG+ ALSALGG ++YL+QAFLD SLL+
Sbjct  621   SEGKILGDGSSF--------LPKMLSELATEDKNGSLALSALGGAIYYLRQAFLDESLLR  672

Query  1849  FAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKR  2028
             FA+FE LP+  F  + +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N C+TA GKR
Sbjct  673   FAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQCITASGKR  732

Query  2029  LLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEA  2208
             LL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A++F+S EA
Sbjct  733   LLKTWLARPLYNTELIKERQDAVAILRGENLPYSLEFRKSLSRLPDMERLIARMFSSIEA  792

Query  2209  NGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKG  2388
             +GRN +KVVLYED AKKQ+Q+FIS LRGCETM  AC SL A L +  S+ L  LLTPG+ 
Sbjct  793   SGRNGDKVVLYEDTAKKQVQEFISTLRGCETMAEACSSLRAILKHDTSRRLLHLLTPGQS  852

Query  2389  LPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKL  2568
             LP++   IK FKD FDWVEA++SGR+IP EG DEEYD AC ++ + E SL KHLKEQ+KL
Sbjct  853   LPNISSSIKYFKDAFDWVEAHNSGRVIPHEGADEEYDCACKTVEEFESSLKKHLKEQRKL  912

Query  2569  FGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAE  2748
              GD SINYVTVGKD YLLEVPESL   VP +YEL SSKKG  RYW P I+KL+ ELSQA+
Sbjct  913   LGDASINYVTVGKDEYLLEVPESLSGSVPHDYELCSSKKGVSRYWTPTIKKLLKELSQAK  972

Query  2749  TERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIREL  2928
             +E+ES LKSI QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD YEG  CRP I   
Sbjct  973   SEKESALKSISQRLIGRFCEHQEKWRQLVSATAELDVLISLAFASDSYEGVRCRPVISGS  1032

Query  2929  PSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLR  3108
              S D VP L A  LGHP+LR DSL +G+FV N+V +GGA  +SFILLTGPNMGGKSTLLR
Sbjct  1033  TS-DGVPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGAEKASFILLTGPNMGGKSTLLR  1091

Query  3109  QVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSAT  3288
             QVCLAVILAQ+GADVPA +F++SPVD+I VRMGAKDHIMAGQSTFLTEL ETA ML+SAT
Sbjct  1092  QVCLAVILAQIGADVPAETFEVSPVDKICVRMGAKDHIMAGQSTFLTELSETAVMLTSAT  1151

Query  3289  RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLC  3468
             RNSLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRG FSTHYHRL++DYQ + +VSLC
Sbjct  1152  RNSLVVLDELGRGTATSDGQAIAESVLEHFIEKVQCRGFFSTHYHRLSVDYQTNPKVSLC  1211

Query  3469  HMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             HMAC IGEG+GG+EEVTFLY+LT G CP+SYGVNVARLAGLPD VL++A  KS+EFE +Y
Sbjct  1212  HMACQIGEGIGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDYVLQRAVIKSQEFEALY  1271


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTP-DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  S   +YG EV+ ++++VYWPLDK WY+G V  +DK  GKH+V
Sbjct  97   SKFKKPLLVIGQTPSPPQSVVITYGDEVVGKQVRVYWPLDKKWYDGSVTFYDKGEGKHVV  156

Query  292  QYDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            +Y+D EEE L+L +E+ EW +      +F RL+R
Sbjct  157  EYEDGEEESLDLGKEKTEWVVGEKSGDRFNRLKR  190



>ref|XP_002874942.1| hypothetical protein ARALYDRAFT_912022 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51201.1| hypothetical protein ARALYDRAFT_912022 [Arabidopsis lyrata subsp. 
lyrata]
Length=1326

 Score =  1320 bits (3415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/1021 (67%), Positives = 799/1021 (78%), Gaps = 20/1021 (2%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIES--VTNNLECVKA  768
             K + RKRK +E  K  S   KK ++  +      KA      +K+ E+  V  NLE    
Sbjct  273   KTDFRKRKTSEVTK--SGGEKKSRTDKDTILKGFKASVVEPPMKIGEADRVVKNLE----  326

Query  769   SNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSG  948
                D+IL G++  RF  RE EK  FLG  RRDA RRR  D NYD RTLYLP DF+K L+G
Sbjct  327   ---DNILDGDALARFGARESEKFRFLGVDRRDAKRRRSTDENYDPRTLYLPPDFVKKLTG  383

Query  949   GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSM  1128
             GQRQWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELD+QYMKGEQPHCGFPEKNFS+
Sbjct  384   GQRQWWEFKSKHMDKVVFFKMGKFYELFEMDAHVGAKELDIQYMKGEQPHCGFPEKNFSV  443

Query  1129  NAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVS  1305
             N EKL RKGYRVLVVEQ ETP+QLE RRK+ GSKDKVVKREICAV+TKGTLT+GEML  +
Sbjct  444   NIEKLVRKGYRVLVVEQTETPDQLEQRRKETGSKDKVVKREICAVVTKGTLTDGEMLLTN  503

Query  1306  PDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRP  1485
             PDASY++A+TE  +   +Q  E  +GVC+VDVAT K++LGQF DD DCS+L  LL E RP
Sbjct  504   PDASYIMALTEGGECLTDQTAEHNFGVCLVDVATKKIMLGQFKDDQDCSALSCLLSEMRP  563

Query  1486  VEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPY  1665
             VEIIKPAK+LS  TER + R TRNPLVN LVP SEFWD+EKTI EV   Y+R++  P   
Sbjct  564   VEIIKPAKVLSSATERTIVRQTRNPLVNNLVPFSEFWDSEKTIHEVGIFYKRISCQPSSA  623

Query  1666  SQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLL  1845
               +E        I  D     LP +LSEL    +NG+ ALSALGG ++YL+QAFLD SLL
Sbjct  624   YSSEG------KIPGDGS-SFLPKILSELATEDKNGSLALSALGGAIYYLRQAFLDESLL  676

Query  1846  KFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGK  2025
             +FA+FE LP   F  + +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N CVTA GK
Sbjct  677   RFAKFESLPCCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQCVTASGK  736

Query  2026  RLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSE  2205
             RLL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A++F+S E
Sbjct  737   RLLKTWLARPLYNPELIKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARMFSSIE  796

Query  2206  ANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGK  2385
             A+GRN +KVVLYED AKK++Q+FIS LRGCETM  AC SL A L +  S+ L  LL+PG+
Sbjct  797   ASGRNGDKVVLYEDTAKKEVQEFISTLRGCETMAEACSSLRAILKHDKSRRLLHLLSPGQ  856

Query  2386  GLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQK  2565
              LP++   IK FKD FDWVEA++SGR+IP EG DEE+D AC ++ + E +L KHLKEQ+K
Sbjct  857   ILPNISSSIKYFKDAFDWVEAHNSGRVIPHEGADEEFDCACKTVEEFESNLKKHLKEQRK  916

Query  2566  LFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQA  2745
             L GD SINYVTVGKD YLLEVPE L   VP +YEL SSKKG  RYW P I+KL+ ELSQA
Sbjct  917   LLGDPSINYVTVGKDEYLLEVPEILSGSVPHDYELCSSKKGVSRYWTPTIKKLLKELSQA  976

Query  2746  ETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRE  2925
             ++E+ES LKSI QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD YEG  CRP I  
Sbjct  977   KSEKESALKSISQRLIGRFCEHQEKWRQLVSATAELDVLISLAFASDSYEGVRCRPVISG  1036

Query  2926  LPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLL  3105
               S D+VP L A  LGHP+LR D+L +G+FV N+V +GG+  +SFILLTGPNMGGKSTLL
Sbjct  1037  STS-DDVPHLSATGLGHPVLRGDTLGRGSFVPNNVKIGGSEKASFILLTGPNMGGKSTLL  1095

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQVCLAVILAQ+GADVPA +F++SPVDRI VRMGAKDHIMAGQSTFLTEL ETA ML+SA
Sbjct  1096  RQVCLAVILAQIGADVPAETFEVSPVDRICVRMGAKDHIMAGQSTFLTELSETAVMLTSA  1155

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             TRNSLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRG+FSTHYHRL++DYQ + +VSL
Sbjct  1156  TRNSLVVLDELGRGTATSDGQAIAESVLEHFIDKVQCRGLFSTHYHRLSVDYQTNPKVSL  1215

Query  3466  CHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             CHMAC +GEG+GG+EEVTFLY+LT G CP+SYGVNVARLAGLPD VL++A  KS+EFE +
Sbjct  1216  CHMACQVGEGIGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDYVLQRAVIKSQEFEAL  1275

Query  3646  Y  3648
             Y
Sbjct  1276  Y  1276


 Score =   101 bits (251),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 2/94 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTP-DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  S   +YG EV+ ++++VYWPLDK WY+G V  +DK   KH+V
Sbjct  96   SKFKKPLLVIGQTPSPPQSAVITYGDEVVGKQVRVYWPLDKKWYDGSVTFYDKCECKHVV  155

Query  292  QYDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            +Y+D EEE L+L +E+IEW +      +F+RLRR
Sbjct  156  EYEDGEEESLDLGKEKIEWVVGDKSGDRFKRLRR  189



>ref|XP_006286904.1| hypothetical protein CARUB_v10000048mg [Capsella rubella]
 gb|EOA19802.1| hypothetical protein CARUB_v10000048mg [Capsella rubella]
Length=1325

 Score =  1315 bits (3404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/1024 (66%), Positives = 794/1024 (78%), Gaps = 27/1024 (3%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATG-GVKVIESVTNNLECVKAS  771
             K + RKRK +E            KSGG  KS   K     G    V+E      E  +  
Sbjct  273   KPDCRKRKTSE----------VTKSGGEKKSRTDKDTILKGFEASVVEPPKKIEEADRVV  322

Query  772   NG--DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLS  945
              G  D+IL G++  RF  RE EK  FLG  RRDA RRRP D NYD RTLYLP DF+K L+
Sbjct  323   KGLEDNILDGDALARFGARESEKFCFLGVDRRDAKRRRPTDENYDPRTLYLPPDFVKKLT  382

Query  946   GGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS  1125
             GGQRQWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELD+QYMKGEQPHCGFPEKNFS
Sbjct  383   GGQRQWWEFKSKHMDKVVFFKMGKFYELFEMDAHVGAKELDIQYMKGEQPHCGFPEKNFS  442

Query  1126  MNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTV  1302
             +N EKL RKGYRVLVVEQ ETP+QLE RRK KGSKDKVVKRE+CAV+TKGTLT+GEM+  
Sbjct  443   VNIEKLVRKGYRVLVVEQTETPDQLEKRRKEKGSKDKVVKREVCAVVTKGTLTDGEMILT  502

Query  1303  SPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             +PDASYL+A+TE  ++  +Q  E  +GVC+VDVAT K++LGQF DD DCS+L  LL E R
Sbjct  503   NPDASYLMALTEGGESLTDQKAEHNFGVCLVDVATKKIMLGQFKDDQDCSALSCLLSEIR  562

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             PVEIIKPA++LS  TER + R TRNPLVN LVPLSEFWDAEKTI EV   Y+R+N     
Sbjct  563   PVEIIKPARVLSSATERTIVRQTRNPLVNNLVPLSEFWDAEKTIHEVGIFYKRIN-----  617

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGT--YALSALGGTLFYLKQAFLDV  1836
                    L  SE          LP +L++L    +NG+   ALSALGG ++YL+QAFLD 
Sbjct  618   -----CQLSSSEGKILGDGSSFLPKMLTDLATEDKNGSGSLALSALGGAIYYLRQAFLDE  672

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             SLL+FA+FE LP+  F  + +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N CVTA
Sbjct  673   SLLRFAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQCVTA  732

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
              GKRLL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+
Sbjct  733   SGKRLLKTWLARPLYNPEMIKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFS  792

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             S EA+GRN +KVVLYED AKKQ+Q+F+S LRGCETM  AC SL A L +  S+ L  LLT
Sbjct  793   SIEASGRNGDKVVLYEDTAKKQVQEFVSTLRGCETMAEACSSLRAILKHDKSRRLLHLLT  852

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PG+ LP++   IK FKD FDWVEA+ SGR+IP EG DEEYD AC ++ + E SL KHLKE
Sbjct  853   PGQSLPNISSFIKYFKDAFDWVEAHDSGRVIPHEGADEEYDCACKTVEEFESSLKKHLKE  912

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GD SINYVTVGKD YLLEVPE L   VP +YEL SSKKG FRYW P I+KL+ EL
Sbjct  913   QRKLLGDASINYVTVGKDEYLLEVPEILSGSVPHDYELCSSKKGVFRYWTPTIKKLLKEL  972

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPH  2916
             S A++E+ES LK+I QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD Y+   CRP 
Sbjct  973   SSAKSEKESALKNISQRLIGRFCEHQEKWRQLVSATAELDVLISLAFASDSYDSVRCRPV  1032

Query  2917  IRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKS  3096
             +    + D VP L A  LGHP+LR DSL +G+FV N+V +GGA  +SFILLTGPNMGGKS
Sbjct  1033  VVSGSTSD-VPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGAEKASFILLTGPNMGGKS  1091

Query  3097  TLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASML  3276
             TLLRQVCLAVILAQ+GADVPA +F++SPVDRI VRMGAKDHIMAGQSTFLTEL ETA ML
Sbjct  1092  TLLRQVCLAVILAQIGADVPAETFEVSPVDRICVRMGAKDHIMAGQSTFLTELSETAVML  1151

Query  3277  SSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQ  3456
             +SAT+NSLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRG+FSTHYHRL++DYQ + +
Sbjct  1152  TSATQNSLVVLDELGRGTATSDGQAIAESVLEHFIDKVQCRGLFSTHYHRLSVDYQTNPK  1211

Query  3457  VSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             VSLCHMAC +GEG+GG+EEVTFLY+LT G CP+SYGVNVARLAGLP+ VL++A  KS+EF
Sbjct  1212  VSLCHMACQVGEGIGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPEYVLQRAVIKSQEF  1271

Query  3637  EGVY  3648
             E +Y
Sbjct  1272  EALY  1275


 Score =   100 bits (250),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 68/97 (70%), Gaps = 8/97 (8%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTPD-STESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  K LLVIG +P+P  S E  YG EV+ R+++VYWPLDK WY+G V  +DK  GKH+V
Sbjct  95   SKFKKSLLVIGQTPSPPLSAEIKYGDEVVGRQVRVYWPLDKRWYDGSVTFYDKGVGKHVV  154

Query  292  QYDDEEEEMLNLSQERIEWIETPVVTK----FRRLRR  390
            +Y+D EEE L+L +E+IEW+   VV K     +RLRR
Sbjct  155  EYEDGEEESLDLGKEKIEWM---VVEKSGDTVKRLRR  188



>gb|AAB57798.1| AGAA.3 [Arabidopsis thaliana]
Length=1362

 Score =  1312 bits (3395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1053 (65%), Positives = 799/1053 (76%), Gaps = 46/1053 (4%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASN  774
             K + RKRK +E  K    K  K  +G   K    KA       K+ +    +L  V    
Sbjct  271   KTDSRKRKTSEVTKSGGEKKSKTDTGTILKGF--KASVVEPAKKIGQGKPKSLLLVVKGL  328

Query  775   GDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQ  954
              D++L G++  RF  R+ EK  FLG  RRDA RRRP D NYD RTLYLP DF+K L+GGQ
Sbjct  329   EDNVLDGDALARFGARDSEKFRFLGVDRRDAKRRRPTDENYDPRTLYLPPDFVKKLTGGQ  388

Query  955   --------RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFP  1110
                     RQWWEFK+KHMDKV+FFKMGKFYELFEMDAH+GAKELD+QYMKGEQPHCGFP
Sbjct  389   VRRAHGNLRQWWEFKAKHMDKVVFFKMGKFYELFEMDAHVGAKELDIQYMKGEQPHCGFP  448

Query  1111  EKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEG  1287
             EKNFS+N EKL RKGYRVLVVEQ ETP+QLE RRK+ GSKDKVVKRE+CAV+TKGTLT+G
Sbjct  449   EKNFSVNIEKLVRKGYRVLVVEQTETPDQLEQRRKETGSKDKVVKREVCAVVTKGTLTDG  508

Query  1288  EMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsl  1467
             EML  +PDASYL+A+TE  ++  N   E  +GVC+VDVAT K+ILGQF DD DCS+L  L
Sbjct  509   EMLLTNPDASYLMALTEGGESLTNPTAEHNFGVCLVDVATQKIILGQFKDDQDCSALSCL  568

Query  1468  lYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLN  1647
             L E RPVEIIKPAK+LS+ TER + R TRNPLVN LVPLSEFWD+EKTI EV  +Y+R+N
Sbjct  569   LSEMRPVEIIKPAKVLSYATERTIVRQTRNPLVNNLVPLSEFWDSEKTIYEVGIIYKRIN  628

Query  1648  NTPI-PYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQA  1824
               P   YS     L    S         LP +LSEL    +NG+ ALSALGG ++YL+QA
Sbjct  629   CQPSSAYSSEGKILGDGSSF--------LPKMLSELATEDKNGSLALSALGGAIYYLRQA  680

Query  1825  FLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNH  2004
             FLD SLL+FA+FE LP+  F  + +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N 
Sbjct  681   FLDESLLRFAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQ  740

Query  2005  CVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLA  2184
             C+TA GKRLL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A
Sbjct  741   CITASGKRLLKTWLARPLYNTELIKERQDAVAILRGENLPYSLEFRKSLSRLPDMERLIA  800

Query  2185  QIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLH  2364
             ++F+S EA+GRN +KVVLYED AKKQ+Q+FIS LRGCETM  AC SL A L +  S+ L 
Sbjct  801   RMFSSIEASGRNGDKVVLYEDTAKKQVQEFISTLRGCETMAEACSSLRAILKHDTSRRLL  860

Query  2365  DLLTPG-------------------------KGLPDVKLVIKQFKDGFDWVEANSSGRII  2469
              LLTPG                         + LP++   IK FKD FDWVEA++SGR+I
Sbjct  861   HLLTPGIINLLHIHILILANCTASHIISLPGQSLPNISSSIKYFKDAFDWVEAHNSGRVI  920

Query  2470  PCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL  2649
             P EG DEEYD AC ++ + E SL KHLKEQ+KL GD SINYVTVGKD YLLEVPESL   
Sbjct  921   PHEGADEEYDCACKTVEEFESSLKKHLKEQRKLLGDASINYVTVGKDEYLLEVPESLSGS  980

Query  2650  VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRE  2829
             VP +YEL SSKKG  RYW P I+KL+ ELSQA++E+ES LKSI QRLIGRFCEH   WR+
Sbjct  981   VPHDYELCSSKKGVSRYWTPTIKKLLKELSQAKSEKESALKSISQRLIGRFCEHQEKWRQ  1040

Query  2830  LISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKG  3009
             L+S  AELDVLISL+ ASD YEG  CRP I    S D VP L A  LGHP+LR DSL +G
Sbjct  1041  LVSATAELDVLISLAFASDSYEGVRCRPVISGSTS-DGVPHLSATGLGHPVLRGDSLGRG  1099

Query  3010  AFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDR  3189
             +FV N+V +GGA  +SFILLTGPNMGGKSTLLRQVCLAVILAQ+GADVPA +F++SPVD+
Sbjct  1100  SFVPNNVKIGGAEKASFILLTGPNMGGKSTLLRQVCLAVILAQIGADVPAETFEVSPVDK  1159

Query  3190  IFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVL  3369
             I VRMGAKDHIMAGQSTFLTEL ETA ML+SATRNSLV LDELGRGT+TSDGQAIAESVL
Sbjct  1160  ICVRMGAKDHIMAGQSTFLTELSETAVMLTSATRNSLVVLDELGRGTATSDGQAIAESVL  1219

Query  3370  EHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTC  3549
             EHF+ KVQCRG FSTHYHRL++DYQ + +VSLCHMAC IGEG+GG+EEVTFLY+LT G C
Sbjct  1220  EHFIEKVQCRGFFSTHYHRLSVDYQTNPKVSLCHMACQIGEGIGGVEEVTFLYRLTPGAC  1279

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             P+SYGVNVARLAGLPD VL++A  KS+EFE +Y
Sbjct  1280  PKSYGVNVARLAGLPDYVLQRAVIKSQEFEALY  1312


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTP-DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  KPLLVIG +P+P  S   +YG EV+ ++++VYWPLDK WY+G V  +DK  GKH+V
Sbjct  97   SKFKKPLLVIGQTPSPPQSVVITYGDEVVGKQVRVYWPLDKKWYDGSVTFYDKGEGKHVV  156

Query  292  QYDDEEEEMLNLSQERIEW-IETPVVTKFRRLRR  390
            +Y+D EEE L+L +E+ EW +      +F RL+R
Sbjct  157  EYEDGEEESLDLGKEKTEWVVGEKSGDRFNRLKR  190



>ref|XP_006286903.1| hypothetical protein CARUB_v10000048mg [Capsella rubella]
 gb|EOA19801.1| hypothetical protein CARUB_v10000048mg [Capsella rubella]
Length=1325

 Score =  1310 bits (3390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/1024 (66%), Positives = 793/1024 (77%), Gaps = 27/1024 (3%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATG-GVKVIESVTNNLECVKAS  771
             K + RKRK +E            KSGG  KS   K     G    V+E      E  +  
Sbjct  273   KPDCRKRKTSE----------VTKSGGEKKSRTDKDTILKGFEASVVEPPKKIEEADRVV  322

Query  772   NG--DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLS  945
              G  D+IL G++  RF  RE EK  FLG  RRDA RRRP D NYD RTLYLP DF+K L+
Sbjct  323   KGLEDNILDGDALARFGARESEKFCFLGVDRRDAKRRRPTDENYDPRTLYLPPDFVKKLT  382

Query  946   GGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS  1125
             GGQRQWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELD+QYMK +QPHCGFPEKNFS
Sbjct  383   GGQRQWWEFKSKHMDKVVFFKMGKFYELFEMDAHVGAKELDIQYMKVKQPHCGFPEKNFS  442

Query  1126  MNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTV  1302
             +N EKL RKGYRVLVVEQ ETP+QLE RRK KGSKDKVVKRE+CAV+TKGTLT+GEM+  
Sbjct  443   VNIEKLVRKGYRVLVVEQTETPDQLEKRRKEKGSKDKVVKREVCAVVTKGTLTDGEMILT  502

Query  1303  SPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             +PDASYL+A+TE  ++  +Q  E  +GVC+VDVAT K++LGQF DD DCS+L  LL E R
Sbjct  503   NPDASYLMALTEGGESLTDQKAEHNFGVCLVDVATKKIMLGQFKDDQDCSALSCLLSEIR  562

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             PVEIIKPA++LS  TER + R TRNPLVN LVPLSEFWDAEKTI EV   Y+R+N     
Sbjct  563   PVEIIKPARVLSSATERTIVRQTRNPLVNNLVPLSEFWDAEKTIHEVGIFYKRIN-----  617

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGT--YALSALGGTLFYLKQAFLDV  1836
                    L  SE          LP +L++L    +NG+   ALSALGG ++YL+QAFLD 
Sbjct  618   -----CQLSSSEGKILGDGSSFLPKMLTDLATEDKNGSGSLALSALGGAIYYLRQAFLDE  672

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             SLL+FA+FE LP+  F  + +K +MVLDAAALENLEIFENS+N G SGTLYAQ+N CVTA
Sbjct  673   SLLRFAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYSGTLYAQLNQCVTA  732

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
              GKRLL+TWLARPLY+ E IKERQDAVA L+G NLP  LEFRK LSRLPDMERL+A+IF+
Sbjct  733   SGKRLLKTWLARPLYNPEMIKERQDAVAILRGENLPYSLEFRKALSRLPDMERLIARIFS  792

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             S EA+GRN +KVVLYED AKKQ+Q+F+S LRGCETM  AC SL A L +  S+ L  LLT
Sbjct  793   SIEASGRNGDKVVLYEDTAKKQVQEFVSTLRGCETMAEACSSLRAILKHDKSRRLLHLLT  852

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PG+ LP++   IK FKD FDWVEA+ SGR+IP EG DEEYD AC ++ + E SL KHLKE
Sbjct  853   PGQSLPNISSFIKYFKDAFDWVEAHDSGRVIPHEGADEEYDCACKTVEEFESSLKKHLKE  912

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GD SINYVTVGKD YLLEVPE L   VP +YEL SSKKG FRYW P I+KL+ EL
Sbjct  913   QRKLLGDASINYVTVGKDEYLLEVPEILSGSVPHDYELCSSKKGVFRYWTPTIKKLLKEL  972

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPH  2916
             S A++E+ES LK+I QRLIGRFCEH   WR+L+S  AELDVLISL+ ASD Y+   CRP 
Sbjct  973   SSAKSEKESALKNISQRLIGRFCEHQEKWRQLVSATAELDVLISLAFASDSYDSVRCRPV  1032

Query  2917  IRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKS  3096
             +    + D VP L A  LGHP+LR DSL +G+FV N+V +GGA  +SFILLTGPNMGGKS
Sbjct  1033  VVSGSTSD-VPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGAEKASFILLTGPNMGGKS  1091

Query  3097  TLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASML  3276
             TLLRQVCLAVILAQ+GADVPA +F++SPVDRI VRMGAKDHIMAGQSTFLTEL ETA ML
Sbjct  1092  TLLRQVCLAVILAQIGADVPAETFEVSPVDRICVRMGAKDHIMAGQSTFLTELSETAVML  1151

Query  3277  SSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQ  3456
             +SAT+NSLV LDELGRGT+TSDGQAIAESVLEHF+ KVQCRG+FSTHYHRL++DYQ + +
Sbjct  1152  TSATQNSLVVLDELGRGTATSDGQAIAESVLEHFIDKVQCRGLFSTHYHRLSVDYQTNPK  1211

Query  3457  VSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             VSLCHMAC +GEG+GG+EEVTFLY+LT G CP+SYGVNVARLAGLP+ VL++A  KS+EF
Sbjct  1212  VSLCHMACQVGEGIGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPEYVLQRAVIKSQEF  1271

Query  3637  EGVY  3648
             E +Y
Sbjct  1272  EALY  1275


 Score =   100 bits (250),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 68/97 (70%), Gaps = 8/97 (8%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTPD-STESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLV  291
            SK  K LLVIG +P+P  S E  YG EV+ R+++VYWPLDK WY+G V  +DK  GKH+V
Sbjct  95   SKFKKSLLVIGQTPSPPLSAEIKYGDEVVGRQVRVYWPLDKRWYDGSVTFYDKGVGKHVV  154

Query  292  QYDDEEEEMLNLSQERIEWIETPVVTK----FRRLRR  390
            +Y+D EEE L+L +E+IEW+   VV K     +RLRR
Sbjct  155  EYEDGEEESLDLGKEKIEWM---VVEKSGDTVKRLRR  188



>ref|XP_009401272.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1279

 Score =  1291 bits (3340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/1020 (65%), Positives = 801/1020 (79%), Gaps = 12/1020 (1%)
 Frame = +1

Query  589   SKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKA  768
             SK +   KR+ T  L  +   AKKIK   N + T SKA  +      +  ++N+      
Sbjct  205   SKNSTGSKRRKTMNLAKLDC-AKKIKFEKNRERTASKASLSMTESNAVAPLSNDRRVQVL  263

Query  769   SNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSG  948
              +    +T  +AERF  RE EK  FL +GRRD   RRPGD NYD RTLYLP +FL+ LSG
Sbjct  264   DSIGSTVTVEAAERFGKREAEKFRFLQEGRRDVRGRRPGDKNYDPRTLYLPPEFLRTLSG  323

Query  949   GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSM  1128
             GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGA+ELDLQYMKGEQPHCGFPEKN+SM
Sbjct  324   GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGARELDLQYMKGEQPHCGFPEKNYSM  383

Query  1129  NAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVS  1305
             N E+L RKGYRVLVVEQ ETPEQLE+RRK+ GSKDKVVKREICA++T+GTL EGE L  +
Sbjct  384   NLERLTRKGYRVLVVEQTETPEQLEIRRKEMGSKDKVVKREICAMVTQGTLMEGESLLRN  443

Query  1306  PDASYLIAVTESCQT-SANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             PD SYL+++ E  ++      G    G+CVVDV+TSK ++GQF DD +   LCS+L E R
Sbjct  444   PDTSYLLSIAEHFRSLEVPGKGGVVIGLCVVDVSTSKFMVGQFEDDLERHWLCSILSELR  503

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             PVE+IKP+K LS ETERV+  +TRNPLVN L+P  EFWDAE+TI+E++  Y  L+   + 
Sbjct  504   PVEVIKPSKALSPETERVIKNNTRNPLVNNLLPFDEFWDAERTINEIRKYYS-LSEHYLA  562

Query  1663  YSQNEADLHPSESIDNDAQLR-NLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVS  1839
              +QN        S DN      +LP+VL+ELVN G +G+YALSALGG LFYL+QAFLD  
Sbjct  563   -AQNGCT-----SADNAGNCPVDLPDVLTELVNVGIDGSYALSALGGCLFYLRQAFLDEK  616

Query  1840  LLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAF  2019
             L+K A+FE L  S F    QKPYM+LDAAALENLEI EN+++ G SGTL+AQ++HCVTAF
Sbjct  617   LIKCAKFERLACSGFFNNLQKPYMILDAAALENLEILENNRSGGLSGTLFAQLDHCVTAF  676

Query  2020  GKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFAS  2199
             GKRLL+ WLARPLY + +I ERQDAVA  KG  L   LEFRKELS+L DMERLL+++F S
Sbjct  677   GKRLLKGWLARPLYDIRSIVERQDAVACFKGAGLTSALEFRKELSKLQDMERLLSRLFVS  736

Query  2200  SEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTP  2379
              EA+GRNAN+V+LYEDAAKK+LQ+FI++L GCE M+ AC SL   L +T+S LLH LLTP
Sbjct  737   CEAHGRNANRVILYEDAAKKRLQEFIASLHGCEAMIQACSSLDTVLTSTESTLLHYLLTP  796

Query  2380  GKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQ  2559
             GKGLPD+  VI+ FKD FDW EA+ +GRIIP EG D +YDAAC  L+ +E +L ++LKEQ
Sbjct  797   GKGLPDMCSVIEHFKDAFDWSEADRTGRIIPHEGGDVDYDAACKKLKDIESNLMRYLKEQ  856

Query  2560  QKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELS  2739
             +K+ G++ +NYV VGKD YLLEVPESL   VP EYELQSSKKGYFRYW P I+  + ELS
Sbjct  857   RKVLGNSEVNYVAVGKDLYLLEVPESLRGAVPAEYELQSSKKGYFRYWTPKIKDFLSELS  916

Query  2740  QAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHI  2919
             QAE E+ESKLK ILQRLIG+F EHHS WR+L+S IAELDVLISL+IASDYYEGPTCRP I
Sbjct  917   QAEAEKESKLKGILQRLIGQFSEHHSKWRQLVSVIAELDVLISLAIASDYYEGPTCRPVI  976

Query  2920  RELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKST  3099
             +E+   +N P L A+ LGHP+LR+D+L KG+FV NDV +GG G   FILLTGPNMGGKST
Sbjct  977   KEV-CHENEPYLSARGLGHPMLRSDALGKGSFVPNDVRIGGVGQPRFILLTGPNMGGKST  1035

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             LLRQVCLAV+LAQ+GADVPA  F+LSPVDRIFVRMGA+D+IMAGQSTFL EL ETA +LS
Sbjct  1036  LLRQVCLAVVLAQLGADVPAECFELSPVDRIFVRMGARDNIMAGQSTFLMELSETAGVLS  1095

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
             SAT+NSLVALDELGRGT+TSDGQAIA SV E+ VH+VQCRG+FSTHYHRL ++Y+++ +V
Sbjct  1096  SATQNSLVALDELGRGTATSDGQAIAASVFEYLVHRVQCRGLFSTHYHRLILEYEKNTKV  1155

Query  3460  SLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             S+CHMAC +G+G+GG+EEVTFLY+L  G+CP+SYGVNVARLAGLP +VL+KAA KS +FE
Sbjct  1156  SICHMACQVGKGVGGVEEVTFLYRLAPGSCPKSYGVNVARLAGLPSSVLQKAAKKSNDFE  1215


 Score = 95.9 bits (237),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 8/89 (9%)
 Frame = +1

Query  118  KSNKPLLVIGPSPTP------DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISG  279
            K  KP LVI PSP         + ++ + +EV+ +RIKV+WPLDK WYEG V SFD++SG
Sbjct  46   KEKKPRLVIPPSPASGAKVPLTAAKNCHTKEVVGKRIKVFWPLDKAWYEGRVSSFDEMSG  105

Query  280  KHLVQYDDEEEEMLNLSQERIEWI--ETP  360
            KHL+ Y D EEE L+L +E+ EWI  ETP
Sbjct  106  KHLICYVDGEEEALDLGKEKFEWIGEETP  134



>gb|KDO87012.1| hypothetical protein CISIN_1g000778mg [Citrus sinensis]
Length=1162

 Score =  1256 bits (3251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/867 (74%), Positives = 739/867 (85%), Gaps = 7/867 (1%)
 Frame = +1

Query  763   KASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKG  939
             K SNG D+ + G+ +ERFS RE +K  FLG  RRDA RRRPGDV YD RTLYLP DFL+ 
Sbjct  267   KLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRN  326

Query  940   LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKN  1119
             LS GQ+QWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPE+N
Sbjct  327   LSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERN  386

Query  1120  FSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEML  1296
             FSMN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE+L
Sbjct  387   FSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELL  446

Query  1297  TVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYE  1476
             + +PDASYL+A+TES Q+ A+Q  +R +G+CVVDVATS++ILGQ  DD DCS LC LL E
Sbjct  447   SANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSE  506

Query  1477  FRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTP  1656
              RPVEIIKPA +LS ETER + RHTRNPLVN+LVPLSEFWDAE T+ E+KN+Y R+    
Sbjct  507   LRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAE-  565

Query  1657  IPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDV  1836
                S N+AD + + S      L  LP +LSEL++ G++G+  LSALGGTLFYLK++FLD 
Sbjct  566   ---SLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDE  622

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             +LL+FA+FELLP S FG +A+KPYMVLDA ALENLE+FENS++  SSGTLYAQ+NHCVTA
Sbjct  623   TLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTA  682

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
             FGKRLLRTWLARPLY+   I+ERQDAVAGL+GVN P  LEFRK LSRLPDMERLLA++FA
Sbjct  683   FGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA  742

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             SSEANGRN+NKVVLYEDAAKKQLQ+FISAL GCE M  AC SLGA L+NT+S+ LH +LT
Sbjct  743   SSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILT  802

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PGKGLP +  ++K FKD FDWVEAN+SGRIIP  GVD +YD+AC  ++++E SL KHLKE
Sbjct  803   PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKE  862

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GDTSI YVT+GKD YLLEVPESL   VP++YEL+SSKKG+FRYW P I+KL+GEL
Sbjct  863   QRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGEL  922

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPH  2916
             SQAE+E+ES LKSILQRLIG+FCEHH+ WR++++  AELD LISL+IASD+YEGPTCRP 
Sbjct  923   SQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPV  982

Query  2917  IRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKS  3096
             I +  S +  P + AKSLGHP+LR+DSL KG FV ND+T+GG G++SFILLTGPNMGGKS
Sbjct  983   ILDSCSNEE-PYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKS  1041

Query  3097  TLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASML  3276
             TLLRQVCLAVILAQVGADVPA  F++SPVDRIFVRMGAKDHIMAGQSTFLTEL ETA ML
Sbjct  1042  TLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALML  1101

Query  3277  SSATRNSLVALDELGRGTSTSDGQAIA  3357
             SSATRNSLV LDELGRGTSTSDGQAIA
Sbjct  1102  SSATRNSLVVLDELGRGTSTSDGQAIA  1128


 Score =   107 bits (266),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYG++VL +RI+VYWPLDK WYEGCVKSFDK   KHLVQYDD E+E+L+L +E+IEW++ 
Sbjct  100  SYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQE  159

Query  358  PVVTKFRRLRR  390
              V+  +RLRR
Sbjct  160  S-VSLLKRLRR  169



>gb|KDO87013.1| hypothetical protein CISIN_1g000778mg [Citrus sinensis]
Length=1129

 Score =  1256 bits (3250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/867 (74%), Positives = 739/867 (85%), Gaps = 7/867 (1%)
 Frame = +1

Query  763   KASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKG  939
             K SNG D+ + G+ +ERFS RE +K  FLG  RRDA RRRPGDV YD RTLYLP DFL+ 
Sbjct  267   KLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRN  326

Query  940   LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKN  1119
             LS GQ+QWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPE+N
Sbjct  327   LSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERN  386

Query  1120  FSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEML  1296
             FSMN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE+L
Sbjct  387   FSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELL  446

Query  1297  TVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYE  1476
             + +PDASYL+A+TES Q+ A+Q  +R +G+CVVDVATS++ILGQ  DD DCS LC LL E
Sbjct  447   SANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSE  506

Query  1477  FRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTP  1656
              RPVEIIKPA +LS ETER + RHTRNPLVN+LVPLSEFWDAE T+ E+KN+Y R+    
Sbjct  507   LRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAE-  565

Query  1657  IPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDV  1836
                S N+AD + + S      L  LP +LSEL++ G++G+  LSALGGTLFYLK++FLD 
Sbjct  566   ---SLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDE  622

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             +LL+FA+FELLP S FG +A+KPYMVLDA ALENLE+FENS++  SSGTLYAQ+NHCVTA
Sbjct  623   TLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTA  682

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
             FGKRLLRTWLARPLY+   I+ERQDAVAGL+GVN P  LEFRK LSRLPDMERLLA++FA
Sbjct  683   FGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA  742

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             SSEANGRN+NKVVLYEDAAKKQLQ+FISAL GCE M  AC SLGA L+NT+S+ LH +LT
Sbjct  743   SSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILT  802

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PGKGLP +  ++K FKD FDWVEAN+SGRIIP  GVD +YD+AC  ++++E SL KHLKE
Sbjct  803   PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKE  862

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GDTSI YVT+GKD YLLEVPESL   VP++YEL+SSKKG+FRYW P I+KL+GEL
Sbjct  863   QRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGEL  922

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPH  2916
             SQAE+E+ES LKSILQRLIG+FCEHH+ WR++++  AELD LISL+IASD+YEGPTCRP 
Sbjct  923   SQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPV  982

Query  2917  IRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKS  3096
             I +  S +  P + AKSLGHP+LR+DSL KG FV ND+T+GG G++SFILLTGPNMGGKS
Sbjct  983   ILDSCSNEE-PYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKS  1041

Query  3097  TLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASML  3276
             TLLRQVCLAVILAQVGADVPA  F++SPVDRIFVRMGAKDHIMAGQSTFLTEL ETA ML
Sbjct  1042  TLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALML  1101

Query  3277  SSATRNSLVALDELGRGTSTSDGQAIA  3357
             SSATRNSLV LDELGRGTSTSDGQAIA
Sbjct  1102  SSATRNSLVVLDELGRGTSTSDGQAIA  1128


 Score =   107 bits (266),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYG++VL +RI+VYWPLDK WYEGCVKSFDK   KHLVQYDD E+E+L+L +E+IEW++ 
Sbjct  100  SYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQE  159

Query  358  PVVTKFRRLRR  390
              V+  +RLRR
Sbjct  160  S-VSLLKRLRR  169



>ref|XP_006841417.1| hypothetical protein AMTR_s00003p00029910 [Amborella trichopoda]
 gb|ERN03092.1| hypothetical protein AMTR_s00003p00029910 [Amborella trichopoda]
Length=1362

 Score =  1252 bits (3240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/1032 (63%), Positives = 798/1032 (77%), Gaps = 14/1032 (1%)
 Frame = +1

Query  595   KAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQS----KAPTATGGVKVIES--VTNNLE  756
             +A  +++K  + + L S   +K K G   +  +S    K      G  V ES    NN+ 
Sbjct  273   QASKKRKKGQDSINLGSRSGRKPKGGTEGRFEKSGDSQKFNFKDKGNAVSESPKTPNNVH  332

Query  757   C-VKASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFL  933
               +K     D LT + A RF  RE EK  FLG GRRDA+ R+PGD+NYDS+TLYLP  FL
Sbjct  333   GELKQCLPKDCLTADVAGRFCAREAEKFEFLGTGRRDANGRKPGDLNYDSKTLYLPQKFL  392

Query  934   KGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPE  1113
             KGL+G QRQWW+FKSKHMDKVLFFKMGKFYELFEMDAH GAKEL+LQYM GEQPHCGFPE
Sbjct  393   KGLTGAQRQWWDFKSKHMDKVLFFKMGKFYELFEMDAHTGAKELELQYMAGEQPHCGFPE  452

Query  1114  KNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGE  1290
             KNFS+N EKLARKGYRVLVVEQIETP+QLELRR++ GSKDKVVKRE CAVITKGTL EGE
Sbjct  453   KNFSVNVEKLARKGYRVLVVEQIETPDQLELRRREMGSKDKVVKREACAVITKGTLAEGE  512

Query  1291  MLTVSPDASYLIAVTESCQTSANQLGERTY-GVCVVDVATSKVILGQFAddsdcsslcsl  1467
             M++++PDASYL++VTE   TS ++  + T  G+C+VDV+TSK +LGQF DD++   LCS+
Sbjct  513   MMSMNPDASYLMSVTEDIHTSMDEKNDDTILGICIVDVSTSKFMLGQFGDDAERRRLCSI  572

Query  1468  lYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLN  1647
             L E RPVE+IKP   L  ETE+VL  HTR+PLVNELVP  EFWDAE+TISE+ N+Y+   
Sbjct  573   LSELRPVELIKPTGALHPETEKVLIVHTRDPLVNELVPGLEFWDAERTISELTNLYKLFK  632

Query  1648  -NTPIPYSQNEADLHPSESID-NDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQ  1821
              N  +    +  +L   E+    +++L  LP V+SELV AGENG YALSA GG LFYL+Q
Sbjct  633   ENIALGCLSDTENLRVCENPHIGESELEYLPIVISELVGAGENGQYALSAFGGCLFYLRQ  692

Query  1822  AFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             A+LD S+L+FA+FE L         Q+ YM LDAAALENLEIFEN+ N G++GTL+AQ++
Sbjct  693   AYLDESVLRFAKFESLLSLGVSNAPQRSYMTLDAAALENLEIFENNCNRGTAGTLFAQVD  752

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLL  2181
             HCVTAFGKRLLR WLARPL  +++I +RQ+A+A LK   L   LEFRKE+ +LPDMERLL
Sbjct  753   HCVTAFGKRLLRNWLARPLNDIDSILDRQNAIADLKNAALSSALEFRKEMFKLPDMERLL  812

Query  2182  AQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLL  2361
             A++FA+SEA GRNA+ VVLYEDAAKKQL QF++ALRGC++M +A  S    LD  +S +L
Sbjct  813   ARVFANSEAKGRNASNVVLYEDAAKKQLVQFLAALRGCQSMASAYSSFANALDCMNSNVL  872

Query  2362  HDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLA  2541
               LLTPGKG+PD++ ++K F D FDW EA+ +G ++P EG D EYD+AC +++ +E  LA
Sbjct  873   RHLLTPGKGVPDIEPMLKYFVDAFDWSEADRTGHVVPHEGGDVEYDSACKTVKDIETCLA  932

Query  2542  KHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRK  2721
             +HLKEQ+K  GD SINYV+VGKD YLLEVPESL + +P++YEL+SS+KGYFRYW P I K
Sbjct  933   RHLKEQRKALGDASINYVSVGKDHYLLEVPESLQQNIPRDYELRSSRKGYFRYWTPEIMK  992

Query  2722  LMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGP  2901
              +GELS AE E+++ LK+ILQR I +FCEHH  WR+L+S +AELD L SL+IAS+Y+EGP
Sbjct  993   FLGELSHAEAEKDASLKTILQRFIVQFCEHHKKWRQLVSAVAELDALTSLAIASEYFEGP  1052

Query  2902  TCRPHIRELPSQDNVP---CLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLT  3072
              C P I  + S  +      L A++LGHPILR+D+L KG+FV ND+ +G A  + FILLT
Sbjct  1053  ACCPTILRMSSSGDGKEGFSLFAENLGHPILRSDALGKGSFVPNDLRIGTAEGARFILLT  1112

Query  3073  GPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTE  3252
             GPNMGGKSTLLRQVCLAVILAQVG+ VPA SF LSPVDRIFVRMGA+D+I  GQSTFLTE
Sbjct  1113  GPNMGGKSTLLRQVCLAVILAQVGSYVPAESFQLSPVDRIFVRMGARDNIFTGQSTFLTE  1172

Query  3253  LLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLA  3432
             L ET+SML SAT NSLVALDELGRGTSTSDGQAIA++VLEH VH + CRG+FSTHYH+LA
Sbjct  1173  LSETSSMLMSATSNSLVALDELGRGTSTSDGQAIADAVLEHLVHTIGCRGIFSTHYHQLA  1232

Query  3433  IDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEK  3612
             ++Y++D +VSLCHMACH+G+G+ G+EEVTFLYKLT G CP+SYGVNVARLAG+P +VL K
Sbjct  1233  VNYEKDPKVSLCHMACHVGKGVDGIEEVTFLYKLTPGACPKSYGVNVARLAGIPHSVLTK  1292

Query  3613  AAAKSREFEGVY  3648
             A  KS EFE  Y
Sbjct  1293  ANEKSVEFEARY  1304


 Score =   100 bits (249),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = +1

Query  181  YGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIETP  360
            YG+E + RRI+VYWPLDK WYEGC+K+ DK SGKH+V YDD +EE L+L +E+IEW+E P
Sbjct  146  YGEEFVGRRIRVYWPLDKEWYEGCIKAHDKPSGKHIVLYDDAQEEELDLEREKIEWVEPP  205

Query  361  VVTKFR-RLRR  390
              +K R RLRR
Sbjct  206  --SKRRGRLRR  214



>ref|XP_010259327.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X2 [Nelumbo 
nucifera]
Length=1174

 Score =  1248 bits (3230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/922 (71%), Positives = 766/922 (83%), Gaps = 11/922 (1%)
 Frame = +1

Query  610   KRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTAT--GGVKVIESVTN-NLECVKASNGD  780
             KRK  E  K+ S   KKIKS GN +         T   G +++E+ ++ N   V    G+
Sbjct  239   KRKNFEWDKVGS--GKKIKSVGNVEKGVLNVTKVTLDSGSRLVEAASDANRRYVSHITGN  296

Query  781   DILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQ  960
               LTG+SAERF++R+ EKL FLG+GRRD++RRRPGD NYD +TLYLPSDFLK LSGGQRQ
Sbjct  297   -TLTGDSAERFALRDAEKLRFLGEGRRDSERRRPGDANYDPKTLYLPSDFLKSLSGGQRQ  355

Query  961   WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEK  1140
             WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS+N EK
Sbjct  356   WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSLNVEK  415

Query  1141  LARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDAS  1317
             LARKGYRVLVVEQ ETPEQLELRRK KG KDKVVKREICAV+TKGTLTEGEM++V+PDAS
Sbjct  416   LARKGYRVLVVEQTETPEQLELRRKEKGCKDKVVKREICAVVTKGTLTEGEMMSVNPDAS  475

Query  1318  YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEII  1497
             YL+AV+E CQ S  Q  +   GVCVVDV+TS+ +LGQF DD + +SLCSLL E RPVEII
Sbjct  476   YLMAVSEGCQISGKQKEDVVIGVCVVDVSTSRFMLGQFGDDMERNSLCSLLSELRPVEII  535

Query  1498  KPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNE  1677
             KPA +LS ETE+VL  HTR+PL+N+LVP+ EFWDAEKTI+EV+ +Y+ LN + +  S NE
Sbjct  536   KPAHVLSPETEKVLLTHTRSPLINDLVPVLEFWDAEKTINEVRRIYKHLNQS-VSGSVNE  594

Query  1678  ADLHPSE-SIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFA  1854
             A L  S  S+ +D     LP+VLSELV+ G+NG+ ALSA GG LFYL+QA LD +LL+FA
Sbjct  595   ASLGNSAFSVGSDGS-GCLPDVLSELVSMGDNGSCALSAFGGCLFYLRQALLDETLLRFA  653

Query  1855  EFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLL  2034
             +FELLP S F  I QK YMVLDAAAL NLEIFEN+KN GSSGTLYAQ+NHCVTAFGKRLL
Sbjct  654   KFELLPCSGFHDIPQKSYMVLDAAALVNLEIFENNKNGGSSGTLYAQLNHCVTAFGKRLL  713

Query  2035  RTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANG  2214
             ++WLARPLYH+  I+ERQ+AVAGLKGV LP  +EFRKE+SRL DMERLLA++FA+SEANG
Sbjct  714   KSWLARPLYHVVLIRERQNAVAGLKGV-LPTAVEFRKEMSRLQDMERLLARLFANSEANG  772

Query  2215  RNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLP  2394
             RNANKVVLYEDAAKKQLQ+F +ALRGCE MV AC SLGA LD+  S LL  LLTPGKGLP
Sbjct  773   RNANKVVLYEDAAKKQLQEFTTALRGCELMVQACTSLGAILDSVKSHLLQHLLTPGKGLP  832

Query  2395  DVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFG  2574
             DV  ++K FKD FDW+EA+ +GRIIP EGVD EYD+AC  + ++E S  KHLKEQ+K+ G
Sbjct  833   DVHSILKHFKDAFDWIEADKTGRIIPHEGVDVEYDSACKKVEEIESSFLKHLKEQRKVLG  892

Query  2575  DTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
             D SI YVTVGK++YLLEVPES+   VP++YEL+SS+KG+FRYW P ++KL+GELSQAE E
Sbjct  893   DVSIKYVTVGKESYLLEVPESMQRTVPRDYELRSSRKGFFRYWTPTVKKLLGELSQAEAE  952

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             +ESKLKSILQ+LIG FCEHH  WR+L+ST AELDVLISL+IASDYYEG TC+P I  L  
Sbjct  953   KESKLKSILQKLIGHFCEHHIKWRQLVSTTAELDVLISLAIASDYYEGATCQPIISGLSC  1012

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQV  3114
                +PCL AK LGHP+LR+D+L KG FV NDV +GG+G  SFILLTGPNMGGKSTL+RQV
Sbjct  1013  STEMPCLSAKGLGHPVLRSDALGKGTFVPNDVCIGGSGSPSFILLTGPNMGGKSTLIRQV  1072

Query  3115  CLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRN  3294
             CLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKDHIM+GQSTF+TEL ETASMLSSATRN
Sbjct  1073  CLAVILAQLGADVPAESFELSPVDRIFVRMGAKDHIMSGQSTFMTELSETASMLSSATRN  1132

Query  3295  SLVALDELGRGTSTSDGQAIAE  3360
             SLV+LDELGRGTSTSDGQAIA+
Sbjct  1133  SLVSLDELGRGTSTSDGQAIAD  1154


 Score =   115 bits (289),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 72/104 (69%), Gaps = 14/104 (13%)
 Frame = +1

Query  115  SKSNKPLLVIGPSP-------------TPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCV  255
            +K  KP LV+G SP             TP S +  YG+EV+ +R++VYWPLDK WYEGCV
Sbjct  65   TKQRKPPLVVGSSPSRSPLTPLSEAVTTPVSGKKLYGEEVVGKRLRVYWPLDKSWYEGCV  124

Query  256  KSFDKISGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLR  387
            KSF+K +GKHLVQYDD EEE+L+L  E++EW +  V + FRRLR
Sbjct  125  KSFNKKTGKHLVQYDDAEEEVLDLGVEKVEWTKGEVRS-FRRLR  167



>ref|XP_009401273.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1256

 Score =  1233 bits (3190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1020 (63%), Positives = 780/1020 (76%), Gaps = 35/1020 (3%)
 Frame = +1

Query  589   SKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKA  768
             SK +   KR+ T  L  +   AKKIK   N + T SKA  +      +  ++N+      
Sbjct  205   SKNSTGSKRRKTMNLAKLDC-AKKIKFEKNRERTASKASLSMTESNAVAPLSNDRRVQVL  263

Query  769   SNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSG  948
              +    +T  +AERF  RE EK  FL +GRRD   RRPGD NYD RTLYLP +FL+ LSG
Sbjct  264   DSIGSTVTVEAAERFGKREAEKFRFLQEGRRDVRGRRPGDKNYDPRTLYLPPEFLRTLSG  323

Query  949   GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSM  1128
             GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGA+ELDLQYMKG              
Sbjct  324   GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGARELDLQYMKG--------------  369

Query  1129  NAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVS  1305
                      YRVLVVEQ ETPEQLE+RRK+ GSKDKVVKREICA++T+GTL EGE L  +
Sbjct  370   ---------YRVLVVEQTETPEQLEIRRKEMGSKDKVVKREICAMVTQGTLMEGESLLRN  420

Query  1306  PDASYLIAVTESCQT-SANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             PD SYL+++ E  ++      G    G+CVVDV+TSK ++GQF DD +   LCS+L E R
Sbjct  421   PDTSYLLSIAEHFRSLEVPGKGGVVIGLCVVDVSTSKFMVGQFEDDLERHWLCSILSELR  480

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             PVE+IKP+K LS ETERV+  +TRNPLVN L+P  EFWDAE+TI+E++  Y  L+   + 
Sbjct  481   PVEVIKPSKALSPETERVIKNNTRNPLVNNLLPFDEFWDAERTINEIRKYYS-LSEHYLA  539

Query  1663  YSQNEADLHPSESIDNDAQLR-NLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVS  1839
              +QN        S DN      +LP+VL+ELVN G +G+YALSALGG LFYL+QAFLD  
Sbjct  540   -AQNGCT-----SADNAGNCPVDLPDVLTELVNVGIDGSYALSALGGCLFYLRQAFLDEK  593

Query  1840  LLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAF  2019
             L+K A+FE L  S F    QKPYM+LDAAALENLEI EN+++ G SGTL+AQ++HCVTAF
Sbjct  594   LIKCAKFERLACSGFFNNLQKPYMILDAAALENLEILENNRSGGLSGTLFAQLDHCVTAF  653

Query  2020  GKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFAS  2199
             GKRLL+ WLARPLY + +I ERQDAVA  KG  L   LEFRKELS+L DMERLL+++F S
Sbjct  654   GKRLLKGWLARPLYDIRSIVERQDAVACFKGAGLTSALEFRKELSKLQDMERLLSRLFVS  713

Query  2200  SEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTP  2379
              EA+GRNAN+V+LYEDAAKK+LQ+FI++L GCE M+ AC SL   L +T+S LLH LLTP
Sbjct  714   CEAHGRNANRVILYEDAAKKRLQEFIASLHGCEAMIQACSSLDTVLTSTESTLLHYLLTP  773

Query  2380  GKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQ  2559
             GKGLPD+  VI+ FKD FDW EA+ +GRIIP EG D +YDAAC  L+ +E +L ++LKEQ
Sbjct  774   GKGLPDMCSVIEHFKDAFDWSEADRTGRIIPHEGGDVDYDAACKKLKDIESNLMRYLKEQ  833

Query  2560  QKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELS  2739
             +K+ G++ +NYV VGKD YLLEVPESL   VP EYELQSSKKGYFRYW P I+  + ELS
Sbjct  834   RKVLGNSEVNYVAVGKDLYLLEVPESLRGAVPAEYELQSSKKGYFRYWTPKIKDFLSELS  893

Query  2740  QAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHI  2919
             QAE E+ESKLK ILQRLIG+F EHHS WR+L+S IAELDVLISL+IASDYYEGPTCRP I
Sbjct  894   QAEAEKESKLKGILQRLIGQFSEHHSKWRQLVSVIAELDVLISLAIASDYYEGPTCRPVI  953

Query  2920  RELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKST  3099
             +E+   +N P L A+ LGHP+LR+D+L KG+FV NDV +GG G   FILLTGPNMGGKST
Sbjct  954   KEV-CHENEPYLSARGLGHPMLRSDALGKGSFVPNDVRIGGVGQPRFILLTGPNMGGKST  1012

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             LLRQVCLAV+LAQ+GADVPA  F+LSPVDRIFVRMGA+D+IMAGQSTFL EL ETA +LS
Sbjct  1013  LLRQVCLAVVLAQLGADVPAECFELSPVDRIFVRMGARDNIMAGQSTFLMELSETAGVLS  1072

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
             SAT+NSLVALDELGRGT+TSDGQAIA SV E+ VH+VQCRG+FSTHYHRL ++Y+++ +V
Sbjct  1073  SATQNSLVALDELGRGTATSDGQAIAASVFEYLVHRVQCRGLFSTHYHRLILEYEKNTKV  1132

Query  3460  SLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             S+CHMAC +G+G+GG+EEVTFLY+L  G+CP+SYGVNVARLAGLP +VL+KAA KS +FE
Sbjct  1133  SICHMACQVGKGVGGVEEVTFLYRLAPGSCPKSYGVNVARLAGLPSSVLQKAAKKSNDFE  1192


 Score = 95.9 bits (237),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 8/89 (9%)
 Frame = +1

Query  118  KSNKPLLVIGPSPTP------DSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISG  279
            K  KP LVI PSP         + ++ + +EV+ +RIKV+WPLDK WYEG V SFD++SG
Sbjct  46   KEKKPRLVIPPSPASGAKVPLTAAKNCHTKEVVGKRIKVFWPLDKAWYEGRVSSFDEMSG  105

Query  280  KHLVQYDDEEEEMLNLSQERIEWI--ETP  360
            KHL+ Y D EEE L+L +E+ EWI  ETP
Sbjct  106  KHLICYVDGEEEALDLGKEKFEWIGEETP  134



>ref|XP_004956779.1| PREDICTED: DNA mismatch repair protein MSH6-like [Setaria italica]
Length=1135

 Score =  1208 bits (3125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/1010 (62%), Positives = 776/1010 (77%), Gaps = 28/1010 (3%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN--KSTQSKAPTATGGVKVIESVTNNLECVKASNGDDILTGNSAERF  813
             +S K KK+  G  +  K    +A   +G V     ++   +     N +  LTG +AERF
Sbjct  87    ISKKRKKVDVGSLDCAKRFSFEAVNTSGKVDPEMRISCGQKEQTTGNANTALTGEAAERF  146

Query  814   SMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDK  993
             + R++EK  FLG+GR+DA  RRPG   YD RTL LPS FLKGL+GGQRQWWEFKS+HMDK
Sbjct  147   AQRDVEKFKFLGEGRKDAKGRRPGSPGYDPRTLLLPSQFLKGLTGGQRQWWEFKSQHMDK  206

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             VLFFKMGKFYELFEMDAH+GAK+LDLQYMKGEQPHCGFPEKN S+N EKLA+KGYRVLVV
Sbjct  207   VLFFKMGKFYELFEMDAHVGAKDLDLQYMKGEQPHCGFPEKNLSVNLEKLAKKGYRVLVV  266

Query  1174  EQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQT  1350
             EQ ETPEQLELRRK  G KDKVV+REICAV+TKGTLTEGE L  +PD  YL++VTES Q 
Sbjct  267   EQTETPEQLELRRKAMGIKDKVVRREICAVVTKGTLTEGEHLLANPDPLYLLSVTESHQQ  326

Query  1351  SANQLGER-TYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHET  1527
             S+ +  +  T GVC+VDV+T+K I+GQF DD +   LCS+L E RPVEIIKP K+LS ET
Sbjct  327   SSKKSEDTCTIGVCIVDVSTNKFIVGQFQDDPERHGLCSILSEMRPVEIIKPGKMLSPET  386

Query  1528  ERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESID  1707
             E+ L  +TR PL+NEL+P +EFWDAEKTI E+K  Y   +       QN           
Sbjct  387   EKALKNNTREPLINELLPSTEFWDAEKTIHEIKQYYSSADK------QNNV---------  431

Query  1708  NDAQ--LRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSH  1881
             ND Q  +  LPN+L++L+ AG+   YALSALGG+LFYL+Q  LD  +L  AEFE  P + 
Sbjct  432   NDVQDSMDCLPNLLNDLIGAGDK-IYALSALGGSLFYLRQTLLDEKILLCAEFE--PLAC  488

Query  1882  FGMIAQ-KPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPL  2058
              G+I   + +M+LDAAALENLE+ EN +  G SGTLYAQ+NHCVT FGKRLL+ W+ARPL
Sbjct  489   SGLINNIRKHMILDAAALENLELLENIRTGGLSGTLYAQLNHCVTGFGKRLLKRWIARPL  548

Query  2059  YHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVL  2238
             Y   AI  RQ A+A  KGV     ++FRK+LSRLPDMERLLA++F+S + N RN++ VVL
Sbjct  549   YDRGAILRRQSAIATFKGVGHDYAVQFRKDLSRLPDMERLLARLFSSCDKNKRNSS-VVL  607

Query  2239  YEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQ  2418
             YEDA+K+ LQQF +ALRGC+ M +AC S+ +TL  T+   L+DLL+PG GLPDV  ++ +
Sbjct  608   YEDASKRLLQQFTAALRGCQQMFHACSSI-STLICTEESQLNDLLSPGTGLPDVSSILDR  666

Query  2419  FKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVT  2598
             F+D FDW +A+S+GR+IP EG D EYDA C +++++  SL ++LK+Q+KL    S++YV 
Sbjct  667   FRDAFDWSDADSNGRVIPREGCDPEYDATCNAIQEIGSSLKEYLKKQRKLLRCASVDYVN  726

Query  2599  VGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSI  2778
             VGKD YL+EVPESL   VP  YELQS+KKG++RYW P ++ L+ ELS+AE ERES LK I
Sbjct  727   VGKDMYLIEVPESLGGSVPGNYELQSTKKGFYRYWTPELKDLISELSKAEAERESILKGI  786

Query  2779  LQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLV  2958
             LQ LI  F EHHS WR+L+S +AELDVLISLSIASDY+EG +CRP I+E    D+ P   
Sbjct  787   LQNLIQLFVEHHSEWRQLVSVVAELDVLISLSIASDYFEGASCRPTIKESNGPDDTPTFH  846

Query  2959  AKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQ  3138
             A++LGHPILR+DSL KG+FV NDV +GG G++SFI+LTGPNMGGKSTLLRQVCL +ILAQ
Sbjct  847   ARNLGHPILRSDSLGKGSFVPNDVKIGGPGNASFIVLTGPNMGGKSTLLRQVCLTIILAQ  906

Query  3139  VGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDEL  3318
             +GADVPA + +LS VDRIFVRMGA+DHIM+GQSTFL EL+ETAS+LSSAT+NSLV LDEL
Sbjct  907   IGADVPAENLELSLVDRIFVRMGARDHIMSGQSTFLVELMETASVLSSATKNSLVVLDEL  966

Query  3319  GRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL  3498
             GRGTSTSDGQAIA SVLE+ VH+VQC G+FSTHYHRLA++++ D +VSLCHMAC +G+G 
Sbjct  967   GRGTSTSDGQAIAASVLEYLVHQVQCLGLFSTHYHRLAVEHK-DAKVSLCHMACEVGKGE  1025

Query  3499  GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             GGLEEVTFLY+LT G CP+SYGVNVARLAG+P +VL++A  KS +FE  Y
Sbjct  1026  GGLEEVTFLYRLTPGACPKSYGVNVARLAGIPASVLQRANEKSNDFEANY  1075



>ref|XP_008345257.1| PREDICTED: DNA mismatch repair protein MSH6-like [Malus domestica]
Length=1175

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/918 (68%), Positives = 724/918 (79%), Gaps = 30/918 (3%)
 Frame = +1

Query  559   NGLRRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVK-VIE  735
             N  +RG SG        +RK + G  L S  AKK K GGN             G K V  
Sbjct  253   NKRKRGDSG-------GRRKLSGGGSLGS--AKKTKCGGN---------VGMNGXKGVSP  294

Query  736   SVTNNLECVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTL  912
               T N E  KA+NG D +L+G+++ RFS+RE EKL FLG+ R DA RR  GD  YD RTL
Sbjct  295   EPTPNAEGTKATNGMDTVLSGDASXRFSLREAEKLHFLGEQRMDAKRRSLGDAXYDPRTL  354

Query  913   YLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQ  1092
             YLP  FLK LSGGQRQWWEFKSKHMDKV+FFKMGKFYELFEMDAHIGAKEL LQYMKGEQ
Sbjct  355   YLPPGFLKSLSGGQRQWWEFKSKHMDKVIFFKMGKFYELFEMDAHIGAKELGLQYMKGEQ  414

Query  1093  PHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDK---------VVK  1242
             PHCGFPEKNFSMN EKLARKGYRVLVVEQ ETP Q++LRRK  GS DK         VVK
Sbjct  415   PHCGFPEKNFSMNVEKLARKGYRVLVVEQTETPXQMDLRRKXDGSIDKXCSFFTCRSVVK  474

Query  1243  REICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVIL  1422
             REICAV+TKGTLTEGEML+ +PDASYL+AVTE+ Q  AN+  ER +GVCVVDVATS+VIL
Sbjct  475   REICAVVTKGTLTEGEMLSANPDASYLMAVTENSQNLANENAERVFGVCVVDVATSRVIL  534

Query  1423  GQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDA  1602
             GQF DD +CS+L  LL E RPVEI+KPA LLS ETE+VL RHTR+PLVNELVP+ EF DA
Sbjct  535   GQFGDDLECSALSCLLSELRPVEIVKPANLLSPETEKVLIRHTRSPLVNELVPVLEFLDA  594

Query  1603  EKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYA  1782
             E+T+ EV+++Y+R ++  +  S  +   H S+S   +     LP+VLSE+V AGENG  A
Sbjct  595   ERTVQEVRSIYRRADDQDVSGSPKKDGFHGSDSHLEEDSYGCLPDVLSEMVRAGENGISA  654

Query  1783  LSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSK  1962
             LSALGG LFYLKQAFLD ++L+FA+FELLP S FG    KPYMVLD+AALENLEIFEN++
Sbjct  655   LSALGGALFYLKQAFLDETILRFAKFELLPSSGFGDTVSKPYMVLDSAALENLEIFENNR  714

Query  1963  NCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFR  2142
             N  SSGTLYAQ+NHCVT FGKRLLRTWLARPLYH+E IK+RQDAVA L+GVNLP  LEF 
Sbjct  715   NGDSSGTLYAQLNHCVTGFGKRLLRTWLARPLYHVELIKQRQDAVASLRGVNLPYALEFH  774

Query  2143  KELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFS  2322
             K +SRLPDMERLL ++F+SS A GRNA KVVLYEDAAKKQLQ+FISALRGCE M   C S
Sbjct  775   KAVSRLPDMERLLVRVFSSSNACGRNAKKVVLYEDAAKKQLQEFISALRGCELMAQTCCS  834

Query  2323  LGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDA  2502
             L   L+N +S  LH LLT GKGLPDV  V+K FKD FDWVEAN+SGRIIP EGVD EYD+
Sbjct  835   LNVILENVESAQLHHLLTLGKGLPDVNSVLKHFKDAFDWVEANNSGRIIPHEGVDIEYDS  894

Query  2503  ACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSK  2682
             AC  ++++E  L KHL+EQ+KL GD SI YVTVGKD+YLLE+PESLC  +P +YEL+SSK
Sbjct  895   ACEKVKEIESHLTKHLQEQRKLLGDKSITYVTVGKDSYLLEMPESLCSCIPPDYELRSSK  954

Query  2683  KGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVL  2862
             KG+ RYW P I+K + ELSQAET++ES LKSILQRLIGRFCEH   WR+L+S  AE+DVL
Sbjct  955   KGFSRYWTPDIKKSLTELSQAETDKESSLKSILQRLIGRFCEHRLKWRQLVSVTAEIDVL  1014

Query  2863  ISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG  3042
             ISL+IASDY+EGP+C+P +      + VP   AKSLGHP+LR+DSL KG FVSND+++GG
Sbjct  1015  ISLAIASDYFEGPSCQPVVMSSSCTNEVPRFSAKSLGHPVLRSDSLGKGTFVSNDISIGG  1074

Query  3043  AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHI  3222
             +GH+SFILLTGPNMGGKSTL+RQVCLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKD+I
Sbjct  1075  SGHASFILLTGPNMGGKSTLIRQVCLAVILAQLGADVPAESFELSPVDRIFVRMGAKDNI  1134

Query  3223  MAGQSTFLTELLETASML  3276
             M GQSTFLTEL ETA+ML
Sbjct  1135  MVGQSTFLTELSETATML  1152


 Score = 90.5 bits (223),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 63/92 (68%), Gaps = 12/92 (13%)
 Frame = +1

Query  148  PSPT--------PDSTES---SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQ  294
            PSPT        P S  S   S+G EV+ +RIKVYWPLDK WYEG VK F+K SGKHLVQ
Sbjct  92   PSPTTPSPLDSKPSSKTSPKKSHGHEVVGKRIKVYWPLDKSWYEGYVKCFNKHSGKHLVQ  151

Query  295  YDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            YDD EEEML+L  E+IEW+    V  F+RLRR
Sbjct  152  YDDAEEEMLDLEMEKIEWVPE-TVKIFKRLRR  182



>ref|XP_003576514.1| PREDICTED: DNA mismatch repair protein MSH6 [Brachypodium distachyon]
Length=1318

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/962 (63%), Positives = 754/962 (78%), Gaps = 18/962 (2%)
 Frame = +1

Query  772   NGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGG  951
             N   +LTG  AERF  R+ EK  FLG GR+DA  RRPG   YD RTL LP  FL  L+GG
Sbjct  312   NAHTVLTGELAERFGQRQAEKFKFLGDGRKDAKGRRPGHPAYDPRTLSLPPQFLANLTGG  371

Query  952   QRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMN  1131
             QRQWWEFKS+HMDKVLFFKMGKFYEL+EMDAH+GA+ELDLQYMKG+QPHCGFPEKN S+N
Sbjct  372   QRQWWEFKSQHMDKVLFFKMGKFYELYEMDAHVGARELDLQYMKGDQPHCGFPEKNLSVN  431

Query  1132  AEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSP  1308
              EKLA+KGYRVLVVEQ ETP QLELRRK+ G+KDKVV+REICA++TKGTLTEGE L  +P
Sbjct  432   LEKLAQKGYRVLVVEQTETPNQLELRRKETGTKDKVVRREICAMVTKGTLTEGEFLLANP  491

Query  1309  DASYLIAVTESCQTSANQLGE-RTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRP  1485
             D SY+++V ES Q S+ +  +  T GVC+VDV+TSK ++GQF DD++   LCS+L E RP
Sbjct  492   DPSYILSVAESYQHSSKKSQDGHTIGVCIVDVSTSKFVVGQFQDDAERHVLCSILSEIRP  551

Query  1486  VEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPY  1665
             VEIIKPAK+LS ETER L  +TR+PL+N+L+P +EFWDAEKTI E++  Y   ++  +  
Sbjct  552   VEIIKPAKMLSPETERALKNNTRDPLINDLLPSTEFWDAEKTIHEIEQYYS--SSDKLTT  609

Query  1666  SQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLL  1845
             SQN      +  + N+     LP +LSEL+ AG+   YALSALGG+LFYL+Q  LD  L+
Sbjct  610   SQN------TPGVQNNVGC--LPALLSELIGAGDRA-YALSALGGSLFYLRQVLLDKKLI  660

Query  1846  KFAEFELLPFSHFGMIAQ-KPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFG  2022
               AEFE  P +  G++   + +M+ DAAALENLEI EN+   G SGTLYAQ+NHCVT FG
Sbjct  661   PCAEFE--PLTCSGLLNNTRKHMIFDAAALENLEILENATG-GLSGTLYAQLNHCVTGFG  717

Query  2023  KRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS  2202
             KRLL+ W+ RPLY  +AI +RQ A+A  KGV     ++FRK+LSRLPDMERLLA++F+S 
Sbjct  718   KRLLKRWIVRPLYDSKAILQRQGAIAIFKGVGHECAIQFRKDLSRLPDMERLLARLFSSC  777

Query  2203  EANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPG  2382
             + NGR++  VVLYED +K+ LQQF SALRGC+ M  AC S+        S LL+DLL+PG
Sbjct  778   DENGRSSKSVVLYEDVSKRLLQQFTSALRGCQQMFQACSSVRMLTGTEGSCLLNDLLSPG  837

Query  2383  KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQ  2562
             KGLPDV  ++  F+D FDW EA+ +GRIIP EG D EYDA C ++ ++E SL ++LKEQ+
Sbjct  838   KGLPDVSSILDHFRDAFDWSEADHNGRIIPHEGCDPEYDATCSAIEEIESSLKEYLKEQR  897

Query  2563  KLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQ  2742
             +L  D+S+ YV VGKD YL+EV ESL   VP+ YELQS+KKG++RYW P +++L+ ELS+
Sbjct  898   ELLADSSVKYVDVGKDTYLIEVSESLGGSVPRNYELQSTKKGFYRYWTPEVKELISELSK  957

Query  2743  AETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIR  2922
             A   +ES LK ILQ+LI  F EHHS WR+L+S +AE+DVLISL+IASDY+EGPTCRP IR
Sbjct  958   AAAGKESILKGILQKLIHLFVEHHSKWRQLVSVVAEIDVLISLAIASDYFEGPTCRPTIR  1017

Query  2923  ELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTL  3102
             E    D+ P   A++LGHPI+R+DSL KG+FV ND+ +GG G++SFI+LTGPNMGGKSTL
Sbjct  1018  ESYGSDDTPTFYARNLGHPIIRSDSLGKGSFVPNDIKMGGPGNASFIVLTGPNMGGKSTL  1077

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             LRQVCL +ILAQ+GA+VPA +F+ S VDRIFVRMGA+DHIMAGQSTFL EL+ETAS+LSS
Sbjct  1078  LRQVCLTIILAQIGANVPAENFEFSLVDRIFVRMGARDHIMAGQSTFLVELMETASVLSS  1137

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT+NSLVALDELGRGTSTSDGQAIA SVLE+ VH VQC G+FSTHYHRLA++ Q+D +VS
Sbjct  1138  ATKNSLVALDELGRGTSTSDGQAIAASVLEYLVHHVQCLGLFSTHYHRLAVE-QQDIKVS  1196

Query  3463  LCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEG  3642
             LCHMAC +G G GGLEEVTFLY+LT G+CP+SYGVNVARLAG+P +VL++A  KS EFE 
Sbjct  1197  LCHMACEVGMGEGGLEEVTFLYRLTAGSCPKSYGVNVARLAGIPASVLQRANQKSNEFEA  1256

Query  3643  VY  3648
              Y
Sbjct  1257  NY  1258


 Score = 77.4 bits (189),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 4/71 (6%)
 Frame = +1

Query  190  EVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIE----T  357
            E + RR++VYWPLD  WYEG V  +D+ S +H V+YDD E+E ++L +E+ EW       
Sbjct  119  EAVGRRLRVYWPLDDAWYEGRVDDYDEGSRRHRVKYDDGEDEEVDLRKEKFEWAAEEATP  178

Query  358  PVVTKFRRLRR  390
            P   K RRLRR
Sbjct  179  PPARKLRRLRR  189



>gb|KDO87014.1| hypothetical protein CISIN_1g000778mg [Citrus sinensis]
Length=1122

 Score =  1205 bits (3118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/840 (73%), Positives = 713/840 (85%), Gaps = 7/840 (1%)
 Frame = +1

Query  763   KASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKG  939
             K SNG D+ + G+ +ERFS RE +K  FLG  RRDA RRRPGDV YD RTLYLP DFL+ 
Sbjct  267   KLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRN  326

Query  940   LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKN  1119
             LS GQ+QWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPE+N
Sbjct  327   LSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERN  386

Query  1120  FSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEML  1296
             FSMN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE+L
Sbjct  387   FSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELL  446

Query  1297  TVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYE  1476
             + +PDASYL+A+TES Q+ A+Q  +R +G+CVVDVATS++ILGQ  DD DCS LC LL E
Sbjct  447   SANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSE  506

Query  1477  FRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTP  1656
              RPVEIIKPA +LS ETER + RHTRNPLVN+LVPLSEFWDAE T+ E+KN+Y R+    
Sbjct  507   LRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAE-  565

Query  1657  IPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDV  1836
                S N+AD + + S      L  LP +LSEL++ G++G+  LSALGGTLFYLK++FLD 
Sbjct  566   ---SLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDE  622

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             +LL+FA+FELLP S FG +A+KPYMVLDA ALENLE+FENS++  SSGTLYAQ+NHCVTA
Sbjct  623   TLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTA  682

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
             FGKRLLRTWLARPLY+   I+ERQDAVAGL+GVN P  LEFRK LSRLPDMERLLA++FA
Sbjct  683   FGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA  742

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             SSEANGRN+NKVVLYEDAAKKQLQ+FISAL GCE M  AC SLGA L+NT+S+ LH +LT
Sbjct  743   SSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILT  802

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PGKGLP +  ++K FKD FDWVEAN+SGRIIP  GVD +YD+AC  ++++E SL KHLKE
Sbjct  803   PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKE  862

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GDTSI YVT+GKD YLLEVPESL   VP++YEL+SSKKG+FRYW P I+KL+GEL
Sbjct  863   QRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGEL  922

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPH  2916
             SQAE+E+ES LKSILQRLIG+FCEHH+ WR++++  AELD LISL+IASD+YEGPTCRP 
Sbjct  923   SQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPV  982

Query  2917  IRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKS  3096
             I +  S +  P + AKSLGHP+LR+DSL KG FV ND+T+GG G++SFILLTGPNMGGKS
Sbjct  983   ILDSCSNEE-PYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKS  1041

Query  3097  TLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASML  3276
             TLLRQVCLAVILAQVGADVPA  F++SPVDRIFVRMGAKDHIMAGQSTFLTEL ETA ML
Sbjct  1042  TLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALML  1101


 Score =   106 bits (265),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYG++VL +RI+VYWPLDK WYEGCVKSFDK   KHLVQYDD E+E+L+L +E+IEW++ 
Sbjct  100  SYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQE  159

Query  358  PVVTKFRRLRR  390
              V+  +RLRR
Sbjct  160  S-VSLLKRLRR  169



>ref|XP_010259328.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X3 [Nelumbo 
nucifera]
Length=1135

 Score =  1199 bits (3103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/900 (70%), Positives = 740/900 (82%), Gaps = 11/900 (1%)
 Frame = +1

Query  610   KRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTAT--GGVKVIESVTN-NLECVKASNGD  780
             KRK  E  K+ S   KKIKS GN +         T   G +++E+ ++ N   V    G+
Sbjct  239   KRKNFEWDKVGS--GKKIKSVGNVEKGVLNVTKVTLDSGSRLVEAASDANRRYVSHITGN  296

Query  781   DILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQ  960
               LTG+SAERF++R+ EKL FLG+GRRD++RRRPGD NYD +TLYLPSDFLK LSGGQRQ
Sbjct  297   -TLTGDSAERFALRDAEKLRFLGEGRRDSERRRPGDANYDPKTLYLPSDFLKSLSGGQRQ  355

Query  961   WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEK  1140
             WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFS+N EK
Sbjct  356   WWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSLNVEK  415

Query  1141  LARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVSPDAS  1317
             LARKGYRVLVVEQ ETPEQLELRRK KG KDKVVKREICAV+TKGTLTEGEM++V+PDAS
Sbjct  416   LARKGYRVLVVEQTETPEQLELRRKEKGCKDKVVKREICAVVTKGTLTEGEMMSVNPDAS  475

Query  1318  YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEII  1497
             YL+AV+E CQ S  Q  +   GVCVVDV+TS+ +LGQF DD + +SLCSLL E RPVEII
Sbjct  476   YLMAVSEGCQISGKQKEDVVIGVCVVDVSTSRFMLGQFGDDMERNSLCSLLSELRPVEII  535

Query  1498  KPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNE  1677
             KPA +LS ETE+VL  HTR+PL+N+LVP+ EFWDAEKTI+EV+ +Y+ LN + +  S NE
Sbjct  536   KPAHVLSPETEKVLLTHTRSPLINDLVPVLEFWDAEKTINEVRRIYKHLNQS-VSGSVNE  594

Query  1678  ADLHPSE-SIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFA  1854
             A L  S  S+ +D     LP+VLSELV+ G+NG+ ALSA GG LFYL+QA LD +LL+FA
Sbjct  595   ASLGNSAFSVGSDGS-GCLPDVLSELVSMGDNGSCALSAFGGCLFYLRQALLDETLLRFA  653

Query  1855  EFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLL  2034
             +FELLP S F  I QK YMVLDAAAL NLEIFEN+KN GSSGTLYAQ+NHCVTAFGKRLL
Sbjct  654   KFELLPCSGFHDIPQKSYMVLDAAALVNLEIFENNKNGGSSGTLYAQLNHCVTAFGKRLL  713

Query  2035  RTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANG  2214
             ++WLARPLYH+  I+ERQ+AVAGLKGV LP  +EFRKE+SRL DMERLLA++FA+SEANG
Sbjct  714   KSWLARPLYHVVLIRERQNAVAGLKGV-LPTAVEFRKEMSRLQDMERLLARLFANSEANG  772

Query  2215  RNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLP  2394
             RNANKVVLYEDAAKKQLQ+F +ALRGCE MV AC SLGA LD+  S LL  LLTPGKGLP
Sbjct  773   RNANKVVLYEDAAKKQLQEFTTALRGCELMVQACTSLGAILDSVKSHLLQHLLTPGKGLP  832

Query  2395  DVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFG  2574
             DV  ++K FKD FDW+EA+ +GRIIP EGVD EYD+AC  + ++E S  KHLKEQ+K+ G
Sbjct  833   DVHSILKHFKDAFDWIEADKTGRIIPHEGVDVEYDSACKKVEEIESSFLKHLKEQRKVLG  892

Query  2575  DTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
             D SI YVTVGK++YLLEVPES+   VP++YEL+SS+KG+FRYW P ++KL+GELSQAE E
Sbjct  893   DVSIKYVTVGKESYLLEVPESMQRTVPRDYELRSSRKGFFRYWTPTVKKLLGELSQAEAE  952

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             +ESKLKSILQ+LIG FCEHH  WR+L+ST AELDVLISL+IASDYYEG TC+P I  L  
Sbjct  953   KESKLKSILQKLIGHFCEHHIKWRQLVSTTAELDVLISLAIASDYYEGATCQPIISGLSC  1012

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQV  3114
                +PCL AK LGHP+LR+D+L KG FV NDV +GG+G  SFILLTGPNMGGKSTL+RQV
Sbjct  1013  STEMPCLSAKGLGHPVLRSDALGKGTFVPNDVCIGGSGSPSFILLTGPNMGGKSTLIRQV  1072

Query  3115  CLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRN  3294
             CLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKDHIM+GQSTF+TEL ETASML    RN
Sbjct  1073  CLAVILAQLGADVPAESFELSPVDRIFVRMGAKDHIMSGQSTFMTELSETASMLVVWARN  1132


 Score =   115 bits (289),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 72/104 (69%), Gaps = 14/104 (13%)
 Frame = +1

Query  115  SKSNKPLLVIGPSP-------------TPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCV  255
            +K  KP LV+G SP             TP S +  YG+EV+ +R++VYWPLDK WYEGCV
Sbjct  65   TKQRKPPLVVGSSPSRSPLTPLSEAVTTPVSGKKLYGEEVVGKRLRVYWPLDKSWYEGCV  124

Query  256  KSFDKISGKHLVQYDDEEEEMLNLSQERIEWIETPVVTKFRRLR  387
            KSF+K +GKHLVQYDD EEE+L+L  E++EW +  V + FRRLR
Sbjct  125  KSFNKKTGKHLVQYDDAEEEVLDLGVEKVEWTKGEVRS-FRRLR  167



>ref|XP_006661208.1| PREDICTED: DNA mismatch repair protein MSH6-like, partial [Oryza 
brachyantha]
Length=1227

 Score =  1199 bits (3102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/997 (62%), Positives = 756/997 (76%), Gaps = 22/997 (2%)
 Frame = +1

Query  772   NGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGG  951
             N    LTG  AERF  R+ EK  FLG+GR+DA  RRPG+ +YD RTL L   FL GL+GG
Sbjct  226   NAHTALTGEVAERFGQRQAEKFKFLGEGRKDAKGRRPGNPSYDPRTLSLSPQFLNGLTGG  285

Query  952   QRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMN  1131
             QRQWWEFKS+HMDKVLFFKMGKFYELFEMDAH+GAKELDLQYMKG+QPHCGFPEKNF +N
Sbjct  286   QRQWWEFKSQHMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGDQPHCGFPEKNFEVN  345

Query  1132  AEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSP  1308
              EKLA+KGYRVLVVEQ ETPEQLELRRKK G KDKVV+REICA +TKGTLTEGE L  +P
Sbjct  346   LEKLAKKGYRVLVVEQTETPEQLELRRKKTGVKDKVVRREICATVTKGTLTEGESLLANP  405

Query  1309  DASYLIAVTES--CQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             D  YL +V ES  C +  N+ G  T GVC+VDV+TSK I+GQF DD +   LCS+L E R
Sbjct  406   DPLYLFSVAESYQCFSDKNKEG-LTIGVCIVDVSTSKFIVGQFQDDPERHGLCSILSEIR  464

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             P EIIKPA +LS ETE+ L  +TR+PL+N L+P  EFWDAEKTI E+K  Y  L+ TP  
Sbjct  465   PAEIIKPANMLSPETEKALKSNTRDPLINNLLPSMEFWDAEKTIHEIKQYYCSLD-TPTA  523

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
              +QN                 +LP +L EL+ AG+  TYALSALGG+LFYL+QA LD  L
Sbjct  524   GAQN--------------NFAHLPELLRELIEAGDK-TYALSALGGSLFYLRQALLDEKL  568

Query  1843  LKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFG  2022
             L  AEFE L  S      +K +M+LDAAALENLEI EN++N   SGTLYAQ+NHCVT FG
Sbjct  569   LPCAEFERLTCSGLTSPIRK-HMILDAAALENLEILENARNGDLSGTLYAQLNHCVTGFG  627

Query  2023  KRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS  2202
             KRLL+ W+ARPLY  + I +RQ A+A  KG      ++FRK+L+RLPDMERLLA++F+S 
Sbjct  628   KRLLKRWIARPLYDHQEILQRQSAIATFKGSGHECAIQFRKDLTRLPDMERLLARLFSSC  687

Query  2203  EANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPG  2382
             + NGR++  VVLYEDA+K+ L QF +ALRGC+ M  AC S+        S LL+DLL+PG
Sbjct  688   DKNGRSSKSVVLYEDASKRLLYQFTTALRGCQQMYYACSSISMLTSTEGSSLLNDLLSPG  747

Query  2383  KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQ  2562
             K LP V  ++  F+D FDW EA+ +GRIIP EG D EYDAAC ++ ++E SL  +LKEQ+
Sbjct  748   KRLPHVSSILDHFRDAFDWAEADRNGRIIPREGCDPEYDAACIAIEEIESSLENYLKEQR  807

Query  2563  KLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQ  2742
             +L  D+S+ YV VGKD YL+E+P++L E VP+ Y+LQS+KKG++RYW P +++L+ ELS+
Sbjct  808   ELLSDSSLKYVNVGKDVYLIEMPDNLREFVPRNYQLQSTKKGFYRYWTPEVKELISELSK  867

Query  2743  AETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIR  2922
             AE E+E+KLK ILQ+LI  F EHHS WR+L+S +AELDVLISL+IASD++EGPTC P I+
Sbjct  868   AEAEKEAKLKCILQKLIQLFVEHHSKWRKLVSVVAELDVLISLAIASDFFEGPTCCPIIK  927

Query  2923  ELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTL  3102
             E    D+ P L A++LGHP LR+DSL  G+FV ND+ +GG G++SFI+LTGPNMGGKSTL
Sbjct  928   ESYGPDDTPILHARNLGHPTLRSDSLGSGSFVPNDIKMGGPGNASFIVLTGPNMGGKSTL  987

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             LRQVCL +ILAQ+GA+VPA SF+LS VDR+FVRMGA+DHIMAGQSTFL EL+ETAS+LSS
Sbjct  988   LRQVCLTIILAQIGANVPAESFELSLVDRMFVRMGARDHIMAGQSTFLVELMETASVLSS  1047

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT+NS+VALDELGRGTSTSDGQAIA SVLE+ VH+VQC G+FSTHYHRLA +  E  +VS
Sbjct  1048  ATKNSIVALDELGRGTSTSDGQAIAASVLEYLVHRVQCLGLFSTHYHRLAAE-NEGSKVS  1106

Query  3463  LCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEG  3642
             LCHMAC I +G GGLEEVTFLYKLT G+CP+SYGVNVARLAG+P +VL +A  KS +FE 
Sbjct  1107  LCHMACEISKGEGGLEEVTFLYKLTPGSCPKSYGVNVARLAGIPASVLRRANEKSIDFEA  1166

Query  3643  VYgnnkgsrgnssknWDEKAIEVIRSLMHLADYNERH  3753
              YG  +    N      E    VI+ L  +A    R 
Sbjct  1167  SYGKRQYITKNKLGCAQEDKFAVIKDLFRVAKAMHRQ  1203


 Score = 75.9 bits (185),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 6/74 (8%)
 Frame = +1

Query  187  QEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIE----  354
            +E + RR++VYWPLD  WYEG V+++D  S +H V+YDD EEE ++L+ ER EW      
Sbjct  45   EEKVGRRLRVYWPLDDAWYEGRVEAYDVGSRRHRVRYDDGEEEEVDLANERYEWAAGEER  104

Query  355  -TP-VVTKFRRLRR  390
             TP    K RRLRR
Sbjct  105  VTPQPARKLRRLRR  118



>gb|EAZ44682.1| hypothetical protein OsJ_29308 [Oryza sativa Japonica Group]
Length=1293

 Score =  1196 bits (3093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1052 (60%), Positives = 783/1052 (74%), Gaps = 27/1052 (3%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN--KSTQSKAPTATGGVKVIESVTNNLECVKASNGDDILTGNSAERF  813
             +S K +K+ +G  +  K    +    TG V++   ++ +       N    LTG  AERF
Sbjct  246   LSKKRRKVDAGALDCAKKFSFEPANTTGKVELKVPISCSQREQPLENALTALTGEVAERF  305

Query  814   SMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDK  993
             + R+ EK  FLG+GR+DA  RRPG+ NYD RTL LPS FL  L+GGQRQWWEFKS+HMDK
Sbjct  306   AQRQAEKFKFLGEGRKDAKGRRPGNPNYDPRTLSLPSQFLNSLTGGQRQWWEFKSQHMDK  365

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             VLFFKMGKFYELFEMDAH+GAKELDLQYMKG++PHCGFPEKNF +N EKLA+KGYRVLV+
Sbjct  366   VLFFKMGKFYELFEMDAHVGAKELDLQYMKGDKPHCGFPEKNFELNLEKLAKKGYRVLVI  425

Query  1174  EQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTES--C  1344
             EQ ETPEQL+LRRK+ G KDKVV+REICA++TKGTLTEGE L  +PD SYL +V ES  C
Sbjct  426   EQTETPEQLDLRRKETGVKDKVVRREICAMVTKGTLTEGESLLANPDPSYLFSVAESYQC  485

Query  1345  QTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHE  1524
              +  +Q G  T GVC+VDV+TSK I+GQF DD++   LCS+L E RP EIIKPAK+LS E
Sbjct  486   GSEKDQDGH-TIGVCIVDVSTSKFIVGQFQDDAERHGLCSILSEIRPAEIIKPAKMLSPE  544

Query  1525  TERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESI  1704
             TE+ L  +TR+PL+N L+P  EFWDAEKTI E+K  Y  L+ TP   +Q  +        
Sbjct  545   TEKALKSNTRDPLINNLLPSMEFWDAEKTIHEIKQYYCSLD-TPGAGAQISSAY------  597

Query  1705  DNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHF  1884
                     LP +LSEL+ AG+  TYALSALGG+LFYL+Q+ LD  LL  AEFE L  S  
Sbjct  598   --------LPELLSELIEAGDK-TYALSALGGSLFYLRQSLLDEKLLPCAEFERLTCSGL  648

Query  1885  GMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYH  2064
                 +K +M+LDAAALENLEI EN++N G SGTLYAQ+NHCVT FGKRLL+ W+ARPLY 
Sbjct  649   TNPIRK-HMILDAAALENLEILENARNGGLSGTLYAQLNHCVTGFGKRLLKRWIARPLYE  707

Query  2065  LEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYE  2244
              +AI +RQ A+A  KG      ++FRK+LSRLPDMERLLA++F+S + NGR++  VVLYE
Sbjct  708   RQAILQRQSAIATFKGSGHECAIQFRKDLSRLPDMERLLARLFSSCDKNGRSSKSVVLYE  767

Query  2245  DAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFK  2424
             DA+K+ L QF +ALRGC+ M  AC S+        S LL+DLL+ GKGLP V  ++  F+
Sbjct  768   DASKRLLHQFTAALRGCQQMFQACSSISMLTSTDGSSLLNDLLSLGKGLPHVSSILDHFR  827

Query  2425  DGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVG  2604
             D FDW EA+ +GRIIP EG D +YDAAC ++ ++E SL K+LKEQ+KL  D+S+ YV VG
Sbjct  828   DAFDWSEADRNGRIIPHEGCDPQYDAACIAIEEIESSLQKYLKEQRKLLSDSSVKYVDVG  887

Query  2605  KDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQ  2784
             KD YLLEV E+L   VP  YELQS+KKG++RYW P +++L+ ELS+AE E+E+KLK ILQ
Sbjct  888   KDTYLLEVSENLRGSVPHNYELQSTKKGFYRYWTPEVKELISELSKAEAEKEAKLKCILQ  947

Query  2785  RLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAK  2964
              LI  F EHHS WR+L+S +AELDVLISL+IASD++EGPTC P I+E    D+ P L A+
Sbjct  948   NLIQLFVEHHSKWRQLVSVVAELDVLISLAIASDFFEGPTCCPIIKESYGPDDTPTLHAR  1007

Query  2965  SLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVG  3144
             +LGHP LR+DSL  G+FV ND+ +GG G++SFI+LTGPNMGGKSTLLRQVCL +ILAQ+G
Sbjct  1008  NLGHPTLRSDSLGSGSFVPNDIKMGGPGNASFIVLTGPNMGGKSTLLRQVCLTIILAQIG  1067

Query  3145  ADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGR  3324
             A+VPA SF+LS VDR+FVRMGA+DHIMAGQSTFL EL+ETAS+LSSAT+NSLVALDELGR
Sbjct  1068  ANVPAESFELSLVDRMFVRMGARDHIMAGQSTFLVELMETASVLSSATKNSLVALDELGR  1127

Query  3325  GTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGG  3504
             GTSTSDGQAIA SVLE+ VH VQC G+FSTHYHRLA +  +D +VSLCHMAC I +G GG
Sbjct  1128  GTSTSDGQAIAASVLEYLVHHVQCLGLFSTHYHRLAAE-NKDSKVSLCHMACEISKGEGG  1186

Query  3505  LEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYgnnkgsrgnssk  3684
             LEEVTFLYKLT G+CP+SYGVNVARLAG+P +VL++A  KS +FE  YG   G   N   
Sbjct  1187  LEEVTFLYKLTPGSCPKSYGVNVARLAGIPASVLQRANEKSSDFEASYGKRPGITKNKPS  1246

Query  3685  nWDEKAIEVIRSLMHLAD---YNERHGGCVGF  3771
                E     I+ L  +     + E H   +G 
Sbjct  1247  CAQEDKFAAIKDLFRVVKAMHHREDHASSLGM  1278


 Score = 67.8 bits (164),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 8/76 (11%)
 Frame = +1

Query  187  QEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIE----  354
            +  + RR++VYWPLD  WYEG V+ +D  S +H V+YDD EEE+++L+ ER EW      
Sbjct  76   ETAVGRRLRVYWPLDDAWYEGRVEGYDVGSRRHRVRYDDGEEEVVDLASERYEWAAAADE  135

Query  355  ---TPVVT-KFRRLRR  390
               TP  + K RRLRR
Sbjct  136  EEVTPQPSRKLRRLRR  151



>ref|XP_008800759.1| PREDICTED: DNA mismatch repair protein MSH6 isoform X2 [Phoenix 
dactylifera]
Length=938

 Score =  1195 bits (3091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/861 (69%), Positives = 708/861 (82%), Gaps = 7/861 (1%)
 Frame = +1

Query  1075  YMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREI  1251
             Y++GEQPHCGFPEKNF+MN EKLARKGYRVLVVEQ ETPEQLELRRK+ GSKDKVVKREI
Sbjct  21    YVQGEQPHCGFPEKNFAMNLEKLARKGYRVLVVEQTETPEQLELRRKEMGSKDKVVKREI  80

Query  1252  CAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSAN-QLGERTYGVCVVDVATSKVILGQ  1428
             CA++TKGTLT+GE L  +PD SYL+++TE+CQ   N + GE   G+CVVDV+TSK ++GQ
Sbjct  81    CAMVTKGTLTDGESLLANPDTSYLMSITENCQCFENHKKGETIIGLCVVDVSTSKFMIGQ  140

Query  1429  FAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEK  1608
             F DDSD   LCS+L E RPVEIIKP+K+LS ETERVL  +TRNPLVN+LVP +EFWDAEK
Sbjct  141   FEDDSDRHCLCSILSELRPVEIIKPSKVLSPETERVLRNNTRNPLVNDLVPFTEFWDAEK  200

Query  1609  TISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALS  1788
              I EV+  Y    +  +P S N++     E+  +D+    LP V +ELV+AG++G YALS
Sbjct  201   AIGEVRKYYSL--SRKLPASANDSISANFENPASDSL--ALPYVFAELVSAGDDGLYALS  256

Query  1789  ALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNC  1968
             A GG LFYL+QAFLD +LL  A+FE LP S F    Q  YM+LDAAALENLEI EN++N 
Sbjct  257   AFGGCLFYLRQAFLDETLLNCAKFEPLPCSGFFSTIQNSYMILDAAALENLEILENNRNG  316

Query  1969  GSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKE  2148
             G SGTL+AQ++HC+TAFGKRLL+ WLARPLY+  +I ERQDA+A +KGV L  VLEFRKE
Sbjct  317   GPSGTLFAQLDHCMTAFGKRLLKRWLARPLYNTRSIVERQDAIAAMKGVGLAFVLEFRKE  376

Query  2149  LSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLG  2328
             LSRLPDMERLLA++FAS  ANGRN+N VVLYEDAAKKQL++FI+ALRGC+ MV AC SL 
Sbjct  377   LSRLPDMERLLARLFASCGANGRNSNGVVLYEDAAKKQLREFIAALRGCQLMVQACSSLS  436

Query  2329  ATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               L  T+S LLH LLTPGKGLPD+  ++  FKD FDW EA+ SGRIIP EG D EYD AC
Sbjct  437   PILSTTESSLLHHLLTPGKGLPDMCSLVSHFKDAFDWSEADCSGRIIPHEGGDVEYDLAC  496

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKG  2688
               ++++E +L ++LKEQ+KL GD SINYVTVGKD YLLEVPESL   VP +YELQSSKKG
Sbjct  497   KRVKEIESALTRYLKEQRKLLGDASINYVTVGKDMYLLEVPESLRGAVPSDYELQSSKKG  556

Query  2689  YFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLIS  2868
             YFRYW P I++ + E SQAE ++ESKLK ILQRLI  F EHHS WR+L+S  AELDVLIS
Sbjct  557   YFRYWTPKIKEFLSEHSQAEADKESKLKGILQRLIKYFSEHHSKWRQLVSATAELDVLIS  616

Query  2869  LSIASDYYEGPTCRPHIREL-PSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA  3045
             L+IASDYYEGP CRP I E+  S D +P L AKSLGHPIL++D+L KG+FV NDV++GGA
Sbjct  617   LAIASDYYEGPACRPFIMEICHSDDKLPFLSAKSLGHPILQSDALGKGSFVPNDVSIGGA  676

Query  3046  GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIM  3225
             G ++FILLTGPNMGGKSTLLRQVCL+VILAQ+GADVPA SF LSPVDRIFVRMGA+DHI+
Sbjct  677   GRANFILLTGPNMGGKSTLLRQVCLSVILAQIGADVPAESFKLSPVDRIFVRMGARDHII  736

Query  3226  AGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGM  3405
             AGQSTFL EL ETASMLSSAT+NSLVALDELGRGTSTSDGQAIA SVLE+ VH++QCRG+
Sbjct  737   AGQSTFLMELSETASMLSSATQNSLVALDELGRGTSTSDGQAIAASVLEYLVHRIQCRGL  796

Query  3406  FSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLA  3585
             FSTHYHRLA++Y++D +VSLCHMAC +G+G+ GLEEVTFLY+LT G+CP+SYGVNVARLA
Sbjct  797   FSTHYHRLAVEYEKDAKVSLCHMACQVGKGVSGLEEVTFLYRLTPGSCPKSYGVNVARLA  856

Query  3586  GLPDNVLEKAAAKSREFEGVY  3648
             G+P +VL+ A AKS EFE  Y
Sbjct  857   GIPASVLQTAMAKSSEFEAGY  877



>dbj|BAD36244.1| putative mismatch binding protein Mus3 [Oryza sativa Japonica 
Group]
 dbj|BAD36299.1| putative mismatch binding protein Mus3 [Oryza sativa Japonica 
Group]
Length=1253

 Score =  1195 bits (3091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/1006 (62%), Positives = 764/1006 (76%), Gaps = 25/1006 (2%)
 Frame = +1

Query  772   NGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGG  951
             N    LTG  AERF+ R+ EK  FLG+GR+DA  RRPG+ NYD RTL LPS FL  L+GG
Sbjct  252   NALTALTGEVAERFAQRQAEKFKFLGEGRKDAKGRRPGNPNYDPRTLSLPSQFLNSLTGG  311

Query  952   QRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMN  1131
             QRQWWEFKS+HMDKVLFFKMGKFYELFEMDAH+GAKELDLQYMKG++PHCGFPEKNF +N
Sbjct  312   QRQWWEFKSQHMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGDKPHCGFPEKNFELN  371

Query  1132  AEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSP  1308
              EKLA+KGYRVLV+EQ ETPEQL+LRRK+ G KDKVV+REICA++TKGTLTEGE L  +P
Sbjct  372   LEKLAKKGYRVLVIEQTETPEQLDLRRKETGVKDKVVRREICAMVTKGTLTEGESLLANP  431

Query  1309  DASYLIAVTES--CQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFR  1482
             D SYL +V ES  C +  +Q G  T GVC+VDV+TSK I+GQF DD++   LCS+L E R
Sbjct  432   DPSYLFSVAESYQCGSEKDQDGH-TIGVCIVDVSTSKFIVGQFQDDAERHGLCSILSEIR  490

Query  1483  PVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIP  1662
             P EIIKPAK+LS ETE+ L  +TR+PL+N L+P  EFWDAEKTI E+K  Y  L+ TP  
Sbjct  491   PAEIIKPAKMLSPETEKALKSNTRDPLINNLLPSMEFWDAEKTIHEIKQYYCSLD-TPGA  549

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
              +Q  +                LP +LSEL+ AG+  TYALSALGG+LFYL+Q+ LD  L
Sbjct  550   GAQISSAY--------------LPELLSELIEAGDK-TYALSALGGSLFYLRQSLLDEKL  594

Query  1843  LKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFG  2022
             L  AEFE L  S      +K +M+LDAAALENLEI EN++N G SGTLYAQ+NHCVT FG
Sbjct  595   LPCAEFERLTCSGLTNPIRK-HMILDAAALENLEILENARNGGLSGTLYAQLNHCVTGFG  653

Query  2023  KRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS  2202
             KRLL+ W+ARPLY  +AI +RQ A+A  KG      ++FRK+LSRLPDMERLLA++F+S 
Sbjct  654   KRLLKRWIARPLYERQAILQRQSAIATFKGSGHECAIQFRKDLSRLPDMERLLARLFSSC  713

Query  2203  EANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPG  2382
             + NGR++  VVLYEDA+K+ L QF +ALRGC+ M  AC S+        S LL+DLL+ G
Sbjct  714   DKNGRSSKSVVLYEDASKRLLHQFTAALRGCQQMFQACSSISMLTSTDGSSLLNDLLSLG  773

Query  2383  KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQ  2562
             KGLP V  ++  F+D FDW EA+ +GRIIP EG D +YDAAC ++ ++E SL K+LKEQ+
Sbjct  774   KGLPHVSSILDHFRDAFDWSEADRNGRIIPHEGCDPQYDAACIAIEEIESSLQKYLKEQR  833

Query  2563  KLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQ  2742
             KL  D+S+ YV VGKD YLLEV E+L   VP  YELQS+KKG++RYW P +++L+ ELS+
Sbjct  834   KLLSDSSVKYVDVGKDTYLLEVSENLRGSVPHNYELQSTKKGFYRYWTPEVKELISELSK  893

Query  2743  AETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIR  2922
             AE E+E+KLK ILQ LI  F EHHS WR+L+S +AELDVLISL+IASD++EGPTC P I+
Sbjct  894   AEAEKEAKLKCILQNLIQLFVEHHSKWRQLVSVVAELDVLISLAIASDFFEGPTCCPIIK  953

Query  2923  ELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTL  3102
             E    D+ P L A++LGHP LR+DSL  G+FV ND+ +GG G++SFI+LTGPNMGGKSTL
Sbjct  954   ESYGPDDTPTLHARNLGHPTLRSDSLGSGSFVPNDIKMGGPGNASFIVLTGPNMGGKSTL  1013

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             LRQVCL +ILAQ+GA+VPA SF+LS VDR+FVRMGA+DHIMAGQSTFL EL+ETAS+LSS
Sbjct  1014  LRQVCLTIILAQIGANVPAESFELSLVDRMFVRMGARDHIMAGQSTFLVELMETASVLSS  1073

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT+NSLVALDELGRGTSTSDGQAIA SVLE+ VH VQC G+FSTHYHRLA +  +D +VS
Sbjct  1074  ATKNSLVALDELGRGTSTSDGQAIAASVLEYLVHHVQCLGLFSTHYHRLAAE-NKDSKVS  1132

Query  3463  LCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEG  3642
             LCHMAC I +G GGLEEVTFLYKLT G+CP+SYGVNVARLAG+P +VL++A  KS +FE 
Sbjct  1133  LCHMACEISKGEGGLEEVTFLYKLTPGSCPKSYGVNVARLAGIPASVLQRANEKSSDFEA  1192

Query  3643  VYgnnkgsrgnssknWDEKAIEVIRSLMHLAD---YNERHGGCVGF  3771
              YG   G   N      E     I+ L  +     + E H   +G 
Sbjct  1193  SYGKRPGITKNKPSCAQEDKFAAIKDLFRVVKAMHHREDHASSLGM  1238


 Score = 67.8 bits (164),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 8/76 (11%)
 Frame = +1

Query  187  QEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIE----  354
            +  + RR++VYWPLD  WYEG V+ +D  S +H V+YDD EEE+++L+ ER EW      
Sbjct  66   ETAVGRRLRVYWPLDDAWYEGRVEGYDVGSRRHRVRYDDGEEEVVDLASERYEWAAAADE  125

Query  355  ---TPVVT-KFRRLRR  390
               TP  + K RRLRR
Sbjct  126  EEVTPQPSRKLRRLRR  141



>ref|XP_008652696.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein MSH6 
[Zea mays]
Length=1295

 Score =  1184 bits (3064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/955 (64%), Positives = 745/955 (78%), Gaps = 21/955 (2%)
 Frame = +1

Query  790   TGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
             TG++AERF  R+ EK  FLG+GR+DA  RRPG+  +D RTL LP  FLK L+GGQRQWWE
Sbjct  305   TGDAAERFGQRDAEKFKFLGEGRKDAKGRRPGNPGFDPRTLLLPPQFLKNLTGGQRQWWE  364

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
             FKS+HMDKVLFFKMGKFYELFEMDAH+GAK+LDLQYMKGEQPHCGFPEKN S+N EKLA 
Sbjct  365   FKSQHMDKVLFFKMGKFYELFEMDAHVGAKDLDLQYMKGEQPHCGFPEKNLSVNLEKLAE  424

Query  1150  KGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPDASYLI  1326
             KGYRVLVVEQ ETP+QLELRRK+ G KDKVV+REICAV+TKGTL EGE L  +PD SYL+
Sbjct  425   KGYRVLVVEQTETPDQLELRRKEMGIKDKVVRREICAVVTKGTLIEGEHLLANPDPSYLL  484

Query  1327  AVTESCQTSANQLGER-TYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKP  1503
             +VTES Q S N+  +  T GV +VDV+TSK I+GQF DD +   LCS+L E RPVEIIKP
Sbjct  485   SVTESYQRSPNKSQDTCTIGVSIVDVSTSKFIVGQFQDDPERHGLCSILSEMRPVEIIKP  544

Query  1504  AKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEAD  1683
             +K+LS ETE+ L+ +TR PL+NELVP +EFWDAEKTI E+K  Y   N       Q +AD
Sbjct  545   SKMLSPETEKALNNNTRKPLINELVPSTEFWDAEKTIDEIKQYYSSANK------QKKAD  598

Query  1684  LHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE  1863
                    D    +  LPN+L EL+ AG+  TYALSALGG+LFYL+Q  LD  +L  AEFE
Sbjct  599   -------DIQDCVDCLPNLLRELIGAGDK-TYALSALGGSLFYLRQTLLDEKILPCAEFE  650

Query  1864  LLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTW  2043
              L  S F    +K +M+LD AALENLE+ EN++  G SGTLYAQ+NHCVT FGKRLL+ W
Sbjct  651   PLACSGFINNIRK-HMILDTAALENLELLENTRTGGLSGTLYAQLNHCVTGFGKRLLKRW  709

Query  2044  LARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNA  2223
             +A+PLY    I  RQ AVA  KGV      +FRK+LSRLPDMERLLA++F + E   + +
Sbjct  710   IAKPLYDRREILRRQSAVATFKGVGQDCAAQFRKDLSRLPDMERLLARLFLNDE--NKRS  767

Query  2224  NKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVK  2403
             + VVLYEDA+KK LQQF SAL GC+ M +AC S+   + +  S+L+ DLL+PGKGL ++ 
Sbjct  768   SSVVLYEDASKKLLQQFTSALCGCQQMFHACSSISTLICSEGSQLI-DLLSPGKGLSNIS  826

Query  2404  LVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTS  2583
              ++ +F+D FDW EA+ +GRIIP EG D EYDA C ++ +++ SL ++LKEQ+KL    S
Sbjct  827   SILDRFRDAFDWSEADRNGRIIPSEGCDPEYDATCNAIEEIKSSLKEYLKEQRKLLRPAS  886

Query  2584  INYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
             +NYV VGKD YL+EVPESL   VP+ YELQS+KKG++RYW P +++L+ ELS+AE+E+ES
Sbjct  887   VNYVNVGKDMYLIEVPESLGGSVPRNYELQSTKKGFYRYWTPELKELILELSKAESEKES  946

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
             KLK+ILQ LI  F EHH+ WR+L+S +AELDVL SL+IAS Y+EGP+C P I+E    D+
Sbjct  947   KLKAILQNLIQLFVEHHTEWRQLVSVVAELDVLTSLAIASGYFEGPSCCPTIKESNGTDD  1006

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLA  3123
              P   A++LGHPILR+DSL KG+FV NDV +GG G++SFI+LTGPNMGGKSTLLRQVCL 
Sbjct  1007  TPTFHARNLGHPILRSDSLGKGSFVPNDVKIGGPGNASFIVLTGPNMGGKSTLLRQVCLT  1066

Query  3124  VILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLV  3303
             +ILAQ+GADVPA   +LS VDRIFVRMGA+DHIMAGQSTFL EL ETAS+LSSAT+NSLV
Sbjct  1067  IILAQIGADVPAEKLELSLVDRIFVRMGARDHIMAGQSTFLVELEETASVLSSATKNSLV  1126

Query  3304  ALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACH  3483
              LDELGRGTSTSDGQAIA SVLE+ VH+VQC G+FSTHYHRLA+++  D +VSLCHMAC 
Sbjct  1127  VLDELGRGTSTSDGQAIAASVLEYLVHQVQCLGLFSTHYHRLAMEHN-DTKVSLCHMACE  1185

Query  3484  IGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             + EG+GGLEEVTFLY+LT G CP+SYGVNVARLAG+P  +L++A  KS EFE  Y
Sbjct  1186  VVEGVGGLEEVTFLYRLTPGACPKSYGVNVARLAGIPTKLLQRANEKSSEFEANY  1240


 Score = 72.0 bits (175),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  190  EVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEW---IETP  360
            EV+ R ++VYWPLD  WY+G V+++D  S +H V+YDD +EE ++L +E+ EW   +E  
Sbjct  97   EVVGRCLRVYWPLDDAWYKGKVEAYDAASRRHRVKYDDGDEEEVDLRKEKFEWAAVVEES  156

Query  361  VVTKFRRLRR  390
             +   R+LRR
Sbjct  157  TLLPARKLRR  166



>ref|XP_008369112.1| PREDICTED: DNA mismatch repair protein MSH6 [Malus domestica]
Length=865

 Score =  1177 bits (3045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/806 (71%), Positives = 673/806 (83%), Gaps = 0/806 (0%)
 Frame = +1

Query  1231  KVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             KVVKREICAV+TKGTLTEG+ML+ +PDASYL+ VTE+ Q  AN+  ER +GVCVVDVATS
Sbjct  9     KVVKREICAVVTKGTLTEGDMLSANPDASYLMXVTENSQNLANENAERVFGVCVVDVATS  68

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             +VILGQF DD +CS+L  LL E RPVEI+KPA LLS ETE+VL RHTR+PLVNE VP+ E
Sbjct  69    RVILGQFGDDLECSALSCLLSELRPVEIVKPANLLSPETEKVLIRHTRSPLVNEXVPVLE  128

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGEN  1770
             F DAE+T+ EV+++Y+R ++  +  S  +   H S+S   +     LP+VLSE+V AGEN
Sbjct  129   FLDAERTVQEVRSIYRRADDQXVSGSPKKXGFHGSDSHLEEDXYGCLPDVLSEMVRAGEN  188

Query  1771  GTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIF  1950
             G  ALSALGG LFYLKQAFLD ++L+FA+FELLP S FG    KPYMVLD+AALENLEIF
Sbjct  189   GIXALSALGGALFYLKQAFLDETILRFAKFELLPSSGFGDTVXKPYMVLDSAALENLEIF  248

Query  1951  ENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGV  2130
             EN++N  SSGTLYAQ+NHCVT FGKRLLRTWLARPLYH+E IK+RQDAVA L+GVNLP  
Sbjct  249   ENNRNGDSSGTLYAQLNHCVTGFGKRLLRTWLARPLYHVELIKQRQDAVASLRGVNLPYA  308

Query  2131  LEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVN  2310
             LEF K +SRLPDMERLL ++F+SS A GRNA KVVLYEDAAKKQLQ+FISALRGCE M  
Sbjct  309   LEFHKAVSRLPDMERLLVRVFSSSNACGRNAKKVVLYEDAAKKQLQEFISALRGCELMAQ  368

Query  2311  ACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDE  2490
              C SL   L+N +S  LH LLT GKGLPDV  V+K FKD FDWVEAN+SGRIIP EGVD 
Sbjct  369   TCCSLXVILENVESAQLHHLLTLGKGLPDVNSVLKHFKDAFDWVEANNSGRIIPHEGVDI  428

Query  2491  EYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYEL  2670
             EYD+AC  ++++E  L KHL+EQ+KL GD SI YVTVGKD+YLLE+PESLC  +P +YEL
Sbjct  429   EYDSACEKVKEIESHLTKHLQEQRKLLGDKSITYVTVGKDSYLLEMPESLCSCIPPDYEL  488

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +SSKKG+ RYW P I+K + ELSQAET++ES LKSILQRLIGRFCEH   WR+L+S  AE
Sbjct  489   RSSKKGFSRYWTPDIKKSLTELSQAETDKESSLKSILQRLIGRFCEHRLKWRQLVSVTAE  548

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             +DVLISL+IASDY+EGP+C+P +      + VP   AKSLGHP+LR+DSL KG FVSND+
Sbjct  549   IDVLISLAIASDYFEGPSCQPVVMSSSCTNEVPRFSAKSLGHPVLRSDSLGKGTFVSNDI  608

Query  3031  TLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
             ++GG+GH+SFILLTGPNMGGKSTL+RQVCLAVILAQ+GADVPA SF+LSPVDRIFVRMGA
Sbjct  609   SIGGSGHASFILLTGPNMGGKSTLIRQVCLAVILAQLGADVPAESFELSPVDRIFVRMGA  668

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
             KD+IM GQSTFLTEL ETA+MLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF++KV
Sbjct  669   KDNIMVGQSTFLTELSETATMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFIYKV  728

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVN  3570
             QCRGMFSTHYHRLA+DYQ + +VSLCHMAC +G G GG+EEVTFLY+L  G CP+SYGVN
Sbjct  729   QCRGMFSTHYHRLAVDYQNNSKVSLCHMACQVGNGDGGVEEVTFLYRLNPGACPKSYGVN  788

Query  3571  VARLAGLPDNVLEKAAAKSREFEGVY  3648
             +ARLAGLP +VL+KA AKSREFE  Y
Sbjct  789   IARLAGLPISVLKKATAKSREFEATY  814



>dbj|BAK02401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1331

 Score =  1175 bits (3040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/1019 (60%), Positives = 769/1019 (75%), Gaps = 34/1019 (3%)
 Frame = +1

Query  607   RKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATG-GVKVIESVTNNLECVKASNGDD  783
             +KRK  +   L   K    +     +  + K PT+ G G +++E+V              
Sbjct  283   KKRKKVDVGTLDCAKKFSFQPANTPEKAEMKVPTSCGTGERILENVHL------------  330

Query  784   ILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQW  963
              LTG+ +ERF  R+MEK  FLG+GR+DA  +RPGD  YD RTL+LP  FLK L+GGQRQW
Sbjct  331   ALTGDLSERFGSRQMEKFTFLGQGRKDAKGKRPGDPAYDPRTLFLPPQFLKNLTGGQRQW  390

Query  964   WEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKL  1143
             WEFKS+HMDKVLFFKMGKFYEL+EMDAH+G KEL+LQYMKG+QPHCGFPEKN ++N EKL
Sbjct  391   WEFKSQHMDKVLFFKMGKFYELYEMDAHVGTKELNLQYMKGDQPHCGFPEKNLAVNLEKL  450

Query  1144  ARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICAVITKGTLTEGEMLTVSPDASY  1320
             A+KGYRVLVVEQ ETP+QL+LRR++ G+KDKVV+REICA++TKGTLTEGE L  +PD SY
Sbjct  451   AQKGYRVLVVEQTETPDQLDLRRRETGTKDKVVRREICAMVTKGTLTEGESLLANPDPSY  510

Query  1321  LIAVTES--CQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEI  1494
             +++V ES  C ++ +Q G  T GVC++DV+TSK I+GQF DD +   LCS+L E RPVEI
Sbjct  511   ILSVVESYPCSSTKSQDGH-TIGVCIIDVSTSKFIIGQFQDDPERHVLCSILSEIRPVEI  569

Query  1495  IKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQN  1674
             IKPAK+LS ETER L  +TR+PL+N L+P +EFWDAEKTI  ++  Y   NN  +  S+N
Sbjct  570   IKPAKMLSAETERALKNNTRDPLINGLLPSTEFWDAEKTIHVIEQYYSSSNN--LTMSRN  627

Query  1675  EADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFA  1854
                      + N+     LP++L EL+ AG+   YALSALGG+LFYLKQ  LD  LL  A
Sbjct  628   TV------GVQNNVGC--LPDLLGELIEAGDRA-YALSALGGSLFYLKQILLDDKLLPCA  678

Query  1855  EFELLPFSHFGMIAQ-KPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRL  2031
             +FE  P +  G+I   + +M+LDAAALENLEI EN+   G SGTLY Q+NHCVT FGKRL
Sbjct  679   KFE--PLTCSGLINNMQKHMILDAAALENLEILENATG-GLSGTLYEQLNHCVTGFGKRL  735

Query  2032  LRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEAN  2211
             L+ W+ RPLY  EAI +RQ A+A  KGV     ++FRK+L RLPDMERLLA +F+    N
Sbjct  736   LKRWIVRPLYDREAILQRQGAIAIFKGVGHECAMQFRKDLCRLPDMERLLAHLFSRCGEN  795

Query  2212  GRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGL  2391
             GR+ + V+LYED AK+ LQQF +ALRGC+ M  AC S+ A      S LL+DLL+PGKGL
Sbjct  796   GRSKS-VILYEDTAKRLLQQFTAALRGCQQMFQACSSIRALTGTEGSSLLNDLLSPGKGL  854

Query  2392  PDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLF  2571
             PDV  ++  F+D FDW EA+ +GRIIP EG D EYDA   ++ ++E +L  +LKEQ+KL 
Sbjct  855   PDVSSILDYFRDAFDWSEADHNGRIIPLEGCDPEYDATSCAIEEIESNLQDYLKEQRKLL  914

Query  2572  GDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAET  2751
              D+S+ YV VGKD YL+EV +SL   VP +YELQS+KKG  RYW P +++L+ ELS+  T
Sbjct  915   RDSSVKYVNVGKDTYLIEVSDSLRGSVPSDYELQSTKKGVCRYWTPEVKQLISELSKVAT  974

Query  2752  ERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELP  2931
             ++ES LK ILQ+LI  F EHHS WR L+S  AE+DVL+SL+IA DY+EGPTC P IREL 
Sbjct  975   DKESILKGILQKLIHLFIEHHSKWRRLVSVAAEIDVLVSLAIAGDYFEGPTCCPTIRELC  1034

Query  2932  SQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQ  3111
               D+ P   A++LGHPI+R+DSL KG+FV N++ +GG G++SFI+LTGPNMGGKSTLLRQ
Sbjct  1035  GPDDTPTFHARNLGHPIIRSDSLGKGSFVPNNINMGGPGNASFIILTGPNMGGKSTLLRQ  1094

Query  3112  VCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATR  3291
             VCL +ILAQ+GA+VPA + +LS VDRIFVRMGA+DHIMAG+STFL EL+ETAS+LSSAT+
Sbjct  1095  VCLTIILAQIGANVPAENLELSLVDRIFVRMGARDHIMAGKSTFLVELMETASVLSSATK  1154

Query  3292  NSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCH  3471
             NSLVALDELGRGTSTSDGQAIA SVL++ VH+VQC G+FSTHYH+LA+++ ED +VSLCH
Sbjct  1155  NSLVALDELGRGTSTSDGQAIAASVLDYLVHRVQCLGLFSTHYHKLAVEH-EDGKVSLCH  1213

Query  3472  MACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             MAC +G G GGLEEVTFLY+LT G+CP+SYGVNVARLAG+P +VL++A  KS +FE  Y
Sbjct  1214  MACQVGTGEGGLEEVTFLYRLTAGSCPKSYGVNVARLAGIPASVLQRANEKSIDFEANY  1272


 Score = 77.0 bits (188),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 4/69 (6%)
 Frame = +1

Query  196  LNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIE----TPV  363
            + RR++VYWPLD  WYEG V+++D  S +H V+YDD EEE ++L +E+ EW       P 
Sbjct  126  VGRRLRVYWPLDDAWYEGTVEAYDGGSRQHHVKYDDGEEEEVDLVKEKFEWAAEEATPPP  185

Query  364  VTKFRRLRR  390
              K RRLRR
Sbjct  186  ARKLRRLRR  194



>gb|EAZ09056.1| hypothetical protein OsI_31317 [Oryza sativa Indica Group]
Length=1265

 Score =  1163 bits (3009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/1083 (58%), Positives = 776/1083 (72%), Gaps = 52/1083 (5%)
 Frame = +1

Query  568   RRGKSGISKKAELRKRKFTEGLKLVST-------KAKKIKSGGNN--KSTQSKAPTATGG  720
             R+GK   S        K   GL  VS        K +K+ +G  +  K    + P  TG 
Sbjct  205   RKGKKNNSLSMSASTPKLASGLGSVSISGSTLSKKRRKVDAGALDCAKKFSFEPPNTTGK  264

Query  721   VKVIESVTNNLECVKASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYD  900
             V++   ++ +       N    LTG  AERF+ R+ EK  FLG+GR+DA  RRPG+ NYD
Sbjct  265   VELKVPISCSQREQPLENALTALTGEVAERFAQRQAEKFKFLGEGRKDAKGRRPGNPNYD  324

Query  901   SRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYM  1080
              RTL LPS FL  L+GGQ                  MGKFYELFEMDAH+GAKELDLQYM
Sbjct  325   PRTLSLPSQFLNSLTGGQ------------------MGKFYELFEMDAHVGAKELDLQYM  366

Query  1081  KGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK-GSKDKVVKREICA  1257
             KG++PHCGFPEKNF +N EKLA+KGYRVLV+EQ ETPEQL+LRRK+ G KDKVV+REICA
Sbjct  367   KGDKPHCGFPEKNFELNLEKLAKKGYRVLVIEQTETPEQLDLRRKETGVKDKVVRREICA  426

Query  1258  VITKGTLTEGEMLTVSPDASYLIAVTES--CQTSANQLGERTYGVCVVDVATSKVILGQF  1431
             ++TKGTLTEGE L  +PD SYL +V ES  C +  +Q G  T GVC+VDV+TSK I+GQF
Sbjct  427   MVTKGTLTEGESLLANPDPSYLFSVAESYQCGSEKDQDGH-TIGVCIVDVSTSKFIVGQF  485

Query  1432  AddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKT  1611
              DD++   LCS+L E RP EIIKPAK+LS  TE+ L+ +TR+PL+N L+P  EFWDAEKT
Sbjct  486   QDDAERHGLCSILSEIRPAEIIKPAKMLSPGTEKALNSNTRDPLINNLLPSMEFWDAEKT  545

Query  1612  ISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSA  1791
             I E+K  Y  L+ TP   +Q  +                LP +LSEL+ AG+  TYALSA
Sbjct  546   IHEIKQYYCSLD-TPGAGAQISSAY--------------LPELLSELIEAGDK-TYALSA  589

Query  1792  LGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCG  1971
             LGG+LFYL+Q+ LD  LL  AEFE L  S      +K +M+LDAAALENLEI EN++N G
Sbjct  590   LGGSLFYLRQSLLDEKLLPCAEFERLTCSGLTNPIRK-HMILDAAALENLEILENARNGG  648

Query  1972  SSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKEL  2151
              SGTLYAQ+NHCVT FGKRLL+ W+ARPLY  +AI +RQ A+A  KG      ++FRK+L
Sbjct  649   LSGTLYAQLNHCVTGFGKRLLKRWIARPLYERQAILQRQSAIATFKGSGHECAIQFRKDL  708

Query  2152  SRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGA  2331
             SRLPDMERLLA++F+S + NGR++  VVLYEDA+K+ L QF +ALRGC+ M  AC S+  
Sbjct  709   SRLPDMERLLARLFSSCDKNGRSSKSVVLYEDASKRLLHQFTAALRGCQQMFQACSSISM  768

Query  2332  TLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACG  2511
                   S LL++LL+PGKGLP V  ++  F+D FDW EA+ +GRIIP EG D +YDAAC 
Sbjct  769   LTSTDGSSLLNNLLSPGKGLPHVSSILDHFRDAFDWSEADRNGRIIPHEGCDPQYDAACI  828

Query  2512  SLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGY  2691
             ++ ++E SL K+LKEQ+KL  D+S+ YV VGKD YLLEV E+L   VPQ YELQS+KKG+
Sbjct  829   AIEEIESSLKKYLKEQRKLLSDSSVKYVDVGKDTYLLEVSENLRGSVPQHYELQSTKKGF  888

Query  2692  FRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISL  2871
             +RYW P +++L+ ELS+AE E+E+KLK ILQ LI  F  HHS WR+L+S +AELDVLISL
Sbjct  889   YRYWTPEVKELISELSKAEAEKEAKLKCILQNLIQLFVGHHSKWRQLVSVVAELDVLISL  948

Query  2872  SIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGH  3051
             +IASD++EGPTC P I+E    D+ P L A++LGHP LR+DSL  G+FV ND+ +GG G+
Sbjct  949   AIASDFFEGPTCCPIIKESYGPDDTPTLHARNLGHPTLRSDSLGSGSFVPNDIKMGGPGN  1008

Query  3052  SSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAG  3231
             +SFI+LTGPNMGGKSTLLRQVCL +ILAQ+GA+VPA SF+LS VDR+FVRMGA+DHIMAG
Sbjct  1009  ASFIVLTGPNMGGKSTLLRQVCLTIILAQIGANVPAESFELSLVDRMFVRMGARDHIMAG  1068

Query  3232  QSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFS  3411
             QSTFL EL+ETAS+LSSAT+NSLVALDELGRGTSTSDGQAIA SVLE+ VH+VQC G+FS
Sbjct  1069  QSTFLVELMETASVLSSATKNSLVALDELGRGTSTSDGQAIAASVLEYLVHRVQCLGLFS  1128

Query  3412  THYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGL  3591
             THYHRLA +  +D +VSLCHMAC I +G GGLEEVTFLYKLT G+CP+SYGVNVARLAG+
Sbjct  1129  THYHRLAAE-NKDSKVSLCHMACEISKGEGGLEEVTFLYKLTPGSCPKSYGVNVARLAGI  1187

Query  3592  PDNVLEKAAAKSREFEGVYgnnkgsrgnssknWDEKAIEVIRSLMHLAD---YNERHGGC  3762
             P +VL++A  KS +FE  YG   G   N      E     I+ L  +     + E H   
Sbjct  1188  PASVLQRANEKSSDFEASYGKRPGITKNKPSCAQEDKFAAIKDLFRVVKAMHHREDHASS  1247

Query  3763  VGF  3771
             +G 
Sbjct  1248  LGM  1250


 Score = 68.2 bits (165),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 8/76 (11%)
 Frame = +1

Query  187  QEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIE----  354
            +  + RR++VYWPLD  WYEG V+ +D  S +H V+YDD EEE+++L+ ER EW      
Sbjct  66   ETAVGRRLRVYWPLDDAWYEGRVEGYDVGSRRHRVRYDDGEEEVVDLASERYEWAAAADE  125

Query  355  ---TPVVT-KFRRLRR  390
               TP  + K RRLRR
Sbjct  126  EEVTPQPSRKLRRLRR  141



>ref|XP_007051090.1| MUTS isoform 2 [Theobroma cacao]
 gb|EOX95247.1| MUTS isoform 2 [Theobroma cacao]
Length=1118

 Score =  1157 bits (2993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/861 (69%), Positives = 692/861 (80%), Gaps = 14/861 (2%)
 Frame = +1

Query  565   LRRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVT  744
             ++  K   S K E +KRK + G KL S   KK K+  N    + K       V ++E V 
Sbjct  235   MKISKRKSSGKTEAKKRKASGGGKLES--GKKSKTNANVSKQELK-------VSLVEPV-  284

Query  745   NNLECVKASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYL  918
               +E  KASNG D+ L G+++ERF  RE EKL FL    R    R+   DVNY+ +TLYL
Sbjct  285   KKIESDKASNGFDNALVGDASERFGKREAEKLHFLTPKERRDANRKRPEDVNYNPKTLYL  344

Query  919   PSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPH  1098
             P DFLK LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPH
Sbjct  345   PLDFLKSLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPH  404

Query  1099  CGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGT  1275
             CGFPE+NFSMN EKLARKGYRVLVVEQ ETPEQLELRRK KG+KDKVVKREICAV+TKGT
Sbjct  405   CGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGAKDKVVKREICAVVTKGT  464

Query  1276  LTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcss  1455
             LTEGEML+ +PD SYL+AVTE CQ+S NQ  +R +GVC VDVATS++ILGQF DD +CS 
Sbjct  465   LTEGEMLSANPDPSYLMAVTECCQSSTNQNEDRIFGVCAVDVATSRIILGQFGDDFECSG  524

Query  1456  lcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMY  1635
             LCSLL E RPVEIIKP KLLS ETER + RHTRN LVNELVP +EFWDA KT+ EVK +Y
Sbjct  525   LCSLLAELRPVEIIKPTKLLSLETERAMLRHTRNLLVNELVPSAEFWDAGKTVCEVKTIY  584

Query  1636  QRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYL  1815
             +R+N+     S N    + + S + D     LP +LS L++AG +G+ ALSALGGTL+YL
Sbjct  585   KRINDQSAARSVNHVGPNAANSCEGDGSC-CLPAILSNLLSAGADGSLALSALGGTLYYL  643

Query  1816  KQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQ  1995
             KQAFLD +LL+FA+FE LP S F  IAQ PYM+LDAAALENLEIFENS+N  SSGTLYAQ
Sbjct  644   KQAFLDETLLRFAKFESLPSSGFSGIAQNPYMLLDAAALENLEIFENSRNGDSSGTLYAQ  703

Query  1996  MNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMER  2175
             +NHCVTAFGKRLL+TWLARPLYH++ IKERQDAVAGLKG NL   LEFRK LSRLPDMER
Sbjct  704   LNHCVTAFGKRLLKTWLARPLYHVDLIKERQDAVAGLKGENLSYALEFRKALSRLPDMER  763

Query  2176  LLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSK  2355
             LLA+IFASS+A GRNANKV+LYEDAAKKQLQ+FISALR CE MV AC SLG  L+N +S 
Sbjct  764   LLARIFASSKAIGRNANKVILYEDAAKKQLQEFISALRCCELMVQACSSLGVILENVEST  823

Query  2356  LLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELS  2535
              LH LLT GKGLP++  ++K FKD FDWV+AN+SGRIIP EGVD EYD+AC  ++++E S
Sbjct  824   QLHHLLTAGKGLPNIHSILKHFKDAFDWVDANNSGRIIPHEGVDMEYDSACERVKEIESS  883

Query  2536  LAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVI  2715
             L KHLKEQ+KL GD+SI YVTVGKD YLLEVPE+L   VP++YEL+SSKKG+FRYW   I
Sbjct  884   LTKHLKEQRKLLGDSSITYVTVGKDVYLLEVPENLRGSVPRDYELRSSKKGFFRYWTQYI  943

Query  2716  RKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYE  2895
             +K++GELSQAE+E+E  LK+ILQRLIG+FCE H+ WR+L+ST AELDVLISL+IASD+YE
Sbjct  944   KKVIGELSQAESEKEMALKNILQRLIGQFCEDHNKWRQLVSTTAELDVLISLAIASDFYE  1003

Query  2896  GPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTG  3075
             GPTCRP I      + VPCL AKSLGHPILR+DSL  GAFV ND+T+GG+GH+SFILLTG
Sbjct  1004  GPTCRPLILGSSCSNEVPCLSAKSLGHPILRSDSLGNGAFVPNDITIGGSGHASFILLTG  1063

Query  3076  PNMGGKSTLLRQVCLAVILAQ  3138
             PNMGGKSTLLRQVCLAVILAQ
Sbjct  1064  PNMGGKSTLLRQVCLAVILAQ  1084


 Score =   122 bits (305),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 3/83 (4%)
 Frame = +1

Query  115  SKSNKPLLVIG--PSPTPDS-TESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKH  285
            SK  KPLLVIG  PSPTP +  + SYG+EV+++RI+VYWPLDK WYEG VKSFDK SG+H
Sbjct  70   SKLKKPLLVIGQTPSPTPSTPADKSYGKEVVDKRIRVYWPLDKAWYEGVVKSFDKESGRH  129

Query  286  LVQYDDEEEEMLNLSQERIEWIE  354
            LVQYDD EEE L+L +E+IEWI+
Sbjct  130  LVQYDDAEEEELDLGKEKIEWIK  152



>gb|EPS69161.1| hypothetical protein M569_05605, partial [Genlisea aurea]
Length=781

 Score =  1019 bits (2636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/755 (67%), Positives = 609/755 (81%), Gaps = 2/755 (0%)
 Frame = +1

Query  1375  TYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTR  1554
              +GVC+VD ATSK+ILGQF DD  C  LCSLL E RP+EIIKPAKLL  ETER L RH R
Sbjct  2     VFGVCLVDAATSKIILGQFQDDYGCCKLCSLLSELRPIEIIKPAKLLCPETERALVRHAR  61

Query  1555  NPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLP  1734
             NPLV EL+P SEFW+AEKTISEV NMY+RL +    +  NE  L P  S   +  ++ LP
Sbjct  62    NPLVTELIPDSEFWNAEKTISEVTNMYKRLGDGSYCFDFNETALLPGNSSSMNGGIKGLP  121

Query  1735  NVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMV  1914
               LSELVN G++GT ALSALGG +FYL+QA LD +LL++A FELL  S F + A+KPYM+
Sbjct  122   GALSELVNLGKDGTEALSALGGAVFYLRQALLDETLLRYANFELLSCSGFSLPARKPYMI  181

Query  1915  LDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDA  2094
             LDAAALENLEIFEN +N  +SGTL+AQ++HC TAFGKRLLR WLARPLYH  +I+ERQDA
Sbjct  182   LDAAALENLEIFENGRNGDASGTLFAQLDHCTTAFGKRLLRKWLARPLYHHSSIRERQDA  241

Query  2095  VAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQF  2274
             VA LK VN P V+ FRK+LS+LPDMERL A++FA SE +GRN+ KVVLYEDAAKKQL +F
Sbjct  242   VAELKKVN-PDVVAFRKDLSKLPDMERLFARVFAGSEGSGRNSGKVVLYEDAAKKQLHEF  300

Query  2275  ISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANS  2454
             +SALRGCE M NAC S     ++ +S LL  LLTPG GLPDV  ++ +FKD FDW EAN+
Sbjct  301   VSALRGCELMNNACTSFAGIKEHMESDLLKHLLTPGAGLPDVHSILTRFKDAFDWDEANN  360

Query  2455  SGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPE  2634
              GR+IP EGVD EYDA+C  L+ +   LAKHLKEQ+K+ GD+SI+YVT+GKD YLLEVPE
Sbjct  361   LGRVIPREGVDVEYDASCQRLKDINSDLAKHLKEQRKILGDSSISYVTIGKDVYLLEVPE  420

Query  2635  SLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHH  2814
             SL + +P+EYEL+SSKKG+FRYW P IR L+GELS+ E++++SKLK IL++L+  FCE H
Sbjct  421   SLSQSIPKEYELRSSKKGFFRYWTPKIRDLVGELSRVESDKDSKLKGILRKLVREFCESH  480

Query  2815  STWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTD  2994
               WR++++T+AELDVLISLSIA +YYEG  CRP ++E  ++  VP + A SLGHPILR D
Sbjct  481   IKWRQMVATVAELDVLISLSIAGEYYEGKACRPVVQEQVAE-AVPHVSALSLGHPILRND  539

Query  2995  SLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDL  3174
             +L +G+FV+NDVTLGG+ H+ F+LLTGPNMGGKSTLLRQVCLAVILAQ+G DVPA SF L
Sbjct  540   TLREGSFVTNDVTLGGSDHAGFMLLTGPNMGGKSTLLRQVCLAVILAQIGTDVPAESFVL  599

Query  3175  SPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAI  3354
             S VDRIFVRMGA D+IMAGQSTFLTELLET+SML++ATR+S VALDELGRGTSTSDGQAI
Sbjct  600   SLVDRIFVRMGATDNIMAGQSTFLTELLETSSMLNAATRSSFVALDELGRGTSTSDGQAI  659

Query  3355  AESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKL  3534
             A +VLEH   K+QC GMFSTHYHRLA++Y+ D +VSL HM C +G+     EEV FLYKL
Sbjct  660   AGAVLEHLFLKIQCLGMFSTHYHRLAVEYRNDPKVSLWHMGCQVGQEGTASEEVIFLYKL  719

Query  3535  TLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
               G+CP+SYGVNVARLAGLPD+VL+KAAAKS EFE
Sbjct  720   MPGSCPKSYGVNVARLAGLPDSVLDKAAAKSLEFE  754



>ref|XP_002311781.2| hypothetical protein POPTR_0008s19530g [Populus trichocarpa]
 gb|EEE89148.2| hypothetical protein POPTR_0008s19530g [Populus trichocarpa]
Length=1055

 Score =  1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/843 (65%), Positives = 635/843 (75%), Gaps = 76/843 (9%)
 Frame = +1

Query  772   NG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSG  948
             NG ++ L  +++ERFS RE EK  FLG+ RRDA RRRP                      
Sbjct  250   NGFENALMTDASERFSTREAEKFPFLGRERRDAKRRRP----------------------  287

Query  949   GQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSM  1128
             G RQ WEFKSKHMDKVLFFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPEKNFS+
Sbjct  288   GDRQRWEFKSKHMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPEKNFSL  347

Query  1129  NAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEMLTVS  1305
             N EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAVITKGTLTEGE+L+ +
Sbjct  348   NVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVITKGTLTEGELLSAN  407

Query  1306  PDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRP  1485
             PDASYL+A+TES Q+ ANQ  ER +GVC VDV TS++ILGQF DD++CSSLC LL E RP
Sbjct  408   PDASYLMALTESRQSLANQGLERIFGVCAVDVTTSRIILGQFGDDAECSSLCCLLSELRP  467

Query  1486  VEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPY  1665
             VEI+KPAK+LS ETERV+ RHTRNPLVNEL PLSEFWDAEKT+ EVK +Y+ + +     
Sbjct  468   VEIVKPAKMLSSETERVMVRHTRNPLVNELAPLSEFWDAEKTVQEVKTIYKPIGDLSASG  527

Query  1666  SQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLL  1845
               N+ DL  +     + +   LP++LSE VN GENG+ ALSALGG L+YLKQAFLD +LL
Sbjct  528   PLNKTDLDTTNLNVGEYRPSCLPSILSEFVNKGENGSPALSALGGALYYLKQAFLDETLL  587

Query  1846  KFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGK  2025
             +FA+F  LP S F  +A+                                          
Sbjct  588   RFAKFNSLPCSDFCEVAE------------------------------------------  605

Query  2026  RLLRTWLARPLYHLEAIKERQDAVAGLKGVNL-PGVLEFRKELSRLPDMERLLAQIFASS  2202
                 TWLARPL HLE+IK+RQDAVAGL+  N  P ++EF+K +S LPD+ERLLA+IF++S
Sbjct  606   ----TWLARPLCHLESIKDRQDAVAGLRATNFQPMMVEFQKVMSGLPDIERLLARIFSTS  661

Query  2203  EANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPG  2382
             EANGRNANKVVL+EDAAKKQLQ+FISALRGCE +  AC SL   L++ +S  LH L TPG
Sbjct  662   EANGRNANKVVLHEDAAKKQLQEFISALRGCELVAQACSSLAVMLESVESGRLHHLSTPG  721

Query  2383  KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQ  2562
             K LPD+  ++K FK  FDWVEAN+SGRIIP EGVD EYD AC  +++VE SLA+HLKEQQ
Sbjct  722   KDLPDILPILKHFKSAFDWVEANNSGRIIPHEGVDVEYDPACEKVKEVESSLARHLKEQQ  781

Query  2563  KLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYE-LQSSKKGYFRYWNPVIRKLMGELS  2739
             KL GD SI YVTVGK+AYLLEVPE L   +PQ+YE L+SSKK       P I+K +GELS
Sbjct  782   KLLGDKSITYVTVGKEAYLLEVPEHLRGSIPQDYELLRSSKKVSIGL--PSIKKFLGELS  839

Query  2740  QAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHI  2919
             Q E+E+ES LKSILQRLI RFC++H  WR+L+S  AELDVLISL+IAS YYEGP CRP I
Sbjct  840   QVESEKESALKSILQRLIVRFCKYHDKWRQLVSATAELDVLISLAIASGYYEGPACRPTI  899

Query  2920  --RELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGK  3093
                 L S+  VPCL AK LGHP+LR+DSL KGAFV ND+++GG+G + FILLTGPNMGGK
Sbjct  900   VGSSLSSEVQVPCLSAKLLGHPVLRSDSLGKGAFVPNDISIGGSGCAGFILLTGPNMGGK  959

Query  3094  STLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASM  3273
             STLLRQVCLAVILAQ+GADVPA SF+LSPVDRIFVRMGAKDHIMAGQSTFLTEL ETA M
Sbjct  960   STLLRQVCLAVILAQIGADVPAESFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETALM  1019

Query  3274  LSS  3282
             L S
Sbjct  1020  LKS  1022


 Score =   111 bits (278),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +1

Query  115  SKSNKPLLVIGPSPTPDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQ  294
            S++   ++   PSP+P ST   YG+EV+ RR++ YWPLDK W+EG VKS D  S KHL+Q
Sbjct  58   SRTQSSIIGQTPSPSP-STIGVYGKEVVERRVRFYWPLDKSWFEGRVKSCDDESKKHLIQ  116

Query  295  YDDEEEEMLNLSQERIEWIETPVVTKFRRLRR  390
            YDD EEE+L+LS E+IEW+E P   KF+RLRR
Sbjct  117  YDDSEEELLDLSNEKIEWVE-PCFKKFKRLRR  147



>gb|KDO87015.1| hypothetical protein CISIN_1g000778mg [Citrus sinensis]
Length=987

 Score =   986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/703 (71%), Positives = 592/703 (84%), Gaps = 6/703 (1%)
 Frame = +1

Query  763   KASNG-DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKG  939
             K SNG D+ + G+ +ERFS RE +K  FLG  RRDA RRRPGDV YD RTLYLP DFL+ 
Sbjct  267   KLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRN  326

Query  940   LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKN  1119
             LS GQ+QWWEFKSKHMDKV+FFKMGKFYELFEMDAH+GAKELDLQYMKGEQPHCGFPE+N
Sbjct  327   LSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERN  386

Query  1120  FSMNAEKLARKGYRVLVVEQIETPEQLELRRK-KGSKDKVVKREICAVITKGTLTEGEML  1296
             FSMN EKLARKGYRVLVVEQ ETPEQLELRRK KGSKDKVVKREICAV+TKGTLTEGE+L
Sbjct  387   FSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELL  446

Query  1297  TVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYE  1476
             + +PDASYL+A+TES Q+ A+Q  +R +G+CVVDVATS++ILGQ  DD DCS LC LL E
Sbjct  447   SANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSE  506

Query  1477  FRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTP  1656
              RPVEIIKPA +LS ETER + RHTRNPLVN+LVPLSEFWDAE T+ E+KN+Y R+    
Sbjct  507   LRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAE-  565

Query  1657  IPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDV  1836
                S N+AD + + S      L  LP +LSEL++ G++G+  LSALGGTLFYLK++FLD 
Sbjct  566   ---SLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDE  622

Query  1837  SLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTA  2016
             +LL+FA+FELLP S FG +A+KPYMVLDA ALENLE+FENS++  SSGTLYAQ+NHCVTA
Sbjct  623   TLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTA  682

Query  2017  FGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFA  2196
             FGKRLLRTWLARPLY+   I+ERQDAVAGL+GVN P  LEFRK LSRLPDMERLLA++FA
Sbjct  683   FGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA  742

Query  2197  SSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT  2376
             SSEANGRN+NKVVLYEDAAKKQLQ+FISAL GCE M  AC SLGA L+NT+S+ LH +LT
Sbjct  743   SSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILT  802

Query  2377  PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKE  2556
             PGKGLP +  ++K FKD FDWVEAN+SGRIIP  GVD +YD+AC  ++++E SL KHLKE
Sbjct  803   PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKE  862

Query  2557  QQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGEL  2736
             Q+KL GDTSI YVT+GKD YLLEVPESL   VP++YEL+SSKKG+FRYW P I+KL+GEL
Sbjct  863   QRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGEL  922

Query  2737  SQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             SQAE+E+ES LKSILQRLIG+FCEHH+ WR++++  A L +++
Sbjct  923   SQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAGLTLIL  965


 Score =   106 bits (265),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  178  SYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQERIEWIET  357
            SYG++VL +RI+VYWPLDK WYEGCVKSFDK   KHLVQYDD E+E+L+L +E+IEW++ 
Sbjct  100  SYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQE  159

Query  358  PVVTKFRRLRR  390
              V+  +RLRR
Sbjct  160  S-VSLLKRLRR  169



>ref|XP_002981472.1| hypothetical protein SELMODRAFT_114224, partial [Selaginella 
moellendorffii]
 gb|EFJ17660.1| hypothetical protein SELMODRAFT_114224, partial [Selaginella 
moellendorffii]
Length=975

 Score =   963 bits (2490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/977 (53%), Positives = 665/977 (68%), Gaps = 65/977 (7%)
 Frame = +1

Query  787   LTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWW  966
             L+G + ERF  R   K  FLGK R+D+  RR    N+DSRTL+LP++F+KGL+GGQRQWW
Sbjct  1     LSGEALERFGGRISRKFSFLGKNRKDSSGRRHDWPNFDSRTLFLPAEFVKGLTGGQRQWW  60

Query  967   EFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLA  1146
             EFK+KHMDKVL FKMGKFYE+FEMDAH+GA++LDLQYMKGEQPHCGFPEKN+  N EKL 
Sbjct  61    EFKAKHMDKVLLFKMGKFYEMFEMDAHVGAQDLDLQYMKGEQPHCGFPEKNYFENVEKLV  120

Query  1147  RKGYRVLVVEQIETPEQLELR-RKKGSKDKVVKREICAVITKGTLTEGEMLTVSPDASYL  1323
             RKG+RVLVVEQ ETPEQLE R RK GSKDKVV+REICA+ITKGT+ +  M++ + + S+L
Sbjct  121   RKGHRVLVVEQTETPEQLEERKRKTGSKDKVVRREICAIITKGTMVDSGMISDNAEPSFL  180

Query  1324  IAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKP  1503
              AVTE     A+  G    G+CVVD + +  +LGQ  DDS  + L S+L E RPVE++ P
Sbjct  181   AAVTEK----ADNYGGSLVGLCVVDASRALFMLGQVEDDSARTKLRSILTELRPVELVLP  236

Query  1504  AKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEAD  1683
               LL+  T++ L   TR PL+++LVP  EFWDAE+T  E++  Y              +D
Sbjct  237   LGLLTDATQKALREQTRKPLISQLVPSKEFWDAEQTTKEIRTSY------------GASD  284

Query  1684  LHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE  1863
             +              +P VL +++  G +    LSA GG + YL+Q+ LD  LL+   FE
Sbjct  285   V--------------MPTVLQKILELGVSSEPVLSAFGGCICYLRQSLLDGQLLQLGRFE  330

Query  1864  LLP-----FSHFGMI--AQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFG  2022
             LLP     F H   I  A + +MVLD+AAL+NLEI ENS NCG +GTL   ++HC+T FG
Sbjct  331   LLPGSDLSFEHSAAIPEAAEAHMVLDSAALDNLEILENSSNCGVAGTLLCLLDHCITPFG  390

Query  2023  KRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS  2202
             +RLL+ W+ RPL ++E+I +RQ+AV  ++GV    V EFR+ELS +PD+ERLLA++ A+S
Sbjct  391   RRLLKQWIVRPLCNIESIVQRQNAVVDMQGVAENAVSEFRRELSGIPDLERLLARLSANS  450

Query  2203  EANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPG  2382
               NGR++ KVVLYEDAAKKQ+++ ++ALRG + +V A    G  L    S  L  LLT G
Sbjct  451   GENGRHSQKVVLYEDAAKKQIKELVAALRGFQKLVKAVSCFGNCLPQLKSARLRSLLTFG  510

Query  2383  KGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQ  2562
             KG PD+K +++ F+D FDW E+ ++GR+    G D    +A     K+E     +LK QQ
Sbjct  511   KGFPDLKPLLQYFEDSFDWSESEANGRVT---GGDHSNLSASDPREKLE----SYLKSQQ  563

Query  2563  KLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQ  2742
             K F +  I+YVTVGKD YLLE+PE L   VP +YEL+SS+KG+ RYW P +++L+ ELS 
Sbjct  564   KFFKNPEISYVTVGKDTYLLEIPEELHTKVPSDYELRSSRKGFCRYWTPRVKELLQELSL  623

Query  2743  AETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIR  2922
              E E+E+ L+ ILQ L  RFC+ H  W   I  ++ELD L+S+S A  + +G TC P   
Sbjct  624   CENEKEAALRGILQTLTKRFCDDHDHWLSAIRAVSELDALMSISSARLHMDGMTCLPTF-  682

Query  2923  ELP-SQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKST  3099
              +P SQ   P   AK+L HPI+   +     FV NDV LGG  +   +LLTGPNMGGKST
Sbjct  683   -VPASQLAKPVFRAKALRHPIVAVSTAASTPFVPNDVVLGGGSNPEVMLLTGPNMGGKST  741

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             LLRQVCL +ILAQ+G++VPA S +LS  DR+FVRMGAKD IM GQSTFL ELLETA ML 
Sbjct  742   LLRQVCLGMILAQIGSEVPAESLELSLTDRLFVRMGAKDQIMTGQSTFLIELLETAVMLR  801

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT+NS VALDELGRGT+TSDGQAIA +VL +  H VQCRGMFS+HYH+LA D+  D  V
Sbjct  802   CATQNSFVALDELGRGTATSDGQAIAHAVLHYLAHNVQCRGMFSSHYHKLASDFANDPSV  861

Query  3460  SLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARL-----------------AG  3588
             SLCHMAC +G G   LE VTFLYKLT G+CP+SYGVNVAR+                 AG
Sbjct  862   SLCHMACKVGGGNNELEAVTFLYKLTSGSCPKSYGVNVARIAGKPKFPSHAHVSRSFHAG  921

Query  3589  LPDNVLEKAAAKSREFE  3639
             +P++VL +AA +S + E
Sbjct  922   MPESVLRRAALQSAKLE  938



>ref|XP_002970000.1| hypothetical protein SELMODRAFT_410679 [Selaginella moellendorffii]
 gb|EFJ29124.1| hypothetical protein SELMODRAFT_410679 [Selaginella moellendorffii]
Length=1232

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/968 (53%), Positives = 661/968 (68%), Gaps = 52/968 (5%)
 Frame = +1

Query  721   VKVIESVTNNL-ECVKASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpgdVNY  897
             V+ IE  T    EC +A     +L+G + ERF  R   K  FLGK R+D+  RR    N+
Sbjct  211   VRQIEPATTRADECCEADRSL-LLSGEALERFGGRISRKFSFLGKNRKDSSGRRHDWPNF  269

Query  898   DSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQY  1077
             DSRTL+LP++F+KGL+GGQRQWWEFK+KHMDKVL FKMGKFYE+FEMDAH+GA++LDLQY
Sbjct  270   DSRTLFLPAEFVKGLTGGQRQWWEFKAKHMDKVLLFKMGKFYEMFEMDAHVGAQDLDLQY  329

Query  1078  MKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELR-RKKGSKDKVVKREIC  1254
             MKGEQPHCGFPEKN+  N EKL RKG+RVLVVEQ ETPEQLE R RK GSKDKVV+REIC
Sbjct  330   MKGEQPHCGFPEKNYFENVEKLVRKGHRVLVVEQTETPEQLEERKRKTGSKDKVVRREIC  389

Query  1255  AVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFA  1434
             A+ITKGT+ +  M++ + + S+L AVTE     A+  G    G+CVVD + +  +LGQ  
Sbjct  390   AIITKGTMVDSGMISDNAEPSFLAAVTEK----ADNYGSSLVGLCVVDASRALFMLGQVE  445

Query  1435  ddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTI  1614
             DDS  + L S+L E RPVE++ P  LL+  T++ L   TR PL+++LVP  EFWDAE+T 
Sbjct  446   DDSARTKLRSILTELRPVELVLPLGLLTDATQKALREQTRKPLISQLVPSKEFWDAEQTT  505

Query  1615  SEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSAL  1794
              E++  Y                        +DA    +P VL +++  G +    LSA 
Sbjct  506   KEIRTSYGA----------------------SDA----MPTVLQKILELGVSSEPVLSAF  539

Query  1795  GGTLFYLKQAFLDVSLLKFAEFELLP-----FSHFGMIAQ----KPYMVLDAAALENLEI  1947
             GG + YL+Q+ LD  LL+   FELLP     F H   I +    + +MVLD+AAL+NLEI
Sbjct  540   GGCICYLRQSLLDGQLLQLGRFELLPGSDLSFEHSAAIPEADPAEAHMVLDSAALDNLEI  599

Query  1948  FENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPG  2127
              ENS NCG +GTL   ++HC+T FG+RLL+ W+ RPL ++E+I +RQ+AV  ++GV    
Sbjct  600   LENSSNCGVAGTLLCLLDHCITPFGRRLLKQWIVRPLCNIESIVQRQNAVVDMQGVAENA  659

Query  2128  VLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMV  2307
             V EFR+EL  +PD+ERLLA++ A+S  NGR++ KVVLYEDAAKKQ+++ ++ALRG + +V
Sbjct  660   VSEFRRELFGIPDLERLLARLSANSGENGRHSQKVVLYEDAAKKQIKELVAALRGFQKLV  719

Query  2308  NACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVD  2487
              A    G  L    S  L  LLT GKG PD+K +++ F+D FDW E+ ++GR+    G D
Sbjct  720   KAVSCFGNCLPQLKSARLRSLLTFGKGFPDLKPLLQYFEDSFDWSESEANGRVT---GGD  776

Query  2488  EEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYE  2667
                 +A     K+E     +LK QQK F +  I+YVTVGKD YLLE+PE L   VP +YE
Sbjct  777   HSNLSASDPREKLE----SYLKSQQKFFKNPEISYVTVGKDTYLLEIPEELHTKVPSDYE  832

Query  2668  LQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIA  2847
             L+SS+KG+ RYW P +++L+ ELS  E E+E+ L+ ILQ L  RFC+ H  W   I  ++
Sbjct  833   LRSSRKGFCRYWTPRVKELLQELSLCENEKEAALRGILQTLTKRFCDDHDHWLSAIRAVS  892

Query  2848  ELDVLISLSIASDYYEGPTCRPHIRELP-SQDNVPCLVAKSLGHPILRTDSLDKGAFVSN  3024
             ELD L+S+S A  + +G TC P    +P SQ   P   AK+L HPI+   +     FV N
Sbjct  893   ELDALMSISSARLHMDGMTCLPTF--VPASQLAKPVFRAKALRHPIVAVSTAASTPFVPN  950

Query  3025  DVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRM  3204
             DV LGG  +   +LLTGPNMGGKSTLLRQVCL +ILAQ+G++VPA S +LS  DR+FVRM
Sbjct  951   DVVLGGGSNPEVMLLTGPNMGGKSTLLRQVCLGMILAQIGSEVPAESLELSLTDRLFVRM  1010

Query  3205  GAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVH  3384
             GAKD IM GQSTFL ELLETA ML  AT+NS VALDELGRGT+TSDGQAIA +VL +  H
Sbjct  1011  GAKDQIMTGQSTFLIELLETAVMLRCATQNSFVALDELGRGTATSDGQAIAHAVLHYLAH  1070

Query  3385  KVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYG  3564
              VQCRGMFS+HYH+LA D+  D  VSLCHMAC +G G   LE VTFLYKLT G+CP+SYG
Sbjct  1071  NVQCRGMFSSHYHKLASDFANDPSVSLCHMACKVGGGNNELEAVTFLYKLTSGSCPKSYG  1130

Query  3565  VNVARLAG  3588
             VNVAR+AG
Sbjct  1131  VNVARIAG  1138



>ref|XP_002460193.1| hypothetical protein SORBIDRAFT_02g024370 [Sorghum bicolor]
 gb|EER96714.1| hypothetical protein SORBIDRAFT_02g024370 [Sorghum bicolor]
Length=638

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/580 (65%), Positives = 474/580 (82%), Gaps = 3/580 (1%)
 Frame = +1

Query  1909  MVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQ  2088
             M+LDAAALENLE+ EN +  G SGTLYAQ+NHCVT FGKRLL+ W+A+PLY   AI  RQ
Sbjct  1     MILDAAALENLELLENMRTGGLSGTLYAQLNHCVTGFGKRLLKRWIAKPLYDRSAILRRQ  60

Query  2089  DAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQ  2268
              AVA  KGV      +FRK+LSRLPDMERLLA++F+S + N R+++ VV+YEDA+K+ LQ
Sbjct  61    SAVATFKGVGQDYAAQFRKDLSRLPDMERLLARLFSSCDENKRSSS-VVVYEDASKRLLQ  119

Query  2269  QFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEA  2448
             QF +ALRGC+ M +AC S+ +TL  T+   L+DLL+PGKGLPD+  ++ +F+D FDW EA
Sbjct  120   QFTAALRGCQQMFHACSSI-STLICTEGSQLNDLLSPGKGLPDISSILDRFRDAFDWSEA  178

Query  2449  NSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEV  2628
             + +GRIIPCEG D EYDA C ++ +++ SL ++LKEQ+KL    S+NYV VGKD YL+EV
Sbjct  179   DRNGRIIPCEGCDPEYDATCYAIEEIKSSLKEYLKEQRKLLRPASVNYVDVGKDMYLIEV  238

Query  2629  PESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCE  2808
             PESL   VP+ YELQS+KKG+FRYW P +++L+ ELS+AE+E+ESKLK ILQ LI  F E
Sbjct  239   PESLGGSVPRNYELQSTKKGFFRYWTPELKELILELSKAESEKESKLKGILQNLIQLFVE  298

Query  2809  HHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILR  2988
             HH+ WR+L+S +AELDVLISL+IAS Y+EGP+C P I+E   Q++ P   A++LGHPILR
Sbjct  299   HHTEWRQLVSVVAELDVLISLAIASGYFEGPSCCPTIKESNGQEDTPTFHARNLGHPILR  358

Query  2989  TDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASF  3168
             +DSL KG+FV NDV +GG+G+ SFI+LTGPNMGGKSTLLRQVCL +ILAQ+GADVPA + 
Sbjct  359   SDSLGKGSFVPNDVKIGGSGNPSFIVLTGPNMGGKSTLLRQVCLTIILAQIGADVPAENL  418

Query  3169  DLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQ  3348
             +LS VDRIFVRMGA+DHIMAGQSTFL EL ETAS+LSSAT+NSLV LDELGRGTSTSDGQ
Sbjct  419   ELSLVDRIFVRMGARDHIMAGQSTFLVELEETASVLSSATKNSLVVLDELGRGTSTSDGQ  478

Query  3349  AIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLY  3528
             AIA SVLE+ VH+VQC G+FSTHYHRLA++ ++D +VSLCHMAC + EG GGLEEVTFLY
Sbjct  479   AIAASVLEYLVHQVQCLGLFSTHYHRLAME-RKDTKVSLCHMACQVVEGEGGLEEVTFLY  537

Query  3529  KLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             +LT G CP+SYGVNVARLAG+P +VL++A  KS +FE  Y
Sbjct  538   RLTPGACPKSYGVNVARLAGIPTSVLQRANEKSSDFEANY  577



>gb|KHN19219.1| DNA mismatch repair protein Msh6-1 [Glycine soja]
Length=677

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/750 (57%), Positives = 503/750 (67%), Gaps = 121/750 (16%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             NYDSRTLYLP DFL+ LS  Q+QWWEFKSKHMDKVLFFKMGKFYELFEMDAH+G KELDL
Sbjct  36    NYDSRTLYLPPDFLRSLSYAQKQWWEFKSKHMDKVLFFKMGKFYELFEMDAHVGEKELDL  95

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSKDKVVKREI  1251
             QYMKG                       Y +LVVEQ ETPEQ     KKGSKDKVV+REI
Sbjct  96    QYMKG-----------------------YCILVVEQTETPEQ-----KKGSKDKVVRREI  127

Query  1252  CAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQF  1431
             C+V+TKGTLT+GE+L+ +P+A+YL+A+TE  +    ++ E  YGVC VDVATS+VI GQF
Sbjct  128   CSVVTKGTLTDGELLSANPEAAYLMALTEHHENHPTEVSEHIYGVCRVDVATSRVIFGQF  187

Query  1432  AddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKT  1611
              DD +CS+LC +L E RPVEI+KPAKLLS ETERVL +HTRNPL+NELVP+ EFWDA+KT
Sbjct  188   KDDLECSALCCILSEIRPVEIVKPAKLLSAETERVLLKHTRNPLLNELVPIVEFWDADKT  247

Query  1612  ISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALSA  1791
             + ++K +Y + N+  +                ND +L  LP+VL ELV  G++   ALSA
Sbjct  248   VDKLKRIYGKTNDVSV----------------NDNELDCLPDVLLELVKTGDDSRSALSA  291

Query  1792  LGGTLFYLKQAFLDVSLLKFAEFELLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCG  1971
             LGG L+YL+QAF D  LL+FA+F+LLP S FG +A KPY+VLDAAALENLEIFENS+N  
Sbjct  292   LGGALYYLRQAFPDERLLRFAQFKLLPCSGFGDLASKPYLVLDAAALENLEIFENSRNGD  351

Query  1972  SSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKEL  2151
             SSGTLYAQ+N CVTAFGKRLL+TWLARPL H+E+IKE QDAVAGLKGVNLP  LEF K L
Sbjct  352   SSGTLYAQLNQCVTAFGKRLLKTWLARPLCHVESIKEHQDAVAGLKGVNLPSALEFLKAL  411

Query  2152  SRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGA  2331
             S+LPDMERLLA IF+SSEA+GRNAN+VVL              ALRGCE M  AC SLG 
Sbjct  412   SKLPDMERLLACIFSSSEASGRNANRVVL-----------VYLALRGCEQMAQACSSLGV  460

Query  2332  TLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACG  2511
              L +  S+ LH LLTPGK LPDV + +  FKD FDW EAN+SGRIIP EGVD        
Sbjct  461   ILSHVKSRQLHHLLTPGKVLPDVCMDLNHFKDAFDWAEANNSGRIIPREGVD--------  512

Query  2512  SLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGY  2691
                       ++     K+F                      L EL   E E +S  K  
Sbjct  513   -------GFFRYWSPDIKVF----------------------LTELSHAESEKESLLKST  543

Query  2692  FRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISL  2871
             F       ++L+G   +                      HH+ W++L+ST AELDVLISL
Sbjct  544   F-------QRLIGRFCE----------------------HHTKWKQLVSTTAELDVLISL  574

Query  2872  SIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGH  3051
             +IA DYYEGPTCRP           P L AKSLGHP+ R+D+L KG FV ND+T+GG+ H
Sbjct  575   AIAGDYYEGPTCRPTFVGTLCTKEAPYLHAKSLGHPVRRSDTLGKGDFVPNDITIGGSDH  634

Query  3052  SSFILLTGPNMGGKSTLLRQVCLAVILAQV  3141
             +SFILLTGP MGGKSTLLRQVCL VILAQV
Sbjct  635   ASFILLTGPKMGGKSTLLRQVCLTVILAQV  664



>gb|AAF35250.1|AF227632_1 mismatch binding protein Mus3 [Zea mays]
Length=629

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/577 (64%), Positives = 461/577 (80%), Gaps = 3/577 (1%)
 Frame = +1

Query  1918  DAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAV  2097
             D AALENLE+ EN++  G SGTLYAQ+NHCVT FGKRLL+ W+A+PLY    I  RQ AV
Sbjct  1     DTAALENLELLENTRTGGLSGTLYAQLNHCVTGFGKRLLKRWIAKPLYDCREILRRQSAV  60

Query  2098  AGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFI  2277
             A  KGV      +FRK+LSRLPDMERLLA++F+S + N R+++ VVLYEDA+KK LQQF 
Sbjct  61    ATFKGVGQDCAAQFRKDLSRLPDMERLLARLFSSCDENKRSSS-VVLYEDASKKLLQQFT  119

Query  2278  SALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSS  2457
             SAL GC+ M +AC S+   + +  S+L+ DLL+PGKGL ++  ++ +F+D FDW +A+ +
Sbjct  120   SALCGCQQMFHACSSISTLICSEGSQLI-DLLSPGKGLSNISSILDRFRDAFDWSDADRN  178

Query  2458  GRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES  2637
             GR IP EG D E+DA C ++ +++ SL ++LKEQ+KL    S+NYV VGKD YL+EVPES
Sbjct  179   GRFIPYEGCDPEFDATCNAIEEIKSSLKEYLKEQRKLLRPASVNYVNVGKDMYLIEVPES  238

Query  2638  LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHS  2817
             L   VP+ YELQS+KKG++RYW P +++L+ ELS+AE+E+ESKLK+ILQ LI  F EHH+
Sbjct  239   LGGSVPRNYELQSTKKGFYRYWTPELKELILELSKAESEKESKLKAILQNLIQLFVEHHT  298

Query  2818  TWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDS  2997
              WR+L+S +AELDVL SL+IAS Y+EGP+C P I+E    D+ P   A++LGHPILR+DS
Sbjct  299   EWRQLVSVVAELDVLTSLAIASGYFEGPSCCPTIKESNGTDDTPTFHARNLGHPILRSDS  358

Query  2998  LDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLS  3177
             L KG+FV NDV +GG G++SFI+LTGPNMGGKSTLLRQVCL +ILAQ+GADVPA   +LS
Sbjct  359   LGKGSFVPNDVKIGGPGNASFIVLTGPNMGGKSTLLRQVCLTIILAQIGADVPAEKLELS  418

Query  3178  PVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIA  3357
              VDRIFVRMGA+DHIMAGQSTFL EL ETAS+LSSAT+NSLV LDELGRGTSTSDGQAIA
Sbjct  419   LVDRIFVRMGARDHIMAGQSTFLVELEETASVLSSATKNSLVVLDELGRGTSTSDGQAIA  478

Query  3358  ESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLT  3537
              SVLE+ VH+VQC G+FSTHYHRLA+++  D +VSLCHMAC + EG GGLEEVTFLY+LT
Sbjct  479   ASVLEYLVHQVQCLGLFSTHYHRLAMEHN-DTKVSLCHMACEVVEGGGGLEEVTFLYRLT  537

Query  3538  LGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
              G CP+SYGVNVARLAG+P  +L++A  KS EFE  Y
Sbjct  538   PGACPKSYGVNVARLAGIPTKLLQRANEKSSEFEANY  574



>gb|EMS59892.1| DNA mismatch repair protein Msh6-1 [Triticum urartu]
Length=626

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/521 (63%), Positives = 412/521 (79%), Gaps = 3/521 (1%)
 Frame = +1

Query  2086  QDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQL  2265
             +D   G  GV     ++FRK+L RLPDMERLLA +F+    NGR +  VVLYED AK+ L
Sbjct  53    EDTFVGF-GVGHECAMQFRKDLCRLPDMERLLAHLFSRCGENGR-SKSVVLYEDTAKRLL  110

Query  2266  QQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVE  2445
             QQF +ALRGC+ M  AC S+ A      S LL+DLL+PGKGLPDV  V+  F+D FDW E
Sbjct  111   QQFTAALRGCQQMFQACSSIRALTGTEGSSLLNDLLSPGKGLPDVSSVLDYFRDAFDWSE  170

Query  2446  ANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLE  2625
             A+ +GRIIP EG D EYDA   ++ ++E SL ++LKEQ+KL  D+S+ YV VGKD YL+E
Sbjct  171   ADHNGRIIPLEGCDPEYDATSCAIEEIESSLQEYLKEQRKLLRDSSVKYVNVGKDTYLIE  230

Query  2626  VPESLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFC  2805
             V ESL   VP +YELQS+KKG  RYW P +++L+ ELS+  T++ES LK ILQ+LI RF 
Sbjct  231   VSESLRGSVPSDYELQSTKKGVCRYWTPEVKQLISELSKVATDKESILKGILQKLIQRFI  290

Query  2806  EHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPIL  2985
             EHHS WR+L+S  AE+DVL+SLSIA DY+EGPTC P IREL   D+ P   A++LGHPI+
Sbjct  291   EHHSKWRQLVSVSAEIDVLVSLSIAGDYFEGPTCCPTIRELCGPDDTPTFHARNLGHPII  350

Query  2986  RTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAAS  3165
             R+DSL  G+FV N++ +GG G++SFI+LTGPNMGGKSTLLRQVCL +ILAQ+GA+VPA +
Sbjct  351   RSDSLSMGSFVPNNINMGGPGNASFIVLTGPNMGGKSTLLRQVCLTIILAQIGANVPAEN  410

Query  3166  FDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDG  3345
              +LS VDRIFVRMGA+DHIMAG+STFL EL+ETAS+LSSAT+NSLVALDELGRGTSTSDG
Sbjct  411   LELSLVDRIFVRMGARDHIMAGKSTFLVELMETASVLSSATKNSLVALDELGRGTSTSDG  470

Query  3346  QAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFL  3525
             QAIA SVL++ VH+VQC G+FSTHYH+LA+++ ED +VSLCHMAC +G G GGLEEVTFL
Sbjct  471   QAIAASVLDYLVHRVQCLGLFSTHYHKLAVEH-EDSKVSLCHMACQVGTGEGGLEEVTFL  529

Query  3526  YKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVY  3648
             Y+LT G+CP+SYGVNVARLAG+P +VL++A  KS +FE  Y
Sbjct  530   YRLTAGSCPKSYGVNVARLAGIPASVLQRANEKSIDFEANY  570



>ref|XP_005644720.1| hypothetical protein COCSUDRAFT_18682, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20176.1| hypothetical protein COCSUDRAFT_18682, partial [Coccomyxa subellipsoidea 
C-169]
Length=1204

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/986 (42%), Positives = 569/986 (58%), Gaps = 58/986 (6%)
 Frame = +1

Query  715   GGVKVIESVTNNLECVKASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpg-dV  891
             G    + +  N          DD+   +   R++ R  ++  FL         R+     
Sbjct  186   GSGTAMRAALNTPATAAKGGADDVEPASDMARYAKRAEDRFPFLSPQEIRDATRKRPGQP  245

Query  892   NYDSRTLYLPSDFLKG--LSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKEL  1065
              Y+ RTLY+P D+ K   +S GQRQWWEFK++H D V+ FKMGKFYE+FEMDAH+GA+ L
Sbjct  246   GYNPRTLYIPHDWFKKAKVSEGQRQWWEFKAQHFDSVMLFKMGKFYEMFEMDAHVGAEVL  305

Query  1066  DLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELR---RKKG-SKDK  1233
              L YMKGEQPHCGFPE N+ M+AE+L R G RV+VVEQ ETP+ L +R   R  G +K  
Sbjct  306   GLTYMKGEQPHCGFPEVNYLMHAERLVRAGLRVVVVEQTETPDMLRIRNDNRPAGQAKCN  365

Query  1234  VVKREICAVITKGTLTEGEMLTVSPDASYLIAVTE-SCQTSANQLGERTY-GVCVVDVAT  1407
             VV+RE+ A++T GTL + +ML   P+A+Y++++ E      A    +RT  G C  D A+
Sbjct  366   VVRREVVAILTTGTLADPDMLRTQPEAAYVLSLWERPAPPVAPGGPQRTLLGACYADCAS  425

Query  1408  SKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELV-PL  1584
             + + LGQ+ DD   S L + L E RP E++ PA  LS  T+RVL    R P  N L  P 
Sbjct  426   NTLTLGQWHDDLTRSQLRAQLAEMRPSELVLPAGGLSEATQRVLKAALRGPRTNRLAAPA  485

Query  1585  SEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAG  1764
             S    A   I E+             Y    A +   E+   DA           L+   
Sbjct  486   S----AADVIHELDTR---------DYFSCAAGM---EAGSRDA--------WPSLLKEP  521

Query  1765  ENGTYALSALGGTLFYLKQAFLDVSLLKFAEFELLP-----FSHFGMIAQKPYMVLDAAA  1929
                  AL ALG    +L++  LD  +L    F  LP                ++ LD +A
Sbjct  522   AEAEAALLALGLARRHLQEVLLDGRVLPLGAFRPLPGCARVAGADAAPDAPRFVALDGSA  581

Query  1930  LENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLK  2109
              +NLE+ EN++  GS+G+L A ++ C T  GKR LR WL RP+  +  I  RQDA  GL 
Sbjct  582   FDNLEVLENTEG-GSAGSLVACLDMCTTVMGKRQLRAWLCRPMARIADITARQDA--GLV  638

Query  2110  GVNL---PGVLEFRKELSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFIS  2280
              V +   P      +EL RL D+ER LA++ AS+ A G   N  + YED AK+++   I+
Sbjct  639   PVIVLLAPASPARARELFRLGDLERALARLQASTLAEGEGTNAAIYYEDTAKRKVLSLIT  698

Query  2281  ALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSG  2460
             ALRG +++      +G+ L + + + L    T G     +   +K+ +   DW +A   G
Sbjct  699   ALRGLQSVQQ----MGSELGSEELRRL----TMGPAAAGMARPLKELQAFTDWEQAAELG  750

Query  2461  RIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESL  2640
             R+IP  G +  +D A   +  VE    +HLKE +K  G +SI+YV+V KD++LL++P+S 
Sbjct  751   RVIPHPGAEAAFDNADARVAAVEAEFEQHLKEVKKKLGCSSISYVSVNKDSHLLDIPDSA  810

Query  2641  CELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHST  2820
                VP  YEL   KKG+ RY +P    L+ + + A+ ERE+ L +ILQ ++ RF   H+ 
Sbjct  811   AGSVPSSYELVGQKKGWKRYRSPRSADLVRDHTAAQEEREAALSTILQGVVRRFAREHAV  870

Query  2821  WRELISTIAELDVLISLSIASDY--YEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTD  2994
             W   +  +AELD L+SL+  +D    +GP CRP  R +P+  +     AK L HP     
Sbjct  871   WEAAVEAMAELDALMSLAAVADVGSAQGPMCRP--RLVPADRDRQIFTAKGLRHPSAGLH  928

Query  2995  SLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDL  3174
                   F+ NDV LGG   + FI+LTGPNMGGKSTLLRQVCLA ++AQVGA VPA S +L
Sbjct  929   MSAGATFIPNDVELGG-DKAPFIILTGPNMGGKSTLLRQVCLAALMAQVGAWVPAVSLEL  987

Query  3175  SPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAI  3354
             +PVD IFVRMGA+D IM GQSTFL EL+ETA+ L+ AT  SLVALDELGRGT+T+DG AI
Sbjct  988   TPVDAIFVRMGARDAIMTGQSTFLVELIETAAALNRATSASLVALDELGRGTATTDGAAI  1047

Query  3355  AESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKL  3534
             A +V+  F  +++CRG+F+THYH+LA  + +D   S+ HMACH+     G E+VTFLY+L
Sbjct  1048  AAAVIHAFTQRIKCRGLFATHYHKLADAHADDPTTSIRHMACHVDRDAAGREQVTFLYQL  1107

Query  3535  TLGTCPRSYGVNVARLAGLPDNVLEK  3612
               G CP+SYG   ARLAG+PD +L++
Sbjct  1108  QDGACPKSYGTACARLAGMPDAILDR  1133


 Score = 68.2 bits (165),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  160  PDSTESSYGQEVLNRRIKVYWPLDKCWYEGCVKSFDKISGKHLVQYDDEEEEMLNLSQER  339
            P+ +   +G+E++  R +V+W  DK WY+G +   D   GKHLV+Y+D E E L+LSQE+
Sbjct  9    PEQSGKGHGKEIVGLRCQVFWADDKTWYKGDITQHDATKGKHLVEYEDGETEWLDLSQEK  68

Query  340  IEWIE  354
             E ++
Sbjct  69   FELLQ  73



>gb|EMT09462.1| DNA mismatch repair protein Msh6-1 [Aegilops tauschii]
Length=551

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/530 (60%), Positives = 405/530 (76%), Gaps = 2/530 (0%)
 Frame = +1

Query  2167  MERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNT  2346
             MERLLA +F+    NGR +  VVLYED AK+ L+QF +ALRGC+ M  AC S+       
Sbjct  1     MERLLAHLFSRCGENGR-SKSVVLYEDTAKRLLKQFTAALRGCQQMFQACSSIRVLTGTE  59

Query  2347  DSKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKV  2526
              S LL+DLL+PGKGLPDV  ++  F+D FDW EA+ +GRIIP EG D EYDA   ++ ++
Sbjct  60    GSSLLNDLLSPGKGLPDVSSILDYFRDAFDWSEADHNGRIIPLEGCDPEYDATSCAIEEI  119

Query  2527  ELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFRYWN  2706
             E SL ++LKEQ+KL  D+S+ YV VGKD YL+EV ESL   VP +YELQS+KKG  RYW 
Sbjct  120   ESSLQEYLKEQRKLLKDSSVKYVNVGKDTYLIEVSESLRGSVPNDYELQSTKKGVCRYWT  179

Query  2707  PVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASD  2886
             P +++L+ ELS+  T++ES LK ILQ+LI  F EHHS WR+L+S  AE+DVL+SLSIA D
Sbjct  180   PEVKQLISELSKVATDKESILKGILQKLIHLFIEHHSKWRQLVSVAAEIDVLVSLSIAGD  239

Query  2887  YYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFIL  3066
             Y+EGPTC P IREL   D+ P   A++LGHPI+R+DSL KG+FV N++ +GG G++SFI+
Sbjct  240   YFEGPTCCPTIRELCGPDDTPTFHARNLGHPIIRSDSLGKGSFVPNNINMGGPGNASFIV  299

Query  3067  LTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFL  3246
             LTGPNMGGKSTLLRQVCL +ILAQ+GADVPA + +LS VDRIFVRMGA+DHIMAG+STFL
Sbjct  300   LTGPNMGGKSTLLRQVCLTIILAQIGADVPAENLELSLVDRIFVRMGARDHIMAGKSTFL  359

Query  3247  TELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHR  3426
              EL+ETAS+LSSAT+NSLVALDELGRGTSTSDGQAIA SVL++ V +VQC G+FSTHYH+
Sbjct  360   VELMETASVLSSATKNSLVALDELGRGTSTSDGQAIAASVLDYLVQRVQCLGLFSTHYHK  419

Query  3427  LAIDYQEDRQVSLCHMACHIGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVL  3606
             LA+++++D+ VSLCHMAC +G G GGLEEVTFLY+LT G+CP+SYGVNVARLAG+P +VL
Sbjct  420   LAVEHEDDK-VSLCHMACQVGTGEGGLEEVTFLYRLTAGSCPKSYGVNVARLAGIPASVL  478

Query  3607  EKAAAKSREFEGVYgnnkgsrgnssknWDEKAIEVIRSLMHLADYNERHG  3756
             ++A  KS +FE  YG    +  + +    E     I+ L  +       G
Sbjct  479   QRANEKSIDFEASYGKRCCATKDKAICTQEDNFTTIKDLFRVVKAGNHQG  528



>ref|XP_001418476.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96769.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1113

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/992 (41%), Positives = 558/992 (56%), Gaps = 86/992 (9%)
 Frame = +1

Query  772   NGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLK----  936
             N  D+L G   E++  R+  K  F+   +      R   D +YD  TL LPS F K    
Sbjct  99    NAQDVLAGVGPEQYDARDRLKFPFMQPEKIKDADGRRPDDPDYDPSTLLLPSTFPKMRDA  158

Query  937   -----GLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHC  1101
                   +S GQ QWW+FK+ + D VL FKMGKFYE+FEMDAHIG ++L L YM+GEQPH 
Sbjct  159   SGVQWTVSPGQAQWWKFKAANFDSVLLFKMGKFYEMFEMDAHIGVRDLGLMYMRGEQPHA  218

Query  1102  GFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSKDK--VVKREICAVITKGT  1275
             GFPEKN++M+AE+LAR G+RV+ +EQ ETP QL  R+KK    K  VV+RE+  V+TKGT
Sbjct  219   GFPEKNYAMHAEQLARNGHRVVCIEQTETPAQLAERKKKDKTCKDTVVRREMVQVLTKGT  278

Query  1276  LTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcss  1455
             + +  ML  SPDA+++ ++ + C+    + GE   G+C  D  T + ++G + DD   S 
Sbjct  279   MVDTGMLNSSPDAAFVCSIIDGCE---EEDGEGWVGLCAADCGTGRFLVGAWRDDEGASC  335

Query  1456  lcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMY  1635
             L + L E RPVEI+ P   LS   +  +                        +    +  
Sbjct  336   LRTALAELRPVEILVPPTGLSARAKMAV------------------------LDMCSHAQ  371

Query  1636  QRLNNTPIPYSQNEADLHPSESIDNDAQLRN-LPNVLSELVNAGENGTY--ALSALGGTL  1806
             QR   +    S NEA L  +E+      L+  LP  + E+ +   +      + A G  +
Sbjct  372   QRTFKS---TSANEA-LEDAEAEGYFKTLKTGLPEAIKEMRDTACHPARECGIGAWGTVV  427

Query  1807  FYLKQAFLDVSLLKFAEFELLPFS------HFGMIAQKPYMVLDAAALENLEIFENSKNC  1968
              YL+ A +D  L+     E L  +      H    A   ++ +DAAAL  LE+ EN+   
Sbjct  428   AYLRAALIDADLVPQGRVESLHTTDAGAREHLARWAHSTHVAMDAAALSGLEVLENTAG-  486

Query  1969  GSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKE  2148
             GS+GTL A ++ CV+  G+RLLR W+ RPL    AI+ RQ AV+ ++G  +      RK 
Sbjct  487   GSAGTLLASLDRCVSGPGRRLLRRWVCRPLTSASAIRARQVAVSMMRGCGIEATGIARKL  546

Query  2149  LSRLPDMERLLAQIFASSEANGRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLG  2328
             L   PD ER ++++  SS   GR+A+ VVLYEDAA+ +L  F++AL G   + +A  ++ 
Sbjct  547   LRAAPDAERAISRVVGSSGEKGRSASHVVLYEDAARAKLNDFLAALEGIRAVRDATKAIA  606

Query  2329  ATLD--------------NTDSKLLHDLLTP--GKGLPDVKLVIKQFKDGFDWVEANSSG  2460
             A +D              N  +    D+ T   G  +PD+   + + +  FDW  A SSG
Sbjct  607   ACVDACEKSDVLRALCIVNDAAATREDVFTAVGGVAMPDLS-ALDEMESAFDWNAAKSSG  665

Query  2461  RIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFG--DTSINYVTVGKDAYLLEVPE  2634
             RI P +GVD + DAA   L   +  LA  L+E +   G   T + +V   KD +L+EVP+
Sbjct  666   RIEPAQGVDADLDAAEEQLTAADADLASWLEEARGELGGHKTEVCFVNANKDTHLVEVPD  725

Query  2635  SLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHH  2814
              L   VP  +  +  +KGY R+    +  L  +   AE  RE  L  + +R++ +FCE+ 
Sbjct  726   RLASKVPHHWVREGKRKGYERFTCDDLVPLRAKRVAAEEAREDALAGVFRRIVAKFCENA  785

Query  2815  STWRELISTIAELDVLISLSIASD-YYE--GPTCRPHIRELPSQDNVPCLVAKSLGHPIL  2985
             S W+   S  A +DVL SL++ S+  Y   G  C P +   P       L +  L HP  
Sbjct  786   SEWQAAASVGAIIDVLASLAVVSEEMYASCGAVCTPKVHPQPRDGEPATLESVGLSHPC-  844

Query  2986  RTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAAS  3165
                SL + AFV ND  LGG  H  F L+TGPNMGGKST LRQVCLA I+A VGADVPAA 
Sbjct  845   -ASSLAR-AFVPNDARLGGK-HPGFCLITGPNMGGKSTYLRQVCLAAIMAHVGADVPAAK  901

Query  3166  FDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDG  3345
             F+++ +D +FVRMGAKD++  GQSTF+ EL ET +ML  AT NSLVALDELGRGT+T+DG
Sbjct  902   FEMTAMDAVFVRMGAKDNLAGGQSTFMVELSETGAMLRRATTNSLVALDELGRGTATADG  961

Query  3346  QAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHI----GEGLG--GL  3507
              AIA +V  H + K +CR +FSTHYHRLA D+  D  V+L HMAC +    G G+   G 
Sbjct  962   TAIACAVASHLIDK-RCRTLFSTHYHRLADDHARDPHVALAHMACRVETPSGAGVETLGR  1020

Query  3508  EEVTFLYKLTLGTCPRSYGVNVARLAGLPDNV  3603
             E VTFLY L  G CPRSYGVNVARLAGLP++V
Sbjct  1021  ETVTFLYTLASGNCPRSYGVNVARLAGLPESV  1052



>emb|CEF98388.1| DNA mismatch repair protein MutS-homologue MSH6 [Ostreococcus 
tauri]
Length=1211

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/1044 (39%), Positives = 572/1044 (55%), Gaps = 103/1044 (10%)
 Frame = +1

Query  664   KSGGNNKSTQSKAPTATGGVKVIESVTNNLECVKASNGDDILTGNSAERFSMREMEKLGF  843
             K+ G NK+T +     T  V    S   +L         ++L G   E+++ RE  K  F
Sbjct  162   KTNGRNKTTVN-----TTSVAAKSSEPKDLSAA------EVLGGVGPEQYAARERLKFTF  210

Query  844   Lgkgrrdadrrrp-gdVNYDSRTLYLPSDFLK---------GLSGGQRQWWEFKSKHMDK  993
             L        + R   D +YD  +L LPS F K          +S GQ QWW FK+ + D 
Sbjct  211   LQPENIKDAKGRRPSDPDYDPSSLLLPSTFPKLRDANGQPWTVSPGQAQWWRFKAANFDS  270

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             VL FKMGKFYE+FEMDAHIG ++L L YM+G+QPH GFPEKN++M+AE+LARKG+RV+ +
Sbjct  271   VLLFKMGKFYEMFEMDAHIGVRDLGLMYMRGDQPHAGFPEKNYAMHAEQLARKGHRVVCI  330

Query  1174  EQIETPEQLELRRKKGS--KDKVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQ  1347
             EQ ETP+QL  R++K    KD VV+RE+  V+TKGT+ +  ML  SPDA+Y+ ++ +   
Sbjct  331   EQTETPDQLAERKRKDKTCKDTVVRREMVQVLTKGTMVDTGMLNSSPDAAYVCSIVDGGV  390

Query  1348  TSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHET  1527
                        G+C  D  T + ++G + DD   S L + L E RPVEI+ P   +S  T
Sbjct  391   EDDGDG---WVGLCAADCGTGRFLVGAWRDDEGASCLRTALAELRPVEILVPPSGMSTRT  447

Query  1528  ERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESID  1707
                      N  V E+   ++               QR   T      + AD    + ++
Sbjct  448   ---------NGAVLEMCSSAQ---------------QRTFKT-----TSAADA--IQDVE  476

Query  1708  NDAQLRNL----PNVLSELVNAGENGTY--ALSALGGTLFYLKQAFLDVSLLKFAEFELL  1869
              +   +NL    P  + EL +   +      +SA G  + YL+ A +D  L+     E L
Sbjct  477   TEGYFKNLKSGLPAAIKELRDTACDPARECGISAWGTIVAYLRAALIDADLVPQGRIESL  536

Query  1870  PFS------HFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRL  2031
               +           A   ++ +DAAAL  LE+ EN+   GS+GTL A ++ C +  G+RL
Sbjct  537   HTTEADTREQLARWAHSSHVAMDAAALSGLEVLENTAG-GSAGTLLASLDRCASGPGRRL  595

Query  2032  LRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASSEAN  2211
             LR W+ RPL    AIK RQ A+A ++G  L      RK L   PD ER ++++  SS   
Sbjct  596   LRRWVCRPLMSPSAIKARQIAIAAMRGSGLEVTGIARKLLREAPDTERAISRVVGSSGGR  655

Query  2212  GRNANKVVLYEDAAKKQLQQFISALRGCETMVNACFSLGATLDNT-------------DS  2352
             GR+A  VVLYED A+ +L  F++AL G   + +A  ++ +  D               D 
Sbjct  656   GRDAAHVVLYEDMARAKLNDFLAALEGVRAVRDAVNAIASCDDACKKSSVLRALCVAGDE  715

Query  2353  KLLHD---LLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRK  2523
                H+     T G  +PD+   +K  +  FDW  A ++GRI P  G+D + DAA   L  
Sbjct  716   AATHEDVFTATGGVAIPDLS-ELKDMEAAFDWNAAKTNGRIEPARGIDADLDAAEDKLAA  774

Query  2524  VELSLAKHLKEQQKLFG--DTSINYVTVGKDAYLLEVPESLCELVPQEYELQSSKKGYFR  2697
              +  LA  L+E +   G   T + +V   KD +L+EVP+ L   VP  +  +  +KG+ R
Sbjct  775   ADAQLAAWLEEARVQLGGHKTEVCFVNANKDTHLVEVPDRLAAKVPHNWVREGKRKGFER  834

Query  2698  YWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSI  2877
             +    +  L  + + A+  RE  L  + +R++ +FCE+   W+   S  A +DVL SL++
Sbjct  835   FTCGELEPLRAKRATAQEAREEALSGVFRRVVAKFCENAGKWQAAASVGAVIDVLSSLAV  894

Query  2878  ASDYYEG---PTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAG  3048
             ASD         C P +   P+Q     LV+K+L HP     SL + +FV ND  LGG  
Sbjct  895   ASDEMYASCSAVCTPKVHPAPAQSESATLVSKNLSHPCAL--SLAR-SFVPNDARLGGE-  950

Query  3049  HSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMA  3228
             H  F L+TGPNMGGKST +RQVCLA I+A VGADVPA+ F+++ +D +FVRMGAKD++  
Sbjct  951   HPGFCLITGPNMGGKSTYIRQVCLAAIMAHVGADVPASKFEMTAMDAVFVRMGAKDNLAG  1010

Query  3229  GQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMF  3408
             GQSTF+ EL ETA+ML  AT NSLVALDELGRGT+T+DG AIA +V  H + + +CR +F
Sbjct  1011  GQSTFMVELSETAAMLRRATTNSLVALDELGRGTATADGTAIACAVASHLIER-RCRTLF  1069

Query  3409  STHYHRLAIDYQEDRQVSLCHMACHI------GEGLGGLEEVTFLYKLTLGTCPRSYGVN  3570
             STHYHRLA D+  D  V+L HMAC +      G    G E VTFLY L  G CPRSYGVN
Sbjct  1070  STHYHRLADDHARDPNVALAHMACRVETPSDAGADAYGRETVTFLYTLASGNCPRSYGVN  1129

Query  3571  VARLAGLPDNVLEKAAAKSREFEG  3642
             VARLAGLP++V   AA ++   E 
Sbjct  1130  VARLAGLPESVCLAAARRASRLEA  1153



>ref|XP_002953223.1| hypothetical protein VOLCADRAFT_105835 [Volvox carteri f. nagariensis]
 gb|EFJ45822.1| hypothetical protein VOLCADRAFT_105835 [Volvox carteri f. nagariensis]
Length=1515

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/1033 (40%), Positives = 573/1033 (55%), Gaps = 131/1033 (13%)
 Frame = +1

Query  895   YDSRTLYLPSDFLK--GLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELD  1068
             YD RTLY+P  + K   +S GQ+QWW FK+ + D VL FKMGKFYE+FEMDA++G + L 
Sbjct  408   YDPRTLYIPPGWFKEFKISEGQQQWWNFKAHNFDSVLLFKMGKFYEMFEMDAYVGVEVLG  467

Query  1069  LQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQI----ETPEQL----ELRRKKGS  1224
             L +M+GEQPH GFPE  ++  AE LAR GYRV+VVEQ+    ETPE L    E RR +G 
Sbjct  468   LTFMRGEQPHAGFPEVKYADMAESLARAGYRVVVVEQVMKGTETPEMLAKRNEQRRMQGK  527

Query  1225  KD-KVVKREICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERT-------Y  1380
             K   VV R+  AV+++GTL + EM+   PDASY++AV E       Q             
Sbjct  528   KQANVVDRQKVAVLSRGTLVDAEMVASRPDASYVLAVAEMDVGGDEQEAAADKAAGAVRI  587

Query  1381  GVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNP  1560
             G+C VD A+ +V++G+F DD   S+L + L   +P E++ P K LS  T  VL    R+P
Sbjct  588   GLCAVDAASGQVLVGEFVDDEVRSTLRTQLTALQPQELVLPRKALSATTSHVLRNGVRDP  647

Query  1561  LVNELVPLSEFWDAEKTISEVKNM-----------------------YQRLNN-------  1650
              VN +   +  W AEKT   +++                        Y    +       
Sbjct  648   RVNSMRGPAGDWSAEKTYRALRDAEYFTASSAAPAATSSPAAAQGGAYGTSEDMEVDGCG  707

Query  1651  ----TPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAG-ENGTYALSALGGTLFYL  1815
                  P     +  D+ PS         +  P +L  +V+ G  +   A++ALGG + +L
Sbjct  708   QGAAAPGATRSSRPDVDPS---------KRWPQLLRRIVSDGVSSRPAAMAALGGMIAFL  758

Query  1816  KQAFLDVSLLKFAEFELLP--FSHFGMI-------------AQKP-YMVLDAAALENLEI  1947
             K + LD ++L    FE LP   +  G               A+ P YM L+ AALENLEI
Sbjct  759   KDSLLDRAVLPLGRFEELPALVASRGSAGAGEDSSGADVAGAEGPLYMALNGAALENLEI  818

Query  1948  FENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPG  2127
              ENS + GS+GTL + +++C T FG+R LR WL RPL  +  I+ RQDAVA L G     
Sbjct  819   LENS-DGGSAGTLLSVLDNCATPFGRRRLRQWLCRPLGRIPDIQARQDAVAQLCGELAEA  877

Query  2128  VLEFRKELSRLPDMERLLAQIFAS--SEANGRNANKVVLYEDAAKKQLQQFISALRGCET  2301
             V + RK L+ + D+ER +A++ AS  S A+GR+A  VVLYEDA K+++    S L+    
Sbjct  878   VGQARKLLASVSDLERAVARLHASTVSGASGRDAANVVLYEDAGKRRVAALTSVLKDLRA  937

Query  2302  MVNACFSLGATLDNTD--SKLLHDLLTPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPC  2475
                A   L   +      S+LL  ++       +V   ++  +   DW EA ++GR +P 
Sbjct  938   AHGALSRLREAMQGGGGGSELLRRIVFDRCRPAEVSSALEALEGATDWKEAAATGRAVPE  997

Query  2476  EGV-------DEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPE  2634
             +         DEEYDAA  ++  VE  +  +LKE ++ FG   +N V+V KD++L+EVP+
Sbjct  998   QVAGVGVGGVDEEYDAAMEAVDTVERKMQDYLKELRQRFG-RDVNLVSVNKDSHLVEVPD  1056

Query  2635  SLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHH  2814
             S+   +  E+ L  ++KGY R+    ++ L+ +L +    +E+ L SIL RL+ +F  H 
Sbjct  1057  SVAGKLGGEFHLVGNRKGYKRFTGNRLKALVADLDRVMERKEAVLSSILTRLLVKFVSHK  1116

Query  2815  STWRELISTIAELDVLISLSI--ASDYYEGPTCRPHIRELPSQDNVP-----------CL  2955
             + W  ++  +A+LD L+SL+    S    GP CRP +    ++D+               
Sbjct  1117  ALWVAVVEAVADLDALMSLAAHAMSPPDGGPMCRPKLVPPAARDSAAGKTGDSEPSGATF  1176

Query  2956  VAKSLGHPILRTDSLDKGAFVSNDVTLGGAGH----SSFILLTGPNMGGKSTLLRQVCLA  3123
              A ++ HP       + GAFV NDV LG  G       FILL+GPNMGGKSTLLRQVCLA
Sbjct  1177  DAVAMRHPA-GISGRNNGAFVPNDVRLGRGGSCGGAPPFILLSGPNMGGKSTLLRQVCLA  1235

Query  3124  VILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLV  3303
              +LAQ+GA VPA S  LSP D IFVRMGA+D IM GQSTF  EL ETA+ML+ AT +SLV
Sbjct  1236  TVLAQIGACVPAESLTLSPADAIFVRMGARDAIMTGQSTFFIELAETAAMLAKATSDSLV  1295

Query  3304  ALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACH  3483
             ALDELGRGT+T DG A+A +VL+H      CRG+F+THYH L+ ++  D QV++ HMAC 
Sbjct  1296  ALDELGRGTATLDGAAVAGAVLQHLATVTGCRGLFATHYHHLSDEHANDPQVAVMHMACA  1355

Query  3484  IGEGLGG----------------------LEEVTFLYKLTLGTCPRSYGVNVARLAGLPD  3597
             +     G                       EEVTFLY+LT G CP+SYG NVARLAGLP 
Sbjct  1356  VEGAADGEEAATAPSSVGNGTGGAGASSGAEEVTFLYRLTPGACPKSYGTNVARLAGLPP  1415

Query  3598  NVLEKAAAKSREF  3636
              V+ +AA  S ++
Sbjct  1416  KVVIRAAEVSAQW  1428



>ref|XP_005152105.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein Msh6 
[Melopsittacus undulatus]
Length=1264

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/996 (40%), Positives = 572/996 (57%), Gaps = 78/996 (8%)
 Frame = +1

Query  793   GNSAERFSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
             GNS   F++ E EKL +L +  R+DA RRR  D +YD  TLY+P D+L   + G R+WW+
Sbjct  264   GNSG--FAVWEHEKLDWLQEGKRKDAHRRRQNDPDYDPCTLYVPEDYLNKCTPGMRRWWQ  321

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F    + L +
Sbjct  322   LKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPEIAFGRFCDVLVQ  381

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS  1317
             KGY+V  VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   ++   P  S
Sbjct  382   KGYKVARVEQTETPEMMEARYKSMAHPTRFDKVVRREICRIITKGTKTYS-IMDCDPSES  440

Query  1318  ---YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
                YL+ V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  441   HNKYLLCVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLIAHYTPV  496

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYS  1668
             +++     LS ET+++L     + +   L+  S+FW+A KT+  +               
Sbjct  497   QVLYEKGNLSVETQKILKGSLISCIQEGLISGSQFWNASKTLKVL---------------  541

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQA  1824
               E     +E+ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+ 
Sbjct  542   LEEGYFKENENSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKRC  598

Query  1825  FLDVSLLKFAEFE------------LLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNC  1968
              +D  LL  A+FE            + P S F    Q+  MVLD   L NLE+ +N  N 
Sbjct  599   LIDQELLSLADFEEYIPVDIDTAKTMRPSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNG  656

Query  1969  GSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRK  2145
              + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  +
Sbjct  657   TTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSE  714

Query  2146  ELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVN  2310
              L +LPD+ERLL++I +     ++     ++ V YE+   +KK++  F+SAL G + M  
Sbjct  715   HLKKLPDLERLLSKIHSIGSPLKSQTHPDSRAVFYEEIKYSKKKIADFLSALEGFKVMSE  774

Query  2311  ACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPC  2475
                 +  T  +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P 
Sbjct  775   IVDGMEGTASDFKSKVLKQLVTRKDKNPNGRFPDLSAELKRWDTAFDHNQARKTGVITPK  834

Query  2476  EGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-V  2652
              G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +
Sbjct  835   AGFDPDYDKALQDIKAVEEELQKYLDKQRKLLGFKSVLYWGTGKNRYQMEIPESVVSRKL  894

Query  2653  PQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWREL  2832
             P+EYEL+SS+KGY RYW   I K++  +  AE  R++ LK  ++R    F ++   W   
Sbjct  895   PEEYELKSSRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRXFYNFDKNSKDWHTA  954

Query  2833  ISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGA  3012
             +  IA LDVLISL+  S   +GP CRP I  LP     P L  ++  HP + T +     
Sbjct  955   VECIAVLDVLISLANYSQDGDGPLCRPVIL-LPEDSAPPFLELRNSRHPCI-TKTFFGDD  1012

Query  3013  FVSNDVTLG-----GAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLS  3177
             F+ ND+ +G     G+  +S +L+TGPNMGGKSTL+RQ  L  I+AQ+G  VPA    L+
Sbjct  1013  FIPNDIVIGSKDEDGSNEASCVLVTGPNMGGKSTLMRQAGLLAIMAQLGCYVPAEVCRLT  1072

Query  3178  PVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIA  3357
             P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA
Sbjct  1073  PIDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIA  1132

Query  3358  ESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYK  3531
              +V++    K++CR +FSTHYH L  D+  +  V L HMAC +         E +TFLYK
Sbjct  1133  SAVVKELAEKIKCRTLFSTHYHSLVEDHAHNVAVRLGHMACMVENESEDPSQETITFLYK  1192

Query  3532  LTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              T G CP+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1193  FTEGACPKSYGFNAARLADIPEEVIQKGHRKAKEFE  1228



>ref|XP_009498652.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Phalacrocorax 
carbo]
Length=1261

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/990 (40%), Positives = 571/990 (58%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F+  E EKL +L +  ++DA R+R  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  265   FTTWEHEKLDWLQEGKKKDAHRKRQSDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  324

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  325   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  384

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  ++    DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  385   RVEQTETPEMMETRYKSMARPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  443

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  444   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  499

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +      L        QN    
Sbjct  500   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL------LEGEYFKEKQNS---  550

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                   +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  551   ------ENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  601

Query  1843  LKFAEFE------------LLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A+FE              P + F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  602   LSLAKFEEYVPVDIDTARTTSPSNFFAKTDQR--MVLDGVTLMNLEVLQNRTNGTTEGTL  659

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  660   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  717

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  718   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMTEIVNVME  777

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  778   EIASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKVGFDPD  837

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  838   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESAISRNLPEEYEL  897

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  898   KSTRKGYKRYWTKEIEKMLAAMLNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  957

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  958   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1015

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA +  L+P+DR+F
Sbjct  1016  VIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEACRLTPIDRVF  1075

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT++SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1076  TRLGASDRIMSGESTFFVELSETSSILQHATQHSLVLVDELGRGTATFDGTAIASAVVKE  1135

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  DY ++  V L HMAC +         E +TFLYK   G C
Sbjct  1136  LAEKIRCRTLFSTHYHSLVEDYSDNAAVRLGHMACMVENESEDPSQERITFLYKFIEGAC  1195

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K+REFE
Sbjct  1196  PKSYGFNAARLANIPEEVIQKGHRKAREFE  1225



>gb|KFW73771.1| DNA mismatch repair protein Msh6, partial [Phalacrocorax carbo]
Length=1275

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/990 (40%), Positives = 571/990 (58%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F+  E EKL +L +  ++DA R+R  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  279   FTTWEHEKLDWLQEGKKKDAHRKRQSDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  338

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  339   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  398

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  ++    DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  399   RVEQTETPEMMETRYKSMARPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  457

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  458   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  513

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +      L        QN    
Sbjct  514   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL------LEGEYFKEKQNS---  564

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                   +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  565   ------ENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  615

Query  1843  LKFAEFE------------LLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A+FE              P + F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  616   LSLAKFEEYVPVDIDTARTTSPSNFFAKTDQR--MVLDGVTLMNLEVLQNRTNGTTEGTL  673

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  674   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  731

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  732   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMTEIVNVME  791

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  792   EIASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKVGFDPD  851

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  852   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESAISRNLPEEYEL  911

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  912   KSTRKGYKRYWTKEIEKMLAAMLNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  971

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  972   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1029

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA +  L+P+DR+F
Sbjct  1030  VIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEACRLTPIDRVF  1089

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT++SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1090  TRLGASDRIMSGESTFFVELSETSSILQHATQHSLVLVDELGRGTATFDGTAIASAVVKE  1149

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  DY ++  V L HMAC +         E +TFLYK   G C
Sbjct  1150  LAEKIRCRTLFSTHYHSLVEDYSDNAAVRLGHMACMVENESEDPSQERITFLYKFIEGAC  1209

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K+REFE
Sbjct  1210  PKSYGFNAARLANIPEEVIQKGHRKAREFE  1239



>ref|XP_009498577.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Phalacrocorax 
carbo]
Length=1262

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/990 (40%), Positives = 571/990 (58%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F+  E EKL +L +  ++DA R+R  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  266   FTTWEHEKLDWLQEGKKKDAHRKRQSDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  325

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  326   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  385

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  ++    DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  386   RVEQTETPEMMETRYKSMARPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  444

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  445   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  500

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +      L        QN    
Sbjct  501   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL------LEGEYFKEKQNS---  551

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                   +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  552   ------ENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  602

Query  1843  LKFAEFE------------LLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A+FE              P + F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  603   LSLAKFEEYVPVDIDTARTTSPSNFFAKTDQR--MVLDGVTLMNLEVLQNRTNGTTEGTL  660

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  661   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  718

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  719   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMTEIVNVME  778

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  779   EIASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKVGFDPD  838

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  839   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESAISRNLPEEYEL  898

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  899   KSTRKGYKRYWTKEIEKMLAAMLNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  958

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  959   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1016

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA +  L+P+DR+F
Sbjct  1017  VIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEACRLTPIDRVF  1076

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT++SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1077  TRLGASDRIMSGESTFFVELSETSSILQHATQHSLVLVDELGRGTATFDGTAIASAVVKE  1136

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  DY ++  V L HMAC +         E +TFLYK   G C
Sbjct  1137  LAEKIRCRTLFSTHYHSLVEDYSDNAAVRLGHMACMVENESEDPSQERITFLYKFIEGAC  1196

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K+REFE
Sbjct  1197  PKSYGFNAARLANIPEEVIQKGHRKAREFE  1226



>ref|XP_010013366.1| PREDICTED: DNA mismatch repair protein Msh6 [Nestor notabilis]
Length=1265

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/962 (40%), Positives = 551/962 (57%), Gaps = 75/962 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  297   DYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGL  356

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV
Sbjct  357   IFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARVEQTETPEMMEARYKSMAHPTKFDKVV  416

Query  1240  KREICAVITKGTLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   ++   P  +   YL+ V E   +S    G+R YGVC VD +  
Sbjct  417   RREICRIITKGTQTYS-IMDCDPSENHNKYLLCVKEKEDSS----GQRVYGVCFVDTSVG  471

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+
Sbjct  472   KFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLISCIQEGLISGSQ  531

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FW+A KT+  +                 E     +E+ +N      LP+V+  L      
Sbjct  532   FWNASKTLKVL---------------LEEGYFKENENSENGC---TLPSVIKSLTSESDS  573

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE------------LLPFSHFGM  1890
               +  GEN   ALSALGG +FYLK+  +D  LL  A FE              P S F  
Sbjct  574   LGLTPGENSELALSALGGCVFYLKKCLIDQELLSLANFEEYIPVDIDTAKTTRPSSFFAK  633

Query  1891  IAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLE  2070
               Q+  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + +
Sbjct  634   TDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPK  691

Query  2071  AIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVL  2238
             +I +R DAV  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + 
Sbjct  692   SINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQTHPDSRAIF  749

Query  2239  YEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPD  2397
             YE+   +KK++  F+SAL G + M     S+  +  +  SK+L  L+T     P    PD
Sbjct  750   YEEIKYSKKKIADFLSALEGFKVMSEIVDSMEESASDFKSKVLKQLVTRKDKNPDGRFPD  809

Query  2398  VKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGD  2577
             +   +K++   FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G 
Sbjct  810   LSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEELQKYLDKQRKLLGF  869

Query  2578  TSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
              S+ Y   GK+ Y +E+PES+    +P+EYEL+SS+KG+ RYW   I K++  +  AE  
Sbjct  870   KSVLYWGAGKNRYQMEIPESVVSRKLPEEYELKSSRKGFKRYWTKEIEKMLAAMVNAEER  929

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             R++ LK  ++RL   F ++   W   +  IA LDVL+SL+  S   +GP CRP I  LP 
Sbjct  930   RDAALKDCMRRLFYNFDKNSKDWHTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPV  988

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-----GAGHSSFILLTGPNMGGKST  3099
                 P L  K+  HP + T +     F+ ND+ +G     G+  +S +L+TGPNMGGKST
Sbjct  989   DSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSKDEDGSSEASCVLVTGPNMGGKST  1047

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             L+RQ  L  I+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L 
Sbjct  1048  LMRQAGLLAIMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQ  1107

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT +SLV +DELGRGT+T DG AIA +V++    K++CR +FSTHYH L  D+  +  V
Sbjct  1108  HATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKIKCRTLFSTHYHSLVEDHAHNVAV  1167

Query  3460  SLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              L HMAC +         E +TFLYK T G CP+SYG N ARLA +P+ V++K   K++E
Sbjct  1168  RLGHMACMVENESEDPSQETITFLYKFTEGACPKSYGFNAARLADIPEEVIQKGHRKAKE  1227

Query  3634  FE  3639
             FE
Sbjct  1228  FE  1229



>ref|XP_009955505.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Leptosomus 
discolor]
Length=1264

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/989 (40%), Positives = 565/989 (57%), Gaps = 74/989 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D NYD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  268   FAVWEHEKLDWLQEGKKKDAHRKRQGDPNYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  327

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  328   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  387

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  388   RVEQTETPEMMETRYKSMTHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  446

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  447   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  502

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  503   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  547

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  548   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  604

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  605   LSLANFEEYVPVDIDTAKTTSSSSFFARTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  662

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V    + E  + L +LPD
Sbjct  663   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-DKISEVSEHLKKLPD  721

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +  
Sbjct  722   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDLMEE  781

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    P++   +K++   FD  +A  +G I P  G D +Y
Sbjct  782   IASDFKSKVLKQLVTRKARNPDGRFPELSAELKRWDTAFDHNQARKTGVITPKVGFDPDY  841

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+
Sbjct  842   DKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYELK  901

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             SS+KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  902   SSRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  961

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ 
Sbjct  962   DVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIV  1019

Query  3034  LGGA-----GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G         +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+PVDR+F 
Sbjct  1020  IGSKEEDSNSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPVDRVFT  1079

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++  
Sbjct  1080  RLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKEL  1139

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK T G CP
Sbjct  1140  AEKIKCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFTEGACP  1199

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +SYG N ARLA +P+ V++K   K+REFE
Sbjct  1200  KSYGFNAARLANIPEEVIQKGHRKAREFE  1228



>ref|XP_009955504.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Leptosomus 
discolor]
Length=1265

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/989 (40%), Positives = 565/989 (57%), Gaps = 74/989 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D NYD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  269   FAVWEHEKLDWLQEGKKKDAHRKRQGDPNYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  328

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  329   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  388

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  389   RVEQTETPEMMETRYKSMTHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  447

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  448   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  503

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  504   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  548

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  549   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  605

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  606   LSLANFEEYVPVDIDTAKTTSSSSFFARTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  663

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V    + E  + L +LPD
Sbjct  664   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-DKISEVSEHLKKLPD  722

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +  
Sbjct  723   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDLMEE  782

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    P++   +K++   FD  +A  +G I P  G D +Y
Sbjct  783   IASDFKSKVLKQLVTRKARNPDGRFPELSAELKRWDTAFDHNQARKTGVITPKVGFDPDY  842

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+
Sbjct  843   DKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYELK  902

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             SS+KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  903   SSRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  962

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ 
Sbjct  963   DVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIV  1020

Query  3034  LGGA-----GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G         +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+PVDR+F 
Sbjct  1021  IGSKEEDSNSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPVDRVFT  1080

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++  
Sbjct  1081  RLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKEL  1140

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK T G CP
Sbjct  1141  AEKIKCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFTEGACP  1200

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +SYG N ARLA +P+ V++K   K+REFE
Sbjct  1201  KSYGFNAARLANIPEEVIQKGHRKAREFE  1229



>ref|XP_009703449.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Cariama 
cristata]
Length=1262

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/990 (40%), Positives = 567/990 (57%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  266   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  325

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  326   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  385

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  386   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-ILDCDPSENHNKYLL  444

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  445   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  500

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  501   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  545

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                +S +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  546   KEKQSSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  602

Query  1843  LKFAEF-ELLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A F E +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  603   LSLANFKEYVPVDIDTAKTTSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  660

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  661   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  718

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  719   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  778

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                ++  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  779   EVANDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  838

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL
Sbjct  839   YDKALQDIKTVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYEL  898

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  899   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  958

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  959   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1016

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1017  VIGSKDEDNSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1076

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IMAG+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1077  TRLGASDRIMAGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1136

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1137  LAEKIRCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1196

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1197  PKSYGFNAARLANIPEEVIQKGHRKAKEFE  1226



>ref|XP_009703448.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Cariama 
cristata]
Length=1263

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/990 (40%), Positives = 567/990 (57%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  267   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  326

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  327   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  386

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  387   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-ILDCDPSENHNKYLL  445

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  446   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  501

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  502   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  546

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                +S +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  547   KEKQSSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  603

Query  1843  LKFAEF-ELLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A F E +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  604   LSLANFKEYVPVDIDTAKTTSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  661

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  662   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  719

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  720   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  779

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                ++  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  780   EVANDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  839

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL
Sbjct  840   YDKALQDIKTVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYEL  899

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  900   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  959

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  960   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1017

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1018  VIGSKDEDNSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1077

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IMAG+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1078  TRLGASDRIMAGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1137

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1138  LAEKIRCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1197

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1198  PKSYGFNAARLANIPEEVIQKGHRKAKEFE  1227



>gb|KFQ00736.1| DNA mismatch repair protein Msh6, partial [Leptosomus discolor]
Length=1274

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/989 (40%), Positives = 565/989 (57%), Gaps = 74/989 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D NYD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  278   FAVWEHEKLDWLQEGKKKDAHRKRQGDPNYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  337

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  338   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  397

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  398   RVEQTETPEMMETRYKSMTHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  456

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  457   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  512

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  513   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  557

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  558   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  614

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  615   LSLANFEEYVPVDIDTAKTTSSSSFFARTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  672

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V    + E  + L +LPD
Sbjct  673   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-DKISEVSEHLKKLPD  731

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +  
Sbjct  732   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDLMEE  791

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    P++   +K++   FD  +A  +G I P  G D +Y
Sbjct  792   IASDFKSKVLKQLVTRKARNPDGRFPELSAELKRWDTAFDHNQARKTGVITPKVGFDPDY  851

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+
Sbjct  852   DKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYELK  911

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             SS+KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  912   SSRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  971

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ 
Sbjct  972   DVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIV  1029

Query  3034  LGGA-----GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G         +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+PVDR+F 
Sbjct  1030  IGSKEEDSNSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPVDRVFT  1089

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++  
Sbjct  1090  RLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKEL  1149

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK T G CP
Sbjct  1150  AEKIKCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFTEGACP  1209

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +SYG N ARLA +P+ V++K   K+REFE
Sbjct  1210  KSYGFNAARLANIPEEVIQKGHRKAREFE  1238



>ref|XP_009469486.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Nipponia 
nippon]
Length=1262

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/991 (40%), Positives = 568/991 (57%), Gaps = 74/991 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  266   FTVWEHEKLDWLQEGKKKDAHRKRQGDPSYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  325

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  326   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  385

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  386   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  444

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  445   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  500

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV------KNMYQRLNNTPIPYS  1668
               LS +T+++L     + +   L+  S+FW+A KT+  +      K      N  P+P  
Sbjct  501   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKEKQNSENGCPLP--  558

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLL  1845
                            A +++L +    L +  GEN   ALSALGG +FYLK+  +D  LL
Sbjct  559   ---------------AVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELL  603

Query  1846  KFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLY  1989
               A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL 
Sbjct  604   SLANFEEYVPVDIDTAKTTSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLL  661

Query  1990  AQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPD  2166
              +++ C T FGKRLL+ WL  PL +  +I +R DAV  L  V  P  + E  + L +LPD
Sbjct  662   ERIDSCCTPFGKRLLKQWLCAPLCNPRSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPD  719

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M     ++  
Sbjct  720   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDAMEE  779

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +Y
Sbjct  780   VASDFKSKILKQLVTRKAKHPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDY  839

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+
Sbjct  840   DKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELK  899

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  900   STRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  959

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP +   P L  K+  HP + T +     F+ ND+ 
Sbjct  960   DVLMSLANYSQDGDGPLCRPVIL-LPVESAPPFLELKNSRHPCI-TKTFFGDDFIPNDIV  1017

Query  3034  LGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F 
Sbjct  1018  IGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFT  1077

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++  
Sbjct  1078  RLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKEL  1137

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP
Sbjct  1138  AEKIRCRTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACP  1197

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             +SYG N ARLA +P+ V++K   K++EFE V
Sbjct  1198  KSYGFNAARLADIPEEVIQKGHRKAKEFEKV  1228



>ref|XP_009469485.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Nipponia 
nippon]
Length=1263

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/991 (40%), Positives = 568/991 (57%), Gaps = 74/991 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  267   FTVWEHEKLDWLQEGKKKDAHRKRQGDPSYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  326

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  327   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  386

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  387   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  445

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  446   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  501

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV------KNMYQRLNNTPIPYS  1668
               LS +T+++L     + +   L+  S+FW+A KT+  +      K      N  P+P  
Sbjct  502   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKEKQNSENGCPLP--  559

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLL  1845
                            A +++L +    L +  GEN   ALSALGG +FYLK+  +D  LL
Sbjct  560   ---------------AVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELL  604

Query  1846  KFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLY  1989
               A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL 
Sbjct  605   SLANFEEYVPVDIDTAKTTSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLL  662

Query  1990  AQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPD  2166
              +++ C T FGKRLL+ WL  PL +  +I +R DAV  L  V  P  + E  + L +LPD
Sbjct  663   ERIDSCCTPFGKRLLKQWLCAPLCNPRSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPD  720

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M     ++  
Sbjct  721   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDAMEE  780

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +Y
Sbjct  781   VASDFKSKILKQLVTRKAKHPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDY  840

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+
Sbjct  841   DKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELK  900

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  901   STRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  960

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP +   P L  K+  HP + T +     F+ ND+ 
Sbjct  961   DVLMSLANYSQDGDGPLCRPVIL-LPVESAPPFLELKNSRHPCI-TKTFFGDDFIPNDIV  1018

Query  3034  LGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F 
Sbjct  1019  IGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFT  1078

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++  
Sbjct  1079  RLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKEL  1138

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP
Sbjct  1139  AEKIRCRTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACP  1198

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             +SYG N ARLA +P+ V++K   K++EFE V
Sbjct  1199  KSYGFNAARLADIPEEVIQKGHRKAKEFEKV  1229



>ref|XP_009893116.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein Msh6 
[Charadrius vociferus]
Length=1265

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/992 (40%), Positives = 569/992 (57%), Gaps = 76/992 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  ++DA R+R  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  269   FAVWEHEKLDWLQEGKKKDAHRKRQSDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  328

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  329   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  388

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  389   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  447

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  448   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  503

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  504   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  548

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  549   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  605

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  606   LSLANFEEYVPVDIDTAKTTSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  663

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  664   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  721

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  722   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  781

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  782   EIASDFKSKVLKQLVTRKAKNPNGRFPDLSGELKRWDTAFDHNQARKTGVITPKAGFDPD  841

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  842   YDKALQDIKSVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYEL  901

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  902   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDQNSKDWQTAVECIAV  961

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  962   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1019

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQVG  VPA    LSP+DR+F
Sbjct  1020  VIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQVGCYVPAEVCRLSPIDRVF  1079

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1080  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1139

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1140  LAEKIKCRTLFSTHYHSLVEDYSHNMAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1199

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             P+SYG N ARLA +P+ V++K   K++EFE +
Sbjct  1200  PKSYGFNAARLANIPEEVIQKGHRKAKEFEKI  1231



>ref|XP_005895692.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X4 [Bos mutus]
Length=1059

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/960 (40%), Positives = 553/960 (58%), Gaps = 68/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYE++ MDA IG  EL L
Sbjct  88    DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYEMYHMDALIGVSELGL  147

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  148   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVV  207

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  208   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEESSGH--TRVYGVCFVDTSLG  264

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             +  +GQF+DD  CS   +L+  + PV+++     LS +T+ +L     + L   L+P S+
Sbjct  265   RFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSMDTKMILKSSLSSSLQEGLIPGSQ  324

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + + ++ ++ D  +  LP VL  +      
Sbjct  325   FWDAAKTLRTLLE-----------------EGYFTDKLNEDGGVM-LPQVLKGMTSESDS  366

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  367   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYVPLDSDMVHATRPGAVFAK  426

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL +  AI
Sbjct  427   ANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPHAI  486

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  487   NDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  545

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + +      +   +D+  SK+L  +LT     P    PD+  
Sbjct  546   TTYSKKKIIDFLSALEGFKVICKIIGIMEEVIDDFKSKILKQVLTLQTKSPEGRFPDLTS  605

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  606   ELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTI  665

Query  2587  NYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K +G L  AE  R++
Sbjct  666   VYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLGNLINAEERRDA  725

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D 
Sbjct  726   SLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLTNYSRGGDGPMCRPIIL-LPEEDT  784

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTLL  3105
              P L  K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKSTL+
Sbjct  785   PPFLDLKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEEENGKAYCVLVTGPNMGGKSTLM  843

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  I+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  844   RQAGLLAIMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  903

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  904   TAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRL  963

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  964   GHMACMVENECEDPSQETITFLYKFINGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1023



>ref|XP_008944973.1| PREDICTED: DNA mismatch repair protein Msh6, partial [Merops 
nubicus]
Length=1235

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/962 (40%), Positives = 551/962 (57%), Gaps = 75/962 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +YD RTLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  294   DYDPRTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGL  353

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     D+VV
Sbjct  354   IFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARVEQTETPEMMEARCKSMTHPTKFDRVV  413

Query  1240  KREICAVITKGTLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +RE+C +ITKGT T   ++   P  +   YL+ V E   +S    G+R YGVC VD +  
Sbjct  414   RRELCRIITKGTQTYS-IMDCDPSENHHKYLLCVKEKEDSS----GQRVYGVCFVDTSVG  468

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+++L           LV  S+
Sbjct  469   KFYVGQFSDDRHCSRFRTLVAHYTPVQVLFEKGNLSVETQKILKGSLVACFQEGLVAGSQ  528

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FW+A KT+  +                 E      ++ +N     +LP+V+  L      
Sbjct  529   FWNASKTLKVL---------------LEEGYFKEKQNSENGC---SLPSVIKSLTSESDS  570

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGM  1890
               +  GEN   ALSALGG +FYL++  +D  LL  A FE  +P            S F  
Sbjct  571   LGLTPGENSELALSALGGCVFYLQKCLIDQELLSLANFEEYVPVDVDTAKTMSSGSSFAK  630

Query  1891  IAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLE  2070
               Q+  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + +
Sbjct  631   TGQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPQ  688

Query  2071  AIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVL  2238
             +I +R DA+  L  V +P  + E  + L +LPD+ERLL++I +     ++     ++ + 
Sbjct  689   SINDRLDAIEDL--VAVPDKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIF  746

Query  2239  YEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPD  2397
             YE+   +KK++  F+SAL G + M      +     +  SK+L  L+T     P    PD
Sbjct  747   YEEVKYSKKKIADFLSALEGFKVMNEIVDVMEEIASDFKSKVLKQLVTRKANNPDGRFPD  806

Query  2398  VKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGD  2577
             +   +K++   FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+K+ G 
Sbjct  807   LSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLQKYLDKQRKVLGT  866

Query  2578  TSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
              S+ Y   GK+ Y +EVPES +   +P+EYEL+SS+KGY RYW   I K++  +  AE  
Sbjct  867   KSLLYWGAGKNRYQMEVPESAVSRNLPEEYELRSSRKGYKRYWTKEIEKMLAAMVNAEER  926

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             R++ LK  ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP 
Sbjct  927   RDASLKDCMRRLFHNFDKNSRDWQAAVECIAVLDVLMSLANYSQDGDGPLCRPEII-LPV  985

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-----GAGHSSFILLTGPNMGGKST  3099
             + + P L  K+  HP + T +     F+ ND+ +G      +  +S +L+TGPNMGGKST
Sbjct  986   ESSPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGCKDENNSSEASCVLVTGPNMGGKST  1044

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             L+RQ  L  ILAQ+G  VPA    L+PVDR+F R+GA D IMAG+STF  EL ET+S+L 
Sbjct  1045  LMRQAGLLAILAQLGCYVPAEVCRLTPVDRVFTRLGASDRIMAGESTFFVELSETSSILQ  1104

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT++SLV +DELGRGT+T DG AIA +V+E    +++CR +FSTHYH L  D+     V
Sbjct  1105  HATKHSLVLVDELGRGTATFDGTAIASAVVEELAERIRCRTLFSTHYHSLVEDHAHRGAV  1164

Query  3460  SLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              L HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K++E
Sbjct  1165  RLGHMACMVENESEDPSQETITFLYKFIEGACPKSYGFNAARLANIPEEVIQKGHRKAKE  1224

Query  3634  FE  3639
             FE
Sbjct  1225  FE  1226



>ref|XP_009984584.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Tauraco 
erythrolophus]
Length=1262

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/992 (40%), Positives = 569/992 (57%), Gaps = 76/992 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  ++DA RRR  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  266   FTVWEHEKLDWLQEGKKKDAHRRRQRDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  325

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  326   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  385

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  S     D+VV+REIC +ITKGT T   ++   P  +   YL+
Sbjct  386   RVEQTETPEMMETRCKSMSHPTKFDRVVRREICRIITKGTQTYS-IMDCDPSENHNKYLL  444

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
             +V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  445   SVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  500

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  501   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  545

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                E+ +N      LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  546   KEKENSENGC---CLPSVVKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  602

Query  1843  LKFAEFE-LLPFS-----------HFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P              FG   Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  603   LSLANFEEYVPVDIDTAKTTSSSRFFGKTDQR--MVLDGVTLMNLEVLQNGTNGSTEGTL  660

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ W+  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  661   LERIDSCCTPFGKRLLKQWVCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  718

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ V YE+   +KK++  F+SAL G + M      + 
Sbjct  719   DLERLLSKIHSIGSPLKSQNHPDSRAVFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  778

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  779   EVASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  838

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL
Sbjct  839   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYEL  898

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  899   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  958

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  959   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1016

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1017  MIGSKDDNSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1076

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1077  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1136

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K+QCR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1137  LAEKIQCRTLFSTHYHSLVEDYSHNMAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1196

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             P+SYG N ARLA +P+ V++K   K++EFE +
Sbjct  1197  PKSYGFNAARLANIPEEVIQKGHRKAQEFEKI  1228



>ref|XP_009984583.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Tauraco 
erythrolophus]
Length=1263

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/992 (40%), Positives = 569/992 (57%), Gaps = 76/992 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  ++DA RRR  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  267   FTVWEHEKLDWLQEGKKKDAHRRRQRDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  326

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  327   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  386

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  S     D+VV+REIC +ITKGT T   ++   P  +   YL+
Sbjct  387   RVEQTETPEMMETRCKSMSHPTKFDRVVRREICRIITKGTQTYS-IMDCDPSENHNKYLL  445

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
             +V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  446   SVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  501

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  502   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  546

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                E+ +N      LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  547   KEKENSENGC---CLPSVVKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  603

Query  1843  LKFAEFE-LLPFS-----------HFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P              FG   Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  604   LSLANFEEYVPVDIDTAKTTSSSRFFGKTDQR--MVLDGVTLMNLEVLQNGTNGSTEGTL  661

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ W+  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  662   LERIDSCCTPFGKRLLKQWVCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  719

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ V YE+   +KK++  F+SAL G + M      + 
Sbjct  720   DLERLLSKIHSIGSPLKSQNHPDSRAVFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  779

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  780   EVASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  839

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL
Sbjct  840   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYEL  899

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  900   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  959

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  960   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1017

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1018  MIGSKDDNSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1077

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1078  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1137

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K+QCR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1138  LAEKIQCRTLFSTHYHSLVEDYSHNMAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1197

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             P+SYG N ARLA +P+ V++K   K++EFE +
Sbjct  1198  PKSYGFNAARLANIPEEVIQKGHRKAQEFEKI  1229



>ref|XP_010132772.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Buceros 
rhinoceros silvestris]
Length=1269

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/998 (39%), Positives = 567/998 (57%), Gaps = 80/998 (8%)
 Frame = +1

Query  793   GNSAERFSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
             G     F+  E EKL +L +G++    R+   D +YD RTLY+P D+L   + G R+WW+
Sbjct  267   GGGTSGFAAWEHEKLDWLQEGKKKDAHRKRQGDPDYDPRTLYVPEDYLNKCTPGMRRWWQ  326

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +
Sbjct  327   LKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGSWAHSGFPETAFGRFSDVLVQ  386

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS  1317
             KGY+V  VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +
Sbjct  387   KGYKVARVEQTETPEMMETRCKSMAHPTRFDKVVRREICRIITKGTQTYS-ILDCDPSEN  445

Query  1318  ---YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
                YL+ V E      +  G+R YGVC VD +  K  +GQF+DD   S   +L+  + PV
Sbjct  446   HNKYLLCVKEK----EDSAGQRVYGVCFVDTSVGKFYVGQFSDDRHRSRFRTLVAHYTPV  501

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIP  1662
             +++     LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N    
Sbjct  502   QVLYEKGNLSVDTQKILKGSLVSCIQEGLIAGSQFWNASKTLKVLLEEEYFKEKQN----  557

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLK  1818
              S+N                  LP+V+  L        +  GENG  ALSALGG +FYLK
Sbjct  558   -SENGC---------------FLPSVIKSLTSESDSLGLTPGENGELALSALGGCVFYLK  601

Query  1819  QAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSK  1962
             +  +D  LL  A FE  +P            S F    Q+  MVLD   L NLE+ +N  
Sbjct  602   KCLIDQELLSLANFEEYVPVDTDTAKTMSSSSFFARTDQR--MVLDGVTLMNLEVLQNGT  659

Query  1963  NCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EF  2139
             N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E 
Sbjct  660   NGTTEGTLLERIDSCCTPFGKRLLKRWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEV  717

Query  2140  RKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETM  2304
              + L +LPD+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M
Sbjct  718   SEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVM  777

Query  2305  VNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRII  2469
                   +     +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I 
Sbjct  778   NEIVDVMEEIAGDFKSKVLKQLVTRKAKNPEGRFPDLSAELKRWDTAFDHNQARKTGVIT  837

Query  2470  PCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCE  2646
             P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ + +E+PES +  
Sbjct  838   PKAGFDPDYDKALEDIKAVEEDLHKYLDKQRKLLGLKSVLYWGAGKNRFQMEIPESAVSR  897

Query  2647  LVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWR  2826
              +P+EYEL+S++KGY RYW   I K++  L  AE  R++ LK  ++RL   F ++   W+
Sbjct  898   NLPEEYELKSTRKGYKRYWTKEIEKMLAALVNAEDRRDAALKDCMRRLFYNFDQNGEDWQ  957

Query  2827  ELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDK  3006
               +  IA LDVL+SL+  S   +GP CRP I  LP     P L  ++  HP + T +   
Sbjct  958   TAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPEDSAPPFLELRNSRHPCI-TKTFFG  1015

Query  3007  GAFVSNDVTLG-----GAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFD  3171
               F+ ND+ +G     G   +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    
Sbjct  1016  DDFIPNDIVIGSKDEDGGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAQVCR  1075

Query  3172  LSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQA  3351
             L+P DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG A
Sbjct  1076  LTPTDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLMDELGRGTATFDGTA  1135

Query  3352  IAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFL  3525
             IA +V++    K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFL
Sbjct  1136  IASAVVKELAEKIRCRTLFSTHYHSLVEDYSHNPAVRLGHMACMVENESEDPSQETITFL  1195

Query  3526  YKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             YK T G CP+SYG N ARLA +P+ V++K   K+++FE
Sbjct  1196  YKFTEGACPKSYGFNAARLANIPEEVIQKGHRKAKQFE  1233



>ref|XP_009270965.1| PREDICTED: DNA mismatch repair protein Msh6 [Aptenodytes forsteri]
Length=1150

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/983 (40%), Positives = 565/983 (57%), Gaps = 62/983 (6%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  154   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  213

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  214   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  273

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  274   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  332

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  333   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  388

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +      L        QN    
Sbjct  389   GNLSVDTQKILKGSLVSCIQEGLIAGSQFWNASKTLKVL------LEEGYFKEKQN----  438

Query  1687  HPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEF-  1860
              P       + +++L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A F 
Sbjct  439   -PENGCSLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLANFA  497

Query  1861  ELLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHC  2007
             E +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++ C
Sbjct  498   EYVPVDIDTAKTRSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSC  555

Query  2008  VTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLA  2184
              T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERLL+
Sbjct  556   CTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERLLS  613

Query  2185  QIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTD  2349
             +I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     +  
Sbjct  614   KIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVIEEIASDFK  673

Query  2350  SKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGS  2514
             SK+L  L+T     PG   PD+   ++++   FD  +A  +G I P  G D +YD A   
Sbjct  674   SKVLKQLVTRKAKNPGGRFPDLSAELQRWDTAFDHNQARKTGVITPKAGFDPDYDKALQD  733

Query  2515  LRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGY  2691
             ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+S++KGY
Sbjct  734   IKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELKSTRKGY  793

Query  2692  FRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISL  2871
              RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+S 
Sbjct  794   KRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSF  853

Query  2872  SIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG---  3042
             +  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G    
Sbjct  854   ANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSKDE  911

Query  3043  --AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKD  3216
               +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA D
Sbjct  912   DSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGASD  971

Query  3217  HIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQC  3396
              IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K++C
Sbjct  972   RIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKIKC  1031

Query  3397  RGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVN  3570
             R +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG N
Sbjct  1032  RTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYGFN  1091

Query  3571  VARLAGLPDNVLEKAAAKSREFE  3639
              ARLA +P+ V++K   K++EFE
Sbjct  1092  AARLANIPEEVIQKGHRKAQEFE  1114



>gb|KFV18064.1| DNA mismatch repair protein Msh6, partial [Tauraco erythrolophus]
Length=1276

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/992 (40%), Positives = 569/992 (57%), Gaps = 76/992 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  ++DA RRR  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  280   FTVWEHEKLDWLQEGKKKDAHRRRQRDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  339

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  340   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  399

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  S     D+VV+REIC +ITKGT T   ++   P  +   YL+
Sbjct  400   RVEQTETPEMMETRCKSMSHPTKFDRVVRREICRIITKGTQTYS-IMDCDPSENHNKYLL  458

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
             +V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  459   SVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  514

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  515   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  559

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                E+ +N      LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  560   KEKENSENGC---CLPSVVKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  616

Query  1843  LKFAEFE-LLPFS-----------HFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P              FG   Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  617   LSLANFEEYVPVDIDTAKTTSSSRFFGKTDQR--MVLDGVTLMNLEVLQNGTNGSTEGTL  674

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ W+  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  675   LERIDSCCTPFGKRLLKQWVCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  732

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ V YE+   +KK++  F+SAL G + M      + 
Sbjct  733   DLERLLSKIHSIGSPLKSQNHPDSRAVFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  792

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  793   EVASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  852

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL
Sbjct  853   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYEL  912

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  913   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  972

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  973   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1030

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1031  MIGSKDDNSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1090

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1091  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1150

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K+QCR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1151  LAEKIQCRTLFSTHYHSLVEDYSHNMAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1210

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             P+SYG N ARLA +P+ V++K   K++EFE +
Sbjct  1211  PKSYGFNAARLANIPEEVIQKGHRKAQEFEKI  1242



>gb|KFQ20814.1| DNA mismatch repair protein Msh6, partial [Merops nubicus]
Length=1250

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/962 (40%), Positives = 551/962 (57%), Gaps = 75/962 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +YD RTLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  308   DYDPRTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGL  367

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     D+VV
Sbjct  368   IFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARVEQTETPEMMEARCKSMTHPTKFDRVV  427

Query  1240  KREICAVITKGTLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +RE+C +ITKGT T   ++   P  +   YL+ V E   +S    G+R YGVC VD +  
Sbjct  428   RRELCRIITKGTQTYS-IMDCDPSENHHKYLLCVKEKEDSS----GQRVYGVCFVDTSVG  482

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+++L           LV  S+
Sbjct  483   KFYVGQFSDDRHCSRFRTLVAHYTPVQVLFEKGNLSVETQKILKGSLVACFQEGLVAGSQ  542

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FW+A KT+  +                 E      ++ +N     +LP+V+  L      
Sbjct  543   FWNASKTLKVL---------------LEEGYFKEKQNSENGC---SLPSVIKSLTSESDS  584

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGM  1890
               +  GEN   ALSALGG +FYL++  +D  LL  A FE  +P            S F  
Sbjct  585   LGLTPGENSELALSALGGCVFYLQKCLIDQELLSLANFEEYVPVDVDTAKTMSSGSSFAK  644

Query  1891  IAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLE  2070
               Q+  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + +
Sbjct  645   TGQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPQ  702

Query  2071  AIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVL  2238
             +I +R DA+  L  V +P  + E  + L +LPD+ERLL++I +     ++     ++ + 
Sbjct  703   SINDRLDAIEDL--VAVPDKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIF  760

Query  2239  YEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPD  2397
             YE+   +KK++  F+SAL G + M      +     +  SK+L  L+T     P    PD
Sbjct  761   YEEVKYSKKKIADFLSALEGFKVMNEIVDVMEEIASDFKSKVLKQLVTRKANNPDGRFPD  820

Query  2398  VKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGD  2577
             +   +K++   FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+K+ G 
Sbjct  821   LSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLQKYLDKQRKVLGT  880

Query  2578  TSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
              S+ Y   GK+ Y +EVPES +   +P+EYEL+SS+KGY RYW   I K++  +  AE  
Sbjct  881   KSLLYWGAGKNRYQMEVPESAVSRNLPEEYELRSSRKGYKRYWTKEIEKMLAAMVNAEER  940

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             R++ LK  ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP 
Sbjct  941   RDASLKDCMRRLFHNFDKNSRDWQAAVECIAVLDVLMSLANYSQDGDGPLCRPEII-LPV  999

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-----GAGHSSFILLTGPNMGGKST  3099
             + + P L  K+  HP + T +     F+ ND+ +G      +  +S +L+TGPNMGGKST
Sbjct  1000  ESSPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGCKDENNSSEASCVLVTGPNMGGKST  1058

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             L+RQ  L  ILAQ+G  VPA    L+PVDR+F R+GA D IMAG+STF  EL ET+S+L 
Sbjct  1059  LMRQAGLLAILAQLGCYVPAEVCRLTPVDRVFTRLGASDRIMAGESTFFVELSETSSILQ  1118

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT++SLV +DELGRGT+T DG AIA +V+E    +++CR +FSTHYH L  D+     V
Sbjct  1119  HATKHSLVLVDELGRGTATFDGTAIASAVVEELAERIRCRTLFSTHYHSLVEDHAHRGAV  1178

Query  3460  SLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              L HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K++E
Sbjct  1179  RLGHMACMVENESEDPSQETITFLYKFIEGACPKSYGFNAARLANIPEEVIQKGHRKAKE  1238

Query  3634  FE  3639
             FE
Sbjct  1239  FE  1240



>gb|KFO88702.1| DNA mismatch repair protein Msh6, partial [Buceros rhinoceros 
silvestris]
Length=1283

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/998 (39%), Positives = 567/998 (57%), Gaps = 80/998 (8%)
 Frame = +1

Query  793   GNSAERFSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
             G     F+  E EKL +L +G++    R+   D +YD RTLY+P D+L   + G R+WW+
Sbjct  281   GGGTSGFAAWEHEKLDWLQEGKKKDAHRKRQGDPDYDPRTLYVPEDYLNKCTPGMRRWWQ  340

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +
Sbjct  341   LKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGSWAHSGFPETAFGRFSDVLVQ  400

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS  1317
             KGY+V  VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +
Sbjct  401   KGYKVARVEQTETPEMMETRCKSMAHPTRFDKVVRREICRIITKGTQTYS-ILDCDPSEN  459

Query  1318  ---YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
                YL+ V E      +  G+R YGVC VD +  K  +GQF+DD   S   +L+  + PV
Sbjct  460   HNKYLLCVKEK----EDSAGQRVYGVCFVDTSVGKFYVGQFSDDRHRSRFRTLVAHYTPV  515

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIP  1662
             +++     LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N    
Sbjct  516   QVLYEKGNLSVDTQKILKGSLVSCIQEGLIAGSQFWNASKTLKVLLEEEYFKEKQN----  571

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLK  1818
              S+N                  LP+V+  L        +  GENG  ALSALGG +FYLK
Sbjct  572   -SENGC---------------FLPSVIKSLTSESDSLGLTPGENGELALSALGGCVFYLK  615

Query  1819  QAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSK  1962
             +  +D  LL  A FE  +P            S F    Q+  MVLD   L NLE+ +N  
Sbjct  616   KCLIDQELLSLANFEEYVPVDTDTAKTMSSSSFFARTDQR--MVLDGVTLMNLEVLQNGT  673

Query  1963  NCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EF  2139
             N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E 
Sbjct  674   NGTTEGTLLERIDSCCTPFGKRLLKRWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEV  731

Query  2140  RKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETM  2304
              + L +LPD+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M
Sbjct  732   SEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVM  791

Query  2305  VNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRII  2469
                   +     +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I 
Sbjct  792   NEIVDVMEEIAGDFKSKVLKQLVTRKAKNPEGRFPDLSAELKRWDTAFDHNQARKTGVIT  851

Query  2470  PCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCE  2646
             P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ + +E+PES +  
Sbjct  852   PKAGFDPDYDKALEDIKAVEEDLHKYLDKQRKLLGLKSVLYWGAGKNRFQMEIPESAVSR  911

Query  2647  LVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWR  2826
              +P+EYEL+S++KGY RYW   I K++  L  AE  R++ LK  ++RL   F ++   W+
Sbjct  912   NLPEEYELKSTRKGYKRYWTKEIEKMLAALVNAEDRRDAALKDCMRRLFYNFDQNGEDWQ  971

Query  2827  ELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDK  3006
               +  IA LDVL+SL+  S   +GP CRP I  LP     P L  ++  HP + T +   
Sbjct  972   TAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPEDSAPPFLELRNSRHPCI-TKTFFG  1029

Query  3007  GAFVSNDVTLG-----GAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFD  3171
               F+ ND+ +G     G   +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    
Sbjct  1030  DDFIPNDIVIGSKDEDGGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAQVCR  1089

Query  3172  LSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQA  3351
             L+P DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG A
Sbjct  1090  LTPTDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLMDELGRGTATFDGTA  1149

Query  3352  IAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFL  3525
             IA +V++    K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFL
Sbjct  1150  IASAVVKELAEKIRCRTLFSTHYHSLVEDYSHNPAVRLGHMACMVENESEDPSQETITFL  1209

Query  3526  YKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             YK T G CP+SYG N ARLA +P+ V++K   K+++FE
Sbjct  1210  YKFTEGACPKSYGFNAARLANIPEEVIQKGHRKAKQFE  1247



>gb|KFM03114.1| DNA mismatch repair protein Msh6, partial [Aptenodytes forsteri]
Length=1152

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/983 (40%), Positives = 565/983 (57%), Gaps = 62/983 (6%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  156   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  215

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  216   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  275

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  276   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  334

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  335   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  390

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +      L        QN    
Sbjct  391   GNLSVDTQKILKGSLVSCIQEGLIAGSQFWNASKTLKVL------LEEGYFKEKQN----  440

Query  1687  HPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEF-  1860
              P       + +++L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A F 
Sbjct  441   -PENGCSLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLANFA  499

Query  1861  ELLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHC  2007
             E +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++ C
Sbjct  500   EYVPVDIDTAKTRSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSC  557

Query  2008  VTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLA  2184
              T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERLL+
Sbjct  558   CTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERLLS  615

Query  2185  QIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTD  2349
             +I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     +  
Sbjct  616   KIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVIEEIASDFK  675

Query  2350  SKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGS  2514
             SK+L  L+T     PG   PD+   ++++   FD  +A  +G I P  G D +YD A   
Sbjct  676   SKVLKQLVTRKAKNPGGRFPDLSAELQRWDTAFDHNQARKTGVITPKAGFDPDYDKALQD  735

Query  2515  LRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGY  2691
             ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+S++KGY
Sbjct  736   IKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELKSTRKGY  795

Query  2692  FRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISL  2871
              RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+S 
Sbjct  796   KRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSF  855

Query  2872  SIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG---  3042
             +  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G    
Sbjct  856   ANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSKDE  913

Query  3043  --AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKD  3216
               +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA D
Sbjct  914   DSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGASD  973

Query  3217  HIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQC  3396
              IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K++C
Sbjct  974   RIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKIKC  1033

Query  3397  RGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVN  3570
             R +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG N
Sbjct  1034  RTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYGFN  1093

Query  3571  VARLAGLPDNVLEKAAAKSREFE  3639
              ARLA +P+ V++K   K++EFE
Sbjct  1094  AARLANIPEEVIQKGHRKAQEFE  1116



>ref|XP_010132771.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Buceros 
rhinoceros silvestris]
Length=1270

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/998 (39%), Positives = 567/998 (57%), Gaps = 80/998 (8%)
 Frame = +1

Query  793   GNSAERFSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
             G     F+  E EKL +L +G++    R+   D +YD RTLY+P D+L   + G R+WW+
Sbjct  268   GGGTSGFAAWEHEKLDWLQEGKKKDAHRKRQGDPDYDPRTLYVPEDYLNKCTPGMRRWWQ  327

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +
Sbjct  328   LKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGSWAHSGFPETAFGRFSDVLVQ  387

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS  1317
             KGY+V  VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +
Sbjct  388   KGYKVARVEQTETPEMMETRCKSMAHPTRFDKVVRREICRIITKGTQTYS-ILDCDPSEN  446

Query  1318  ---YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
                YL+ V E      +  G+R YGVC VD +  K  +GQF+DD   S   +L+  + PV
Sbjct  447   HNKYLLCVKEK----EDSAGQRVYGVCFVDTSVGKFYVGQFSDDRHRSRFRTLVAHYTPV  502

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIP  1662
             +++     LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N    
Sbjct  503   QVLYEKGNLSVDTQKILKGSLVSCIQEGLIAGSQFWNASKTLKVLLEEEYFKEKQN----  558

Query  1663  YSQNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLK  1818
              S+N                  LP+V+  L        +  GENG  ALSALGG +FYLK
Sbjct  559   -SENGC---------------FLPSVIKSLTSESDSLGLTPGENGELALSALGGCVFYLK  602

Query  1819  QAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSK  1962
             +  +D  LL  A FE  +P            S F    Q+  MVLD   L NLE+ +N  
Sbjct  603   KCLIDQELLSLANFEEYVPVDTDTAKTMSSSSFFARTDQR--MVLDGVTLMNLEVLQNGT  660

Query  1963  NCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EF  2139
             N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E 
Sbjct  661   NGTTEGTLLERIDSCCTPFGKRLLKRWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEV  718

Query  2140  RKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETM  2304
              + L +LPD+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M
Sbjct  719   SEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVM  778

Query  2305  VNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRII  2469
                   +     +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I 
Sbjct  779   NEIVDVMEEIAGDFKSKVLKQLVTRKAKNPEGRFPDLSAELKRWDTAFDHNQARKTGVIT  838

Query  2470  PCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCE  2646
             P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ + +E+PES +  
Sbjct  839   PKAGFDPDYDKALEDIKAVEEDLHKYLDKQRKLLGLKSVLYWGAGKNRFQMEIPESAVSR  898

Query  2647  LVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWR  2826
              +P+EYEL+S++KGY RYW   I K++  L  AE  R++ LK  ++RL   F ++   W+
Sbjct  899   NLPEEYELKSTRKGYKRYWTKEIEKMLAALVNAEDRRDAALKDCMRRLFYNFDQNGEDWQ  958

Query  2827  ELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDK  3006
               +  IA LDVL+SL+  S   +GP CRP I  LP     P L  ++  HP + T +   
Sbjct  959   TAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPEDSAPPFLELRNSRHPCI-TKTFFG  1016

Query  3007  GAFVSNDVTLG-----GAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFD  3171
               F+ ND+ +G     G   +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    
Sbjct  1017  DDFIPNDIVIGSKDEDGGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAQVCR  1076

Query  3172  LSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQA  3351
             L+P DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG A
Sbjct  1077  LTPTDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLMDELGRGTATFDGTA  1136

Query  3352  IAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFL  3525
             IA +V++    K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFL
Sbjct  1137  IASAVVKELAEKIRCRTLFSTHYHSLVEDYSHNPAVRLGHMACMVENESEDPSQETITFL  1196

Query  3526  YKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             YK T G CP+SYG N ARLA +P+ V++K   K+++FE
Sbjct  1197  YKFTEGACPKSYGFNAARLANIPEEVIQKGHRKAKQFE  1234



>ref|XP_005229333.1| PREDICTED: DNA mismatch repair protein Msh6 [Falco peregrinus]
Length=1262

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/962 (40%), Positives = 553/962 (57%), Gaps = 75/962 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  294   DYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGL  353

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E+R K  +     DKVV
Sbjct  354   IFMKGTWAHSGFPETVFGRFSDVLVQKGYKVARVEQTETPEMMEMRYKSMAHPTKFDKVV  413

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+ V E  ++S    G+R YGVC VD +  
Sbjct  414   RREICRIITKGTQTYS-VLDCDPSENHSKYLLCVKEKEESS----GQRVYGVCFVDTSVG  468

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+
Sbjct  469   KFYIGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQ  528

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FW+A KT+  +                 E      ++ +N     +LP+V+  L      
Sbjct  529   FWNASKTLKVL---------------LEEGYFKEKQNSENGC---SLPSVIKSLTSESDS  570

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGM  1890
               +  GEN   ALSALGG +FYLK+  +D  LL  A FE  +P            S F  
Sbjct  571   LGLTPGENSELALSALGGCVFYLKKCLIDQELLSLANFEEYIPVDIDTAKTTSSSSFFAK  630

Query  1891  IAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLE  2070
               Q+  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + +
Sbjct  631   TDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDTCCTPFGKRLLKQWLCAPLCNPK  688

Query  2071  AIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVL  2238
             +I +R DAV  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + 
Sbjct  689   SINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIF  746

Query  2239  YEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPD  2397
             YE+   +KK++  F+SAL G + M      +     N  S++L  L+T     PG   PD
Sbjct  747   YEEIKYSKKKIADFLSALEGFKVMNEIVDVMEDVASNFKSRVLKQLVTRKAKNPGGRFPD  806

Query  2398  VKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGD  2577
             +   ++++   FD  +A  +G I P  G D +YD A   ++ VE  L  +L +Q+KL G 
Sbjct  807   LSAELRRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHNYLDKQRKLLGF  866

Query  2578  TSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
              S+ Y   GK+ Y +E+PES+    +P+EYEL+S++KGY RYW   I K++  +  AE  
Sbjct  867   KSMLYWGAGKNRYQMEIPESVVSRNLPEEYELKSTRKGYKRYWTKEIEKMLAAMVNAEER  926

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             R++ LK  ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP 
Sbjct  927   RDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPV  985

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-----GAGHSSFILLTGPNMGGKST  3099
                 P L  K+  HP + T +     F+ ND+ +G     G+  +S +L+TGPNMGGKST
Sbjct  986   DSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSRDEDGSSAASCVLVTGPNMGGKST  1044

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             L+RQ  L V++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L 
Sbjct  1045  LMRQAGLLVVMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQ  1104

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT +SLV +DELGRGT+T DG AIA +V++  V +++CR +FSTHYH L  DY     V
Sbjct  1105  HATEHSLVLVDELGRGTATFDGTAIASAVVKELVERIKCRTLFSTHYHSLVEDYSHSVAV  1164

Query  3460  SLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              L HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ +++K   K++E
Sbjct  1165  QLGHMACMVENESEDPSQETITFLYKFIEGACPKSYGFNAARLADIPEEIIQKGHRKAKE  1224

Query  3634  FE  3639
             FE
Sbjct  1225  FE  1226



>ref|XP_008529698.1| PREDICTED: DNA mismatch repair protein Msh6 [Equus przewalskii]
Length=1261

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/960 (40%), Positives = 551/960 (57%), Gaps = 68/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  290   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVSELGL  349

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K       D+VV
Sbjct  350   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKHDRVV  409

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC VITKGT T   +L   P    + YL+++ E    S+     R YGVC VD +  
Sbjct  410   RREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKDDDSSGH--SRVYGVCFVDASLG  466

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  467   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSMETKMILKGSLSSSLQEGLIPGSQ  526

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + + +E ++ D+ +  LP VL ++      
Sbjct  527   FWDAAKTLRTLLE-----------------EGYFTEKLNEDSGVM-LPQVLKDMTSESDS  568

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  569   VGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDMVSATRPGAVFTK  628

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  629   ANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCSPYAI  688

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  689   NDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  747

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + +      +   +D+  SK+L  ++T     P    PD+ +
Sbjct  748   TTYSKKKIIDFLSALEGFKVICKIIGIMEEVVDDFKSKILKQVITLQTKNPEGRFPDLTI  807

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  808   ELNRWDTAFDHEKARRTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTI  867

Query  2587  NYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  868   VYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDV  927

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D 
Sbjct  928   SLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLANYSRGGDGPMCRPLIL-LPEEDT  986

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTLL  3105
              P L  K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKSTL+
Sbjct  987   PPFLYLKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEEENGKAYCVLVTGPNMGGKSTLM  1045

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  1046  RQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  1105

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  1106  TAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRL  1165

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K+REFE
Sbjct  1166  GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANIPEEVIQKGHRKAREFE  1225



>ref|XP_009560846.1| PREDICTED: DNA mismatch repair protein Msh6 [Cuculus canorus]
Length=1264

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/1107 (38%), Positives = 605/1107 (55%), Gaps = 102/1107 (9%)
 Frame = +1

Query  568   RRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTN  747
             RR +S  +K++ L   + +E  K    KA  + S   +K T   AP +       ES  N
Sbjct  211   RRERSKPAKRSSLENER-SEAPK----KAATLSSEAKSKLTSFAAPDS------FESQAN  259

Query  748   NLECVKASNGDDILTGNSAERFSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPS  924
                C   SNG           F   E EKL +L +  ++DA +RR  D  YD  TLY+P 
Sbjct  260   --ACSGGSNG-----------FGTWEHEKLDWLQEGKKKDAQKRRQNDPAYDPCTLYVPE  306

Query  925   DFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCG  1104
             D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H G
Sbjct  307   DYLNKCTPGMRRWWQLKSQNFDAVVFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSG  366

Query  1105  FPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKG  1272
             FPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     D+VV+REIC +ITKG
Sbjct  367   FPETAFGRFSDVLVQKGYKVARVEQTETPEMMETRCKSMAHPTKFDRVVRREICRIITKG  426

Query  1273  TLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAdds  1443
             T T   +L   P  S   YL+ V E      +  G+  YGVC VD +  K  +GQF+DD 
Sbjct  427   TQTYS-ILDCDPSESHNKYLLCVKEK----EDSAGQCVYGVCFVDTSVGKFYVGQFSDDR  481

Query  1444  dcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV  1623
              CS   +L+  + PV+++     LS  T+++L     + +   L+  S+FW+A KT+   
Sbjct  482   HCSRFRTLVAHYTPVQVLYEKGNLSVSTQKILKGSLVSCIQEGLISGSQFWNASKTL---  538

Query  1624  KNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGG  1800
             K + +         S+NE  L P         ++ L +    L +  G+NG  ALSALGG
Sbjct  539   KVLLEEGYFKEKQDSENECSLPPV--------IKALTSESDSLGLTPGDNGELALSALGG  590

Query  1801  TLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLE  1944
              +FYLK+  +D  LL  A FE  +P            S F    Q+  MVLD   L NLE
Sbjct  591   CVFYLKKCLIDQELLSLANFEAYIPVDIDTAKIVCSNSSFARTDQR--MVLDGVTLMNLE  648

Query  1945  IFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLP  2124
             + +N  N  + GTL  ++++C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P
Sbjct  649   VLQNGTNGTTEGTLLERIDYCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--P  706

Query  2125  G-VLEFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISAL  2286
             G + E  + L +LPD+ERLL++I +     ++     ++ + YE+   +KK++  F+S L
Sbjct  707   GKISEVSEHLKKLPDLERLLSKIHSIGSPLKSQTHPDSRAIFYEEIKYSKKKIADFLSTL  766

Query  2287  RGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEAN  2451
              G + M     ++     +  SK+L  L+T     P    PD+   +K++   FD  +A 
Sbjct  767   EGFKVMNEIIDAMEEVASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQAR  826

Query  2452  SSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVP  2631
              +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+P
Sbjct  827   KTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGTGKNRYQMEIP  886

Query  2632  ESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCE  2808
             ES+    +P+EYEL+S+KKGY RYW   I K++  +  AE  R++ LK  ++RL   F +
Sbjct  887   ESVVSRNLPEEYELKSTKKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDK  946

Query  2809  HHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILR  2988
             +   W+  +  +A LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + 
Sbjct  947   NSKDWQAAVDCVAMLDVLMSLANYSQDSDGPLCRPVIL-LPVDGAPPFLELKNSRHPCI-  1004

Query  2989  TDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADV  3153
             T +     F+ ND+ +G        ++S +L+TGPNMGGKSTL+RQ  L  I+AQ+G  V
Sbjct  1005  TKTFFGDDFIPNDIMIGSKDEESGSNASCVLVTGPNMGGKSTLMRQAGLLAIMAQLGCYV  1064

Query  3154  PAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTS  3333
             PA +  L+P+DR+F R+GA D IM+G+STF  EL ETAS+L  AT +SLV +DELGRGT+
Sbjct  1065  PAEACRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILQHATEHSLVLVDELGRGTA  1124

Query  3334  TSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGL  3507
             T DG AIA +V++    +++CR +FSTHYH L  DY     V L HMAC +         
Sbjct  1125  TFDGTAIASAVVKELAERIRCRTLFSTHYHSLVEDYSRSAAVRLGHMACMVENESEDPSQ  1184

Query  3508  EEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYgnnkgsrgnsskn  3687
             E +TFLYK   G CP+SYG N ARLA +P+ V+++   K++EFE                
Sbjct  1185  ETITFLYKFIGGACPKSYGFNAARLADIPEEVIQQGHRKAQEFEKTTI------------  1232

Query  3688  WDEKAIEVIRSLMHLADYNERHGGCVG  3768
                 ++ V R L  + D     G  VG
Sbjct  1233  ----SLRVFRYLCQVVDGTRSDGNAVG  1255



>ref|XP_005440331.1| PREDICTED: DNA mismatch repair protein Msh6 [Falco cherrug]
Length=1262

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/962 (40%), Positives = 552/962 (57%), Gaps = 75/962 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  294   DYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGL  353

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV
Sbjct  354   IFMKGTWAHSGFPETVFGRFSDVLVQKGYKVARVEQTETPEMMETRYKSMAHPTKFDKVV  413

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+ V E  ++S    G+R YGVC VD +  
Sbjct  414   RREICRIITKGTQTYS-VLDCDPSENHSKYLLCVKEKEESS----GQRVYGVCFVDTSVG  468

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+
Sbjct  469   KFYIGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQ  528

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FW+A KT+  +                 E      ++ +N     +LP+V+  L      
Sbjct  529   FWNASKTLKVL---------------LEEGYFKEKQNSENGC---SLPSVIKSLTSESDS  570

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGM  1890
               +  GEN   ALSALGG +FYLK+  +D  LL  A FE  +P            S F  
Sbjct  571   LGLTPGENSELALSALGGCVFYLKKCLIDQELLSLANFEEYIPVDIDTAKTTSSSSFFAK  630

Query  1891  IAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLE  2070
               Q+  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + +
Sbjct  631   TDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDTCCTPFGKRLLKQWLCAPLCNPK  688

Query  2071  AIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVL  2238
             +I +R DAV  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + 
Sbjct  689   SINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIF  746

Query  2239  YEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPD  2397
             YE+   +KK++  F+SAL G + M      +     N  S++L  L+T     PG   PD
Sbjct  747   YEEIKYSKKKIADFLSALEGFKVMNEIVDVMEDVASNFKSRVLKQLVTRKAKNPGGRFPD  806

Query  2398  VKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGD  2577
             +   ++++   FD  +A  +G I P  G D +YD A   ++ VE  L  +L +Q+KL G 
Sbjct  807   LSAELRRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHNYLDKQRKLLGF  866

Query  2578  TSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
              S+ Y   GK+ Y +E+PES+    +P+EYEL+S++KGY RYW   I K++  +  AE  
Sbjct  867   KSMLYWGAGKNRYQMEIPESVVSRNLPEEYELKSTRKGYKRYWTKEIEKMLAAMVNAEER  926

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             R++ LK  ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP 
Sbjct  927   RDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPV  985

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-----GAGHSSFILLTGPNMGGKST  3099
                 P L  K+  HP + T +     F+ ND+ +G     G+  +S +L+TGPNMGGKST
Sbjct  986   DSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSRDEDGSSAASCVLVTGPNMGGKST  1044

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             L+RQ  L V++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L 
Sbjct  1045  LMRQAGLLVVMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQ  1104

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT +SLV +DELGRGT+T DG AIA +V++  V +++CR +FSTHYH L  DY     V
Sbjct  1105  HATEHSLVLVDELGRGTATFDGTAIASAVVKELVERIKCRTLFSTHYHSLVEDYSHSVAV  1164

Query  3460  SLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              L HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ +++K   K++E
Sbjct  1165  QLGHMACMVENESEDPSQETITFLYKFIEGACPKSYGFNAARLADIPEEIIQKGHRKAKE  1224

Query  3634  FE  3639
             FE
Sbjct  1225  FE  1226



>ref|XP_010307417.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Balearica 
regulorum gibbericeps]
Length=1263

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/959 (40%), Positives = 549/959 (57%), Gaps = 69/959 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  295   DYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGL  354

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV
Sbjct  355   IFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARVEQTETPEMMETRYKSMAHPTKFDKVV  414

Query  1240  KREICAVITKGTLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P  +   YL+ V E   +S    G+R YGVC VD +  
Sbjct  415   RREICRIITKGTQTYS-VLDCDPSENHNKYLLCVKEKEDSS----GQRVYGVCFVDTSVG  469

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+
Sbjct  470   KFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQ  529

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNA---  1761
             FW+A KT+  +                 E      ++ +N   L ++   L+   ++   
Sbjct  530   FWNASKTLKVL---------------LEEGYFKEKQNSENGCCLPSVVKCLTSESDSLGL  574

Query  1762  --GENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQ  1899
               GEN   ALSALGG +FYLK+  +D  LL  A FE  +P            S F    Q
Sbjct  575   TPGENSELALSALGGCVFYLKKCLIDQELLSLANFEEYVPVDIDTAKTTSSSSFFAKTDQ  634

Query  1900  KPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIK  2079
             +  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I 
Sbjct  635   R--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSIN  692

Query  2080  ERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYED  2247
             +R DAV  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + YE+
Sbjct  693   DRLDAVEDLLAV--PHKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEE  750

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + M      +     +  SK+L  L+T     P    PD+  
Sbjct  751   IKYSKKKIADFLSALEGFKVMNEIVDVMEEIASDFKSKVLRQLVTRKAKNPDGRFPDLSA  810

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              +K++   FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+
Sbjct  811   ELKRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSM  870

Query  2587  NYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y   GK+ Y +E+PES+    +P+EYEL+S++KGY RYW   I K++  +  AE  R++
Sbjct  871   LYWGAGKNRYQMEIPESVISRNLPEEYELKSTRKGYKRYWTKEIEKMLAAMVNAEERRDA  930

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP    
Sbjct  931   ALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSA  989

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-----GAGHSSFILLTGPNMGGKSTLLR  3108
              P L  K+  HP + T +     F+ ND+ +G     G   +S +L+TGPNMGGKSTL+R
Sbjct  990   PPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSKDEDGGSEASCVLVTGPNMGGKSTLMR  1048

Query  3109  QVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSAT  3288
             Q  L VI+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT
Sbjct  1049  QAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHAT  1108

Query  3289  RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLC  3468
              +SLV +DELGRGT+T DG AIA +V++    K+QCR +FSTHYH L  DY  +  V L 
Sbjct  1109  EHSLVLVDELGRGTATFDGTAIASAVVKELAEKIQCRTLFSTHYHSLVEDYAHNAAVRLG  1168

Query  3469  HMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K+REFE
Sbjct  1169  HMACMVENESEDPSQETITFLYKFIEGACPKSYGFNAARLANIPEEVIQKGHRKAREFE  1227



>ref|XP_010307416.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Balearica 
regulorum gibbericeps]
Length=1264

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/959 (40%), Positives = 549/959 (57%), Gaps = 69/959 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  296   DYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGL  355

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV
Sbjct  356   IFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARVEQTETPEMMETRYKSMAHPTKFDKVV  415

Query  1240  KREICAVITKGTLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P  +   YL+ V E   +S    G+R YGVC VD +  
Sbjct  416   RREICRIITKGTQTYS-VLDCDPSENHNKYLLCVKEKEDSS----GQRVYGVCFVDTSVG  470

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+
Sbjct  471   KFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQ  530

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNA---  1761
             FW+A KT+  +                 E      ++ +N   L ++   L+   ++   
Sbjct  531   FWNASKTLKVL---------------LEEGYFKEKQNSENGCCLPSVVKCLTSESDSLGL  575

Query  1762  --GENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQ  1899
               GEN   ALSALGG +FYLK+  +D  LL  A FE  +P            S F    Q
Sbjct  576   TPGENSELALSALGGCVFYLKKCLIDQELLSLANFEEYVPVDIDTAKTTSSSSFFAKTDQ  635

Query  1900  KPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIK  2079
             +  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I 
Sbjct  636   R--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSIN  693

Query  2080  ERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYED  2247
             +R DAV  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + YE+
Sbjct  694   DRLDAVEDLLAV--PHKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEE  751

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + M      +     +  SK+L  L+T     P    PD+  
Sbjct  752   IKYSKKKIADFLSALEGFKVMNEIVDVMEEIASDFKSKVLRQLVTRKAKNPDGRFPDLSA  811

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              +K++   FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+
Sbjct  812   ELKRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSM  871

Query  2587  NYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y   GK+ Y +E+PES+    +P+EYEL+S++KGY RYW   I K++  +  AE  R++
Sbjct  872   LYWGAGKNRYQMEIPESVISRNLPEEYELKSTRKGYKRYWTKEIEKMLAAMVNAEERRDA  931

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP    
Sbjct  932   ALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSA  990

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-----GAGHSSFILLTGPNMGGKSTLLR  3108
              P L  K+  HP + T +     F+ ND+ +G     G   +S +L+TGPNMGGKSTL+R
Sbjct  991   PPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSKDEDGGSEASCVLVTGPNMGGKSTLMR  1049

Query  3109  QVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSAT  3288
             Q  L VI+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT
Sbjct  1050  QAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHAT  1109

Query  3289  RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLC  3468
              +SLV +DELGRGT+T DG AIA +V++    K+QCR +FSTHYH L  DY  +  V L 
Sbjct  1110  EHSLVLVDELGRGTATFDGTAIASAVVKELAEKIQCRTLFSTHYHSLVEDYAHNAAVRLG  1169

Query  3469  HMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K+REFE
Sbjct  1170  HMACMVENESEDPSQETITFLYKFIEGACPKSYGFNAARLANIPEEVIQKGHRKAREFE  1228



>gb|KFO77406.1| DNA mismatch repair protein Msh6, partial [Cuculus canorus]
Length=1273

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/1107 (38%), Positives = 605/1107 (55%), Gaps = 102/1107 (9%)
 Frame = +1

Query  568   RRGKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTN  747
             RR +S  +K++ L   + +E  K    KA  + S   +K T   AP +       ES  N
Sbjct  220   RRERSKPAKRSSLENER-SEAPK----KAATLSSEAKSKLTSFAAPDS------FESQAN  268

Query  748   NLECVKASNGDDILTGNSAERFSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPS  924
                C   SNG           F   E EKL +L +  ++DA +RR  D  YD  TLY+P 
Sbjct  269   --ACSGGSNG-----------FGTWEHEKLDWLQEGKKKDAQKRRQNDPAYDPCTLYVPE  315

Query  925   DFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCG  1104
             D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H G
Sbjct  316   DYLNKCTPGMRRWWQLKSQNFDAVVFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSG  375

Query  1105  FPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKG  1272
             FPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     D+VV+REIC +ITKG
Sbjct  376   FPETAFGRFSDVLVQKGYKVARVEQTETPEMMETRCKSMAHPTKFDRVVRREICRIITKG  435

Query  1273  TLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAdds  1443
             T T   +L   P  S   YL+ V E      +  G+  YGVC VD +  K  +GQF+DD 
Sbjct  436   TQTYS-ILDCDPSESHNKYLLCVKEK----EDSAGQCVYGVCFVDTSVGKFYVGQFSDDR  490

Query  1444  dcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV  1623
              CS   +L+  + PV+++     LS  T+++L     + +   L+  S+FW+A KT+   
Sbjct  491   HCSRFRTLVAHYTPVQVLYEKGNLSVSTQKILKGSLVSCIQEGLISGSQFWNASKTL---  547

Query  1624  KNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGG  1800
             K + +         S+NE  L P         ++ L +    L +  G+NG  ALSALGG
Sbjct  548   KVLLEEGYFKEKQDSENECSLPPV--------IKALTSESDSLGLTPGDNGELALSALGG  599

Query  1801  TLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLE  1944
              +FYLK+  +D  LL  A FE  +P            S F    Q+  MVLD   L NLE
Sbjct  600   CVFYLKKCLIDQELLSLANFEAYIPVDIDTAKIVCSNSSFARTDQR--MVLDGVTLMNLE  657

Query  1945  IFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLP  2124
             + +N  N  + GTL  ++++C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P
Sbjct  658   VLQNGTNGTTEGTLLERIDYCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--P  715

Query  2125  G-VLEFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISAL  2286
             G + E  + L +LPD+ERLL++I +     ++     ++ + YE+   +KK++  F+S L
Sbjct  716   GKISEVSEHLKKLPDLERLLSKIHSIGSPLKSQTHPDSRAIFYEEIKYSKKKIADFLSTL  775

Query  2287  RGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEAN  2451
              G + M     ++     +  SK+L  L+T     P    PD+   +K++   FD  +A 
Sbjct  776   EGFKVMNEIIDAMEEVASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQAR  835

Query  2452  SSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVP  2631
              +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+P
Sbjct  836   KTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGTGKNRYQMEIP  895

Query  2632  ESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCE  2808
             ES+    +P+EYEL+S+KKGY RYW   I K++  +  AE  R++ LK  ++RL   F +
Sbjct  896   ESVVSRNLPEEYELKSTKKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDK  955

Query  2809  HHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILR  2988
             +   W+  +  +A LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + 
Sbjct  956   NSKDWQAAVDCVAMLDVLMSLANYSQDSDGPLCRPVIL-LPVDGAPPFLELKNSRHPCI-  1013

Query  2989  TDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADV  3153
             T +     F+ ND+ +G        ++S +L+TGPNMGGKSTL+RQ  L  I+AQ+G  V
Sbjct  1014  TKTFFGDDFIPNDIMIGSKDEESGSNASCVLVTGPNMGGKSTLMRQAGLLAIMAQLGCYV  1073

Query  3154  PAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTS  3333
             PA +  L+P+DR+F R+GA D IM+G+STF  EL ETAS+L  AT +SLV +DELGRGT+
Sbjct  1074  PAEACRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILQHATEHSLVLVDELGRGTA  1133

Query  3334  TSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGL  3507
             T DG AIA +V++    +++CR +FSTHYH L  DY     V L HMAC +         
Sbjct  1134  TFDGTAIASAVVKELAERIRCRTLFSTHYHSLVEDYSRSAAVRLGHMACMVENESEDPSQ  1193

Query  3508  EEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGVYgnnkgsrgnsskn  3687
             E +TFLYK   G CP+SYG N ARLA +P+ V+++   K++EFE                
Sbjct  1194  ETITFLYKFIGGACPKSYGFNAARLADIPEEVIQQGHRKAQEFEKTTI------------  1241

Query  3688  WDEKAIEVIRSLMHLADYNERHGGCVG  3768
                 ++ V R L  + D     G  VG
Sbjct  1242  ----SLRVFRYLCQVVDGTRSDGNAVG  1264



>ref|XP_005391051.1| PREDICTED: DNA mismatch repair protein Msh6 [Chinchilla lanigera]
Length=1306

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/961 (40%), Positives = 551/961 (57%), Gaps = 72/961 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA +G  EL L
Sbjct  337   DFDASTLYVPEDFLNTCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALVGVNELGL  396

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     DKVV
Sbjct  397   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDKVV  456

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  ++S++    R YGVC VD +  
Sbjct  457   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEESSSHT---RLYGVCFVDTSLG  512

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  513   KFFVGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSVETKTILKGTLSSSLQEGLIPGSQ  572

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                     + +E ++ D+ +  LP VL  +      
Sbjct  573   FWDAAKTLRTLLE-----------------GGYFTEKLNEDSGVM-LPQVLKAMTSESDS  614

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-----------LLPFSHFGMI  1893
               +  GEN   ALSALGG +FYLK+  +D  LL  A FE           + P + F   
Sbjct  615   IGLTPGENSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSIRPGAIFTKA  674

Query  1894  AQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEA  2073
              Q+  MVLDA  L NLEIF N  N  S GTL  +++ C T FGKRLL+ WL  PL    A
Sbjct  675   NQR--MVLDAVTLNNLEIFVNGTNGSSEGTLLDRIDTCHTPFGKRLLKQWLCAPLCSPSA  732

Query  2074  IKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYE  2244
             I +R DAV  L GV    + E    L +LPD+ERLL++I    +  ++     ++ ++YE
Sbjct  733   INDRLDAVEDLMGVP-DKISEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYE  791

Query  2245  DA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVK  2403
             +   +KK++  F+SAL G + M      +   +D+  SK+L  ++T     P    PD+ 
Sbjct  792   ETTYSKKKIIDFLSALEGFKVMCKIIEIIEEVVDDFKSKVLKQVVTLQTKNPDGRFPDLT  851

Query  2404  LVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTS  2583
               + ++   FD  +A  +G I P  G D +YD A   +R+ E SL  +L +Q+   G  +
Sbjct  852   AELNRWDTAFDHEKARRTGLITPKAGFDSDYDQALADIRENEQSLLDYLDKQRSRIGCRT  911

Query  2584  INYVTVGKDAYLLEVPESLC-ELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERE  2760
             I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+
Sbjct  912   IVYWGIGRNRYQLEIPENFTTHNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRD  971

Query  2761  SKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQD  2940
               LK  ++RL   F ++++ W+  +  IA LDVL+ L+  S   +GP CRP +  LP +D
Sbjct  972   VSLKDCMRRLFYNFDKNYTDWQCAVECIAVLDVLLCLANYSQGGDGPMCRPAVL-LPGED  1030

Query  2941  NVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTL  3102
             N P L      HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKSTL
Sbjct  1031  NPPFLELGGSRHPCI-TKTFFGDDFIPNDILIGCEEQQEENGKAYCVLVTGPNMGGKSTL  1089

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             +RQ  L  ++AQ+G  VPA    L+PVDR+F R+GA D IM+G+STF  EL ETAS+L  
Sbjct  1090  IRQAGLLAVMAQMGCYVPAEVCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILRH  1149

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V 
Sbjct  1150  ATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIRCRTLFSTHYHSLVEDYSKNVAVR  1209

Query  3463  LCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REF
Sbjct  1210  LGHMACMVENECEDPSQETITFLYKFVKGACPKSYGFNAARLANLPEEVIQKGHRKAREF  1269

Query  3637  E  3639
             E
Sbjct  1270  E  1270



>emb|CCA22891.1| PREDICTED: similar to G/T mismatch binding protein p [Albugo 
laibachii Nc14]
Length=1191

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/948 (40%), Positives = 549/948 (58%), Gaps = 63/948 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             NYD RTLY+P +FLK  +    QWWE KS++MD VLFFK+GKFYELF MDA +G KEL+L
Sbjct  224   NYDPRTLYVPPNFLKKETPAMIQWWEVKSRNMDTVLFFKVGKFYELFHMDADVGFKELNL  283

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKG-SKDKVVKRE  1248
              YMKGE+ H GFPE      A +L +KGYRV  VEQ ETPE +++R      K KVV+RE
Sbjct  284   IYMKGEKAHSGFPEIAHDKMASQLVQKGYRVARVEQTETPEMMKIRNANSKQKSKVVRRE  343

Query  1249  ICAVITKGTLTEGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQ  1428
             IC++++ G  + G +L+  P    L  V +  QT         YGVCV+D  T+   LG+
Sbjct  344   ICSMVSPGLNSFGCLLSDDPCTRML--VLKEVQTKQGSALVPRYGVCVLDTPTACFQLGE  401

Query  1429  FAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEK  1608
             F D      L +LL ++R VE I      +  T++++     + ++ EL   SEFW A K
Sbjct  402   FNDTVQRDRLKTLLAQYRIVEFICERSETAKATKQIIKFGAPDAVITELKSGSEFWSASK  461

Query  1609  TISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTYALS  1788
             T+ E++N  Q   N+  P            SI       NL  +         +G  ALS
Sbjct  462   TVQEIQNA-QYFTNSGWP-----------SSIAQYLTSENLVEI---------DGELALS  500

Query  1789  ALGGTLFYLKQAFLDVSLLKFAEFE-LLPF------SHFGMIAQ-------KPYMVLDAA  1926
             ALGG ++ L++  +D  LL    F+  +P       S  G   Q       + Y VLD+ 
Sbjct  501   ALGGCIWQLRRGIVDKELLSMCNFKNYIPSDQQVRSSCQGTAVQMGTPELNQRYAVLDSQ  560

Query  1927  ALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGL  2106
              L NLEI  N++N   +G+L   ++   T+FGKRL + W+ +PL  +  I +R DAV  L
Sbjct  561   TLSNLEILRNNRNGKRNGSLINILDKTATSFGKRLFQEWVVKPLCQVADITDRLDAVQEL  620

Query  2107  KGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYEDAAK--KQLQQ  2271
                N+  V + R    +LPD+ER+L +I    ++  A     ++ ++YE      ++++ 
Sbjct  621   MA-NMETVTQIRNCFKKLPDLERVLFRIHTLGSADRARDHPDSRAIMYESNTYNIRKIRD  679

Query  2272  FISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKG----------LPDVKLVIKQF  2421
             F++AL G E+ ++   ++       +S LL +++                PD++  ++ F
Sbjct  680   FVAALNGFESAMDLIEAITPIFAQFESSLLRNIVQKSDSDGETERSAGQFPDLRKRLEFF  739

Query  2422  KDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTV  2601
             K  FD   A  SG IIP  GVD EYDAAC  +++VE +L ++L+EQ+K+     I+Y   
Sbjct  740   KVSFDRESAQKSGVIIPETGVDPEYDAACIDIQRVEKALEEYLEEQKKILRCQQISYWGK  799

Query  2602  GKD-AYLLEVPE-SLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKS  2775
              KD  Y LE+PE ++    P+EYEL+S +KG+ R+  P IRKL+ EL++ E +RE  LK 
Sbjct  800   KKDDRYQLEIPEEAITSKQPKEYELKSRRKGFKRFHTPKIRKLLAELTRTEEKREEALKD  859

Query  2776  ILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCL  2955
              ++R+  +F E+H  W + +  +A LD   SL++ S + E  + RP +    S D +P +
Sbjct  860   QMRRIFHKFDENHIEWVQAVRFLAVLDCYQSLAVVSAHSENYS-RPLVMSAKSNDGIPFI  918

Query  2956  VAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLAVILA  3135
               K   H  +  +      F+ ND TLG  G  S +LL+GPNMGGKSTLLRQ CL  ++A
Sbjct  919   DFKGGVHATMAGNE----HFIPNDTTLGLDGRGSLMLLSGPNMGGKSTLLRQTCLIALMA  974

Query  3136  QVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDE  3315
             Q+G  VPA +  +SP DRIF R+GA D+++AGQST   EL ETA++L+ +T++SLV LDE
Sbjct  975   QIGCFVPATNCRMSPFDRIFTRIGATDNLLAGQSTLYVELAETATILNHSTQHSLVILDE  1034

Query  3316  LGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEG  3495
             LGRGTST DG AIA SV+E+ + +V CR MF+THYH L  +YQ D +V+L HMAC I   
Sbjct  1035  LGRGTSTFDGTAIASSVVEYLLRRVGCRSMFATHYHSLVEEYQNDSKVALSHMACMIDP-  1093

Query  3496  LGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
                  +VTFLYKL+ G CPRSYG NVA LA LP+ V++ A AKS++FE
Sbjct  1094  -KEEHKVTFLYKLSPGMCPRSYGTNVAILAQLPEQVIQCAIAKSKQFE  1140



>ref|XP_007942603.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X4 [Orycteropus 
afer afer]
 ref|XP_007942604.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X4 [Orycteropus 
afer afer]
Length=1058

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/960 (40%), Positives = 551/960 (57%), Gaps = 69/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TL++P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  88    DFDASTLHVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  147

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K       D+VV
Sbjct  148   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKHDRVV  207

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  208   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGH--TRMYGVCFVDTSLG  264

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  265   KFYIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSTETKMILKSSLSSSLQEGLIPGSQ  324

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + + +E ++ D+ +  LP VL ++      
Sbjct  325   FWDAAKTLRTLLE-----------------EGYFTEKLNGDSGVM-LPQVLKDMTSETDS  366

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  367   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYVPLDSDMVSATRPGAIFAK  426

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    +I
Sbjct  427   ANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERIDTCHTPFGKRLLKQWLCAPLCSPFSI  486

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  487   NDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  545

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + M      +   +D+  SKLL  ++T     P    PD+  
Sbjct  546   TTYSKKKIIDFLSALEGFKVMCKIIEIMEEVIDDFKSKLLKQVITLQTKNPEGRFPDLTT  605

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  606   ELNRWDTAFDHEKARKTGIITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTI  665

Query  2587  NYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PES     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  666   VYWGIGRNRYQLEIPESFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDV  725

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  +A LDVL+ L+  S   +GP CRP I  LP  D 
Sbjct  726   SLKDCMRRLFYNFDKNYKDWQSAVECMAVLDVLLCLANYSRGGDGPMCRPVIL-LPEDDT  784

Query  2944  VPCLVAKSLGHP-ILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGKSTLL  3105
              P L  K   HP I++T   D   F+ ND+ +G       G +  +L+TGPNMGGKSTL+
Sbjct  785   PPFLELKGSRHPCIMKTFFGDD--FIPNDILIGCEEEEENGQAYCVLVTGPNMGGKSTLM  842

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  843   RQAGLLTVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  902

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  903   TAHSLVLVDELGRGTATFDGTAIAHAVVKELAESIKCRTLFSTHYHSLVEDYSQNVAVRL  962

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  963   GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1022



>gb|KFQ88383.1| DNA mismatch repair protein Msh6, partial [Phoenicopterus ruber 
ruber]
Length=1278

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/1065 (38%), Positives = 597/1065 (56%), Gaps = 109/1065 (10%)
 Frame = +1

Query  589   SKKAELRKRKFTEGLKLVSTKAK-KIKSGGNNKSTQSKAPTATGGVKVIESVTNNLECVK  765
             ++++E  KR  T     VS++AK K+ S    +S +S+A   +GG+              
Sbjct  239   NERSETPKRAAT-----VSSEAKSKLTSFAAPESFESQANACSGGI--------------  279

Query  766   ASNGDDILTGNSAERFSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGL  942
               NG           F++ E EKL +L +G++   RR+   D +YD  TLY+P D+L   
Sbjct  280   --NG-----------FAVWEHEKLDWLQEGKKKDARRKRQGDPDYDPCTLYVPEDYLNKC  326

Query  943   SGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNF  1122
             + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F
Sbjct  327   TPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAF  386

Query  1123  SMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGE  1290
                ++ L +KGY+V  VEQ ETPE +E+R K  +     DKVV+REIC +ITKGT T   
Sbjct  387   GRFSDVLVQKGYKVARVEQTETPEMMEMRYKSMTHPTKFDKVVRREICRIITKGTQTYS-  445

Query  1291  MLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslc  1461
             +L   P  +   YL+ V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   
Sbjct  446   VLDCDPSENHNKYLLCVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFR  501

Query  1462  sllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQR  1641
             +L+  + PV+++     LS +T+++L     + +   L+  S+FW+A KT+  +      
Sbjct  502   TLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL------  555

Query  1642  LNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALG  1797
                        E      E+ +N     +LP+V+  L        +  GEN   ALSALG
Sbjct  556   ---------LEEGYFKEKENSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALG  603

Query  1798  GTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENL  1941
             G +FYLK+  +D  LL  A FE  +P            S F    Q+  MVLD   L NL
Sbjct  604   GCVFYLKKCLIDQELLSLANFEEYIPVDIDTAKTTSSSSFFAKTDQR--MVLDGVTLMNL  661

Query  1942  EIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNL  2121
             E+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  
Sbjct  662   EVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--  719

Query  2122  PGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISA  2283
             P  + E  + L +LPD+ERLL++I +     ++     ++ + YE+   +KK++  F+SA
Sbjct  720   PHKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSA  779

Query  2284  LRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEA  2448
             L G + M      +     +  SK+L  L+T     P    PD+   +K++   FD  +A
Sbjct  780   LEGFKVMNEIVDVMEEIASDFRSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQA  839

Query  2449  NSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEV  2628
               +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+
Sbjct  840   RKTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEI  899

Query  2629  PESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFC  2805
             PES+    +P+EYEL+S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F 
Sbjct  900   PESVISRNLPEEYELKSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFD  959

Query  2806  EHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPIL  2985
             ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP +
Sbjct  960   KNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI  1018

Query  2986  RTDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGAD  3150
              T +     F+ ND+ +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  
Sbjct  1019  -TKTFFGDDFIPNDIVIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCY  1077

Query  3151  VPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGT  3330
             VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT
Sbjct  1078  VPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGT  1137

Query  3331  STSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GG  3504
             +T DG AIA +V++    +++CR +FSTHYH L  DY  +  V L HMAC +        
Sbjct  1138  ATFDGTAIASAVVKELAEQIRCRTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPS  1197

Query  3505  LEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              E +TFLYK   G CP+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1198  QETITFLYKFIEGACPKSYGFNAARLANIPEEVIQKGHRKAKEFE  1242



>ref|XP_004328246.1| PREDICTED: DNA mismatch repair protein Msh6 isoform 2 [Tursiops 
truncatus]
Length=1230

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/1055 (38%), Positives = 593/1055 (56%), Gaps = 81/1055 (8%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN---KSTQSKAPTATGGVKVIESVTNN----LECVKASNGDDILTG-  795
             V+ K K++ +G  +   KS++ + P+AT     I S T N        + S     ++G 
Sbjct  166   VAPKRKRMITGNGSLKRKSSRKEMPSATKRATGISSETKNTLSAFSAPQNSESQAHVSGG  225

Query  796   -NSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
              + + R ++   E L +L + +R    RR     ++D+ TLY+P DFL   + G R+WW+
Sbjct  226   CDDSSRPTIWYHETLEWLKEEKRRDKHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ  285

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +
Sbjct  286   IKSQNFDLVIFYKVGKFYELYHMDALTGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ  345

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPD--  1311
             KGY+V  VEQ ETPE +E R +K +     D+VV+REIC VITKGT T   +L   P   
Sbjct  346   KGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRVITKGTQTYS-VLEGDPSEN  404

Query  1312  -ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
              + YL+++ E  + S+     R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  405   YSKYLLSLKEKEEDSSGH--ARVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV  462

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYS  1668
             +++     LS ET+ +L     + L   L+P S+FWDA KT+  +               
Sbjct  463   QVLFEKGNLSVETKMILKGSLSSSLQEGLIPGSQFWDAAKTLRTLLE-------------  509

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQA  1824
                 + + ++ ++ D+ +  LP VL  +        +  GE    ALSALGG +FYLK+ 
Sbjct  510   ----EGYFTDKLNEDSGVM-LPQVLKGMTSESDSVGLTPGEKSELALSALGGCVFYLKKC  564

Query  1825  FLDVSLLKFAEFE------------LLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNC  1968
              +D  LL  A FE            + P + F   +Q+  MVLDA  L NLEIF N  N 
Sbjct  565   LIDQELLSMANFEEYIPLDSDTVRAIGPGAVFAKASQR--MVLDAVTLSNLEIFLNGTNG  622

Query  1969  GSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKE  2148
              + GTL  +++ C T FGKRLL+ WL  PL +   I +R DA+  L  V    + E    
Sbjct  623   STEGTLLDKIDTCYTPFGKRLLKQWLCAPLCNPYVISDRLDAIEDLMVVP-DKISEVVDL  681

Query  2149  LSRLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNA  2313
             L +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + +   
Sbjct  682   LKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVLCKI  741

Query  2314  CFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCE  2478
                +   +D+  SK+L  +LT     P    PD+ L + ++   FD  +A  +G I P  
Sbjct  742   IGVMEEVIDDFKSKILKQVLTLQAKNPEGRFPDLTLELNRWDTAFDHEKARKTGLITPKA  801

Query  2479  GVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVP  2655
             G D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+ +   +P
Sbjct  802   GFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTIVYWGIGRNRYQLEIPENFITRNLP  861

Query  2656  QEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELI  2835
             +EYEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+  +
Sbjct  862   EEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQAAV  921

Query  2836  STIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAF  3015
               IA LDVL+ L+  S   +GP CRP I  LP +D  P L  K   HP + T +     F
Sbjct  922   ECIAVLDVLLCLANYSRGGDGPMCRPVIL-LPGEDTPPFLDLKGSRHPCI-TKTFFGDDF  979

Query  3016  VSNDVTLGGA-----GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSP  3180
             + ND+ +G       G +  +L+TGPNMGGKSTL+RQ  L V++AQ+G  VPA    L+P
Sbjct  980   IPNDILIGCEEEEENGKAYCVLVTGPNMGGKSTLMRQAGLLVVMAQMGCYVPAEVCRLTP  1039

Query  3181  VDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAE  3360
             +DR+F R+GA D IM+G+STF  EL ETAS+L  AT +SLV +DELGRGT+T DG AIA 
Sbjct  1040  IDRVFTRLGASDRIMSGESTFFVELSETASILKHATAHSLVLVDELGRGTATFDGTAIAN  1099

Query  3361  SVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKL  3534
             +V++     ++CR +FSTHYH L  DY ++  V L HMAC +         E +TFLYK 
Sbjct  1100  AVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQETITFLYKF  1159

Query  3535  TLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
               G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1160  IKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1194



>ref|XP_010292690.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Phaethon 
lepturus]
Length=1262

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/987 (40%), Positives = 569/987 (58%), Gaps = 66/987 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  266   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  325

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  326   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  385

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  386   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-ILDCDPSENHNKYLL  444

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  445   CVKEKDDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  500

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQNEA  1680
               LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N     S+N  
Sbjct  501   GNLSVDTQKILKGSLVSCIQEALISGSQFWNASKTLKVLLEEGYFKEKQN-----SENGC  555

Query  1681  DLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
              L PS        +R+L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A 
Sbjct  556   SL-PS-------VIRSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLAN  607

Query  1858  FE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++
Sbjct  608   FEEYIPVDIDTARTTSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERID  665

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERL  2178
              C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERL
Sbjct  666   SCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERL  723

Query  2179  LAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDN  2343
             L++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     +
Sbjct  724   LSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMTEIVDVMEEVASD  783

Query  2344  TDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               S++L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD A 
Sbjct  784   FKSRVLKQLVTRKAKNPDGHFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKAL  843

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKK  2685
               ++ V+  L  +L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+S++K
Sbjct  844   QDIKAVDEDLHNYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYELKSTRK  903

Query  2686  GYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             GY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+
Sbjct  904   GYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLM  963

Query  2866  SLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-  3042
             SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G  
Sbjct  964   SLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSK  1021

Query  3043  ----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
                 +  +S +L+TGPNMGGKSTL+RQ  L  I+AQ+G  VPA    L+P+DR+F R+GA
Sbjct  1022  DEDSSSEASCVLVTGPNMGGKSTLMRQAGLLAIMAQLGCYVPAEVCRLTPIDRVFTRLGA  1081

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
              D IMAG+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K+
Sbjct  1082  SDRIMAGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKI  1141

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYG  3564
             +CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG
Sbjct  1142  KCRTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYG  1201

Query  3565  VNVARLAGLPDNVLEKAAAKSREFEGV  3645
              N ARLA +P+ V++K   K++EFE V
Sbjct  1202  FNAARLANIPEEVIQKGHRKAKEFEKV  1228



>ref|XP_010292689.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Phaethon 
lepturus]
Length=1263

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/987 (40%), Positives = 569/987 (58%), Gaps = 66/987 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  267   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  326

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  327   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  386

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  387   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-ILDCDPSENHNKYLL  445

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  446   CVKEKDDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  501

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQNEA  1680
               LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N     S+N  
Sbjct  502   GNLSVDTQKILKGSLVSCIQEALISGSQFWNASKTLKVLLEEGYFKEKQN-----SENGC  556

Query  1681  DLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
              L PS        +R+L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A 
Sbjct  557   SL-PS-------VIRSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLAN  608

Query  1858  FE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++
Sbjct  609   FEEYIPVDIDTARTTSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERID  666

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERL  2178
              C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERL
Sbjct  667   SCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERL  724

Query  2179  LAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDN  2343
             L++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     +
Sbjct  725   LSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMTEIVDVMEEVASD  784

Query  2344  TDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               S++L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD A 
Sbjct  785   FKSRVLKQLVTRKAKNPDGHFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKAL  844

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKK  2685
               ++ V+  L  +L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+S++K
Sbjct  845   QDIKAVDEDLHNYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYELKSTRK  904

Query  2686  GYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             GY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+
Sbjct  905   GYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLM  964

Query  2866  SLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-  3042
             SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G  
Sbjct  965   SLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSK  1022

Query  3043  ----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
                 +  +S +L+TGPNMGGKSTL+RQ  L  I+AQ+G  VPA    L+P+DR+F R+GA
Sbjct  1023  DEDSSSEASCVLVTGPNMGGKSTLMRQAGLLAIMAQLGCYVPAEVCRLTPIDRVFTRLGA  1082

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
              D IMAG+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K+
Sbjct  1083  SDRIMAGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKI  1142

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYG  3564
             +CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG
Sbjct  1143  KCRTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYG  1202

Query  3565  VNVARLAGLPDNVLEKAAAKSREFEGV  3645
              N ARLA +P+ V++K   K++EFE V
Sbjct  1203  FNAARLANIPEEVIQKGHRKAKEFEKV  1229



>gb|KFO14162.1| DNA mismatch repair protein Msh6, partial [Balearica regulorum 
gibbericeps]
Length=1277

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/959 (40%), Positives = 549/959 (57%), Gaps = 69/959 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  309   DYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGL  368

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV
Sbjct  369   IFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARVEQTETPEMMETRYKSMAHPTKFDKVV  428

Query  1240  KREICAVITKGTLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P  +   YL+ V E   +S    G+R YGVC VD +  
Sbjct  429   RREICRIITKGTQTYS-VLDCDPSENHNKYLLCVKEKEDSS----GQRVYGVCFVDTSVG  483

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+
Sbjct  484   KFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQ  543

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNA---  1761
             FW+A KT+  +                 E      ++ +N   L ++   L+   ++   
Sbjct  544   FWNASKTLKVL---------------LEEGYFKEKQNSENGCCLPSVVKCLTSESDSLGL  588

Query  1762  --GENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQ  1899
               GEN   ALSALGG +FYLK+  +D  LL  A FE  +P            S F    Q
Sbjct  589   TPGENSELALSALGGCVFYLKKCLIDQELLSLANFEEYVPVDIDTAKTTSSSSFFAKTDQ  648

Query  1900  KPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIK  2079
             +  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I 
Sbjct  649   R--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSIN  706

Query  2080  ERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYED  2247
             +R DAV  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + YE+
Sbjct  707   DRLDAVEDLLAV--PHKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEE  764

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + M      +     +  SK+L  L+T     P    PD+  
Sbjct  765   IKYSKKKIADFLSALEGFKVMNEIVDVMEEIASDFKSKVLRQLVTRKAKNPDGRFPDLSA  824

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              +K++   FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+
Sbjct  825   ELKRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSM  884

Query  2587  NYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y   GK+ Y +E+PES+    +P+EYEL+S++KGY RYW   I K++  +  AE  R++
Sbjct  885   LYWGAGKNRYQMEIPESVISRNLPEEYELKSTRKGYKRYWTKEIEKMLAAMVNAEERRDA  944

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP    
Sbjct  945   ALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSA  1003

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-----GAGHSSFILLTGPNMGGKSTLLR  3108
              P L  K+  HP + T +     F+ ND+ +G     G   +S +L+TGPNMGGKSTL+R
Sbjct  1004  PPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSKDEDGGSEASCVLVTGPNMGGKSTLMR  1062

Query  3109  QVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSAT  3288
             Q  L VI+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT
Sbjct  1063  QAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHAT  1122

Query  3289  RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLC  3468
              +SLV +DELGRGT+T DG AIA +V++    K+QCR +FSTHYH L  DY  +  V L 
Sbjct  1123  EHSLVLVDELGRGTATFDGTAIASAVVKELAEKIQCRTLFSTHYHSLVEDYAHNAAVRLG  1182

Query  3469  HMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K+REFE
Sbjct  1183  HMACMVENESEDPSQETITFLYKFIEGACPKSYGFNAARLANIPEEVIQKGHRKAREFE  1241



>gb|KFW62049.1| DNA mismatch repair protein Msh6, partial [Pygoscelis adeliae]
Length=1278

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/983 (40%), Positives = 565/983 (57%), Gaps = 62/983 (6%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  282   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  341

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  342   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  401

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  402   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  460

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  461   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  516

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +      L        QN    
Sbjct  517   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL------LEEGYFKEKQN----  566

Query  1687  HPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEF-  1860
              P       + +++L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A F 
Sbjct  567   -PENGCSLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLANFA  625

Query  1861  ELLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHC  2007
             E +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++ C
Sbjct  626   EYVPVDIDTAKTRSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSC  683

Query  2008  VTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLA  2184
              T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERLL+
Sbjct  684   CTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERLLS  741

Query  2185  QIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTD  2349
             +I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     N  
Sbjct  742   KIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVIEEIASNFK  801

Query  2350  SKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGS  2514
             SK+L  L+T     PG   PD+   ++++   FD  +A  +G I P  G D +YD A   
Sbjct  802   SKVLKQLVTRKAKNPGGRFPDLSAELQRWDTAFDHNQARKTGVITPKAGFDPDYDKALQD  861

Query  2515  LRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGY  2691
             ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+S++KGY
Sbjct  862   IKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELKSTRKGY  921

Query  2692  FRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISL  2871
              RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+S 
Sbjct  922   KRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSF  981

Query  2872  SIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG---  3042
             +  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G    
Sbjct  982   ANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSKDE  1039

Query  3043  --AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKD  3216
               +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA D
Sbjct  1040  DSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGASD  1099

Query  3217  HIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQC  3396
              IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K++C
Sbjct  1100  RIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKIKC  1159

Query  3397  RGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVN  3570
             R +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG N
Sbjct  1160  RTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYGFN  1219

Query  3571  VARLAGLPDNVLEKAAAKSREFE  3639
              ARLA +P+ V++K   K++EFE
Sbjct  1220  AARLANIPEEVIQKGHRKAQEFE  1242



>gb|KFQ82192.1| DNA mismatch repair protein Msh6, partial [Phaethon lepturus]
Length=1276

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/987 (40%), Positives = 569/987 (58%), Gaps = 66/987 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  280   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  339

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  340   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  399

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  400   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-ILDCDPSENHNKYLL  458

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  459   CVKEKDDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  514

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQNEA  1680
               LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N     S+N  
Sbjct  515   GNLSVDTQKILKGSLVSCIQEALISGSQFWNASKTLKVLLEEGYFKEKQN-----SENGC  569

Query  1681  DLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
              L PS        +R+L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A 
Sbjct  570   SL-PS-------VIRSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLAN  621

Query  1858  FE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++
Sbjct  622   FEEYIPVDIDTARTTSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERID  679

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERL  2178
              C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERL
Sbjct  680   SCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERL  737

Query  2179  LAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDN  2343
             L++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     +
Sbjct  738   LSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMTEIVDVMEEVASD  797

Query  2344  TDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               S++L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD A 
Sbjct  798   FKSRVLKQLVTRKAKNPDGHFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKAL  857

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKK  2685
               ++ V+  L  +L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+S++K
Sbjct  858   QDIKAVDEDLHNYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESVVSRNLPEEYELKSTRK  917

Query  2686  GYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             GY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+
Sbjct  918   GYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLM  977

Query  2866  SLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-  3042
             SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G  
Sbjct  978   SLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSK  1035

Query  3043  ----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
                 +  +S +L+TGPNMGGKSTL+RQ  L  I+AQ+G  VPA    L+P+DR+F R+GA
Sbjct  1036  DEDSSSEASCVLVTGPNMGGKSTLMRQAGLLAIMAQLGCYVPAEVCRLTPIDRVFTRLGA  1095

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
              D IMAG+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K+
Sbjct  1096  SDRIMAGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKI  1155

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYG  3564
             +CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG
Sbjct  1156  KCRTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYG  1215

Query  3565  VNVARLAGLPDNVLEKAAAKSREFEGV  3645
              N ARLA +P+ V++K   K++EFE V
Sbjct  1216  FNAARLANIPEEVIQKGHRKAKEFEKV  1242



>ref|XP_009331892.1| PREDICTED: DNA mismatch repair protein Msh6 [Pygoscelis adeliae]
Length=1264

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/983 (40%), Positives = 565/983 (57%), Gaps = 62/983 (6%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  268   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  327

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  328   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  387

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  388   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  446

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  447   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  502

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +      L        QN    
Sbjct  503   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL------LEEGYFKEKQN----  552

Query  1687  HPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEF-  1860
              P       + +++L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A F 
Sbjct  553   -PENGCSLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLANFA  611

Query  1861  ELLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHC  2007
             E +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++ C
Sbjct  612   EYVPVDIDTAKTRSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSC  669

Query  2008  VTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERLLA  2184
              T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERLL+
Sbjct  670   CTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERLLS  727

Query  2185  QIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTD  2349
             +I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     N  
Sbjct  728   KIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVIEEIASNFK  787

Query  2350  SKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGS  2514
             SK+L  L+T     PG   PD+   ++++   FD  +A  +G I P  G D +YD A   
Sbjct  788   SKVLKQLVTRKAKNPGGRFPDLSAELQRWDTAFDHNQARKTGVITPKAGFDPDYDKALQD  847

Query  2515  LRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGY  2691
             ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+S++KGY
Sbjct  848   IKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELKSTRKGY  907

Query  2692  FRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISL  2871
              RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+S 
Sbjct  908   KRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSF  967

Query  2872  SIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG---  3042
             +  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G    
Sbjct  968   ANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSKDE  1025

Query  3043  --AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKD  3216
               +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA D
Sbjct  1026  DSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGASD  1085

Query  3217  HIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQC  3396
              IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K++C
Sbjct  1086  RIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKIKC  1145

Query  3397  RGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVN  3570
             R +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG N
Sbjct  1146  RTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYGFN  1205

Query  3571  VARLAGLPDNVLEKAAAKSREFE  3639
              ARLA +P+ V++K   K++EFE
Sbjct  1206  AARLANIPEEVIQKGHRKAQEFE  1228



>ref|XP_008499374.1| PREDICTED: DNA mismatch repair protein Msh6 [Calypte anna]
Length=1262

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/989 (40%), Positives = 571/989 (58%), Gaps = 62/989 (6%)
 Frame = +1

Query  790   TGNSAERFSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWW  966
             +G S E F++ E EKL +L +G++    RR   D +YD  TLY+P D+L   + G R+WW
Sbjct  261   SGGSGE-FAVWEHEKLDWLQEGKKKDVHRRRQGDPDYDPCTLYVPEDYLNKCTPGMRRWW  319

Query  967   EFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLA  1146
             + KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L 
Sbjct  320   QLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLV  379

Query  1147  RKGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDA  1314
             +KGY+V  VEQ ETPE +E R K  +     D+VV+REIC +ITKGT T   +L   P  
Sbjct  380   QKGYKVARVEQTETPEMMEARCKAMAHPTKFDRVVRREICRIITKGTQTYS-ILDCDPSE  438

Query  1315  S---YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRP  1485
             +   YL+ V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + P
Sbjct  439   NHNQYLLCVKEKDASS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTP  494

Query  1486  VEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPY  1665
             V+++     LS +T+++L     + +   L+  S+FW+A KT+  +      L       
Sbjct  495   VQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL------LEEGYFKE  548

Query  1666  SQNEADLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
              QN      SE     + +++L +    L +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  549   KQN------SEGCFLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  602

Query  1843  LKFAEFE-LLP-----------FSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P           +S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  603   LSLANFEEYVPVDISTAKNVSLYSFFAKTDQR--MVLDGVTLMNLEVLQNRTNGTTEGTL  660

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V    + E  + L +LPD
Sbjct  661   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLMAVP-HKMTEVCEHLKKLPD  719

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M     ++  
Sbjct  720   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEVKYSKKKIADFLSALEGFKVMNEIVATMEE  779

Query  2332  TLDNTDSKLLHDLLT-PGKGL----PDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                   SK+L  + T  GK L    PD+   +K++   FD  +A  +G I P  G D +Y
Sbjct  780   IASEFKSKVLKQIATRKGKNLGGHFPDLSAELKRWNTAFDHNQARKTGVITPKVGFDPDY  839

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQ  2673
             D A   ++ VE  L  +L +Q+KL G  S+ Y  VGK+ Y +E+PES +   +P EY+L+
Sbjct  840   DKALQDIKAVEEDLQSYLDKQRKLLGFRSLLYWGVGKNRYQMEIPESAISRNLPAEYQLK  899

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             SS+KGY RYW   I K++  L  AE  R++ LK  ++RL   F ++   WR  +  IA L
Sbjct  900   SSRKGYKRYWTKEIEKMLAALVNAEERRDAALKDCMRRLFYNFDKNSKAWRTAVECIAVL  959

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP +  LP     P L  +   HP + T +L    F+ ND+ 
Sbjct  960   DVLMSLANYSQDGDGPLCRPAVV-LPVDSAPPFLELQHSRHPCI-TKTLFGDDFIPNDIM  1017

Query  3034  LGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F 
Sbjct  1018  IGSKNKNCSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFT  1077

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT++SLV +DELGRGT+T DG AIA +V++  
Sbjct  1078  RLGASDRIMSGESTFFVELSETSSILQHATKHSLVLVDELGRGTATFDGTAIASAVVKEL  1137

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K+QCR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP
Sbjct  1138  AEKIQCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGACP  1197

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +SYG N ARLA +P+ V++K   K++EFE
Sbjct  1198  KSYGFNAARLADIPEEVIQKGHRKAKEFE  1226



>ref|XP_004686277.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Condylura 
cristata]
Length=1227

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/962 (40%), Positives = 548/962 (57%), Gaps = 74/962 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ T+Y+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  258   DFDASTVYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVSELGL  317

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K       D+VV
Sbjct  318   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMTHISKHDRVV  377

Query  1240  KREICAVITKGTLT----EGEMLTVSPDASYLIAVTESCQTSANQLGERTYGVCVVDVAT  1407
             +REIC VITKGT T    EGE+      + YL+++ E   +S +    R YGVC VD + 
Sbjct  378   RREICRVITKGTQTYSVLEGEL--SENHSKYLLSLKEKDDSSGHT---RVYGVCFVDTSL  432

Query  1408  SKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLS  1587
              K  +GQF DD  CS   +L+  + PV+I+     LS ET  +L     + L   L+P S
Sbjct  433   GKFFIGQFTDDRHCSRFRTLVAHYPPVQILFEKGNLSVETRMILKGSLSSSLQEGLIPGS  492

Query  1588  EFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-----  1752
             +FWDA KT+   K + +              + + +E +  D+ +  LP VL  +     
Sbjct  493   QFWDAAKTL---KTLLE--------------EGYFTEKLSEDSGVM-LPEVLKSMTSEAD  534

Query  1753  ---VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE------------LLPFSHFG  1887
                +  GE    ALSALGG +FYLK+  +D  LL  A FE              P + F 
Sbjct  535   SIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYVPLDSDMFSGTRPGAVFA  594

Query  1888  MIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHL  2067
               +Q+  MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL   
Sbjct  595   KTSQR--MVLDAVTLNNLEIFLNGTNGSTEGTLLEKIDTCNTPFGKRLLKQWLCAPLCSP  652

Query  2068  EAIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVL  2238
              AI +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++
Sbjct  653   HAINDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIM  711

Query  2239  YEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPD  2397
             YE+   +KK++  F+SAL G + +      +   +D+  SK+L  ++T     P    PD
Sbjct  712   YEETTYSKKKIIDFLSALEGFKVLCKIIEIMEEVVDDFKSKILKQVITLHTKNPEGRFPD  771

Query  2398  VKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGD  2577
             +   + ++   FD  +A  +G I P  G D +YD A   +R+ E SL  +L +Q+   G 
Sbjct  772   LTTELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLDYLDKQRSRIGC  831

Query  2578  TSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
              +I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K +  L  AE  
Sbjct  832   RAIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEER  891

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             R++ LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP 
Sbjct  892   RDTSLKDCMRRLFYNFDKNYKDWQTAVECIAMLDVLLCLANYSRGGDGPMCRPIIL-LPE  950

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGKST  3099
             +   P L  K   HP + T +     F+ ND+ +G       G +  +L+TGPNMGGKST
Sbjct  951   EHTPPFLALKGSRHPCI-TKTFFGDDFIPNDILIGCEDEEENGKAYCVLVTGPNMGGKST  1009

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             L+RQV L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+
Sbjct  1010  LMRQVGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILT  1069

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V
Sbjct  1070  HATAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAV  1129

Query  3460  SLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+RE
Sbjct  1130  RLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKARE  1189

Query  3634  FE  3639
             FE
Sbjct  1190  FE  1191



>ref|XP_009935608.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Opisthocomus 
hoazin]
Length=1262

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/956 (40%), Positives = 550/956 (58%), Gaps = 61/956 (6%)
 Frame = +1

Query  895   YDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQ  1074
             YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L 
Sbjct  295   YDPCTLYVPEDYLSKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGLI  354

Query  1075  YMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVK  1242
             +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV+
Sbjct  355   FMKGTWAHSGFPETAFGRYSDVLVQKGYKVARVEQTETPEMMETRYKSMAHPTKFDKVVR  414

Query  1243  REICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATSK  1413
             REIC +ITKGT T   +L   P    + YL+ V E   +S    G+R YGVC VD +  K
Sbjct  415   REICRIITKGTQTYS-VLDCDPSENHSKYLLCVKEKEDSS----GQRVYGVCFVDTSVGK  469

Query  1414  VILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEF  1593
               +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+F
Sbjct  470   FYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLIAGSQF  529

Query  1594  WDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-VNAGEN  1770
             W+A KT+  +      L        QN  D          A +++L +    L +  G+N
Sbjct  530   WNASKTLKVL------LEEGYFKEKQNSED-----GCSLPAVIKSLTSESDSLGLTPGDN  578

Query  1771  GTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMV  1914
                ALSALGG +FYLK+  +D  LL  A FE  +P            S F    Q+  MV
Sbjct  579   SELALSALGGCVFYLKKCLIDQELLSLANFEEYVPVDIDSAKTTSSSSFFARTDQR--MV  636

Query  1915  LDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDA  2094
             LD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DA
Sbjct  637   LDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDA  696

Query  2095  VAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYED--AAK  2256
             V  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + YE+   +K
Sbjct  697   VEDLLAV--PHKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEELKYSK  754

Query  2257  KQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQF  2421
             K++  F+SAL G + M      +     +  SK+L  L+T     P    PD+   +K++
Sbjct  755   KKIADFLSALEGFKVMNEVVDVMEEIASDFKSKVLKQLVTRRDRNPDGRFPDLSAELKRW  814

Query  2422  KDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTV  2601
                FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   
Sbjct  815   DTAFDHNQARKTGVITPKAGFDPDYDKALQDIKVVEEDLHKYLDKQRKLLGFKSVLYWGA  874

Query  2602  GKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSI  2778
             GK+ Y +E+PES+    +P+EYEL+S++KGY RYW   I K++  +  AE  R++ LK  
Sbjct  875   GKNRYQMEIPESVVSRNLPEEYELKSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDC  934

Query  2779  LQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLV  2958
             ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP     P L 
Sbjct  935   MRRLFYNFDKNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLE  993

Query  2959  AKSLGHPILRTDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLA  3123
              K+  HP + T +     F+ ND+ +G      +  +S +L+TGPNMGGKSTL+RQ  L 
Sbjct  994   LKNSRHPCI-TKTFFGDDFIPNDIVIGSKDEDSSTEASCVLVTGPNMGGKSTLMRQAGLL  1052

Query  3124  VILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLV  3303
             VI+AQ+G  VPA +  L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV
Sbjct  1053  VIMAQLGCYVPAEACRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLV  1112

Query  3304  ALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACH  3483
              +DELGRGT+T DG AIA +V++    K++CR +FSTHYH L  D+     V L HMAC 
Sbjct  1113  LVDELGRGTATFDGTAIASAVVKELAEKIRCRTLFSTHYHSLVEDHAHSAAVRLGHMACM  1172

Query  3484  IGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             +         E +TFLYK T G CP+SYG N ARLA +P+ V++K   K++EFE +
Sbjct  1173  VENESEDPSQETITFLYKFTQGACPKSYGFNAARLANIPEEVIQKGHRKAKEFEKI  1228



>ref|XP_009935609.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Opisthocomus 
hoazin]
Length=1263

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/956 (40%), Positives = 550/956 (58%), Gaps = 61/956 (6%)
 Frame = +1

Query  895   YDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQ  1074
             YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L 
Sbjct  296   YDPCTLYVPEDYLSKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGLI  355

Query  1075  YMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVK  1242
             +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV+
Sbjct  356   FMKGTWAHSGFPETAFGRYSDVLVQKGYKVARVEQTETPEMMETRYKSMAHPTKFDKVVR  415

Query  1243  REICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATSK  1413
             REIC +ITKGT T   +L   P    + YL+ V E   +S    G+R YGVC VD +  K
Sbjct  416   REICRIITKGTQTYS-VLDCDPSENHSKYLLCVKEKEDSS----GQRVYGVCFVDTSVGK  470

Query  1414  VILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEF  1593
               +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+F
Sbjct  471   FYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLIAGSQF  530

Query  1594  WDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-VNAGEN  1770
             W+A KT+  +      L        QN  D          A +++L +    L +  G+N
Sbjct  531   WNASKTLKVL------LEEGYFKEKQNSED-----GCSLPAVIKSLTSESDSLGLTPGDN  579

Query  1771  GTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMV  1914
                ALSALGG +FYLK+  +D  LL  A FE  +P            S F    Q+  MV
Sbjct  580   SELALSALGGCVFYLKKCLIDQELLSLANFEEYVPVDIDSAKTTSSSSFFARTDQR--MV  637

Query  1915  LDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDA  2094
             LD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DA
Sbjct  638   LDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDA  697

Query  2095  VAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYED--AAK  2256
             V  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + YE+   +K
Sbjct  698   VEDLLAV--PHKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEELKYSK  755

Query  2257  KQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQF  2421
             K++  F+SAL G + M      +     +  SK+L  L+T     P    PD+   +K++
Sbjct  756   KKIADFLSALEGFKVMNEVVDVMEEIASDFKSKVLKQLVTRRDRNPDGRFPDLSAELKRW  815

Query  2422  KDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTV  2601
                FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   
Sbjct  816   DTAFDHNQARKTGVITPKAGFDPDYDKALQDIKVVEEDLHKYLDKQRKLLGFKSVLYWGA  875

Query  2602  GKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSI  2778
             GK+ Y +E+PES+    +P+EYEL+S++KGY RYW   I K++  +  AE  R++ LK  
Sbjct  876   GKNRYQMEIPESVVSRNLPEEYELKSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDC  935

Query  2779  LQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLV  2958
             ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP     P L 
Sbjct  936   MRRLFYNFDKNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLE  994

Query  2959  AKSLGHPILRTDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLA  3123
              K+  HP + T +     F+ ND+ +G      +  +S +L+TGPNMGGKSTL+RQ  L 
Sbjct  995   LKNSRHPCI-TKTFFGDDFIPNDIVIGSKDEDSSTEASCVLVTGPNMGGKSTLMRQAGLL  1053

Query  3124  VILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLV  3303
             VI+AQ+G  VPA +  L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV
Sbjct  1054  VIMAQLGCYVPAEACRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLV  1113

Query  3304  ALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACH  3483
              +DELGRGT+T DG AIA +V++    K++CR +FSTHYH L  D+     V L HMAC 
Sbjct  1114  LVDELGRGTATFDGTAIASAVVKELAEKIRCRTLFSTHYHSLVEDHAHSAAVRLGHMACM  1173

Query  3484  IGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             +         E +TFLYK T G CP+SYG N ARLA +P+ V++K   K++EFE +
Sbjct  1174  VENESEDPSQETITFLYKFTQGACPKSYGFNAARLANIPEEVIQKGHRKAKEFEKI  1229



>ref|XP_010003282.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Chaetura 
pelagica]
Length=1261

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/1047 (39%), Positives = 588/1047 (56%), Gaps = 78/1047 (7%)
 Frame = +1

Query  646   TKAKKIKSGGNNKSTQSKAPTAT---GGVKVIESVTNNLECVKASNGDDILTGNSAERFS  816
             +K  K  S  NN S  SK P         K+I + T        +N     TG     F+
Sbjct  212   SKPAKRSSLENNHSEASKRPVTVSLEAKSKLI-AFTAPESFESQANASSGCTGG----FA  266

Query  817   MREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDK  993
             + E EKL +L  G++    RR   D +YD  TLY+P D+L   + G R+WW+ KS++ D 
Sbjct  267   VWEHEKLDWLQAGKKKDAHRRRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDA  326

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             V+ +K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V  +
Sbjct  327   VICYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARI  386

Query  1174  EQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLIAV  1332
             EQ ETPE +E+R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+ V
Sbjct  387   EQTETPEMMEMRCKAMAHPTKFDKVVRREICRIITKGTQTYS-VLDSDPSENHNKYLLCV  445

Query  1333  TESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKL  1512
              E    S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++     
Sbjct  446   KEKEDFS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGN  501

Query  1513  LSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQNEADL  1686
             LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N     S++   L
Sbjct  502   LSADTQKILKSSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKETQN-----SEDGCSL  556

Query  1687  HP---SESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
              P   S + +ND          S  +  GEN   ALSALGG +FYLK+  +D  LL  A 
Sbjct  557   PPVIKSLTSEND----------SLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLAN  606

Query  1858  FE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             FE  +P            S F    Q+  MVLD   L NLE+ +N  N    GTL  +++
Sbjct  607   FEEYVPVDIATAKTVSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTMEGTLLERID  664

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERL  2178
              C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERL
Sbjct  665   SCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PHKMSEVCEHLKKLPDLERL  722

Query  2179  LAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDN  2343
             L++I +     ++     ++ V YE+   +KK++  F+SAL G + M     ++  +  +
Sbjct  723   LSKIHSIGSPLKSQNHPDSRAVFYEEVKYSKKKIADFLSALEGFKVMNEIVDAMEESAGD  782

Query  2344  TDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD A 
Sbjct  783   FKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKAL  842

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKK  2685
               ++ VE  L  +L +Q+KL G  S+ Y  VGK+ Y +E+PES+    +P+EYEL+SS+K
Sbjct  843   QDIKAVEEDLNNYLAQQRKLLGLKSVLYWGVGKNRYQMEIPESVVSRKLPEEYELKSSRK  902

Query  2686  GYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             GY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+
Sbjct  903   GYKRYWTKEIEKMLAAMINAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLM  962

Query  2866  SLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-  3042
             SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G  
Sbjct  963   SLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSK  1020

Query  3043  ----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
                 +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA
Sbjct  1021  DEDSSTKASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGA  1080

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
              D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K+
Sbjct  1081  SDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKI  1140

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYG  3564
             QCR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG
Sbjct  1141  QCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYG  1200

Query  3565  VNVARLAGLPDNVLEKAAAKSREFEGV  3645
              N ARLA +P+ V++K   K++EFE +
Sbjct  1201  FNAARLANIPEEVIQKGHRKAKEFEKI  1227



>ref|XP_005980707.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Pantholops 
hodgsonii]
Length=1080

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/960 (40%), Positives = 553/960 (58%), Gaps = 68/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYE++ MDA IG  EL L
Sbjct  109   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYEMYHMDALIGVSELGL  168

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETP+ +E R +K +     D+VV
Sbjct  169   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPDMMEARCRKMAHTSKYDRVV  228

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
              REIC VITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  229   MREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEESSGHT--RMYGVCFVDTSLG  285

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             +  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  286   RFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSTETKMILKSSLSSSLQEGLIPGSQ  345

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + + ++ ++ D  +  LP VL  +      
Sbjct  346   FWDAAKTLRTLLE-----------------EGYFTDKLNEDGGVM-LPQVLKGMTSESDS  387

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  388   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYVPLDSDMVHAARPGAVFTK  447

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL +  AI
Sbjct  448   ANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPHAI  507

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  508   NDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  566

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + +      +   +D+  SK+L  +LT     P    PD+  
Sbjct  567   TTYSKKKIIDFLSALEGFKVICKIIGVMEEVIDDFKSKILKQVLTLQTKNPEGRFPDLTS  626

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  627   ELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTI  686

Query  2587  NYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K + +L +AE  R++
Sbjct  687   VYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLADLIKAEERRDA  746

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D 
Sbjct  747   SLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLTNYSRGGDGPMCRPVIL-LPEEDT  805

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTLL  3105
              P L  K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKSTL+
Sbjct  806   PPFLDLKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEEENGKAYCVLVTGPNMGGKSTLM  864

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  I+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  865   RQAGLLAIMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  924

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  925   TAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNIAVRL  984

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  985   GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1044



>ref|XP_004265022.1| PREDICTED: DNA mismatch repair protein Msh6 isoform 2 [Orcinus 
orca]
Length=1230

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/1053 (38%), Positives = 591/1053 (56%), Gaps = 77/1053 (7%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN---KSTQSKAPTATGGVKVIESVTNN----LECVKASNGDDILTG-  795
             V+ K K++ +G  +   KS++ + P+AT     I S T N        + S     ++G 
Sbjct  166   VAPKRKRMITGNGSLKRKSSRKEMPSATKRATGISSETKNTLSAFSAPQNSESQAHVSGG  225

Query  796   -NSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
              + + R ++   E L +L + +R    RR     ++D+ TLY+P DFL   + G R+WW+
Sbjct  226   CDDSSRPTIWYHETLEWLKEEKRRDKHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ  285

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +
Sbjct  286   IKSQNFDLVIFYKVGKFYELYHMDALTGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ  345

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPD--  1311
             KGY+V  VEQ ETPE +E R +K +     D+VV+REIC VITKGT T   +L   P   
Sbjct  346   KGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRVITKGTQTYS-VLEGDPSEN  404

Query  1312  -ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
              + YL+++ E  + S+     R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  405   YSKYLLSLKEKEEDSSGH--ARVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV  462

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYS  1668
             +++     LS ET+ +L     + L   L+P S+FWDA KT+  +               
Sbjct  463   QVLFEKGNLSVETKMILKGSLSSSLQEGLIPGSQFWDAAKTLRTLLE-------------  509

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQA  1824
                 + + ++ ++ D+ +  LP VL  +        +  GE    ALSALGG +FYLK+ 
Sbjct  510   ----EGYFTDKLNEDSGVM-LPQVLKGMTSESDSVGLTPGEKSELALSALGGCVFYLKKC  564

Query  1825  FLDVSLLKFAEFE-LLPFSHFGMIAQKP---------YMVLDAAALENLEIFENSKNCGS  1974
              +D  LL  A FE  +P     + A  P          MVLDA  L NLEIF N  N  +
Sbjct  565   LIDQELLSMANFEEYIPLDSDTVRATGPGAVFAKASQRMVLDAVTLNNLEIFLNGTNGST  624

Query  1975  SGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELS  2154
              GTL  +++ C T FGKRLL+ WL  PL +   I +R DA+  L  V    + E    L 
Sbjct  625   EGTLLDKIDTCYTPFGKRLLKQWLCAPLCNPYVISDRLDAIEDLMVVP-DKISEVVDLLK  683

Query  2155  RLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACF  2319
             +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + +     
Sbjct  684   KLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVLCKIIG  743

Query  2320  SLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGV  2484
              +   +D+  SK+L  +LT     P    PD+ L + ++   FD  +A  +G I P  G 
Sbjct  744   VMEEVIDDFKSKILKQVLTLQAKNPEGRFPDLTLELNRWDTAFDHEKARKTGLITPKAGF  803

Query  2485  DEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQE  2661
             D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+ +   +P+E
Sbjct  804   DSDYDQALADIRENEQSLLEYLEKQRSRIGCRTIVYWGIGRNRYQLEIPENFITRNLPEE  863

Query  2662  YELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELIST  2841
             YEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+  +  
Sbjct  864   YELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQAAVEC  923

Query  2842  IAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVS  3021
             IA LDVL+ L+  S   +GP CRP I  LP +D  P L  K   HP + T +     F+ 
Sbjct  924   IAVLDVLLCLANYSRGGDGPMCRPVIL-LPGEDTPPFLDLKGSRHPCI-TKTFFGDDFIP  981

Query  3022  NDVTLGGA-----GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVD  3186
             ND+ +G       G +  +L+TGPNMGGKSTL+RQ  L V++AQ+G  VPA    L+P+D
Sbjct  982   NDILIGCEEEEENGKAYCVLVTGPNMGGKSTLMRQAGLLVVMAQMGCYVPAEVCRLTPID  1041

Query  3187  RIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESV  3366
             R+F R+GA D IM+G+STF  EL ETAS+L  AT +SLV +DELGRGT+T DG AIA +V
Sbjct  1042  RVFTRLGASDRIMSGESTFFVELSETASILKHATAHSLVLVDELGRGTATFDGTAIANAV  1101

Query  3367  LEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTL  3540
             ++     ++CR +FSTHYH L  DY ++  V L HMAC +         E +TFLYK   
Sbjct  1102  VKELAENIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQETITFLYKFIK  1161

Query  3541  GTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1162  GACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1194



>ref|XP_007111684.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X3 [Physeter 
catodon]
Length=1275

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/1053 (38%), Positives = 592/1053 (56%), Gaps = 77/1053 (7%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN---KSTQSKAPTATGGVKVIESVTNN----LECVKASNGDDILTG-  795
             V+ K K++ +G  +   KS++ + P+AT     I S T N        + S     ++G 
Sbjct  211   VAPKRKRMVTGNGSLKRKSSRKEMPSATKRATGISSETKNTLSAFSAAQNSESQAHISGG  270

Query  796   -NSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
              + + R ++   E L +L + +R    RR     ++D+ TLY+P DFL   + G R+WW+
Sbjct  271   CDDSSRPTIWYHETLEWLKEEKRRDTHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ  330

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   ++ L +
Sbjct  331   IKSQNFDLVIFYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ  390

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPD--  1311
             KGY+V  VEQ ETPE +E R +K +     D+VV+REIC VITKGT T   +L   P   
Sbjct  391   KGYKVARVEQTETPEMMEARCRKMAHISKFDRVVRREICRVITKGTQTYS-VLEGDPSEN  449

Query  1312  -ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
              + YL+++ E    S+     R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  450   YSKYLLSLKEKDDDSSGH--ARVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYSPV  507

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYS  1668
             +++     LS ET+ +L     + L   L+P S+FWDA KT+  +               
Sbjct  508   QVLFEKGNLSVETKMILKGSLSSSLQEGLIPGSQFWDAAKTLRTLLE-------------  554

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQA  1824
                 + + ++ ++ D+ +  LP VL ++        +  GE    ALSALGG +FYLK+ 
Sbjct  555   ----EGYFTDKLNEDSGVM-LPQVLKDMTSESDSVGLTPGEKSELALSALGGCVFYLKKC  609

Query  1825  FLDVSLLKFAEFE-LLPFSHFGMIAQKP---------YMVLDAAALENLEIFENSKNCGS  1974
              +D  LL  A FE  +P     + A +P          MVLDA  L NLEIF N  N  +
Sbjct  610   LIDQELLSMANFEEYIPLDSDTVRATRPGAVFAKANQRMVLDAVTLNNLEIFLNGTNGST  669

Query  1975  SGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELS  2154
              GTL  +++ C T FGKRLL+ WL  PL +   I +R DA+  L  V    + E    L 
Sbjct  670   EGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPYVISDRLDAIEDLMAVP-DKISEVVDLLK  728

Query  2155  RLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACF  2319
             +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + +     
Sbjct  729   KLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKILCKIIG  788

Query  2320  SLGATLDNTDSKLLHDLL-----TPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGV  2484
              +   +D+  SK+L  +L      P    PD+ L + ++   FD  +A  +G I P  G 
Sbjct  789   VMEEVIDDFKSKILKQVLILQTKNPEGRFPDLTLELNRWDTAFDHEKARKTGLITPKAGF  848

Query  2485  DEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQE  2661
             D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+ +   +P+E
Sbjct  849   DSDYDQALADIRENEQSLLEYLEKQRSRIGCRTIVYWGIGRNRYQLEIPENFITRNLPEE  908

Query  2662  YELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELIST  2841
             YEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+  +  
Sbjct  909   YELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQAAVEC  968

Query  2842  IAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVS  3021
             IA LDVL+ L+  S   +GP CRP I  LP +D  P L  K   HP + T +     F+ 
Sbjct  969   IAVLDVLLCLANYSRGGDGPMCRPVIL-LPEEDTPPFLDLKGSRHPCI-TKTFFGDDFIP  1026

Query  3022  NDVTLGGA-----GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVD  3186
             ND+ +G       G +  +L+TGPNMGGKSTL+RQ  L V++AQ+G  VPA    L+ +D
Sbjct  1027  NDILIGCEEEEENGKAYCVLVTGPNMGGKSTLMRQAGLLVVMAQMGCYVPAEVCRLTAID  1086

Query  3187  RIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESV  3366
             R+F R+GA D IM+G+STF  EL ETAS+L+ AT +SLV +DELGRGT+T DG AIA +V
Sbjct  1087  RVFTRLGASDRIMSGESTFFVELSETASILTHATAHSLVLVDELGRGTATFDGTAIANAV  1146

Query  3367  LEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTL  3540
             ++     ++CR +FSTHYH L  DY ++  V L HMAC +         E +TFLYK   
Sbjct  1147  VKELAENIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQETITFLYKFIK  1206

Query  3541  GTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1207  GACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1239



>ref|XP_010003283.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X3 [Chaetura 
pelagica]
Length=1264

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/1047 (39%), Positives = 588/1047 (56%), Gaps = 78/1047 (7%)
 Frame = +1

Query  646   TKAKKIKSGGNNKSTQSKAPTAT---GGVKVIESVTNNLECVKASNGDDILTGNSAERFS  816
             +K  K  S  NN S  SK P         K+I + T        +N     TG     F+
Sbjct  215   SKPAKRSSLENNHSEASKRPVTVSLEAKSKLI-AFTAPESFESQANASSGCTGG----FA  269

Query  817   MREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDK  993
             + E EKL +L  G++    RR   D +YD  TLY+P D+L   + G R+WW+ KS++ D 
Sbjct  270   VWEHEKLDWLQAGKKKDAHRRRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDA  329

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             V+ +K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V  +
Sbjct  330   VICYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARI  389

Query  1174  EQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLIAV  1332
             EQ ETPE +E+R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+ V
Sbjct  390   EQTETPEMMEMRCKAMAHPTKFDKVVRREICRIITKGTQTYS-VLDSDPSENHNKYLLCV  448

Query  1333  TESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKL  1512
              E    S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++     
Sbjct  449   KEKEDFS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGN  504

Query  1513  LSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQNEADL  1686
             LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N     S++   L
Sbjct  505   LSADTQKILKSSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKETQN-----SEDGCSL  559

Query  1687  HP---SESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
              P   S + +ND          S  +  GEN   ALSALGG +FYLK+  +D  LL  A 
Sbjct  560   PPVIKSLTSEND----------SLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLAN  609

Query  1858  FE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             FE  +P            S F    Q+  MVLD   L NLE+ +N  N    GTL  +++
Sbjct  610   FEEYVPVDIATAKTVSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTMEGTLLERID  667

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERL  2178
              C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERL
Sbjct  668   SCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PHKMSEVCEHLKKLPDLERL  725

Query  2179  LAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDN  2343
             L++I +     ++     ++ V YE+   +KK++  F+SAL G + M     ++  +  +
Sbjct  726   LSKIHSIGSPLKSQNHPDSRAVFYEEVKYSKKKIADFLSALEGFKVMNEIVDAMEESAGD  785

Query  2344  TDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD A 
Sbjct  786   FKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKAL  845

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKK  2685
               ++ VE  L  +L +Q+KL G  S+ Y  VGK+ Y +E+PES+    +P+EYEL+SS+K
Sbjct  846   QDIKAVEEDLNNYLAQQRKLLGLKSVLYWGVGKNRYQMEIPESVVSRKLPEEYELKSSRK  905

Query  2686  GYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             GY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+
Sbjct  906   GYKRYWTKEIEKMLAAMINAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLM  965

Query  2866  SLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-  3042
             SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G  
Sbjct  966   SLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSK  1023

Query  3043  ----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
                 +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA
Sbjct  1024  DEDSSTKASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGA  1083

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
              D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K+
Sbjct  1084  SDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKI  1143

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYG  3564
             QCR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG
Sbjct  1144  QCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYG  1203

Query  3565  VNVARLAGLPDNVLEKAAAKSREFEGV  3645
              N ARLA +P+ V++K   K++EFE +
Sbjct  1204  FNAARLANIPEEVIQKGHRKAKEFEKI  1230



>ref|XP_009805637.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Gavia 
stellata]
Length=1262

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/985 (40%), Positives = 570/985 (58%), Gaps = 66/985 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  +RDA RRR  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  266   FAVWEHEKLDWLQEGKKRDAHRRRQSDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  325

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  326   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  385

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  386   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  444

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  445   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  500

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQNEA  1680
               LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N     S+N  
Sbjct  501   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKEKQN-----SENGC  555

Query  1681  DLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
              L PS        +R+L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A 
Sbjct  556   SL-PS-------VIRSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLAN  607

Query  1858  FE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++
Sbjct  608   FEEYVPVDIDTAKTTSSGSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERID  665

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERL  2178
              C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERL
Sbjct  666   SCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERL  723

Query  2179  LAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDN  2343
             L++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     +
Sbjct  724   LSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVMEEIASD  783

Query  2344  TDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD A 
Sbjct  784   FKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKAL  843

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKK  2685
               ++ VE  L ++L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+S++K
Sbjct  844   QDIKAVEQDLHEYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELKSTRK  903

Query  2686  GYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             GY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+
Sbjct  904   GYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLM  963

Query  2866  SLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-  3042
             SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G  
Sbjct  964   SLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSK  1021

Query  3043  ----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
                    +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA
Sbjct  1022  DEDSGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCSLTPIDRVFTRLGA  1081

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
              D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K+
Sbjct  1082  SDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKI  1141

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYG  3564
             +CR +FSTHYH L  DY     V L HMAC +         E +TFLYK   G CP+SYG
Sbjct  1142  KCRTLFSTHYHSLVEDYAHSAAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYG  1201

Query  3565  VNVARLAGLPDNVLEKAAAKSREFE  3639
              N ARLA +P+ V++K   K++EFE
Sbjct  1202  FNAARLANIPEEVIQKGHRKAKEFE  1226



>ref|XP_009805636.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Gavia 
stellata]
Length=1263

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/985 (40%), Positives = 570/985 (58%), Gaps = 66/985 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  +RDA RRR  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  267   FAVWEHEKLDWLQEGKKRDAHRRRQSDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  326

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  327   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  386

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  387   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  445

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  446   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  501

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQNEA  1680
               LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N     S+N  
Sbjct  502   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKEKQN-----SENGC  556

Query  1681  DLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
              L PS        +R+L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A 
Sbjct  557   SL-PS-------VIRSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLAN  608

Query  1858  FE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++
Sbjct  609   FEEYVPVDIDTAKTTSSGSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERID  666

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERL  2178
              C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERL
Sbjct  667   SCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERL  724

Query  2179  LAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDN  2343
             L++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     +
Sbjct  725   LSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVMEEIASD  784

Query  2344  TDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD A 
Sbjct  785   FKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKAL  844

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKK  2685
               ++ VE  L ++L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+S++K
Sbjct  845   QDIKAVEQDLHEYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELKSTRK  904

Query  2686  GYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             GY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+
Sbjct  905   GYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLM  964

Query  2866  SLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-  3042
             SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G  
Sbjct  965   SLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSK  1022

Query  3043  ----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
                    +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA
Sbjct  1023  DEDSGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCSLTPIDRVFTRLGA  1082

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
              D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K+
Sbjct  1083  SDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKI  1142

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYG  3564
             +CR +FSTHYH L  DY     V L HMAC +         E +TFLYK   G CP+SYG
Sbjct  1143  KCRTLFSTHYHSLVEDYAHSAAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYG  1202

Query  3565  VNVARLAGLPDNVLEKAAAKSREFE  3639
              N ARLA +P+ V++K   K++EFE
Sbjct  1203  FNAARLANIPEEVIQKGHRKAKEFE  1227



>ref|XP_009869985.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Apaloderma 
vittatum]
Length=1198

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/960 (40%), Positives = 547/960 (57%), Gaps = 73/960 (8%)
 Frame = +1

Query  895   YDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQ  1074
             YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL  MDA IG  EL L 
Sbjct  231   YDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELCHMDAVIGVNELGLV  290

Query  1075  YMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVK  1242
             +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV+
Sbjct  291   FMKGTWAHSGFPEIAFGRFSDVLVQKGYKVARVEQTETPEMMETRYKSMAHPTKFDKVVR  350

Query  1243  REICAVITKGTLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATSK  1413
             REIC +ITKGT T   +L   P  +   YL++V E   +S    G R YGVC VD +  K
Sbjct  351   REICRIITKGTQTYS-ILDCDPSENHNKYLLSVKEKEDSS----GHRVYGVCFVDTSVGK  405

Query  1414  VILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEF  1593
               +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+F
Sbjct  406   FYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQF  465

Query  1594  WDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-------  1752
             W+A KT+  +                 E      ++ +N     +LP+V+  L       
Sbjct  466   WNASKTLKVL---------------LEEGYFKEKQTSENGC---SLPSVIKSLTSESDSL  507

Query  1753  -VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMI  1893
              +  GEN   ALSALG  +FYLK+  +D  LL  A FE  +P            S F   
Sbjct  508   GLTPGENSELALSALGACVFYLKKCLIDQELLSLANFEEYVPVDIDAAKTTSSGSFFAKT  567

Query  1894  AQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEA  2073
              Q+  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++
Sbjct  568   DQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKS  625

Query  2074  IKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYE  2244
             I +R DAV  L  V      E  + L +LPD+ERLL++I +     ++     ++ + YE
Sbjct  626   INDRLDAVEDLLAVP-DKTSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYE  684

Query  2245  DA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVK  2403
             +   +KK++  F+SAL G + M     ++     +  S++L  L+T     P    PD+ 
Sbjct  685   EIKYSKKKIADFLSALEGFKVMNEIIDAMEEVASDFKSRVLKQLVTRKAKNPDGRFPDLS  744

Query  2404  LVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTS  2583
               ++++   FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S
Sbjct  745   AELRRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKS  804

Query  2584  INYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERE  2760
             + Y   GK+ Y +E+PESL    +P+EYEL+SS+KGY RYW   I K++  +  AE  R+
Sbjct  805   VLYWGAGKNRYQMEIPESLISRNLPEEYELKSSRKGYKRYWTKEIEKMLAAMVNAEERRD  864

Query  2761  SKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQD  2940
             + LK  ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP   
Sbjct  865   AALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDS  923

Query  2941  NVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLL  3105
               P L  K+  HP + T +     F+ ND+ +G      +  +S +L+TGPNMGGKSTL+
Sbjct  924   APPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSRDEESSSEASCVLVTGPNMGGKSTLM  982

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  A
Sbjct  983   RQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHA  1042

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++    K++CR +FSTHYH L  DY  +  V L
Sbjct  1043  TEHSLVLVDELGRGTATFDGTAIASAVVKELAEKIKCRTLFSTHYHSLVEDYSRNVAVRL  1102

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1103  GHMACMVENESEDPSQETITFLYKFISGACPKSYGFNAARLANIPEEVIQKGHRKAKEFE  1162



>ref|XP_010003281.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Chaetura 
pelagica]
Length=1265

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/1050 (39%), Positives = 584/1050 (56%), Gaps = 84/1050 (8%)
 Frame = +1

Query  646   TKAKKIKSGGNNKSTQSKAPTAT---GGVKVIESVTNNLECVKASNGDDILTGNSAERFS  816
             +K  K  S  NN S  SK P         K+I + T        +N     TG     F+
Sbjct  216   SKPAKRSSLENNHSEASKRPVTVSLEAKSKLI-AFTAPESFESQANASSGCTGG----FA  270

Query  817   MREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDK  993
             + E EKL +L  G++    RR   D +YD  TLY+P D+L   + G R+WW+ KS++ D 
Sbjct  271   VWEHEKLDWLQAGKKKDAHRRRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDA  330

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             V+ +K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V  +
Sbjct  331   VICYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARI  390

Query  1174  EQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLIAV  1332
             EQ ETPE +E+R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+ V
Sbjct  391   EQTETPEMMEMRCKAMAHPTKFDKVVRREICRIITKGTQTYS-VLDSDPSENHNKYLLCV  449

Query  1333  TESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKL  1512
              E    S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++     
Sbjct  450   KEKEDFS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGN  505

Query  1513  LSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHP  1692
             LS +T+++L     + +   L+  S+FW+A KT+  +      L       +QN  D   
Sbjct  506   LSADTQKILKSSLVSCIQEGLISGSQFWNASKTLKVL------LEEGYFKETQNSEDGC-  558

Query  1693  SESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSLLK  1848
                        +LP V+  L        +  GEN   ALSALGG +FYLK+  +D  LL 
Sbjct  559   -----------SLPPVIKSLTSENDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLS  607

Query  1849  FAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYA  1992
              A FE  +P            S F    Q+  MVLD   L NLE+ +N  N    GTL  
Sbjct  608   LANFEEYVPVDIATAKTVSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTMEGTLLE  665

Query  1993  QMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDM  2169
             +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+
Sbjct  666   RIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PHKMSEVCEHLKKLPDL  723

Query  2170  ERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGAT  2334
             ERLL++I +     ++     ++ V YE+   +KK++  F+SAL G + M     ++  +
Sbjct  724   ERLLSKIHSIGSPLKSQNHPDSRAVFYEEVKYSKKKIADFLSALEGFKVMNEIVDAMEES  783

Query  2335  LDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYD  2499
               +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD
Sbjct  784   AGDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYD  843

Query  2500  AACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQS  2676
              A   ++ VE  L  +L +Q+KL G  S+ Y  VGK+ Y +E+PES+    +P+EYEL+S
Sbjct  844   KALQDIKAVEEDLNNYLAQQRKLLGLKSVLYWGVGKNRYQMEIPESVVSRKLPEEYELKS  903

Query  2677  SKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELD  2856
             S+KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LD
Sbjct  904   SRKGYKRYWTKEIEKMLAAMINAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLD  963

Query  2857  VLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTL  3036
             VL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +
Sbjct  964   VLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVI  1021

Query  3037  GG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVR  3201
             G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R
Sbjct  1022  GSKDEDSSTKASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTR  1081

Query  3202  MGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFV  3381
             +GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++   
Sbjct  1082  LGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELA  1141

Query  3382  HKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPR  3555
              K+QCR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+
Sbjct  1142  EKIQCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGACPK  1201

Query  3556  SYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             SYG N ARLA +P+ V++K   K++EFE +
Sbjct  1202  SYGFNAARLANIPEEVIQKGHRKAKEFEKI  1231



>ref|XP_010614100.1| PREDICTED: DNA mismatch repair protein Msh6 [Fukomys damarensis]
 gb|KFO18454.1| DNA mismatch repair protein Msh6 [Fukomys damarensis]
Length=1258

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/964 (40%), Positives = 551/964 (57%), Gaps = 79/964 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  290   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  349

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     DKVV
Sbjct  350   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDKVV  409

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  410   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RLYGVCFVDTSLG  466

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  467   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSVETKTILKGTLSSSLQEGLIPGSQ  526

Query  1591  FWDAEKTIS---EVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL---  1752
             FWDA KT+    E     +++N+  +                       LP VL  +   
Sbjct  527   FWDANKTLRTLLEEGYFTEKVNDIGV----------------------MLPRVLKGMTSE  564

Query  1753  -----VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP---  1905
                  +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     M++ +P   
Sbjct  565   SDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDS-DMVSTRPGAI  623

Query  1906  ------YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHL  2067
                    MVLDA  L NLEIF N  N  + GTL+ +++ C T FGKRLL+ WL  PL   
Sbjct  624   FTKASQRMVLDAVTLNNLEIFLNGTNGSTDGTLFERIDTCHTPFGKRLLKQWLCAPLCSP  683

Query  2068  EAIKERQDAVAGLKGVNLPG-VLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVV  2235
              AI +R DAV  L  +++P  + E    L +LPD+ERLL++I    +  ++     ++ +
Sbjct  684   FAISDRLDAVEDL--MDVPDKISEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAI  741

Query  2236  LYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLP  2394
             +YE+   +KK++  F+SAL G + M      +   +D   SK+L  ++T     P    P
Sbjct  742   MYEETTYSKKKIIDFLSALEGFKVMCKIIEIMEEVVDEFKSKILKQVVTFQTKNPEGRFP  801

Query  2395  DVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFG  2574
             D+   + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L +Q+   G
Sbjct  802   DLTTELNRWDTAFDHEKARRTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRIG  861

Query  2575  DTSINYVTVGKDAYLLEVPESLC-ELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAET  2751
               +I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K +  L  AE 
Sbjct  862   CRTIVYWGIGRNRYQLEIPENFTTHNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEE  921

Query  2752  ERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELP  2931
              R+  LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP
Sbjct  922   RRDVSLKDCMRRLFYNFDKNYKDWQCAVDCIAVLDVLLCLANYSQGGDGPMCRPVIL-LP  980

Query  2932  SQDNVPCLVAKSLGHP-ILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGK  3093
              +DN P L  K   HP I++T   D   F+ ND+ +G       G +  +L+TGPNMGGK
Sbjct  981   GEDNPPFLELKGSRHPCIMKTFFGDD--FIPNDILIGCEEQEENGKAYCVLVTGPNMGGK  1038

Query  3094  STLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASM  3273
             STL+RQ  L  ++AQ+G  VPA    L+PVDR+F R+GA D IM+G+STF  EL ETAS+
Sbjct  1039  STLIRQAGLLAVMAQMGCYVPAEVCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASI  1098

Query  3274  LSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDR  3453
             L  AT +SLV +DELGRGT+T DG AIA +V+      ++CR +FSTHYH L  DY ++ 
Sbjct  1099  LRHATAHSLVLVDELGRGTATFDGTAIANAVVRELAETIRCRTLFSTHYHSLVEDYSKNV  1158

Query  3454  QVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKS  3627
              V L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+
Sbjct  1159  AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKA  1218

Query  3628  REFE  3639
             REFE
Sbjct  1219  REFE  1222



>gb|KFU95180.1| DNA mismatch repair protein Msh6, partial [Chaetura pelagica]
Length=1274

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/1047 (39%), Positives = 588/1047 (56%), Gaps = 78/1047 (7%)
 Frame = +1

Query  646   TKAKKIKSGGNNKSTQSKAPTAT---GGVKVIESVTNNLECVKASNGDDILTGNSAERFS  816
             +K  K  S  NN S  SK P         K+I + T        +N     TG     F+
Sbjct  225   SKPAKRSSLENNHSEASKRPVTVSLEAKSKLI-AFTAPESFESQANASSGCTGG----FA  279

Query  817   MREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDK  993
             + E EKL +L  G++    RR   D +YD  TLY+P D+L   + G R+WW+ KS++ D 
Sbjct  280   VWEHEKLDWLQAGKKKDAHRRRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDA  339

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             V+ +K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V  +
Sbjct  340   VICYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARI  399

Query  1174  EQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLIAV  1332
             EQ ETPE +E+R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+ V
Sbjct  400   EQTETPEMMEMRCKAMAHPTKFDKVVRREICRIITKGTQTYS-VLDSDPSENHNKYLLCV  458

Query  1333  TESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKL  1512
              E    S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++     
Sbjct  459   KEKEDFS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGN  514

Query  1513  LSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQNEADL  1686
             LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N     S++   L
Sbjct  515   LSADTQKILKSSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKETQN-----SEDGCSL  569

Query  1687  HP---SESIDNDAQLRNLPNVLSELVNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
              P   S + +ND          S  +  GEN   ALSALGG +FYLK+  +D  LL  A 
Sbjct  570   PPVIKSLTSEND----------SLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLAN  619

Query  1858  FE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             FE  +P            S F    Q+  MVLD   L NLE+ +N  N    GTL  +++
Sbjct  620   FEEYVPVDIATAKTVSSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTMEGTLLERID  677

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERL  2178
              C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERL
Sbjct  678   SCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PHKMSEVCEHLKKLPDLERL  735

Query  2179  LAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDN  2343
             L++I +     ++     ++ V YE+   +KK++  F+SAL G + M     ++  +  +
Sbjct  736   LSKIHSIGSPLKSQNHPDSRAVFYEEVKYSKKKIADFLSALEGFKVMNEIVDAMEESAGD  795

Query  2344  TDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD A 
Sbjct  796   FKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKAL  855

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKK  2685
               ++ VE  L  +L +Q+KL G  S+ Y  VGK+ Y +E+PES+    +P+EYEL+SS+K
Sbjct  856   QDIKAVEEDLNNYLAQQRKLLGLKSVLYWGVGKNRYQMEIPESVVSRKLPEEYELKSSRK  915

Query  2686  GYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             GY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+
Sbjct  916   GYKRYWTKEIEKMLAAMINAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLM  975

Query  2866  SLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-  3042
             SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G  
Sbjct  976   SLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSK  1033

Query  3043  ----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
                 +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA
Sbjct  1034  DEDSSTKASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGA  1093

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
              D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K+
Sbjct  1094  SDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKI  1153

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYG  3564
             QCR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP+SYG
Sbjct  1154  QCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYG  1213

Query  3565  VNVARLAGLPDNVLEKAAAKSREFEGV  3645
              N ARLA +P+ V++K   K++EFE +
Sbjct  1214  FNAARLANIPEEVIQKGHRKAKEFEKI  1240



>gb|KFQ48090.1| DNA mismatch repair protein Msh6, partial [Pelecanus crispus]
Length=1276

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/992 (40%), Positives = 568/992 (57%), Gaps = 76/992 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  ++DA R+R  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  280   FAVWEHEKLDWLQEGKKKDAHRKRQDDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  339

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  340   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  399

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  400   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  458

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  459   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  514

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  515   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  559

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  560   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  616

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  617   LSLANFEEYVPVDIDTAKTMSLSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  674

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  675   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  732

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  733   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  792

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  793   EIASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  852

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  853   YDKALQDIKTVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYEL  912

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  913   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  972

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  973   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1030

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G         +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1031  MIGSKDEDSGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1090

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1091  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1150

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1151  LAEKIKCRTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1210

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             P+SYG N ARLA +P+ V++K   K++EFE +
Sbjct  1211  PKSYGFNAARLANIPEEVIQKGHRKAKEFEKI  1242



>emb|CCI45044.1| unnamed protein product [Albugo candida]
Length=1193

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/953 (40%), Positives = 555/953 (58%), Gaps = 71/953 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +YD RTLY+P +FLK  +    QWWE KS++MD +LFFK+GKFYELF MDA IG KEL+L
Sbjct  226   DYDPRTLYVPPNFLKKETPAMIQWWEVKSRNMDTILFFKVGKFYELFHMDADIGFKELNL  285

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKG-SKDKVVKRE  1248
              YMKGE+ H GFPE  +   A +L RKGYRV  VEQ ETPE +++R      K KVV+RE
Sbjct  286   IYMKGEKAHSGFPEIAYDKMASQLVRKGYRVARVEQTETPEMMKVRNASSKQKSKVVRRE  345

Query  1249  ICAVITKGTLTEGEMLTVSPD--ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVIL  1422
             IC++++ G  T G    +S D   + ++ + E      + L  R YGVCV+D +T+   L
Sbjct  346   ICSMVSPGLNTFG---CISSDDYCAKMLVLKEKQIKQGSTLIPR-YGVCVLDTSTACFQL  401

Query  1423  GQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDA  1602
             G+F D      L +LL ++R VE+I     ++  T++ +     + +V EL   SEFW A
Sbjct  402   GEFDDTVQRDRLKTLLAQYRIVELICERSEMTKATKQTIKFGAPDAVVTELKSGSEFWSA  461

Query  1603  EKTISEVK-NMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNAGENGTY  1779
              KT+ E++   Y +++  P   +Q       SE++  D                  +G  
Sbjct  462   SKTVQEIQIAQYFKISGWPASIAQ----YLTSENVVRD------------------DGEL  499

Query  1780  ALSALGGTLFYLKQAFLDVSLLKFAEF--------ELLPFSHFGM-------IAQKPYMV  1914
             ALSALGG ++ L++  +D  LL    F        E    SH          I Q+ Y+V
Sbjct  500   ALSALGGCIWQLRRGIVDKELLTMNNFKTYIPSDQETRDTSHDPTKQVATPEINQR-YVV  558

Query  1915  LDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDA  2094
             LDA  L NLEI  N++N   +G+L   ++  VT+FGKRL + W+ +PL  +  I +R DA
Sbjct  559   LDAQTLSNLEILRNNRNGKRNGSLIDILDKTVTSFGKRLFQEWVVKPLCQVAHISDRLDA  618

Query  2095  VAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYEDAAK--K  2259
             V  L   N+  V E R  L +LPD+ER+L +I    ++  A     ++ V+YE      +
Sbjct  619   VEELIA-NMETVNEIRDCLKKLPDLERVLFRIHTLGSADRARDHPDSRAVMYESNTYNIR  677

Query  2260  QLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLTPGKG----------LPDVKLV  2409
             +++ F++AL G E+ +N   ++       +S LL   +                PD++  
Sbjct  678   KIRDFVAALNGFESAMNLINAITPKFAQFESSLLRTFVRRSNSDGGNEQSVSQFPDLRKR  737

Query  2410  IKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSIN  2589
             ++ FK  FD   A  SG IIP  G+D EYDAAC  +++VE SL ++L+EQ+++     I+
Sbjct  738   LEFFKVSFDRESAQKSGVIIPETGIDPEYDAACMDIQRVEKSLEEYLEEQKQILRCQQIS  797

Query  2590  YVTVGKD-AYLLEVPE-SLCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
             Y    KD  Y LE+PE ++    P+EYEL+S +KG+ RY  P IRKL+ +L   E +RE 
Sbjct  798   YWGKKKDDRYQLEIPEEAIASKQPKEYELKSRRKGFKRYHTPEIRKLLSKLICTEEKREE  857

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++R+  +F E+++ W + +  +A LD   SL++ S + E   CRP +    S + 
Sbjct  858   ALKDQMRRIFHKFDENYTEWLQAVRYLAVLDCYQSLAVVSAHSEN-YCRPLVVSAKSNNG  916

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGAGHSSFILLTGPNMGGKSTLLRQVCLA  3123
             +P +  +   H  +  +      F+ ND TLG   + + +LL+GPNMGGKSTLLRQ CL 
Sbjct  917   IPFIDFEGGVHATMAGNE----HFIPNDTTLGLDENGTLMLLSGPNMGGKSTLLRQTCLI  972

Query  3124  VILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLV  3303
              ++AQ+G  VPA    +SPVDRIF R+GA D+++AGQST   EL ETA++L+ +T++SLV
Sbjct  973   ALMAQIGCYVPATRCRMSPVDRIFTRIGATDNLLAGQSTLFVELAETATILNHSTQHSLV  1032

Query  3304  ALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACH  3483
              LDELGRGTST DG AIA SV+E+ + +V CR MF+THYH L  +YQ D +V+L HMAC 
Sbjct  1033  ILDELGRGTSTFDGTAIASSVVEYLLRRVGCRAMFATHYHSLVEEYQNDPKVALSHMACM  1092

Query  3484  IGEGLGGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFEG  3642
             +        +VTFLYKL+ G CPRSYG NVA LA LPD V++ A AKSR+FE 
Sbjct  1093  VDSEQE--HKVTFLYKLSAGMCPRSYGTNVAILAQLPDQVIQCAIAKSRQFES  1143



>ref|XP_009869984.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Apaloderma 
vittatum]
Length=1199

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/960 (40%), Positives = 547/960 (57%), Gaps = 73/960 (8%)
 Frame = +1

Query  895   YDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQ  1074
             YD  TLY+P D+L   + G R+WW+ KS++ D V+F+K+GKFYEL  MDA IG  EL L 
Sbjct  232   YDPCTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELCHMDAVIGVNELGLV  291

Query  1075  YMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVK  1242
             +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV+
Sbjct  292   FMKGTWAHSGFPEIAFGRFSDVLVQKGYKVARVEQTETPEMMETRYKSMAHPTKFDKVVR  351

Query  1243  REICAVITKGTLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVATSK  1413
             REIC +ITKGT T   +L   P  +   YL++V E   +S    G R YGVC VD +  K
Sbjct  352   REICRIITKGTQTYS-ILDCDPSENHNKYLLSVKEKEDSS----GHRVYGVCFVDTSVGK  406

Query  1414  VILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEF  1593
               +GQF+DD  CS   +L+  + PV+++     LS +T+++L     + +   L+  S+F
Sbjct  407   FYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQF  466

Query  1594  WDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-------  1752
             W+A KT+  +                 E      ++ +N     +LP+V+  L       
Sbjct  467   WNASKTLKVL---------------LEEGYFKEKQTSENGC---SLPSVIKSLTSESDSL  508

Query  1753  -VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMI  1893
              +  GEN   ALSALG  +FYLK+  +D  LL  A FE  +P            S F   
Sbjct  509   GLTPGENSELALSALGACVFYLKKCLIDQELLSLANFEEYVPVDIDAAKTTSSGSFFAKT  568

Query  1894  AQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEA  2073
              Q+  MVLD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++
Sbjct  569   DQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKS  626

Query  2074  IKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYE  2244
             I +R DAV  L  V      E  + L +LPD+ERLL++I +     ++     ++ + YE
Sbjct  627   INDRLDAVEDLLAVP-DKTSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYE  685

Query  2245  DA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVK  2403
             +   +KK++  F+SAL G + M     ++     +  S++L  L+T     P    PD+ 
Sbjct  686   EIKYSKKKIADFLSALEGFKVMNEIIDAMEEVASDFKSRVLKQLVTRKAKNPDGRFPDLS  745

Query  2404  LVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTS  2583
               ++++   FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S
Sbjct  746   AELRRWDTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKS  805

Query  2584  INYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERE  2760
             + Y   GK+ Y +E+PESL    +P+EYEL+SS+KGY RYW   I K++  +  AE  R+
Sbjct  806   VLYWGAGKNRYQMEIPESLISRNLPEEYELKSSRKGYKRYWTKEIEKMLAAMVNAEERRD  865

Query  2761  SKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQD  2940
             + LK  ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP   
Sbjct  866   AALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDS  924

Query  2941  NVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLL  3105
               P L  K+  HP + T +     F+ ND+ +G      +  +S +L+TGPNMGGKSTL+
Sbjct  925   APPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSRDEESSSEASCVLVTGPNMGGKSTLM  983

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  A
Sbjct  984   RQAGLLVIMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHA  1043

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++    K++CR +FSTHYH L  DY  +  V L
Sbjct  1044  TEHSLVLVDELGRGTATFDGTAIASAVVKELAEKIKCRTLFSTHYHSLVEDYSRNVAVRL  1103

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1104  GHMACMVENESEDPSQETITFLYKFISGACPKSYGFNAARLANIPEEVIQKGHRKAKEFE  1163



>ref|XP_005324540.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X4 [Ictidomys 
tridecemlineatus]
Length=1126

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/1056 (38%), Positives = 592/1056 (56%), Gaps = 83/1056 (8%)
 Frame = +1

Query  640   VSTKAKKIKSGGN---NKSTQSKAPTATG-GVKVIESVTNNLECVKASNGDDILT-----  792
             V+ K K++ +G +    KS++ + P+ T     ++    N L    A    D        
Sbjct  62    VAPKRKRMVTGSSAFKRKSSRKEMPSTTKRAAGILSETKNTLSAFSAPQNSDSQAHVSGG  121

Query  793   GNSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
             G+++ R +    E L +L K +R  + RR     ++D+ TLY+P DFL   + G R+WW+
Sbjct  122   GDNSSRPTTWYHETLEWLKKEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ  181

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   ++ L +
Sbjct  182   IKSQNFDLVIFYKVGKFYELYHMDALIGVNELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ  241

Query  1150  KGYRVLVVEQIETPEQLELRRKK----GSKDKVVKREICAVITKGTLTEGEMLTVSPD--  1311
             KGY+V  VEQ ETPE +E R +K       D+VVKREIC +ITKGT T   +L   P   
Sbjct  242   KGYKVARVEQTETPEMMEARCRKMAHISKHDRVVKREICRIITKGTQTYS-VLEGDPSEN  300

Query  1312  -ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
              + YL+++ E  + S+     R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  301   YSKYLLSLKEKEEDSSGHT--RMYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV  358

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYS  1668
             +++     LS ET+ +L     + L   L P S+FWDA KT+  +               
Sbjct  359   QVLFEKGNLSVETKTILKSSLSSSLQEGLTPGSQFWDAAKTLRTLLE-------------  405

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQA  1824
                 + + +E ++ D+ +  LP VL ++        +  GE    ALSALGG +FYLK+ 
Sbjct  406   ----EGYFTEKLNEDSGVM-LPQVLKDMTSESDSIGLTPGEKSELALSALGGCVFYLKKC  460

Query  1825  FLDVSLLKFAEFE-LLPF----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCG  1971
              +D  LL  A FE  +P           + F    Q+  MVLDA  L NLEIF N  N  
Sbjct  461   LIDQELLSMANFEEYIPLDSDMVNTRSGAKFTKANQR--MVLDAVTLNNLEIFVNGTNGS  518

Query  1972  SSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPG-VLEFRKE  2148
             + GTL  +++ C T FGKRLL+ WL  PL    AI +R +A+  L  + +P  + E  + 
Sbjct  519   TEGTLLERIDTCHTIFGKRLLKQWLCAPLCSPFAINDRLNAIEDL--IVVPDKISEVTEL  576

Query  2149  LSRLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNA  2313
             L +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + M   
Sbjct  577   LKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKI  636

Query  2314  CFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCE  2478
                +   +D+  SK+L  ++T     P    PD+   + ++   FD  +A  +G I P  
Sbjct  637   IGIMEEVVDDFKSKILKQVVTLQTKNPEGCFPDLTSELNRWDTAFDHEKARKTGLITPKA  696

Query  2479  GVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLC-ELVP  2655
             G D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+     +P
Sbjct  697   GFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTHNLP  756

Query  2656  QEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELI  2835
             +EYEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+  +
Sbjct  757   EEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDISLKDCMRRLFYNFDKNYKDWQSAV  816

Query  2836  STIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAF  3015
               IA LDVLI L+  S   +GP CRP I  LP +D +P L  K   HP + T +     F
Sbjct  817   ECIAVLDVLICLANYSQGGDGPMCRPVIL-LPGEDTLPFLELKGSRHPCI-TKTFFGDDF  874

Query  3016  VSNDVTLGGA------GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLS  3177
             + ND+ +G        G +  +L+TGPNMGGKSTL+RQ  L  ++AQ+G  VPA    L+
Sbjct  875   IPNDILIGCEEEEKENGKAYCVLVTGPNMGGKSTLIRQAGLLAVMAQMGCYVPAEVCRLT  934

Query  3178  PVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIA  3357
             PVDR+F R+GA D IM+G+STF  EL ETAS+L+ AT +SLV +DELGRGT+T DG AIA
Sbjct  935   PVDRVFTRLGASDRIMSGESTFFVELSETASILTHATAHSLVLMDELGRGTATFDGTAIA  994

Query  3358  ESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYK  3531
              +V++     ++CR +FSTHYH L  +Y ++  V L HMAC +         E +TFLYK
Sbjct  995   NAVVKELAETIKCRTLFSTHYHSLVEEYSKNVAVRLGHMACMVENECEDPSQETITFLYK  1054

Query  3532  LTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
                G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1055  FIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1090



>ref|XP_004436727.1| PREDICTED: DNA mismatch repair protein Msh6 isoform 2 [Ceratotherium 
simum simum]
Length=1226

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/961 (39%), Positives = 552/961 (57%), Gaps = 70/961 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  255   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  314

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K       D+VV
Sbjct  315   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKHDRVV  374

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC VITKGT T   +L   P    + YL+++ E  + S+     R YG+C VD +  
Sbjct  375   RREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RVYGICFVDASLG  431

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  432   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSTETKMILKGSLSSSLQEGLIPGSQ  491

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + + +E ++ D+ +  LP VL  +      
Sbjct  492   FWDAAKTLRTLLE-----------------EGYFTEKLNEDSGVM-LPQVLKGMTSESDS  533

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE   P     + A +P      
Sbjct  534   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYTPLDSDMVSAARPGAVFAK  593

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  594   ANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCSPYAI  653

Query  2077  KERQDAVAGLKGVNLPG-VLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYE  2244
              +R DA+  L  +++P  + E    L +LPD+ERLL++I    +  ++     ++ ++YE
Sbjct  654   NDRLDAIEDL--MDVPDKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYE  711

Query  2245  DA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVK  2403
             +   +KK++  F+SAL G + +      +   +D+  SK+L  ++T     P    PD+ 
Sbjct  712   ETTYSKKKIIDFLSALEGFKAICKIIEIMEEVVDDFKSKILKQVITLQTKNPEGRFPDLT  771

Query  2404  LVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTS  2583
             + + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +
Sbjct  772   VELNRWDTAFDHEKARRTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRT  831

Query  2584  INYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERE  2760
             I Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K +  L  AE  R+
Sbjct  832   IVYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRD  891

Query  2761  SKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQD  2940
               LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D
Sbjct  892   VSLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLANYSRGGDGPMCRPVIL-LPEED  950

Query  2941  NVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTL  3102
               P    K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKSTL
Sbjct  951   TPPFFYLKGSRHPCI-TKTFFGDDFIPNDILIGCEEEKEENGKAYCVLVTGPNMGGKSTL  1009

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             +RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ 
Sbjct  1010  MRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTH  1069

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V 
Sbjct  1070  ATAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVR  1129

Query  3463  LCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             L HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K+REF
Sbjct  1130  LGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANIPEEVIQKGHRKAREF  1189

Query  3637  E  3639
             E
Sbjct  1190  E  1190



>gb|KFV49979.1| DNA mismatch repair protein Msh6, partial [Gavia stellata]
Length=1276

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/985 (40%), Positives = 570/985 (58%), Gaps = 66/985 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  +RDA RRR  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  280   FAVWEHEKLDWLQEGKKRDAHRRRQSDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  339

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  340   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  399

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  400   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  458

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  459   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  514

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQNEA  1680
               LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++   N     S+N  
Sbjct  515   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKEKQN-----SENGC  569

Query  1681  DLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAE  1857
              L PS        +R+L +    L +  GEN   ALSALGG +FYLK+  +D  LL  A 
Sbjct  570   SL-PS-------VIRSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQELLSLAN  621

Query  1858  FE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMN  2001
             FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL  +++
Sbjct  622   FEEYVPVDIDTAKTTSSGSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERID  679

Query  2002  HCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMERL  2178
              C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LPD+ERL
Sbjct  680   SCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLPDLERL  737

Query  2179  LAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDN  2343
             L++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +     +
Sbjct  738   LSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVMEEIASD  797

Query  2344  TDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAAC  2508
               SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +YD A 
Sbjct  798   FKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKAL  857

Query  2509  GSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKK  2685
               ++ VE  L ++L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+S++K
Sbjct  858   QDIKAVEQDLHEYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELKSTRK  917

Query  2686  GYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLI  2865
             GY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL+
Sbjct  918   GYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVLDVLM  977

Query  2866  SLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGG-  3042
             SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G  
Sbjct  978   SLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGSK  1035

Query  3043  ----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGA  3210
                    +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F R+GA
Sbjct  1036  DEDSGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCSLTPIDRVFTRLGA  1095

Query  3211  KDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKV  3390
              D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++    K+
Sbjct  1096  SDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKELAEKI  1155

Query  3391  QCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYG  3564
             +CR +FSTHYH L  DY     V L HMAC +         E +TFLYK   G CP+SYG
Sbjct  1156  KCRTLFSTHYHSLVEDYAHSAAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSYG  1215

Query  3565  VNVARLAGLPDNVLEKAAAKSREFE  3639
              N ARLA +P+ V++K   K++EFE
Sbjct  1216  FNAARLANIPEEVIQKGHRKAKEFE  1240



>ref|XP_003417633.2| PREDICTED: DNA mismatch repair protein Msh6 [Loxodonta africana]
Length=1294

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/959 (40%), Positives = 548/959 (57%), Gaps = 67/959 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TL++P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  324   DFDASTLFVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  383

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K       D+VV
Sbjct  384   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKHDRVV  443

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  444   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RVYGVCFVDTSLG  500

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET  +L     + L   L+P S+
Sbjct  501   KFYVGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSAETRMILKSSLSSSLQEGLMPGSQ  560

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   D + +E + N+     LP VL  +      
Sbjct  561   FWDAAKTLRILLE-----------------DGYFTEKL-NEGSGVMLPQVLKGMTSESDS  602

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE   P     + A KP      
Sbjct  603   IGLTPGEKSELALSALGGCIFYLKKCLIDQELLSMANFEEYTPLDSDMVSAAKPGAIFVK  662

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL     I
Sbjct  663   ANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERIDTCHTPFGKRLLKQWLCAPLCSPFPI  722

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  723   NDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  781

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + M      +   +D+ +SKLL  ++T     P    PD+  
Sbjct  782   TTYSKKKIIDFLSALEGFKVMCKIIEVMEEVVDDFNSKLLKQVITLQTKNPEGRFPDLTT  841

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              +K++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  842   ELKRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTI  901

Query  2587  NYVTVGKDAYLLEVPESLC-ELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PES     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  902   VYWGIGRNRYQLEIPESFTIRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDV  961

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP  DN
Sbjct  962   SLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIL-LPEDDN  1020

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-----GAGHSSFILLTGPNMGGKSTLLR  3108
              P L  K   HP + T +     F+ ND+ +G     G G +  +L+TGPNMGGKSTL+R
Sbjct  1021  PPFLELKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEGNGKAYCVLVTGPNMGGKSTLMR  1079

Query  3109  QVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSAT  3288
             Q  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ AT
Sbjct  1080  QAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHAT  1139

Query  3289  RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLC  3468
              +SLV +DELGRGT+T DG AIA++V++     ++CR +FSTHYH L  +Y ++  V L 
Sbjct  1140  AHSLVLVDELGRGTATFDGTAIADAVVQELAENIKCRTLFSTHYHSLVENYSQNVAVRLG  1199

Query  3469  HMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1200  HMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1258



>ref|XP_006216496.1| PREDICTED: DNA mismatch repair protein Msh6-like isoform X2 [Vicugna 
pacos]
Length=1060

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/960 (40%), Positives = 545/960 (57%), Gaps = 68/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  88    DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALTGVNELGL  147

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  148   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVV  207

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC VITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  208   RREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RVYGVCFVDTSLG  264

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  265   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSTETKMILKGSLSSSLQESLMPGSQ  324

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +       +N                   N+     LP VL  +      
Sbjct  325   FWDAAKTLRTLVEEGYFTDNL------------------NEGSGVMLPQVLKAMTSESDS  366

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  367   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYVPLDSDMVSATRPGAFFAK  426

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL +  AI
Sbjct  427   ANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPYAI  486

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V      E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  487   NDRLDAIEDLMIVP-DKTSEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  545

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + +      +   +D+  SK+L  ++T     P    PD+ +
Sbjct  546   TTYSKKKIIDFLSALEGFKVICKIVEIMEEVVDDFKSKILKQIITLQTKTPEGRFPDLTV  605

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  606   ELNRWDTAFDHEKARKTGLITPKAGFDPDYDQALADIRENEQSLLEYLEKQRSRIGCRTI  665

Query  2587  NYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  666   VYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLASLINAEERRDV  725

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D 
Sbjct  726   SLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLANYSQGGDGPMCRPVIL-LPEEDT  784

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTLL  3105
              P L  K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKSTL+
Sbjct  785   PPFLDLKGSRHPCI-TKTFFGDDFIPNDILIGCKEEEEENGQAYCVLVTGPNMGGKSTLM  843

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  844   RQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  903

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  904   TAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRL  963

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V+ K   K+REFE
Sbjct  964   GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIRKGHRKAREFE  1023



>ref|XP_002935421.2| PREDICTED: DNA mismatch repair protein Msh6 [Xenopus (Silurana) 
tropicalis]
Length=1338

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/969 (41%), Positives = 544/969 (56%), Gaps = 80/969 (8%)
 Frame = +1

Query  889   VNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELD  1068
              +YD  TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL 
Sbjct  368   ADYDPSTLYVPDDFLNKCTPGMRKWWQLKSQNFDTVIFYKVGKFYELYHMDAVIGVNELG  427

Query  1069  LQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKV  1236
             L +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E+R K  S     D+V
Sbjct  428   LTFMKGAWAHSGFPEIAFGRFSDVLVQKGYKVARVEQTETPEMMEVRCKSMSHPSKFDRV  487

Query  1237  VKREICAVITKGTLTEGEMLTVSPDAS---YLIAVTESCQTSANQLGERTYGVCVVDVAT  1407
             V+REIC +ITKGT T   +L  +P  S   YL+   E    S+ Q   R YGV  VD + 
Sbjct  488   VRREICRIITKGTQTYS-VLDGNPSESHSKYLLCFKEKMDDSSGQ--RRIYGVSFVDTSV  544

Query  1408  SKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLS  1587
              K  +GQF DD  CS   +L+  F P++I+      S +T++VL       +   L P S
Sbjct  545   GKFHVGQFEDDRHCSRFRTLVAHFPPIQILFEKGNPSSDTKKVLKSCLSTSIQESLQPTS  604

Query  1588  EFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-----  1752
             +FWDA KT+            T    +  E D  P           NLP VL  L     
Sbjct  605   QFWDAFKTL-----------KTLAEEAYFEKDFQPGSG--------NLPTVLKNLTSEND  645

Query  1753  ---VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFG  1887
                +  GE    ALSALG  ++YLK+  +D  LL  A FE  +P            S F 
Sbjct  646   SLALTPGEKSELALSALGACIYYLKKCLIDQELLSMANFEEYIPVDTGIEKAQASSSFFA  705

Query  1888  MIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHL  2067
               +Q+  MVLD   L NLEI +N  N  + GTL  +++ C T FGKRLL+ WL  PL + 
Sbjct  706   KTSQR--MVLDGVTLTNLEILQNGTNGSTEGTLLEKLDTCSTPFGKRLLKQWLCAPLCNP  763

Query  2068  EAIKERQDAVAGLKGVNLPG-VLEFRKELSRLPDMERLLAQIFASS---EANGRNANKVV  2235
              +I +R +AV  L  ++LP  V E  + L +LPD+ERLL++I +     ++     ++ V
Sbjct  764   FSINDRLNAVEDL--MDLPDKVSEVSELLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAV  821

Query  2236  LYEDAA--KKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLL-----TPGKGLP  2394
             +YE+ A  KK++  F+SAL G + M      L     N  S +L  ++     TP    P
Sbjct  822   MYEEIAYSKKKIADFLSALEGFKVMREVISILEDAAANFKSSILKQIVSIKGKTPQGHFP  881

Query  2395  DVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFG  2574
             D+   +K++   FD  +A  +G I P  G D +YD A   ++  E  L ++L +Q+K   
Sbjct  882   DLSAELKRWDTSFDHEKARKTGVITPKVGFDPDYDEALKDIKTTEQDLNEYLDKQRKRLS  941

Query  2575  DTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAET  2751
               ++ Y    K+ Y +E+PES+ E  +P+EYEL+S+KKGY RYW   I K+ G+L+ AE 
Sbjct  942   CKTVVYWGTAKNRYQMEIPESVTERNLPEEYELKSTKKGYKRYWTKAIEKMFGDLANAEE  1001

Query  2752  ERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELP  2931
              R++ LK  ++RL   F +++  W+  +   A LDVLISLS  S   +GP CRP I    
Sbjct  1002  RRDAALKDCMRRLFYNFDKNYKEWQTAVECFAVLDVLISLSQYSQGGDGPVCRPVIV---  1058

Query  2932  SQDN-VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG--------GAGHSSFILLTGPNM  3084
              QDN +P L  K   HP + T +     F+ ND+ +G         +  +  +L+TGPNM
Sbjct  1059  LQDNHLPFLELKGSRHPCI-TKTFFGDDFIPNDILIGCKEEDSDDSSDEAHCVLVTGPNM  1117

Query  3085  GGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLET  3264
             GGKSTLLRQ  L V++AQ+G  VPA S  L+PVDR+F R+GA D IMAG+STF  EL ET
Sbjct  1118  GGKSTLLRQAGLQVVMAQLGCYVPAESCRLTPVDRVFTRLGASDRIMAGESTFFVELSET  1177

Query  3265  ASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQ  3444
             +S+L  AT +SLV LDELGRGT+T DG AIA +V++     V+CR +FSTHYH L  DY 
Sbjct  1178  SSILQHATEHSLVLLDELGRGTATFDGTAIASAVVKELSQSVKCRTLFSTHYHSLVEDYS  1237

Query  3445  EDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAA  3618
               + V L HMAC +         E +TFLYK   G CP+SYG N ARLA +PD +++   
Sbjct  1238  HSQAVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLAHIPDEIIQVGH  1297

Query  3619  AKSREFEGV  3645
              K+REFE +
Sbjct  1298  QKAREFESI  1306



>ref|XP_009487242.1| PREDICTED: DNA mismatch repair protein Msh6 [Pelecanus crispus]
Length=1262

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/992 (40%), Positives = 568/992 (57%), Gaps = 76/992 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  ++DA R+R  D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  266   FAVWEHEKLDWLQEGKKKDAHRKRQDDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  325

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  326   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  385

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  386   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  444

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  445   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  500

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  501   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  545

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  546   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  602

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  603   LSLANFEEYVPVDIDTAKTMSLSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  660

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  661   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  718

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  719   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  778

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  779   EIASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  838

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  839   YDKALQDIKTVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYEL  898

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  899   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  958

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  959   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1016

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G         +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1017  MIGSKDEDSGSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1076

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1077  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1136

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1137  LAEKIKCRTLFSTHYHSLVEDYSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1196

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFEGV  3645
             P+SYG N ARLA +P+ V++K   K++EFE +
Sbjct  1197  PKSYGFNAARLANIPEEVIQKGHRKAKEFEKI  1228



>ref|XP_009584805.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Fulmarus 
glacialis]
Length=1265

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/990 (39%), Positives = 566/990 (57%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D NYD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  269   FAVWEHEKLDWLQEGKKKDAHRKRQGDPNYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  328

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  329   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  388

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  389   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNRYLL  447

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  448   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  503

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  504   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  548

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  549   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  605

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  606   LSLANFEEYVPVDIDTAKTTSSGSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  663

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  664   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  721

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  722   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  781

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  782   EIASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  841

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  842   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYEL  901

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  902   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  961

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ N++
Sbjct  962   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNNI  1019

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1020  VIGSEDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1079

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1080  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1139

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                +++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1140  LAEQIKCRTLFSTHYHSLVEDYSHNTAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1199

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1200  PKSYGFNAARLANIPEEVIQKGHRKAKEFE  1229



>ref|XP_009584804.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Fulmarus 
glacialis]
Length=1266

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/990 (39%), Positives = 566/990 (57%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D NYD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  270   FAVWEHEKLDWLQEGKKKDAHRKRQGDPNYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  329

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  330   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  389

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  390   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNRYLL  448

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  449   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  504

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  505   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  549

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  550   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  606

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  607   LSLANFEEYVPVDIDTAKTTSSGSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  664

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  665   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  722

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  723   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  782

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  783   EIASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  842

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  843   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYEL  902

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  903   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  962

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ N++
Sbjct  963   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNNI  1020

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1021  VIGSEDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1080

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1081  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1140

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                +++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1141  LAEQIKCRTLFSTHYHSLVEDYSHNTAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1200

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1201  PKSYGFNAARLANIPEEVIQKGHRKAKEFE  1230



>gb|KFP47728.1| DNA mismatch repair protein Msh6, partial [Cathartes aura]
Length=1276

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/990 (40%), Positives = 564/990 (57%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    RR   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  280   FAVWEHEKLDWLQEGKKKDAHRRRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  339

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  340   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  399

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  400   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  458

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  459   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  514

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+   K + +       P S+N    
Sbjct  515   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTL---KVLLEEGYFKEKPNSENGC--  569

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                          +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  570   -------------SLPSVVKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  616

Query  1843  LKFAEFE------------LLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE              P S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  617   LSLANFEEYVPVDIDTAKTTSPSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  674

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  675   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  732

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  733   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  792

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+      P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  793   EVASDFKSKVLKQLVNRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  852

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  853   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYEL  912

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  913   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  972

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  973   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1030

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1031  VIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1090

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1091  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1150

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1151  LAEKIKCRTLFSTHYHSLVEDYSYNMAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1210

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++    K++EFE
Sbjct  1211  PKSYGFNAARLANIPEEVIQTGHRKAKEFE  1240



>ref|XP_009076584.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein Msh6-like 
[Acanthisitta chloris]
Length=1263

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/1064 (38%), Positives = 598/1064 (56%), Gaps = 76/1064 (7%)
 Frame = +1

Query  574   GKSGISKKAELRKRKFTEGLKLVSTKAKKIKSGGNNKSTQSKAPTATGGVKVIESVTNNL  753
              +S I   ++ ++R+ T+  K  S  +   ++     +  S+A +        ES  +  
Sbjct  198   AESPIKVPSKRKRRETTKPAKRSSLGSDSSETPKRVATVSSEAKSKLTSFSAPESFESQA  257

Query  754   ECVKASNGDDILTGNSAERFSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDF  930
                    GD          F++ E EKL +L +  R+DA R+R  D  YD  TLY+P D+
Sbjct  258   SACSGGTGD----------FAVWEHEKLDWLQEGKRKDAHRKRQSDPGYDPCTLYVPEDY  307

Query  931   LKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFP  1110
             L   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFP
Sbjct  308   LNKCTPGMRRWWQLKSQNFDAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFP  367

Query  1111  EKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTL  1278
             E  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV+REIC +ITKGT 
Sbjct  368   ETAFGRFSDVLVQKGYKVARVEQTETPEMMEARCKATAHTTRFDKVVRREICRIITKGTQ  427

Query  1279  TEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdc  1449
             T   ++   P    + YL++V E   +S    G+R YGVC VD +  K  +GQF+DD  C
Sbjct  428   TYS-IMDCDPSENHSKYLLSVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHC  482

Query  1450  sslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--  1623
             S   +L+  + PV+++     LS +T+++L     + +   L+  S+FW+A KT+  +  
Sbjct  483   SRFRTLIAHYTPVQVLYEKGNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKALLE  542

Query  1624  KNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-VNAGENGTYALSALGG  1800
             +  ++   N     S+N   L PS        +++L +    L +  GEN   ALSALGG
Sbjct  543   EGYFKEKQN-----SENGCSL-PS-------AIKSLTSESDSLGLTPGENSELALSALGG  589

Query  1801  TLFYLKQAFLDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLE  1944
              +FYLK+  +D  LL  A FE  +P            S F    Q+  MVLD   L NLE
Sbjct  590   CVFYLKRCLIDQELLSLANFEEYVPVDIATARTVSSSSLFARTDQR--MVLDGVTLMNLE  647

Query  1945  IFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLP  2124
             + +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P
Sbjct  648   VLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCTPLCNPKSINDRLDAVEDLLAV--P  705

Query  2125  GVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISAL  2286
               + E  + L +LPD+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL
Sbjct  706   DKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSAL  765

Query  2287  RGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEAN  2451
              G + M     ++     +  SK+L  L+T     P    PD+   + ++   FD  +A 
Sbjct  766   EGFKVMNEIVDAMEEIASDFKSKVLKQLVTRKAKNPDGHFPDLSAELTRWDTAFDHNQAR  825

Query  2452  SSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVP  2631
              +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+P
Sbjct  826   KTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIP  885

Query  2632  ESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCE  2808
             ES+    +P+EYEL+SS+KGY RYW   I K++  +  AE  R++ LK  ++RL   F +
Sbjct  886   ESVISRNLPEEYELKSSRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFHNFDK  945

Query  2809  HHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILR  2988
             +   W+  +  IA LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + 
Sbjct  946   NSKDWQTAVECIAVLDVLMSLAHYSQGGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-  1003

Query  2989  TDSLDKGAFVSNDVTLGGAGHSSF-----ILLTGPNMGGKSTLLRQVCLAVILAQVGADV  3153
             T +     F+ ND+ +G +   S      +L+TGPNMGGKSTL+RQ  L VI+AQ+G  V
Sbjct  1004  TKTFFGDDFIPNDIVIGSSDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYV  1063

Query  3154  PAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTS  3333
             PA +  L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+
Sbjct  1064  PAEACRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLMDELGRGTA  1123

Query  3334  TSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGL  3507
             T DG AIA +V++    K+ CR +FSTHYH L  DY  +R V L HMAC +         
Sbjct  1124  TFDGTAIASAVVKELAEKICCRTLFSTHYHSLVEDYSHNRAVRLGHMACMVENESEDPSQ  1183

Query  3508  EEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             E +TFLYK   G CP+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1184  ETITFLYKFIEGACPKSYGFNAARLADIPEEVIQKGHRKAKEFE  1227



>ref|XP_006185841.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Camelus 
ferus]
Length=1059

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/960 (40%), Positives = 545/960 (57%), Gaps = 68/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  88    DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALTGVNELGL  147

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  148   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVV  207

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC VITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  208   RREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RVYGVCFVDTSLG  264

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  265   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSTETKMILKGSLSSSLQESLMPGSQ  324

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +       +N                   N+     LP VL  +      
Sbjct  325   FWDAAKTLRTLVEEGYFTDNL------------------NEGSGVMLPQVLKAMTSESDS  366

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  367   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYVPLDSDMVSATRPGAFFAK  426

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL +  AI
Sbjct  427   ANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPYAI  486

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V      E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  487   NDRLDAIEDLMIVP-DKTSEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  545

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + +      +   +D+  SK+L  ++T     P    PD+ +
Sbjct  546   TTYSKKKIIDFLSALEGFKVICKIVEIMEEVVDDFKSKILKQIITLQTKTPEGRFPDLTV  605

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  606   ELNRWATAFDHEKARKTGLITPKAGFDPDYDQALADIRENEQSLLEYLEKQRSRIGCRTI  665

Query  2587  NYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  666   VYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLASLINAEERRDV  725

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D 
Sbjct  726   SLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLANYSRGGDGPMCRPVIL-LPEEDT  784

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTLL  3105
              P L  K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKSTL+
Sbjct  785   PPFLDLKGSRHPCI-TKTFFGDDFIPNDILIGCKEEEEENGQAYCVLVTGPNMGGKSTLM  843

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  844   RQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  903

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  904   TAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRL  963

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V+ K   K+REFE
Sbjct  964   GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIRKGHRKAREFE  1023



>gb|KFV98003.1| DNA mismatch repair protein Msh6, partial [Fulmarus glacialis]
Length=1279

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/990 (39%), Positives = 566/990 (57%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D NYD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  283   FAVWEHEKLDWLQEGKKKDAHRKRQGDPNYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  342

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  343   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  402

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  403   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNRYLL  461

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  462   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  517

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  518   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  562

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  563   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  619

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  620   LSLANFEEYVPVDIDTAKTTSSGSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  677

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  678   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  735

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  736   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  795

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  796   EIASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  855

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL
Sbjct  856   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYEL  915

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  916   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  975

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ N++
Sbjct  976   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNNI  1033

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1034  VIGSEDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1093

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1094  TRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1153

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                +++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G C
Sbjct  1154  LAEQIKCRTLFSTHYHSLVEDYSHNTAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1213

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1214  PKSYGFNAARLANIPEEVIQKGHRKAKEFE  1243



>ref|XP_005895691.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X3 [Bos mutus]
Length=1229

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/1063 (38%), Positives = 598/1063 (56%), Gaps = 81/1063 (8%)
 Frame = +1

Query  622   TEGLKL---VSTKAKKIKSGGNN---KSTQSKAPTATGGVKVIESVTNN----LECVKAS  771
             +EGL     V+ K K++ +G  +   KS++ + P+AT     I S T N        + S
Sbjct  155   SEGLDTPVKVAPKRKRMVTGNGSLKRKSSRKEMPSATKRATGISSETKNTLSAFSVPQNS  214

Query  772   NGDDILTG--NSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGL  942
                  ++G  + + R ++   E L +L + +R    RR     ++D+ TLY+P DFL   
Sbjct  215   EPQAHISGGCDDSNRPTVWYHETLEWLKEEKRRDVHRRRPDHPDFDASTLYVPEDFLNSC  274

Query  943   SGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNF  1122
             + G R+WW+ KS++ D V+F+K+GKFYE++ MDA IG  EL L +MKG   H GFPE  F
Sbjct  275   TPGMRKWWQIKSQNFDLVIFYKVGKFYEMYHMDALIGVSELGLVFMKGNWAHSGFPEIAF  334

Query  1123  SMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGE  1290
                ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV+REIC +ITKGT T   
Sbjct  335   GRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYS-  393

Query  1291  MLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslc  1461
             +L   P    + YL+++ E  + S+     R YGVC VD +  +  +GQF+DD  CS   
Sbjct  394   VLEGDPSENYSKYLLSLKEKEEESSGHT--RVYGVCFVDTSLGRFFIGQFSDDRHCSRFR  451

Query  1462  sllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQR  1641
             +L+  + PV+++     LS +T+ +L     + L   L+P S+FWDA KT+  +      
Sbjct  452   TLVAHYPPVQVLFEKGNLSMDTKMILKSSLSSSLQEGLIPGSQFWDAAKTLRTLLE----  507

Query  1642  LNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALG  1797
                          + + ++ ++ D  +  LP VL  +        +  GE    ALSALG
Sbjct  508   -------------EGYFTDKLNEDGGVM-LPQVLKGMTSESDSIGLTPGEKSELALSALG  553

Query  1798  GTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP---------YMVLDAAALENLEI  1947
             G +FYLK+  +D  LL  A FE  +P     + A +P          MVLDA  L NLEI
Sbjct  554   GCVFYLKKCLIDQELLSMANFEEYVPLDSDMVHATRPGAVFAKANQRMVLDAVTLNNLEI  613

Query  1948  FENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPG  2127
             F N  N  + GTL  +++ C T FGKRLL+ WL  PL +  AI +R DA+  L  V    
Sbjct  614   FLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPHAINDRLDAIEDLMVVP-DK  672

Query  2128  VLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRG  2292
             + E    L +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G
Sbjct  673   ISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEG  732

Query  2293  CETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSS  2457
              + +      +   +D+  SK+L  +LT     P    PD+   + ++   FD  +A  +
Sbjct  733   FKVICKIIGIMEEVIDDFKSKILKQVLTLQTKSPEGRFPDLTSELNRWDTAFDHEKARKT  792

Query  2458  GRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES  2637
             G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+
Sbjct  793   GLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTIVYWGIGRNRYQLEIPEN  852

Query  2638  -LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHH  2814
              +   +P+EYEL+S+KKG  RYW   I K +G L  AE  R++ LK  ++RL   F +++
Sbjct  853   FITRNLPEEYELKSTKKGCKRYWTKTIEKKLGNLINAEERRDASLKDCMRRLFYNFDKNY  912

Query  2815  STWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTD  2994
               W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D  P L  K   HP + T 
Sbjct  913   KDWQAAVECIAVLDVLLCLTNYSRGGDGPMCRPIIL-LPEEDTPPFLDLKGSRHPCI-TK  970

Query  2995  SLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVP  3156
             +     F+ ND+ +G        G +  +L+TGPNMGGKSTL+RQ  L  I+AQ+G  VP
Sbjct  971   TFFGDDFIPNDILIGCEEEEEENGKAYCVLVTGPNMGGKSTLMRQAGLLAIMAQMGCYVP  1030

Query  3157  AASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTST  3336
             A    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ AT +SLV +DELGRGT+T
Sbjct  1031  AEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHATAHSLVLVDELGRGTAT  1090

Query  3337  SDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLE  3510
              DG AIA +V++     ++CR +FSTHYH L  DY ++  V L HMAC +         E
Sbjct  1091  FDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQE  1150

Query  3511  EVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1151  TITFLYKFINGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1193



>gb|EDM02631.1| rCG61559 [Rattus norvegicus]
Length=1361

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/962 (40%), Positives = 543/962 (56%), Gaps = 74/962 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +Y+S TLY+P DFL   + G R+WW+FKS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  392   DYNSSTLYVPEDFLNSCTPGMRRWWQFKSQNFDLVIFYKVGKFYELYHMDAVIGVSELGL  451

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  452   IFMKGNWAHSGFPEIAFGRFSDSLVQKGYKVARVEQTETPEMMEARCRKMAHVSKFDRVV  511

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+  +  R YGVC VD +  
Sbjct  512   RREICRIITKGTQTYS-VLDGDPSENYSRYLLSLKEKEEDSSGHM--RAYGVCFVDTSLG  568

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  LGQF+DD  CS L +L+  + PV+I+     LS ET+ VL     + L   L+P S+
Sbjct  569   KFFLGQFSDDRHCSRLRTLVAHYPPVQILFEKGNLSTETKTVLKGSLSSCLQEGLIPGSQ  628

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                    L       N+     LP VL  +      
Sbjct  629   FWDATKTLRTL--------------------LEGGYFTGNEGSGAELPPVLKAMTSESDS  668

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE------------LLPFSHFGM  1890
               +  GE    +LSALGG +FYLK+  +D  LL  A FE            + P + F  
Sbjct  669   VGLTPGEESELSLSALGGCVFYLKKCLIDQELLSMANFEEYFPLDSDMVGTVKPGAVFTK  728

Query  1891  IAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLE  2070
              +Q+  MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    
Sbjct  729   ASQR--MVLDAVTLSNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLCAPLCSPS  786

Query  2071  AIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLY  2241
             AI +R DA+  L  V    V E    L +LPD+ERLL++I    +  ++      + ++Y
Sbjct  787   AISDRLDAIEDLMAVP-DKVAEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDTRAIMY  845

Query  2242  EDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDV  2400
             E+   +KK++  F+SAL G + M      +    D   SK L  ++T     P    PD+
Sbjct  846   EETTYSKKKIIDFLSALEGFKVMCKITRLMEDVADGFKSKTLKQVVTLQTKSPKGRFPDL  905

Query  2401  KLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDT  2580
                + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L +Q+   G  
Sbjct  906   TAELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRIGCR  965

Query  2581  SINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETER  2757
             +I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW  VI K +  L  AE  R
Sbjct  966   NIVYWGIGRNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKVIEKKLSNLINAEERR  1025

Query  2758  ESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQ  2937
             ++ LK  ++RL   F ++H  W+  +   A LDVL+ L+  S   +GP CRP +  LP +
Sbjct  1026  DASLKDCMRRLFYNFDKNHKDWQSAVECTAVLDVLLCLASYSQGGDGPMCRP-VLLLPGE  1084

Query  2938  DNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG------GAGHSSFILLTGPNMGGKST  3099
             D  P L  K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKST
Sbjct  1085  DTHPFLELKGSRHPCI-TKTFFGDDFIPNDILIGCEEDAEADGKAYCVLVTGPNMGGKST  1143

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             L+RQ  L  ++AQ+G  VPA    L+PVDR+F R+GA D IM+G+STF  EL ETAS+L 
Sbjct  1144  LIRQAGLLAVMAQMGCYVPAELCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILR  1203

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V
Sbjct  1204  HATAHSLVLVDELGRGTATFDGTAIASAVVKELAETIKCRTLFSTHYHSLVEDYSKNVCV  1263

Query  3460  SLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+RE
Sbjct  1264  RLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKARE  1323

Query  3634  FE  3639
             FE
Sbjct  1324  FE  1325



>ref|XP_007111682.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Physeter 
catodon]
Length=1360

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/1053 (38%), Positives = 592/1053 (56%), Gaps = 77/1053 (7%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN---KSTQSKAPTATGGVKVIESVTNN----LECVKASNGDDILTG-  795
             V+ K K++ +G  +   KS++ + P+AT     I S T N        + S     ++G 
Sbjct  296   VAPKRKRMVTGNGSLKRKSSRKEMPSATKRATGISSETKNTLSAFSAAQNSESQAHISGG  355

Query  796   -NSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
              + + R ++   E L +L + +R    RR     ++D+ TLY+P DFL   + G R+WW+
Sbjct  356   CDDSSRPTIWYHETLEWLKEEKRRDTHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ  415

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   ++ L +
Sbjct  416   IKSQNFDLVIFYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ  475

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPD--  1311
             KGY+V  VEQ ETPE +E R +K +     D+VV+REIC VITKGT T   +L   P   
Sbjct  476   KGYKVARVEQTETPEMMEARCRKMAHISKFDRVVRREICRVITKGTQTYS-VLEGDPSEN  534

Query  1312  -ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
              + YL+++ E    S+     R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  535   YSKYLLSLKEKDDDSSGH--ARVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYSPV  592

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYS  1668
             +++     LS ET+ +L     + L   L+P S+FWDA KT+  +               
Sbjct  593   QVLFEKGNLSVETKMILKGSLSSSLQEGLIPGSQFWDAAKTLRTLLE-------------  639

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQA  1824
                 + + ++ ++ D+ +  LP VL ++        +  GE    ALSALGG +FYLK+ 
Sbjct  640   ----EGYFTDKLNEDSGVM-LPQVLKDMTSESDSVGLTPGEKSELALSALGGCVFYLKKC  694

Query  1825  FLDVSLLKFAEFE-LLPFSHFGMIAQKP---------YMVLDAAALENLEIFENSKNCGS  1974
              +D  LL  A FE  +P     + A +P          MVLDA  L NLEIF N  N  +
Sbjct  695   LIDQELLSMANFEEYIPLDSDTVRATRPGAVFAKANQRMVLDAVTLNNLEIFLNGTNGST  754

Query  1975  SGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELS  2154
              GTL  +++ C T FGKRLL+ WL  PL +   I +R DA+  L  V    + E    L 
Sbjct  755   EGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPYVISDRLDAIEDLMAVP-DKISEVVDLLK  813

Query  2155  RLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACF  2319
             +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + +     
Sbjct  814   KLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKILCKIIG  873

Query  2320  SLGATLDNTDSKLLHDLL-----TPGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGV  2484
              +   +D+  SK+L  +L      P    PD+ L + ++   FD  +A  +G I P  G 
Sbjct  874   VMEEVIDDFKSKILKQVLILQTKNPEGRFPDLTLELNRWDTAFDHEKARKTGLITPKAGF  933

Query  2485  DEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQE  2661
             D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+ +   +P+E
Sbjct  934   DSDYDQALADIRENEQSLLEYLEKQRSRIGCRTIVYWGIGRNRYQLEIPENFITRNLPEE  993

Query  2662  YELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELIST  2841
             YEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+  +  
Sbjct  994   YELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQAAVEC  1053

Query  2842  IAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVS  3021
             IA LDVL+ L+  S   +GP CRP I  LP +D  P L  K   HP + T +     F+ 
Sbjct  1054  IAVLDVLLCLANYSRGGDGPMCRPVIL-LPEEDTPPFLDLKGSRHPCI-TKTFFGDDFIP  1111

Query  3022  NDVTLGGA-----GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVD  3186
             ND+ +G       G +  +L+TGPNMGGKSTL+RQ  L V++AQ+G  VPA    L+ +D
Sbjct  1112  NDILIGCEEEEENGKAYCVLVTGPNMGGKSTLMRQAGLLVVMAQMGCYVPAEVCRLTAID  1171

Query  3187  RIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESV  3366
             R+F R+GA D IM+G+STF  EL ETAS+L+ AT +SLV +DELGRGT+T DG AIA +V
Sbjct  1172  RVFTRLGASDRIMSGESTFFVELSETASILTHATAHSLVLVDELGRGTATFDGTAIANAV  1231

Query  3367  LEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTL  3540
             ++     ++CR +FSTHYH L  DY ++  V L HMAC +         E +TFLYK   
Sbjct  1232  VKELAENIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQETITFLYKFIK  1291

Query  3541  GTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1292  GACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1324



>ref|XP_006164752.1| PREDICTED: DNA mismatch repair protein Msh6 [Tupaia chinensis]
Length=1362

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/1059 (39%), Positives = 594/1059 (56%), Gaps = 88/1059 (8%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN---KSTQSKAPTATGGVKVIESVTNN----------LEC-VKASNG  777
             V+ K K++ +G  +   KS++ + P+AT     I S T N          LE  V  S G
Sbjct  297   VAPKRKRMITGNGSLKRKSSRKEMPSATKRTPGISSETKNTLSAFSSPQPLESQVHVSGG  356

Query  778   DDILTGNSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGLSGGQ  954
                  G+ + R ++   E L +L K +R  + RR     ++D+ TLY+P DFL   + G 
Sbjct  357   -----GDESSRPTVWYHETLEWLKKEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGM  411

Query  955   RQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNA  1134
             R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   +
Sbjct  412   RKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGLVFMKGNWAHSGFPEIAFGRYS  471

Query  1135  EKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVVKREICAVITKGTLTEGEMLTV  1302
             + L +KGY+V  VEQ ETPE +E R +K       D+VV+REIC VITKGT T   +L  
Sbjct  472   DSLVQKGYKVARVEQTETPEMMEARCRKMAHISKHDRVVRREICRVITKGTQTYS-VLEG  530

Query  1303  SPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllY  1473
              P    + YL+++ E  + S+     R YGVC VD +  K  +GQF+DD  CS   +L+ 
Sbjct  531   DPSENYSKYLLSLKEKEEESSGHT--RVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVA  588

Query  1474  EFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNT  1653
              + PV+++     LS ET+ VL     + L   L+P S+FWDA KT+  +          
Sbjct  589   HYPPVQVLFEKGNLSMETKAVLKSSLSSSLQEGLIPGSQFWDATKTLRTLLE--------  640

Query  1654  PIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLF  1809
                      + + +E ++ D+ +  LP VL  +        +  GE    ALSALGG +F
Sbjct  641   ---------EGYFTEKLNEDSTVM-LPQVLKNMTSESDSIGLTPGEKSELALSALGGCVF  690

Query  1810  YLKQAFLDVSLLKFAEFE--------LLPFSHFGMIAQKP--YMVLDAAALENLEIFENS  1959
             YLK+  +D  LL  A FE        ++  +  G I  K    MVLDA  L NLEIF N 
Sbjct  691   YLKKCLIDQELLSMANFEKYIPLDSDMVSTTKSGAIFAKTNQRMVLDAVTLNNLEIFLNG  750

Query  1960  KNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEF  2139
              N  + GTL  +++ C T+FGKRLL+ WL  PL    AI +R DA+  L  V    + E 
Sbjct  751   TNGSTEGTLLERIDTCQTSFGKRLLKQWLCAPLCSPYAINDRLDAIEDLMVVT-NKISEV  809

Query  2140  RKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETM  2304
                L +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + +
Sbjct  810   TDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVI  869

Query  2305  VNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRII  2469
                   +   +D+  SK+L  ++T     P    PD+ + + ++   FD  +A  +G I 
Sbjct  870   CKIIGIMEEFIDDFKSKILKQVITLKTKNPEGRFPDLTIELNRWDTAFDHEKARKTGLIT  929

Query  2470  PCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL  2649
             P  G D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+    
Sbjct  930   PKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFATR  989

Query  2650  -VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWR  2826
              +P+EYEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+
Sbjct  990   NLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQ  1049

Query  2827  ELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDK  3006
               +  IA LDVL+ L+  S   +GP CRP I  LP +D  P L  K   HP + T +   
Sbjct  1050  SAVECIAVLDVLLCLANYSQGGDGPMCRPVIL-LPGEDTPPFLELKGSRHPCI-TKTFFG  1107

Query  3007  GAFVSNDVTLG------GAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASF  3168
               F+ ND+ +G        G +  +L+TGPNMGGKSTL+RQ  L  ++AQ+G  VPA   
Sbjct  1108  DDFIPNDILIGCEEEEEKNGQAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAEVC  1167

Query  3169  DLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQ  3348
              L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ AT +SLV +DELGRGT+T DG 
Sbjct  1168  RLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHATAHSLVLVDELGRGTATFDGT  1227

Query  3349  AIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTF  3522
             AIA +V++     ++CR +FSTHYH L  DY ++  V L HMAC +         E +TF
Sbjct  1228  AIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQETITF  1287

Query  3523  LYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             LYK   G CP+SYG N A+LA LP+ V++K   K+REFE
Sbjct  1288  LYKFIKGACPKSYGFNAAKLANLPEEVIQKGHRKAREFE  1326



>ref|XP_009904180.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Picoides 
pubescens]
Length=1260

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/1046 (39%), Positives = 587/1046 (56%), Gaps = 78/1046 (7%)
 Frame = +1

Query  649   KAKKIKSGGNNKST---QSKAPTATGGVKV-IESVTNNLECVKASNGDDILTGNSAERFS  816
             K K+IK      S+   QS+ P     V V  +S   +    ++           +  F 
Sbjct  207   KRKEIKKPAKRSSSENEQSEPPKRVAAVSVEAKSKLTSFAAPESFESQANACSGGSSGFG  266

Query  817   MREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDK  993
             + E EKL +L +  ++DA RRR  D +YD  TLY+P D+L   + G R+WW+ KS++ D 
Sbjct  267   VWEHEKLDWLQEGKKKDARRRRQSDPDYDPHTLYVPEDYLNRCTPGMRRWWQLKSQNFDA  326

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V  V
Sbjct  327   VIFYKVGKFYELYHMDAVTGVSELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARV  386

Query  1174  EQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLIAV  1332
             EQ ETPE +E R K  +     DKVV+REIC +ITKGT T   ++   P  +   YL+ V
Sbjct  387   EQTETPEMMEARCKATAHPTRFDKVVRREICRIITKGTQTYS-IMDCDPSENHHKYLLCV  445

Query  1333  TESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKL  1512
              E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++     
Sbjct  446   KEKEDSS----GQRVYGVCFVDTSVGKFHVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGN  501

Query  1513  LSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHP  1692
             LS +T+++L     + +   L+  S+FW+A KT+  +                 E     
Sbjct  502   LSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYFKE  546

Query  1693  SESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSLLK  1848
              E+ +N     +LP+V+  L        +  GEN   ALSALG  +FYL++  +D  LL 
Sbjct  547   KETSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGACVFYLQKCLIDQELLS  603

Query  1849  FAEFE-LLPF---------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQM  1998
              A FE  LP          S F    Q+  MVLD   L NLE+ +N  N  + GTL  ++
Sbjct  604   LANFEEYLPVDVNAAKATSSCFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERI  661

Query  1999  NHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMER  2175
             + C T FGKRLL+ WL  PL + ++I +R DAV  L  +++P  + E  + L +LPD+ER
Sbjct  662   DSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDL--LSVPDKMSEVGEHLKKLPDLER  719

Query  2176  LLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLD  2340
             LL +I +     ++     ++ + YE+   +KK++  F+SAL G + M     ++     
Sbjct  720   LLNKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMQEIVDAMEEVAS  779

Query  2341  NTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAA  2505
             +  SK+L  L+T     P    P++   +K++   FD  +A  +G I P  G D +YD A
Sbjct  780   DFKSKVLKQLVTREGQNPDGRFPELSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKA  839

Query  2506  CGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSK  2682
                +  VE  L ++L++Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+SS+
Sbjct  840   LQDIDAVEEDLKRYLEKQRKLLGYKSVMYWGAGKNRYQMEIPESVVSRHLPEEYELKSSR  899

Query  2683  KGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVL  2862
             KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL
Sbjct  900   KGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDQNSKAWQTAVECIAVLDVL  959

Query  2863  ISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-  3039
             +SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G 
Sbjct  960   MSLANYSQDGDGPLCRPVIV-LPGDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGS  1017

Query  3040  ----GAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMG  3207
                 G+  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA +  L+P+DR+F R+G
Sbjct  1018  TDEDGSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEACRLTPIDRVFTRLG  1077

Query  3208  AKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHK  3387
             A D IM+G+STF  EL ET+ +L  AT++SLV +DELGRGT+T DG AIA +VL+    +
Sbjct  1078  ASDRIMSGESTFFVELSETSCILQHATKHSLVLMDELGRGTATFDGTAIASAVLKELAER  1137

Query  3388  VQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSY  3561
             ++CR +FSTHYH L  D      V L HMAC +         E +TFLYK   G CP+SY
Sbjct  1138  IKCRTLFSTHYHSLVEDCSHTGAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSY  1197

Query  3562  GVNVARLAGLPDNVLEKAAAKSREFE  3639
             G N ARLA +P+ V++K   K+REFE
Sbjct  1198  GFNAARLANIPEEVIQKGHRKAREFE  1223



>ref|XP_008569880.1| PREDICTED: DNA mismatch repair protein Msh6 [Galeopterus variegatus]
Length=1262

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/960 (40%), Positives = 545/960 (57%), Gaps = 68/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  291   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVSELGL  350

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K       D+VV
Sbjct  351   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKHDRVV  410

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  411   RREICRIITKGTQTYS-VLEGDPSENYSRYLLSLKEKEEDSSGH--NRVYGVCFVDTSLG  467

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L       L   L+P S+
Sbjct  468   KFYVGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSMETKTILKGSLSCSLQEGLIPGSQ  527

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + +  E ++ D+ +  LP VL E+      
Sbjct  528   FWDAAKTLRTLLE-----------------EGYFMEKLNEDSGVM-LPQVLKEMTSESDS  569

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     +   +P      
Sbjct  570   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDMVSTTRPGAVFTK  629

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF NS N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  630   ANQRMVLDAVTLNNLEIFLNSTNGSTEGTLLERIDTCYTPFGKRLLKQWLCAPLCSPYAI  689

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ V+YE+
Sbjct  690   NDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAVMYEE  748

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + M      +   +D+  SK+L  ++T     P    PD+  
Sbjct  749   TTYSKKKIIDFLSALEGFKVMCKIIEIMEEVIDDFKSKILRQIVTLQTKNPEGHFPDLTT  808

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L+ Q+   G  +I
Sbjct  809   ELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLETQRNRIGCRTI  868

Query  2587  NYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  869   VYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDV  928

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  +A LDVL+ L+  S   +GP CRP I  LP +D 
Sbjct  929   SLKDCMRRLFYNFDKNYKDWQSAVECMAVLDVLLCLTNYSRGGDGPMCRPVIL-LPGEDI  987

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG------GAGHSSFILLTGPNMGGKSTLL  3105
             +P L  K   HP + T +     F+ ND+ +G          +  +L+TGPNMGGKSTL+
Sbjct  988   LPFLELKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEEETSKAYCVLVTGPNMGGKSTLM  1046

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM G+STF  EL ETAS+L  A
Sbjct  1047  RQAGLLAVMAQMGCYVPAEGCRLTPIDRVFTRLGASDRIMTGESTFFVELSETASILMHA  1106

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  1107  TAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVRL  1166

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1167  GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1226



>ref|XP_009904173.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Picoides 
pubescens]
Length=1261

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/1046 (39%), Positives = 587/1046 (56%), Gaps = 78/1046 (7%)
 Frame = +1

Query  649   KAKKIKSGGNNKST---QSKAPTATGGVKV-IESVTNNLECVKASNGDDILTGNSAERFS  816
             K K+IK      S+   QS+ P     V V  +S   +    ++           +  F 
Sbjct  208   KRKEIKKPAKRSSSENEQSEPPKRVAAVSVEAKSKLTSFAAPESFESQANACSGGSSGFG  267

Query  817   MREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDK  993
             + E EKL +L +  ++DA RRR  D +YD  TLY+P D+L   + G R+WW+ KS++ D 
Sbjct  268   VWEHEKLDWLQEGKKKDARRRRQSDPDYDPHTLYVPEDYLNRCTPGMRRWWQLKSQNFDA  327

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V  V
Sbjct  328   VIFYKVGKFYELYHMDAVTGVSELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARV  387

Query  1174  EQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLIAV  1332
             EQ ETPE +E R K  +     DKVV+REIC +ITKGT T   ++   P  +   YL+ V
Sbjct  388   EQTETPEMMEARCKATAHPTRFDKVVRREICRIITKGTQTYS-IMDCDPSENHHKYLLCV  446

Query  1333  TESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKL  1512
              E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++     
Sbjct  447   KEKEDSS----GQRVYGVCFVDTSVGKFHVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGN  502

Query  1513  LSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHP  1692
             LS +T+++L     + +   L+  S+FW+A KT+  +                 E     
Sbjct  503   LSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYFKE  547

Query  1693  SESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSLLK  1848
              E+ +N     +LP+V+  L        +  GEN   ALSALG  +FYL++  +D  LL 
Sbjct  548   KETSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGACVFYLQKCLIDQELLS  604

Query  1849  FAEFE-LLPF---------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQM  1998
              A FE  LP          S F    Q+  MVLD   L NLE+ +N  N  + GTL  ++
Sbjct  605   LANFEEYLPVDVNAAKATSSCFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERI  662

Query  1999  NHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMER  2175
             + C T FGKRLL+ WL  PL + ++I +R DAV  L  +++P  + E  + L +LPD+ER
Sbjct  663   DSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDL--LSVPDKMSEVGEHLKKLPDLER  720

Query  2176  LLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLD  2340
             LL +I +     ++     ++ + YE+   +KK++  F+SAL G + M     ++     
Sbjct  721   LLNKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMQEIVDAMEEVAS  780

Query  2341  NTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAA  2505
             +  SK+L  L+T     P    P++   +K++   FD  +A  +G I P  G D +YD A
Sbjct  781   DFKSKVLKQLVTREGQNPDGRFPELSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKA  840

Query  2506  CGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSK  2682
                +  VE  L ++L++Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+SS+
Sbjct  841   LQDIDAVEEDLKRYLEKQRKLLGYKSVMYWGAGKNRYQMEIPESVVSRHLPEEYELKSSR  900

Query  2683  KGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVL  2862
             KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL
Sbjct  901   KGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDQNSKAWQTAVECIAVLDVL  960

Query  2863  ISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-  3039
             +SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G 
Sbjct  961   MSLANYSQDGDGPLCRPVIV-LPGDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGS  1018

Query  3040  ----GAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMG  3207
                 G+  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA +  L+P+DR+F R+G
Sbjct  1019  TDEDGSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEACRLTPIDRVFTRLG  1078

Query  3208  AKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHK  3387
             A D IM+G+STF  EL ET+ +L  AT++SLV +DELGRGT+T DG AIA +VL+    +
Sbjct  1079  ASDRIMSGESTFFVELSETSCILQHATKHSLVLMDELGRGTATFDGTAIASAVLKELAER  1138

Query  3388  VQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSY  3561
             ++CR +FSTHYH L  D      V L HMAC +         E +TFLYK   G CP+SY
Sbjct  1139  IKCRTLFSTHYHSLVEDCSHTGAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSY  1198

Query  3562  GVNVARLAGLPDNVLEKAAAKSREFE  3639
             G N ARLA +P+ V++K   K+REFE
Sbjct  1199  GFNAARLANIPEEVIQKGHRKAREFE  1224



>ref|XP_005354777.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Microtus 
ochrogaster]
Length=1229

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/960 (40%), Positives = 544/960 (57%), Gaps = 69/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +++S TLY+P DFL   + G R+WWE KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  259   DFNSSTLYVPEDFLNSCTPGMRKWWEIKSQNFDLVIFYKVGKFYELYHMDAVIGVSELGL  318

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  319   VFMKGNWAHSGFPEIAFGRFSDSLVQKGYKVARVEQTETPEMMEARCRKMAHVSKFDRVV  378

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +RE+C +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  379   RREVCRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RVYGVCFVDTSLG  435

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+I+     LS ET+ VL     + L   L+P S+
Sbjct  436   KFFMGQFSDDRHCSRFRTLVAHYPPVQILFEKGNLSTETKTVLKGSLSSCLQEGLIPGSQ  495

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVNA---  1761
             FWDA KT+  +                   + + +  ++ D  +  LP VL  + +    
Sbjct  496   FWDATKTLRTLLE-----------------EGYFTGKLNEDGGV-ALPGVLKSMTSGSDS  537

Query  1762  -----GENGTYALSALGGTLFYLKQAFLDVSLLKFAEF-ELLPFSHFGMIAQKP------  1905
                  GEN   ALSALGG +FYLK+  +D  LL  A F E  P     +   +P      
Sbjct  538   IGLTPGENSELALSALGGCVFYLKKCLIDQELLSMANFEEYFPLDSKMVTTVRPGAVFTK  597

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLE+F N  N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  598   ANQRMVLDAVTLNNLEVFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLCAPLCSPCAI  657

Query  2077  KERQDAVAGLKGVNLPG-VLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYE  2244
              +R DAV  L  + LP  + E    L +LPD+ERLL++I    +  ++     ++ V+YE
Sbjct  658   SDRLDAVEDL--MALPDKITEVTDLLKKLPDLERLLSKIHNIGSPLKSQNHPDSRAVMYE  715

Query  2245  DA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVK  2403
             +   +KK++  F+SAL G + M      +    D+  SK L  ++T     P    PD+ 
Sbjct  716   ETTYSKKKIIDFLSALEGFKVMCKIIGLMEDVADDFKSKTLKQVVTLQTKSPEGCFPDLN  775

Query  2404  LVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTS  2583
               + ++   FD   A  +G I P  G D +YD A   +R+ E SL ++L +Q+   G  +
Sbjct  776   TELNRWDTAFDHERARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRLGCRT  835

Query  2584  INYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERE  2760
             I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+
Sbjct  836   IVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRD  895

Query  2761  SKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQD  2940
               LK  ++R+   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D
Sbjct  896   MSLKDCMRRMFYNFDKNYKDWQSAVECIAVLDVLLCLANYSQGGDGPMCRPEIL-LPRED  954

Query  2941  NVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGKSTLL  3105
               P L  K   HP + T +     F+ ND+ +G       G +  +L+TGPNMGGKSTL+
Sbjct  955   RHPFLELKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEENGKAYCVLVTGPNMGGKSTLI  1013

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  ++AQ+G  VPA    L+PVDR+F R+GA D IM+G+STF  EL ETAS+L  A
Sbjct  1014  RQAGLLAVMAQMGCYVPAEVCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILRHA  1073

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  1074  TVHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSKNVSVRL  1133

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1134  GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1193



>ref|XP_006239797.2| PREDICTED: DNA mismatch repair protein Msh6 [Rattus norvegicus]
Length=1435

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/962 (40%), Positives = 544/962 (57%), Gaps = 74/962 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +Y+S TLY+P DFL   + G R+WW+FKS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  466   DYNSSTLYVPEDFLNSCTPGMRRWWQFKSQNFDLVIFYKVGKFYELYHMDAVIGVSELGL  525

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  526   IFMKGNWAHSGFPEIAFGRFSDSLVQKGYKVARVEQTETPEMMEARCRKMAHVSKFDRVV  585

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+  +  R YGVC VD +  
Sbjct  586   RREICRIITKGTQTY-SVLDGDPSENYSRYLLSLKEKEEDSSGHM--RAYGVCFVDTSLG  642

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  LGQF+DD  CS L +L+  + PV+I+     LS ET+ VL  +  + L   L+P S+
Sbjct  643   KFFLGQFSDDRHCSRLRTLVAHYPPVQILFEKGNLSTETKTVLKGYWSSCLQEGLIPGSQ  702

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVN----  1758
             FWDA KT+  +                    L       N+     LP VL  + +    
Sbjct  703   FWDATKTLRTL--------------------LEGGYFTGNEGSGAELPPVLKAMTSESDS  742

Query  1759  ----AGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE------------LLPFSHFGM  1890
                  GE    +LSALGG +FYLK+  +D  LL  A FE            + P + F  
Sbjct  743   VGLTPGEESELSLSALGGCVFYLKKCLIDQELLSMANFEEYFPLDSDMVGTVKPGAVFTK  802

Query  1891  IAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLE  2070
              +Q+  MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    
Sbjct  803   ASQR--MVLDAVTLSNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLCAPLCSPS  860

Query  2071  AIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLY  2241
             AI +R DA+  L  V    V E    L +LPD+ERLL++I    +  ++      + ++Y
Sbjct  861   AISDRLDAIEDLMAVP-DKVAEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDTRAIMY  919

Query  2242  EDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDV  2400
             E+   +KK++  F+SAL G + M      +    D   SK L  ++T     P    PD+
Sbjct  920   EETTYSKKKIIDFLSALEGFKVMCKITRLMEDVADGFKSKTLKQVVTLQTKSPKGRFPDL  979

Query  2401  KLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDT  2580
                + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L +Q+   G  
Sbjct  980   TAELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRIGCR  1039

Query  2581  SINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETER  2757
             +I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW  VI K +  L  AE  R
Sbjct  1040  NIVYWGIGRNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKVIEKKLSNLINAEERR  1099

Query  2758  ESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQ  2937
             ++ LK  ++RL   F ++H  W+  +   A LDVL+ L+  S   +GP CRP +  LP +
Sbjct  1100  DASLKDCMRRLFYNFDKNHKDWQSAVECTAVLDVLLCLASYSQGGDGPMCRP-VLLLPGE  1158

Query  2938  DNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG------GAGHSSFILLTGPNMGGKST  3099
             D  P L  K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKST
Sbjct  1159  DTHPFLELKGSRHPCI-TKTFFGDDFIPNDILIGCEEDAEADGKAYCVLVTGPNMGGKST  1217

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             L+RQ  L  ++AQ+G  VPA    L+PVDR+F R+GA D IM+G+STF  EL ETAS+L 
Sbjct  1218  LIRQAGLLAVMAQMGCYVPAELCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILR  1277

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V
Sbjct  1278  HATAHSLVLVDELGRGTATFDGTAIASAVVKELAETIKCRTLFSTHYHSLVEDYSKNVCV  1337

Query  3460  SLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+RE
Sbjct  1338  RLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKARE  1397

Query  3634  FE  3639
             FE
Sbjct  1398  FE  1399



>gb|KFV62076.1| DNA mismatch repair protein Msh6, partial [Picoides pubescens]
Length=1274

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/1046 (39%), Positives = 587/1046 (56%), Gaps = 78/1046 (7%)
 Frame = +1

Query  649   KAKKIKSGGNNKST---QSKAPTATGGVKV-IESVTNNLECVKASNGDDILTGNSAERFS  816
             K K+IK      S+   QS+ P     V V  +S   +    ++           +  F 
Sbjct  221   KRKEIKKPAKRSSSENEQSEPPKRVAAVSVEAKSKLTSFAAPESFESQANACSGGSSGFG  280

Query  817   MREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDK  993
             + E EKL +L +  ++DA RRR  D +YD  TLY+P D+L   + G R+WW+ KS++ D 
Sbjct  281   VWEHEKLDWLQEGKKKDARRRRQSDPDYDPHTLYVPEDYLNRCTPGMRRWWQLKSQNFDA  340

Query  994   VLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVV  1173
             V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V  V
Sbjct  341   VIFYKVGKFYELYHMDAVTGVSELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVARV  400

Query  1174  EQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLIAV  1332
             EQ ETPE +E R K  +     DKVV+REIC +ITKGT T   ++   P  +   YL+ V
Sbjct  401   EQTETPEMMEARCKATAHPTRFDKVVRREICRIITKGTQTYS-IMDCDPSENHHKYLLCV  459

Query  1333  TESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKL  1512
              E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++     
Sbjct  460   KEKEDSS----GQRVYGVCFVDTSVGKFHVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGN  515

Query  1513  LSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHP  1692
             LS +T+++L     + +   L+  S+FW+A KT+  +                 E     
Sbjct  516   LSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYFKE  560

Query  1693  SESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSLLK  1848
              E+ +N     +LP+V+  L        +  GEN   ALSALG  +FYL++  +D  LL 
Sbjct  561   KETSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGACVFYLQKCLIDQELLS  617

Query  1849  FAEFE-LLPF---------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQM  1998
              A FE  LP          S F    Q+  MVLD   L NLE+ +N  N  + GTL  ++
Sbjct  618   LANFEEYLPVDVNAAKATSSCFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTLLERI  675

Query  1999  NHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLPDMER  2175
             + C T FGKRLL+ WL  PL + ++I +R DAV  L  +++P  + E  + L +LPD+ER
Sbjct  676   DSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDL--LSVPDKMSEVGEHLKKLPDLER  733

Query  2176  LLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGATLD  2340
             LL +I +     ++     ++ + YE+   +KK++  F+SAL G + M     ++     
Sbjct  734   LLNKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMQEIVDAMEEVAS  793

Query  2341  NTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAA  2505
             +  SK+L  L+T     P    P++   +K++   FD  +A  +G I P  G D +YD A
Sbjct  794   DFKSKVLKQLVTREGQNPDGRFPELSAELKRWDTAFDHNQARKTGVITPKAGFDPDYDKA  853

Query  2506  CGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSK  2682
                +  VE  L ++L++Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+SS+
Sbjct  854   LQDIDAVEEDLKRYLEKQRKLLGYKSVMYWGAGKNRYQMEIPESVVSRHLPEEYELKSSR  913

Query  2683  KGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVL  2862
             KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA LDVL
Sbjct  914   KGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDQNSKAWQTAVECIAVLDVL  973

Query  2863  ISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG-  3039
             +SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ +G 
Sbjct  974   MSLANYSQDGDGPLCRPVIV-LPGDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIVIGS  1031

Query  3040  ----GAGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMG  3207
                 G+  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA +  L+P+DR+F R+G
Sbjct  1032  TDEDGSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEACRLTPIDRVFTRLG  1091

Query  3208  AKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHK  3387
             A D IM+G+STF  EL ET+ +L  AT++SLV +DELGRGT+T DG AIA +VL+    +
Sbjct  1092  ASDRIMSGESTFFVELSETSCILQHATKHSLVLMDELGRGTATFDGTAIASAVLKELAER  1151

Query  3388  VQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSY  3561
             ++CR +FSTHYH L  D      V L HMAC +         E +TFLYK   G CP+SY
Sbjct  1152  IKCRTLFSTHYHSLVEDCSHTGAVRLGHMACMVENESEDPSQETITFLYKFIEGACPKSY  1211

Query  3562  GVNVARLAGLPDNVLEKAAAKSREFE  3639
             G N ARLA +P+ V++K   K+REFE
Sbjct  1212  GFNAARLANIPEEVIQKGHRKAREFE  1237



>ref|XP_005508183.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Columba 
livia]
Length=1261

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/954 (40%), Positives = 549/954 (58%), Gaps = 61/954 (6%)
 Frame = +1

Query  895   YDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQ  1074
             YD  TLY+P D+L   + G R+WW+ KS++ D V+ +K+GKFYEL+ MDA IG  EL L 
Sbjct  294   YDPGTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVICYKVGKFYELYHMDAVIGVNELGLI  353

Query  1075  YMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVK  1242
             +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV+
Sbjct  354   FMKGTWAHSGFPETAFGRFSDVLVQKGYKVARVEQTETPEMMEARCKSAAHPTKFDKVVR  413

Query  1243  REICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATSK  1413
             REIC +ITKGT T   +L   P    + YL+ V E  ++S    G+R YGVC VD +  K
Sbjct  414   REICRIITKGTQTYS-ILDCDPSENHSKYLLCVKEKEESS----GQRVYGVCFVDTSVGK  468

Query  1414  VILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEF  1593
               +GQF+DD  CS   +L+  + PV+++     LS +T+++L     +     L+  S+F
Sbjct  469   FYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCFQEGLISGSQF  528

Query  1594  WDAEKTISEV--KNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-VNAG  1764
             W+A KT+  +  +  ++   N     S+N   L P         +++L +    L +  G
Sbjct  529   WNASKTLKVLLEEEYFKEKQN-----SENGCSLPPV--------IKSLTSESDSLGLTPG  575

Query  1765  ENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF---------SHFGMIAQKPYMV  1914
             EN   ALSALGG +FYLK+  +D  LL  A FE  +P          S    +     MV
Sbjct  576   ENSELALSALGGCVFYLKKCLIDQELLSLANFEEYVPVDIDTAKTISSRSFFVKTDQRMV  635

Query  1915  LDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDA  2094
             LD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DA
Sbjct  636   LDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDA  695

Query  2095  VAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AK  2256
             V  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + YE+   +K
Sbjct  696   VEDLLAV--PHKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSK  753

Query  2257  KQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQF  2421
             K++  F+SAL G + M      +     +  S++L  L+T     P    PD+   +K++
Sbjct  754   KKIADFLSALEGFKVMNEIVDVMEEVASDFKSEVLKQLVTRKAKNPDGRFPDLSAELKRW  813

Query  2422  KDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTV  2601
                FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   
Sbjct  814   DTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGA  873

Query  2602  GKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSI  2778
             GK+ Y +E+PES+    +P+EYEL+SS+KGY RYW   I +++  +  AE  R++ LK  
Sbjct  874   GKNRYQMEIPESVISRNLPEEYELKSSRKGYKRYWTKEIERMLAAMVNAEERRDAALKDC  933

Query  2779  LQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLV  2958
             ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP     P L 
Sbjct  934   MRRLFYNFDQNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLE  992

Query  2959  AKSLGHPILRTDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLA  3123
              K+  HP + T +     F+ ND+ +G         +S +L+TGPNMGGKSTL+RQ  L 
Sbjct  993   LKNSRHPCI-TKTFFGDDFIPNDIVIGSKDEESGSEASCVLVTGPNMGGKSTLMRQAGLL  1051

Query  3124  VILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLV  3303
             VI+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV
Sbjct  1052  VIMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLV  1111

Query  3304  ALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACH  3483
              +DELGRGT+T DG AIA +V++    +++CR +FSTHYH L  DY  +  V L HMAC 
Sbjct  1112  LVDELGRGTATFDGTAIASAVVKELAERIRCRTLFSTHYHSLVEDYSHNGAVRLGHMACM  1171

Query  3484  IGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1172  VENESEDPSQETITFLYKFIEGACPKSYGFNAARLADIPEEVIQKGHRKAKEFE  1225



>ref|XP_005508182.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Columba 
livia]
Length=1260

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/954 (40%), Positives = 549/954 (58%), Gaps = 61/954 (6%)
 Frame = +1

Query  895   YDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQ  1074
             YD  TLY+P D+L   + G R+WW+ KS++ D V+ +K+GKFYEL+ MDA IG  EL L 
Sbjct  293   YDPGTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVICYKVGKFYELYHMDAVIGVNELGLI  352

Query  1075  YMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVK  1242
             +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV+
Sbjct  353   FMKGTWAHSGFPETAFGRFSDVLVQKGYKVARVEQTETPEMMEARCKSAAHPTKFDKVVR  412

Query  1243  REICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATSK  1413
             REIC +ITKGT T   +L   P    + YL+ V E  ++S    G+R YGVC VD +  K
Sbjct  413   REICRIITKGTQTYS-ILDCDPSENHSKYLLCVKEKEESS----GQRVYGVCFVDTSVGK  467

Query  1414  VILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEF  1593
               +GQF+DD  CS   +L+  + PV+++     LS +T+++L     +     L+  S+F
Sbjct  468   FYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCFQEGLISGSQF  527

Query  1594  WDAEKTISEV--KNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-VNAG  1764
             W+A KT+  +  +  ++   N     S+N   L P         +++L +    L +  G
Sbjct  528   WNASKTLKVLLEEEYFKEKQN-----SENGCSLPPV--------IKSLTSESDSLGLTPG  574

Query  1765  ENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF---------SHFGMIAQKPYMV  1914
             EN   ALSALGG +FYLK+  +D  LL  A FE  +P          S    +     MV
Sbjct  575   ENSELALSALGGCVFYLKKCLIDQELLSLANFEEYVPVDIDTAKTISSRSFFVKTDQRMV  634

Query  1915  LDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDA  2094
             LD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DA
Sbjct  635   LDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDA  694

Query  2095  VAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AK  2256
             V  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + YE+   +K
Sbjct  695   VEDLLAV--PHKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSK  752

Query  2257  KQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQF  2421
             K++  F+SAL G + M      +     +  S++L  L+T     P    PD+   +K++
Sbjct  753   KKIADFLSALEGFKVMNEIVDVMEEVASDFKSEVLKQLVTRKAKNPDGRFPDLSAELKRW  812

Query  2422  KDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTV  2601
                FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   
Sbjct  813   DTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGA  872

Query  2602  GKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSI  2778
             GK+ Y +E+PES+    +P+EYEL+SS+KGY RYW   I +++  +  AE  R++ LK  
Sbjct  873   GKNRYQMEIPESVISRNLPEEYELKSSRKGYKRYWTKEIERMLAAMVNAEERRDAALKDC  932

Query  2779  LQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLV  2958
             ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP     P L 
Sbjct  933   MRRLFYNFDQNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLE  991

Query  2959  AKSLGHPILRTDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLA  3123
              K+  HP + T +     F+ ND+ +G         +S +L+TGPNMGGKSTL+RQ  L 
Sbjct  992   LKNSRHPCI-TKTFFGDDFIPNDIVIGSKDEESGSEASCVLVTGPNMGGKSTLMRQAGLL  1050

Query  3124  VILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLV  3303
             VI+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV
Sbjct  1051  VIMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLV  1110

Query  3304  ALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACH  3483
              +DELGRGT+T DG AIA +V++    +++CR +FSTHYH L  DY  +  V L HMAC 
Sbjct  1111  LVDELGRGTATFDGTAIASAVVKELAERIRCRTLFSTHYHSLVEDYSHNGAVRLGHMACM  1170

Query  3484  IGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1171  VENESEDPSQETITFLYKFIEGACPKSYGFNAARLADIPEEVIQKGHRKAKEFE  1224



>ref|XP_005662624.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X3 [Sus scrofa]
Length=1231

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/960 (40%), Positives = 550/960 (57%), Gaps = 68/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  260   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVSELGL  319

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  320   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVV  379

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC VITKGT T   +L   P    + YL+++ E    S+     R YGVC VD +  
Sbjct  380   RREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKEDDSSGHT--RVYGVCFVDTSLG  436

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  437   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGSLSTETKMILKGSLSSSLQEGLIPGSQ  496

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + + ++ ++ D+ +  LP VL  +      
Sbjct  497   FWDAGKTLRTLLE-----------------EGYFTDKLNEDSGVM-LPQVLKGMTSESDS  538

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  539   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDVVSASRPGAVFAK  598

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N+ N    GTL  +++ C T FGKRLL+ WL  PL +  AI
Sbjct  599   ANQRMVLDAVTLNNLEIFLNATNGSPEGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPYAI  658

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  659   SDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  717

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + +      +   +D+  SK+L  +LT     P    PD+ +
Sbjct  718   TTYSKKKIIDFLSALEGFKVICKIRGIMEEVIDDFKSKILKQVLTLQTKNPEGRFPDLTV  777

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  778   ELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTI  837

Query  2587  NYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  838   VYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDV  897

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D 
Sbjct  898   SLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLANYSRGGDGPMCRPVIL-LPGEDT  956

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTLL  3105
              P L  K   HP + T +     F+ ND+ +G          +  +L+TGPNMGGKSTL+
Sbjct  957   PPFLYLKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEEENDKAYCVLVTGPNMGGKSTLM  1015

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  1016  RQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  1075

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  1076  TAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRL  1135

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1136  GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1195



>ref|XP_010126363.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Chlamydotis 
macqueenii]
Length=1264

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/989 (39%), Positives = 567/989 (57%), Gaps = 74/989 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  268   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  327

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+ +K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   ++ L +KGY++ 
Sbjct  328   DAVICYKVGKFYELYHMDAVIGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKIA  387

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  388   RVEQTETPEMMETRCKSMAHPTKFDKVVRREICRIITKGTQTYS-ILDCDPSENHNKYLL  446

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  447   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  502

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  503   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  547

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
               +++ +N     +LP+V+  L        +  GE+   ALSALGG +FYLK+  +D  L
Sbjct  548   KENQNSENGC---SLPSVIKSLTSESDSLGLTPGEDSELALSALGGCVFYLKKCLIDQEL  604

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L    FE  +P            S FG   Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  605   LSLGNFEEYVPVDIDTAKTVSSSSFFGKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  662

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V    V E  + L +LPD
Sbjct  663   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-DKVSEVSEHLKKLPD  721

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+S L G + M      +  
Sbjct  722   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSTLEGFKVMNEIVDVMEE  781

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +Y
Sbjct  782   IASDFKSKILKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPDY  841

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL+
Sbjct  842   DKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESVISRNLPEEYELK  901

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  902   STRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  961

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+ 
Sbjct  962   DVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDIV  1019

Query  3034  LGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA +  L+P+DR+F 
Sbjct  1020  IGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEACRLTPIDRVFT  1079

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT++SLV +DELGRGT+T DG AIA +V++  
Sbjct  1080  RLGASDRIMSGESTFFVELSETSSILQHATQHSLVLVDELGRGTATFDGTAIASAVVKEL  1139

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K+QCR +FSTHYH L  D+  +  V L HMAC +         E +TFLYK   G CP
Sbjct  1140  AEKIQCRTLFSTHYHSLVEDHSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGACP  1199

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +SYG N ARLA +P+ V++K   K++EFE
Sbjct  1200  KSYGFNAARLANIPEEVIQKGHRKAKEFE  1228



>ref|XP_008698065.1| PREDICTED: DNA mismatch repair protein Msh6 [Ursus maritimus]
Length=1260

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/961 (40%), Positives = 553/961 (58%), Gaps = 72/961 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  291   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  350

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  351   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVV  410

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC VITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  411   RREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RVYGVCFVDTSLG  467

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  468   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSTETKMILKGSLSSSLQEGLIPGSQ  527

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + +  E ++ D+ +  LP VL  +      
Sbjct  528   FWDAAKTLRTLLE-----------------EGYFKEKLNEDSGVM-LPQVLKGMTSESDS  569

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A  P      
Sbjct  570   LGLTPGEKSELALSALGGCIFYLKKCLIDQELLSMANFEEYIPLDSDMVSATGPGAFFAK  629

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  630   ANQRMVLDAVTLNNLEIFMNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCSPYAI  689

Query  2077  KERQDAVAGLKGV--NLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLY  2241
              +R DA+  L  V   +  V++    L +LPD+ERLL++I    +  ++     ++ ++Y
Sbjct  690   NDRLDAIEDLMVVPDKISDVVDL---LKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMY  746

Query  2242  EDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDV  2400
             E+   +KK++  F+SAL G + +      +   +DN  SK+L  ++T     P    PD+
Sbjct  747   EETTYSKKKIIDFLSALEGFKVICKIIEIMEEDVDNFKSKILKQVVTLQTKTPEGRFPDL  806

Query  2401  KLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDT  2580
              L + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  
Sbjct  807   TLELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCR  866

Query  2581  SINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETER  2757
             +I Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K +  L  AE  R
Sbjct  867   TIVYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERR  926

Query  2758  ESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQ  2937
             ++ LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +
Sbjct  927   DTSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIL-LPEE  985

Query  2938  DNVPCLVAKSLGHP-ILRTDSLDKGAFVSNDVTLGGA----GHSSFILLTGPNMGGKSTL  3102
                P L  +   HP I++T   D   F+ ND+ +G      G +  +L+TGPNMGGKSTL
Sbjct  986   GTPPFLDLRGSRHPCIMKTFFGDD--FIPNDILIGCEEEENGKAYCVLVTGPNMGGKSTL  1043

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             +RQ  L  ++AQ G  +PA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ 
Sbjct  1044  MRQAGLLAVMAQTGCYIPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTH  1103

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V 
Sbjct  1104  ATAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVR  1163

Query  3463  LCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REF
Sbjct  1164  LGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREF  1223

Query  3637  E  3639
             E
Sbjct  1224  E  1224



>ref|XP_005324539.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X3 [Ictidomys 
tridecemlineatus]
Length=1231

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/1056 (38%), Positives = 592/1056 (56%), Gaps = 83/1056 (8%)
 Frame = +1

Query  640   VSTKAKKIKSGGN---NKSTQSKAPTATG-GVKVIESVTNNLECVKASNGDDILT-----  792
             V+ K K++ +G +    KS++ + P+ T     ++    N L    A    D        
Sbjct  167   VAPKRKRMVTGSSAFKRKSSRKEMPSTTKRAAGILSETKNTLSAFSAPQNSDSQAHVSGG  226

Query  793   GNSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
             G+++ R +    E L +L K +R  + RR     ++D+ TLY+P DFL   + G R+WW+
Sbjct  227   GDNSSRPTTWYHETLEWLKKEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ  286

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   ++ L +
Sbjct  287   IKSQNFDLVIFYKVGKFYELYHMDALIGVNELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ  346

Query  1150  KGYRVLVVEQIETPEQLELRRKK----GSKDKVVKREICAVITKGTLTEGEMLTVSPD--  1311
             KGY+V  VEQ ETPE +E R +K       D+VVKREIC +ITKGT T   +L   P   
Sbjct  347   KGYKVARVEQTETPEMMEARCRKMAHISKHDRVVKREICRIITKGTQTYS-VLEGDPSEN  405

Query  1312  -ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
              + YL+++ E  + S+     R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  406   YSKYLLSLKEKEEDSSGHT--RMYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV  463

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYS  1668
             +++     LS ET+ +L     + L   L P S+FWDA KT+  +               
Sbjct  464   QVLFEKGNLSVETKTILKSSLSSSLQEGLTPGSQFWDAAKTLRTLLE-------------  510

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQA  1824
                 + + +E ++ D+ +  LP VL ++        +  GE    ALSALGG +FYLK+ 
Sbjct  511   ----EGYFTEKLNEDSGVM-LPQVLKDMTSESDSIGLTPGEKSELALSALGGCVFYLKKC  565

Query  1825  FLDVSLLKFAEFE-LLPF----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCG  1971
              +D  LL  A FE  +P           + F    Q+  MVLDA  L NLEIF N  N  
Sbjct  566   LIDQELLSMANFEEYIPLDSDMVNTRSGAKFTKANQR--MVLDAVTLNNLEIFVNGTNGS  623

Query  1972  SSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPG-VLEFRKE  2148
             + GTL  +++ C T FGKRLL+ WL  PL    AI +R +A+  L  + +P  + E  + 
Sbjct  624   TEGTLLERIDTCHTIFGKRLLKQWLCAPLCSPFAINDRLNAIEDL--IVVPDKISEVTEL  681

Query  2149  LSRLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNA  2313
             L +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + M   
Sbjct  682   LKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKI  741

Query  2314  CFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCE  2478
                +   +D+  SK+L  ++T     P    PD+   + ++   FD  +A  +G I P  
Sbjct  742   IGIMEEVVDDFKSKILKQVVTLQTKNPEGCFPDLTSELNRWDTAFDHEKARKTGLITPKA  801

Query  2479  GVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLC-ELVP  2655
             G D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+     +P
Sbjct  802   GFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTHNLP  861

Query  2656  QEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELI  2835
             +EYEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+  +
Sbjct  862   EEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDISLKDCMRRLFYNFDKNYKDWQSAV  921

Query  2836  STIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAF  3015
               IA LDVLI L+  S   +GP CRP I  LP +D +P L  K   HP + T +     F
Sbjct  922   ECIAVLDVLICLANYSQGGDGPMCRPVIL-LPGEDTLPFLELKGSRHPCI-TKTFFGDDF  979

Query  3016  VSNDVTLGGA------GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLS  3177
             + ND+ +G        G +  +L+TGPNMGGKSTL+RQ  L  ++AQ+G  VPA    L+
Sbjct  980   IPNDILIGCEEEEKENGKAYCVLVTGPNMGGKSTLIRQAGLLAVMAQMGCYVPAEVCRLT  1039

Query  3178  PVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIA  3357
             PVDR+F R+GA D IM+G+STF  EL ETAS+L+ AT +SLV +DELGRGT+T DG AIA
Sbjct  1040  PVDRVFTRLGASDRIMSGESTFFVELSETASILTHATAHSLVLMDELGRGTATFDGTAIA  1099

Query  3358  ESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYK  3531
              +V++     ++CR +FSTHYH L  +Y ++  V L HMAC +         E +TFLYK
Sbjct  1100  NAVVKELAETIKCRTLFSTHYHSLVEEYSKNVAVRLGHMACMVENECEDPSQETITFLYK  1159

Query  3532  LTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
                G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1160  FIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1195



>ref|XP_007460044.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Lipotes 
vexillifer]
Length=1230

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/959 (40%), Positives = 551/959 (57%), Gaps = 67/959 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  260   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALTGVSELGL  319

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  320   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVV  379

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC VITKGT T   +L   P    + YL+++ E   +S+     R YGVC VD +  
Sbjct  380   RREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKDDSSSGH--ARVYGVCFVDTSLG  436

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  437   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSVETKMILKGSLSSSLQEGLIPGSQ  496

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + + ++ ++ D+ +  LP VL  +      
Sbjct  497   FWDAAKTLRTLLE-----------------EGYFTDKLNEDSGVV-LPQVLKGMTSESDS  538

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A  P      
Sbjct  539   VGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVRATGPGAVFAK  598

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL +   I
Sbjct  599   ASQRMVLDAVTLNNLEIFLNGTNGSTEGTLLDKIDTCYTPFGKRLLKQWLCAPLCNPCVI  658

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  659   SDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  717

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + +      +   +D+  S++L  +LT     P    PD+ L
Sbjct  718   TTYSKKKIIDFLSALEGFKVLCKIIGVMEEVIDDFKSEILKQVLTLQTKNPEGRFPDLTL  777

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  778   ELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTI  837

Query  2587  NYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I + +  L  AE  R+ 
Sbjct  838   VYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIERKLANLINAEERRDV  897

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D 
Sbjct  898   SLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLANYSRGGDGPMCRPVIL-LPEEDT  956

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGKSTLLR  3108
              P L  K   HP + T +     F+ ND+ +G       G +  +L+TGPNMGGKSTL+R
Sbjct  957   PPFLDLKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEENGKAYCVLVTGPNMGGKSTLMR  1015

Query  3109  QVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSAT  3288
             Q  L V++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ AT
Sbjct  1016  QAGLLVVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHAT  1075

Query  3289  RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLC  3468
              +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L 
Sbjct  1076  AHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRLG  1135

Query  3469  HMACHIGEGLG--GLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1136  HMACMVENECDDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1194



>ref|XP_007942602.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X3 [Orycteropus 
afer afer]
Length=1229

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/960 (40%), Positives = 551/960 (57%), Gaps = 69/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TL++P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  259   DFDASTLHVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  318

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K       D+VV
Sbjct  319   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKHDRVV  378

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  379   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RMYGVCFVDTSLG  435

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  436   KFYIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSTETKMILKSSLSSSLQEGLIPGSQ  495

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + + +E ++ D+ +  LP VL ++      
Sbjct  496   FWDAAKTLRTLLE-----------------EGYFTEKLNGDSGVM-LPQVLKDMTSETDS  537

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  538   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYVPLDSDMVSATRPGAIFAK  597

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    +I
Sbjct  598   ANQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERIDTCHTPFGKRLLKQWLCAPLCSPFSI  657

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  658   NDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  716

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + M      +   +D+  SKLL  ++T     P    PD+  
Sbjct  717   TTYSKKKIIDFLSALEGFKVMCKIIEIMEEVIDDFKSKLLKQVITLQTKNPEGRFPDLTT  776

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  777   ELNRWDTAFDHEKARKTGIITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTI  836

Query  2587  NYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PES     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  837   VYWGIGRNRYQLEIPESFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDV  896

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  +A LDVL+ L+  S   +GP CRP I  LP  D 
Sbjct  897   SLKDCMRRLFYNFDKNYKDWQSAVECMAVLDVLLCLANYSRGGDGPMCRPVIL-LPEDDT  955

Query  2944  VPCLVAKSLGHP-ILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGKSTLL  3105
              P L  K   HP I++T   D   F+ ND+ +G       G +  +L+TGPNMGGKSTL+
Sbjct  956   PPFLELKGSRHPCIMKTFFGDD--FIPNDILIGCEEEEENGQAYCVLVTGPNMGGKSTLM  1013

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  1014  RQAGLLTVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  1073

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  1074  TAHSLVLVDELGRGTATFDGTAIAHAVVKELAESIKCRTLFSTHYHSLVEDYSQNVAVRL  1133

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1134  GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1193



>ref|XP_008160380.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X3 [Eptesicus 
fuscus]
Length=1059

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/960 (39%), Positives = 552/960 (58%), Gaps = 68/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G ++WW+ KS++ D V+F+K+GKFYEL+ MDA  G  EL L
Sbjct  88    DFDASTLYVPEDFLNSCTPGMKKWWQIKSQNFDLVIFYKVGKFYELYHMDALTGVSELGL  147

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K       D+VV
Sbjct  148   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKHDRVV  207

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + ++     R YGVC VD +  
Sbjct  208   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDTSGHT--RVYGVCFVDASLG  264

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQFADD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  265   KFFIGQFADDRHCSRFRTLVAHYPPVQVLFERGNLSTETKMILKGSLSSSLQEGLIPGSQ  324

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + +  E ++ D+ +  LP+VL  +      
Sbjct  325   FWDAAKTLRTLLE-----------------EGYFKEKLNEDSGVV-LPHVLKGMTSESDS  366

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  367   VGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDMVSATRPGAVFSK  426

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLD+  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL +  AI
Sbjct  427   ANQRMVLDSVTLNNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPFAI  486

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  487   NDRLDAIEDLMFVP-DKITEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  545

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + +     ++   +D+  SK+L  ++T     P    PD+ +
Sbjct  546   TTYSKKKIIDFLSALEGFKVICKIIGTMEEVIDDFKSKILKQVITLQTKNPEGHFPDLTV  605

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +++ E SL ++L++Q+   G  +I
Sbjct  606   ELNRWDTAFDHEKARKTGVITPKVGFDSDYDQALADIKENEQSLLEYLEKQRSRIGCRTI  665

Query  2587  NYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  666   VYWGIGRNRYQLEIPENFITHNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDV  725

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP +  LP +D 
Sbjct  726   SLKDCMRRLFYNFDKNYKNWQAAVECIAVLDVLLCLANYSRGGDGPMCRPVVL-LPKEDT  784

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTLL  3105
                L  K   HP + T +     F+ ND+ +G        G ++ +L+TGPNMGGKSTL+
Sbjct  785   PVFLDLKGSRHPCI-TKTFFGDDFIPNDILIGCEEKEEENGKAACVLVTGPNMGGKSTLM  843

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  844   RQAGLLAVIAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  903

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  904   TAHSLVLVDELGRGTATFDGTAIASAVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRL  963

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  964   GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1023



>ref|XP_010126364.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Chlamydotis 
macqueenii]
Length=1263

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/990 (39%), Positives = 568/990 (57%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  267   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  326

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+ +K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   ++ L +KGY++ 
Sbjct  327   DAVICYKVGKFYELYHMDAVIGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKIA  386

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  387   RVEQTETPEMMETRCKSMAHPTKFDKVVRREICRIITKGTQTYS-ILDCDPSENHNKYLL  445

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  446   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  501

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV-KNMYQRLNNTPIPYSQNEAD  1683
               LS +T+++L     + +   L+  S+FW+A KT+  + +  Y + N      S+N   
Sbjct  502   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKENQN----SENGC-  556

Query  1684  LHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVS  1839
                           +LP+V+  L        +  GE+   ALSALGG +FYLK+  +D  
Sbjct  557   --------------SLPSVIKSLTSESDSLGLTPGEDSELALSALGGCVFYLKKCLIDQE  602

Query  1840  LLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGT  1983
             LL    FE  +P            S FG   Q+  MVLD   L NLE+ +N  N  + GT
Sbjct  603   LLSLGNFEEYVPVDIDTAKTVSSSSFFGKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGT  660

Query  1984  LYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLP  2163
             L  +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V    V E  + L +LP
Sbjct  661   LLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-DKVSEVSEHLKKLP  719

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+S L G + M      + 
Sbjct  720   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSTLEGFKVMNEIVDVME  779

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  780   EIASDFKSKILKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  839

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL
Sbjct  840   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESVISRNLPEEYEL  899

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  900   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  959

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  960   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1017

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA +  L+P+DR+F
Sbjct  1018  VIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEACRLTPIDRVF  1077

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT++SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1078  TRLGASDRIMSGESTFFVELSETSSILQHATQHSLVLVDELGRGTATFDGTAIASAVVKE  1137

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K+QCR +FSTHYH L  D+  +  V L HMAC +         E +TFLYK   G C
Sbjct  1138  LAEKIQCRTLFSTHYHSLVEDHSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1197

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1198  PKSYGFNAARLANIPEEVIQKGHRKAKEFE  1227



>ref|XP_009646497.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X3 [Egretta 
garzetta]
Length=1264

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/989 (40%), Positives = 562/989 (57%), Gaps = 74/989 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    RR   + +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  268   FAVWEHEKLDWLQEGKKKDAHRRRQGEPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  327

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  328   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  387

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     D+VV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  388   RVEQTETPEMMETRCKSMAHPTKFDRVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  446

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  447   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  502

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + L   LV  S+FW+A KT+  +                 E   
Sbjct  503   GNLSVDTQKILKGSLVSCLQEGLVSGSQFWNASKTLKVL---------------LEEGYF  547

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N      LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  548   KEQQNSENGC---FLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  604

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  605   LSLANFEEYIPVDTDTAKTMNSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  662

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V      E  + L RLPD
Sbjct  663   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-HKTSEVSEHLKRLPD  721

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +  
Sbjct  722   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVMEE  781

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +Y
Sbjct  782   IASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKVGFDPDY  841

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+
Sbjct  842   DKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELK  901

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             SS+KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  902   SSRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  961

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ N++ 
Sbjct  962   DVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNNIV  1019

Query  3034  LGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F 
Sbjct  1020  IGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFT  1079

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++  
Sbjct  1080  RLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKEL  1139

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP
Sbjct  1140  AEKIKCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGACP  1199

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +SYG N ARLA +P+ V++K   K+ EFE
Sbjct  1200  KSYGFNAARLANIPEEVIQKGHRKAEEFE  1228



>ref|XP_009646495.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X1 [Egretta 
garzetta]
Length=1262

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/989 (40%), Positives = 562/989 (57%), Gaps = 74/989 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    RR   + +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  266   FAVWEHEKLDWLQEGKKKDAHRRRQGEPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  325

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  326   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  385

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     D+VV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  386   RVEQTETPEMMETRCKSMAHPTKFDRVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  444

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  445   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  500

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + L   LV  S+FW+A KT+  +                 E   
Sbjct  501   GNLSVDTQKILKGSLVSCLQEGLVSGSQFWNASKTLKVL---------------LEEGYF  545

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N      LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  546   KEQQNSENGC---FLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  602

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  603   LSLANFEEYIPVDTDTAKTMNSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  660

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V      E  + L RLPD
Sbjct  661   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-HKTSEVSEHLKRLPD  719

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +  
Sbjct  720   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVMEE  779

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +Y
Sbjct  780   IASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKVGFDPDY  839

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+
Sbjct  840   DKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELK  899

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             SS+KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  900   SSRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  959

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ N++ 
Sbjct  960   DVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNNIV  1017

Query  3034  LGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F 
Sbjct  1018  IGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFT  1077

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++  
Sbjct  1078  RLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKEL  1137

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP
Sbjct  1138  AEKIKCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGACP  1197

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +SYG N ARLA +P+ V++K   K+ EFE
Sbjct  1198  KSYGFNAARLANIPEEVIQKGHRKAEEFE  1226



>ref|XP_009646496.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X2 [Egretta 
garzetta]
Length=1263

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/989 (40%), Positives = 562/989 (57%), Gaps = 74/989 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    RR   + +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  267   FAVWEHEKLDWLQEGKKKDAHRRRQGEPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  326

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  327   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  386

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     D+VV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  387   RVEQTETPEMMETRCKSMAHPTKFDRVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  445

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  446   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  501

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + L   LV  S+FW+A KT+  +                 E   
Sbjct  502   GNLSVDTQKILKGSLVSCLQEGLVSGSQFWNASKTLKVL---------------LEEGYF  546

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N      LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  547   KEQQNSENGC---FLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  603

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  604   LSLANFEEYIPVDTDTAKTMNSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  661

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V      E  + L RLPD
Sbjct  662   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-HKTSEVSEHLKRLPD  720

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +  
Sbjct  721   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVMEE  780

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +Y
Sbjct  781   IASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKVGFDPDY  840

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+
Sbjct  841   DKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELK  900

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             SS+KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  901   SSRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  960

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ N++ 
Sbjct  961   DVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNNIV  1018

Query  3034  LGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F 
Sbjct  1019  IGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFT  1078

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++  
Sbjct  1079  RLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKEL  1138

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP
Sbjct  1139  AEKIKCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGACP  1198

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +SYG N ARLA +P+ V++K   K+ EFE
Sbjct  1199  KSYGFNAARLANIPEEVIQKGHRKAEEFE  1227



>gb|KFP45611.1| DNA mismatch repair protein Msh6, partial [Chlamydotis macqueenii]
Length=1277

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/990 (39%), Positives = 568/990 (57%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    R+   D +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  281   FAVWEHEKLDWLQEGKKKDAHRKRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  340

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+ +K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   ++ L +KGY++ 
Sbjct  341   DAVICYKVGKFYELYHMDAVIGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKIA  400

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  401   RVEQTETPEMMETRCKSMAHPTKFDKVVRREICRIITKGTQTYS-ILDCDPSENHNKYLL  459

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  460   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  515

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV-KNMYQRLNNTPIPYSQNEAD  1683
               LS +T+++L     + +   L+  S+FW+A KT+  + +  Y + N      S+N   
Sbjct  516   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKENQN----SENGC-  570

Query  1684  LHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVS  1839
                           +LP+V+  L        +  GE+   ALSALGG +FYLK+  +D  
Sbjct  571   --------------SLPSVIKSLTSESDSLGLTPGEDSELALSALGGCVFYLKKCLIDQE  616

Query  1840  LLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGT  1983
             LL    FE  +P            S FG   Q+  MVLD   L NLE+ +N  N  + GT
Sbjct  617   LLSLGNFEEYVPVDIDTAKTVSSSSFFGKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGT  674

Query  1984  LYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLP  2163
             L  +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V    V E  + L +LP
Sbjct  675   LLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-DKVSEVSEHLKKLP  733

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+S L G + M      + 
Sbjct  734   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSTLEGFKVMNEIVDVME  793

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  794   EIASDFKSKILKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  853

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL
Sbjct  854   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESVISRNLPEEYEL  913

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  914   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  973

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  974   LDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1031

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA +  L+P+DR+F
Sbjct  1032  VIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEACRLTPIDRVF  1091

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IM+G+STF  EL ET+S+L  AT++SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1092  TRLGASDRIMSGESTFFVELSETSSILQHATQHSLVLVDELGRGTATFDGTAIASAVVKE  1151

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K+QCR +FSTHYH L  D+  +  V L HMAC +         E +TFLYK   G C
Sbjct  1152  LAEKIQCRTLFSTHYHSLVEDHSHNVAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1211

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1212  PKSYGFNAARLANIPEEVIQKGHRKAKEFE  1241



>gb|EMC84167.1| DNA mismatch repair protein Msh6, partial [Columba livia]
Length=1247

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/954 (40%), Positives = 549/954 (58%), Gaps = 61/954 (6%)
 Frame = +1

Query  895   YDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQ  1074
             YD  TLY+P D+L   + G R+WW+ KS++ D V+ +K+GKFYEL+ MDA IG  EL L 
Sbjct  306   YDPGTLYVPEDYLNKCTPGMRRWWQLKSQNFDAVICYKVGKFYELYHMDAVIGVNELGLI  365

Query  1075  YMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVVK  1242
             +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R K  +     DKVV+
Sbjct  366   FMKGTWAHSGFPETAFGRFSDVLVQKGYKVARVEQTETPEMMEARCKSAAHPTKFDKVVR  425

Query  1243  REICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATSK  1413
             REIC +ITKGT T   +L   P    + YL+ V E  ++S    G+R YGVC VD +  K
Sbjct  426   REICRIITKGTQTYS-ILDCDPSENHSKYLLCVKEKEESS----GQRVYGVCFVDTSVGK  480

Query  1414  VILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEF  1593
               +GQF+DD  CS   +L+  + PV+++     LS +T+++L     +     L+  S+F
Sbjct  481   FYVGQFSDDRHCSRFRTLVAHYTPVQVLYEKGNLSVDTQKILKGSLVSCFQEGLISGSQF  540

Query  1594  WDAEKTISEV--KNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL-VNAG  1764
             W+A KT+  +  +  ++   N     S+N   L P         +++L +    L +  G
Sbjct  541   WNASKTLKVLLEEEYFKEKQN-----SENGCSLPPV--------IKSLTSESDSLGLTPG  587

Query  1765  ENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPF---------SHFGMIAQKPYMV  1914
             EN   ALSALGG +FYLK+  +D  LL  A FE  +P          S    +     MV
Sbjct  588   ENSELALSALGGCVFYLKKCLIDQELLSLANFEEYVPVDIDTAKTISSRSFFVKTDQRMV  647

Query  1915  LDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDA  2094
             LD   L NLE+ +N  N  + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DA
Sbjct  648   LDGVTLMNLEVLQNGTNGTTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDA  707

Query  2095  VAGLKGVNLPGVL-EFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AK  2256
             V  L  V  P  + E  + L +LPD+ERLL++I +     ++     ++ + YE+   +K
Sbjct  708   VEDLLAV--PHKMSEVSEHLKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSK  765

Query  2257  KQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQF  2421
             K++  F+SAL G + M      +     +  S++L  L+T     P    PD+   +K++
Sbjct  766   KKIADFLSALEGFKVMNEIVDVMEEVASDFKSEVLKQLVTRKAKNPDGRFPDLSAELKRW  825

Query  2422  KDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTV  2601
                FD  +A  +G I P  G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   
Sbjct  826   DTAFDHNQARKTGVITPKAGFDPDYDKALQDIKAVEEDLHKYLDKQRKLLGFKSVLYWGA  885

Query  2602  GKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSI  2778
             GK+ Y +E+PES+    +P+EYEL+SS+KGY RYW   I +++  +  AE  R++ LK  
Sbjct  886   GKNRYQMEIPESVISRNLPEEYELKSSRKGYKRYWTKEIERMLAAMVNAEERRDAALKDC  945

Query  2779  LQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLV  2958
             ++RL   F ++   W+  +  IA LDVL+SL+  S   +GP CRP I  LP     P L 
Sbjct  946   MRRLFYNFDQNSKDWQTAVECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLE  1004

Query  2959  AKSLGHPILRTDSLDKGAFVSNDVTLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLA  3123
              K+  HP + T +     F+ ND+ +G         +S +L+TGPNMGGKSTL+RQ  L 
Sbjct  1005  LKNSRHPCI-TKTFFGDDFIPNDIVIGSKDEESGSEASCVLVTGPNMGGKSTLMRQAGLL  1063

Query  3124  VILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLV  3303
             VI+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV
Sbjct  1064  VIMAQLGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLV  1123

Query  3304  ALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACH  3483
              +DELGRGT+T DG AIA +V++    +++CR +FSTHYH L  DY  +  V L HMAC 
Sbjct  1124  LVDELGRGTATFDGTAIASAVVKELAERIRCRTLFSTHYHSLVEDYSHNGAVRLGHMACM  1183

Query  3484  IGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1184  VENESEDPSQETITFLYKFIEGACPKSYGFNAARLADIPEEVIQKGHRKAKEFE  1237



>gb|KFQ05143.1| DNA mismatch repair protein Msh6, partial [Haliaeetus albicilla]
Length=1280

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/990 (40%), Positives = 565/990 (57%), Gaps = 76/990 (8%)
 Frame = +1

Query  811   FSMREMEKLGFLgk-grrdadrrrpgdVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +  ++DA RRR  D  YD  TL++P D+L   + G R+WW+ KS++ 
Sbjct  284   FAVWEHEKLDWLQEGKKKDAHRRRQSDPGYDPCTLHVPEDYLNKCTPGMRRWWQLKSQNF  343

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  344   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  403

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  404   RVEQTETPEMMETRYKSMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  462

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  463   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  518

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + +   L+  S+FW+A KT+  +                 E   
Sbjct  519   GNLSVDTQKILKGSLVSCIQEGLISGSQFWNASKTLKVL---------------LEEGYF  563

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N     +LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  564   KEKQNSENGC---SLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  620

Query  1843  LKFAEFE------------LLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE              P S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  621   LSLANFEEYVPVDIDTAKTTSPSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  678

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKELSRLP  2163
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V  P  + E  + L +LP
Sbjct  679   LERIDSCFTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAV--PDKMSEVSEHLKKLP  736

Query  2164  DMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLG  2328
             D+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      + 
Sbjct  737   DLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVME  796

Query  2329  ATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEE  2493
                 +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +
Sbjct  797   EIASDFKSKILKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKAGFDPD  856

Query  2494  YDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-VPQEYEL  2670
             YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES+    +P+EYEL
Sbjct  857   YDKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESVVSRNLPEEYEL  916

Query  2671  QSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAE  2850
             +S++KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA 
Sbjct  917   KSTRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAV  976

Query  2851  LDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDV  3030
             LDVL+SL+  S    GP CRP I  LP     P L  K+  HP + T +     F+ ND+
Sbjct  977   LDVLMSLANYSQDGGGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNDI  1034

Query  3031  TLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIF  3195
              +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F
Sbjct  1035  VIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVF  1094

Query  3196  VRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEH  3375
              R+GA D IMAG+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++ 
Sbjct  1095  TRLGASDRIMAGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKE  1154

Query  3376  FVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTC  3549
                K++CR +FSTHYH L  D+  +  V L HMAC +         E +TFLYK   G C
Sbjct  1155  LAEKIKCRTLFSTHYHSLVEDHSHNMAVRLGHMACMVENESEDPSQETITFLYKFIEGAC  1214

Query  3550  PRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             P+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1215  PKSYGFNAARLANIPEEVIQKGHRKAKEFE  1244



>ref|XP_003787948.1| PREDICTED: DNA mismatch repair protein Msh6-like isoform 2 [Otolemur 
garnettii]
Length=1056

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/965 (40%), Positives = 553/965 (57%), Gaps = 80/965 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  87    DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  146

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K       DKVV
Sbjct  147   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKHDKVV  206

Query  1240  KREICAVITKGTLT----EGEMLTVSPDAS-YLIAVTESCQTSANQLGERTYGVCVVDVA  1404
             +REIC VITKGT T    EG+    S D S YL+++ E   +S +    R YGVC VD +
Sbjct  207   RREICRVITKGTQTYSVLEGD---PSEDYSKYLLSLKEKEDSSGHT---RIYGVCFVDTS  260

Query  1405  TSKVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPL  1584
               K  +GQF+DD  CS   +L+  + PV+++     LS ET+ VL     + L   L P 
Sbjct  261   LGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSVETKTVLKGSLSSSLQEGLTPG  320

Query  1585  SEFWDAEKTIS-EVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL---  1752
             S+FWDA KT+   ++  Y R                  E +  D+ +  LP VL ++   
Sbjct  321   SQFWDACKTLRILLEEGYFR------------------EKLSEDSGVM-LPQVLKDMTSE  361

Query  1753  -----VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP---  1905
                  +  GE    ALSALGG +FYLK+  +D  LL  A FE   P     + A  P   
Sbjct  362   SDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYFPLDSDIVSATSPGAI  421

Query  1906  ------YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHL  2067
                    MVLDA  L NLEIF+N  N  + GTL  +++ C T FGKRLL+ WL  PL   
Sbjct  422   FMKANQRMVLDAVTLNNLEIFQNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCSP  481

Query  2068  EAIKERQDAVAGLKGVNLPG-VLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVV  2235
              AI +R DA+  L  +  P  + E    L +LPD+ERLL++I    +  ++     ++ +
Sbjct  482   YAISDRLDAIEDL--MAFPDKISEVVDLLKKLPDLERLLSKIHNVGSPMKSQNHPDSRAI  539

Query  2236  LYEDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT----PGKG-LP  2394
             +YE+   +KK++  F+SAL G + +      +   +D+  SK+L  ++T      +G  P
Sbjct  540   MYEETTYSKKKIIDFLSALEGFKVVCKIKDIMEEVVDDFKSKILKQIITLKTKSSQGHFP  599

Query  2395  DVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFG  2574
             D+ + + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G
Sbjct  600   DLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIG  659

Query  2575  DTSINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAET  2751
               +I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K + +L  AE 
Sbjct  660   CRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLADLINAEE  719

Query  2752  ERESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELP  2931
              R+  LK  ++RL   F +++  W+  +  +A LDVL+ L+  S   +GP CRP I  L 
Sbjct  720   RRDVSLKDCMRRLFYNFDKNYKDWQSAVECMAVLDVLLCLTNYSRGGDGPMCRPVI--LL  777

Query  2932  SQDNVPCLVAKSLGHP-ILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGG  3090
              +D  P L  K   HP I++T   D   F+ ND+ +G        G +  +L+TGPNMGG
Sbjct  778   PEDTAPFLELKGSRHPCIMKTFFGDD--FIPNDILIGCEEEEEENGKAYCVLVTGPNMGG  835

Query  3091  KSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETAS  3270
             KSTL+RQ  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS
Sbjct  836   KSTLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETAS  895

Query  3271  MLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQED  3450
             +L  AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++
Sbjct  896   ILKHATAHSLVLVDELGRGTATFDGTAIASAVVKELAETIKCRTLFSTHYHSLVEDYSQN  955

Query  3451  RQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAK  3624
               V L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K
Sbjct  956   VAVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRK  1015

Query  3625  SREFE  3639
             +REFE
Sbjct  1016  AREFE  1020



>gb|KFP10594.1| DNA mismatch repair protein Msh6, partial [Egretta garzetta]
Length=1277

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/989 (40%), Positives = 562/989 (57%), Gaps = 74/989 (7%)
 Frame = +1

Query  811   FSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHM  987
             F++ E EKL +L +G++    RR   + +YD  TLY+P D+L   + G R+WW+ KS++ 
Sbjct  281   FAVWEHEKLDWLQEGKKKDAHRRRQGEPDYDPCTLYVPEDYLNKCTPGMRRWWQLKSQNF  340

Query  988   DKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGYRVL  1167
             D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY+V 
Sbjct  341   DAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGYKVA  400

Query  1168  VVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---YLI  1326
              VEQ ETPE +E R K  +     D+VV+REIC +ITKGT T   +L   P  +   YL+
Sbjct  401   RVEQTETPEMMETRCKSMAHPTKFDRVVRREICRIITKGTQTYS-VLDCDPSENHNKYLL  459

Query  1327  AVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEIIKPA  1506
              V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++   
Sbjct  460   CVKEKEDSS----GQRVYGVCFVDTSVGKFYVGQFSDDRHCSRFRTLVAHYTPVQVLYEK  515

Query  1507  KLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYSQNEADL  1686
               LS +T+++L     + L   LV  S+FW+A KT+  +                 E   
Sbjct  516   GNLSVDTQKILKGSLVSCLQEGLVSGSQFWNASKTLKVL---------------LEEGYF  560

Query  1687  HPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAFLDVSL  1842
                ++ +N      LP+V+  L        +  GEN   ALSALGG +FYLK+  +D  L
Sbjct  561   KEQQNSENGC---FLPSVIKSLTSESDSLGLTPGENSELALSALGGCVFYLKKCLIDQEL  617

Query  1843  LKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCGSSGTL  1986
             L  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  + GTL
Sbjct  618   LSLANFEEYIPVDTDTAKTMNSSSFFAKTDQR--MVLDGVTLMNLEVLQNGTNGTTEGTL  675

Query  1987  YAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELSRLPD  2166
               +++ C T FGKRLL+ WL  PL + ++I +R DAV  L  V      E  + L RLPD
Sbjct  676   LERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAVEDLLAVP-HKTSEVSEHLKRLPD  734

Query  2167  MERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACFSLGA  2331
             +ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M      +  
Sbjct  735   LERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEIVDVMEE  794

Query  2332  TLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEY  2496
                +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  G D +Y
Sbjct  795   IASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKVGFDPDY  854

Query  2497  DAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQEYELQ  2673
             D A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P+EYEL+
Sbjct  855   DKALQDIKAVEEDLHKYLDKQRKLLGFKSMLYWGAGKNRYQMEIPESAISRNLPEEYELK  914

Query  2674  SSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELISTIAEL  2853
             SS+KGY RYW   I K++  +  AE  R++ LK  ++RL   F ++   W+  +  IA L
Sbjct  915   SSRKGYKRYWTKEIEKMLAAMVNAEERRDAALKDCMRRLFYNFDKNSKDWQTAVECIAVL  974

Query  2854  DVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVT  3033
             DVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F+ N++ 
Sbjct  975   DVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDFIPNNIV  1032

Query  3034  LGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVDRIFV  3198
             +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P+DR+F 
Sbjct  1033  IGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTPIDRVFT  1092

Query  3199  RMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESVLEHF  3378
             R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA +V++  
Sbjct  1093  RLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIASAVVKEL  1152

Query  3379  VHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCP  3552
               K++CR +FSTHYH L  DY  +  V L HMAC +         E +TFLYK   G CP
Sbjct  1153  AEKIKCRTLFSTHYHSLVEDYSHNAAVRLGHMACMVENESEDPSQETITFLYKFIEGACP  1212

Query  3553  RSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             +SYG N ARLA +P+ V++K   K+ EFE
Sbjct  1213  KSYGFNAARLANIPEEVIQKGHRKAEEFE  1241



>ref|XP_006880967.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X3 [Elephantulus 
edwardii]
Length=1160

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/959 (40%), Positives = 540/959 (56%), Gaps = 67/959 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D  TLY+P DFL   + G R+WW+ KS+H D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  190   DFDGSTLYVPEDFLNSCTPGMRKWWQIKSQHFDLVIFYKVGKFYELYHMDALIGVSELGL  249

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKK----GSKDKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R ++       D+VV
Sbjct  250   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRRMAHTSKHDRVV  309

Query  1240  KREICAVITKGTLTEGEMLTVSPDASY---LIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P  SY   L+++ E  + S+     R YGVC VD +  
Sbjct  310   RREICRIITKGTQTYS-VLEGEPSESYSKYLLSLKEKEEESSGHT--RVYGVCFVDTSMG  366

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF DD  CS L +L+  + PV+++     LS ET+ VL     + L   L+P S+
Sbjct  367   KFHVGQFPDDRHCSRLRTLVAHYTPVQVLFEKGNLSAETKMVLKSSLSSSLQEGLIPGSQ  426

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                     + +E ++ D  +  LP  L E+      
Sbjct  427   FWDAAKTLRTLLE-----------------GGYFTEKLNEDKGVM-LPQALKEMTSESDS  468

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A K       
Sbjct  469   IGLTPGERSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDMVSAPKSSALFAK  528

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL     I
Sbjct  529   AHQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERIDTCHTPFGKRLLKQWLCAPLCSPFPI  588

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIFASS---EANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I       ++     ++ ++YE+
Sbjct  589   NDRLDAIEDLMAVP-DKISEVADLLKKLPDLERLLSKIHTVGSPLKSQNHPDSRAIMYEE  647

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + M      +    D+  SKLL  ++T     P    PD+  
Sbjct  648   TTYSKKKIIDFLSALEGFKGMCKIIEIMEDVADDFKSKLLKQVITLQTKNPNCRFPDLTT  707

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +++ E SL ++L++Q+   G  SI
Sbjct  708   ELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIKENEQSLLEYLEKQRSRIGCRSI  767

Query  2587  NYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PES     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+ 
Sbjct  768   VYWGIGRNRYQLEIPESFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDV  827

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP  D 
Sbjct  828   SLKDCMRRLFFNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIM-LPEDDT  886

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGKSTLLR  3108
              P L  +   HP + T +     F+ ND+ +G       G +  +L+TGPNMGGKSTL+R
Sbjct  887   PPFLELRGSRHPCI-TKTFFGDDFIPNDILIGCEEEEENGKAYCVLVTGPNMGGKSTLMR  945

Query  3109  QVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSAT  3288
             Q  L  ++AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L  AT
Sbjct  946   QAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILKHAT  1005

Query  3289  RNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLC  3468
              +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L 
Sbjct  1006  AHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNYAVRLG  1065

Query  3469  HMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1066  HMACMVENECEDTSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1124



>ref|XP_006736892.1| PREDICTED: DNA mismatch repair protein Msh6 isoform X4 [Leptonychotes 
weddellii]
Length=1060

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/964 (39%), Positives = 551/964 (57%), Gaps = 75/964 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TL +P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  88    DFDASTLCVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  147

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  148   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVV  207

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC VITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  208   RREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGH--TRVYGVCFVDTSLG  264

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  265   KFFIGQFSDDRHCSRFRTLVAHYSPVQVLFEKGNLSTETKMILKGSLSSSLQEGLIPGSQ  324

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + +  E ++ D+ +  LP VL  +      
Sbjct  325   FWDAAKTLRTLLE-----------------EGYFKEKLNEDSGVM-LPQVLKGMTSESDS  366

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  367   LGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDMVSATRPGAVFAK  426

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  427   ANQRMVLDAVTLSNLEIFTNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCSPYAI  486

Query  2077  KERQDAVAGLKGV--NLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLY  2241
              +R DA+  L  V   +  V++    L +LPD+ERLL++I    +  ++     ++ ++Y
Sbjct  487   NDRLDAIEDLMVVPDKISDVVDL---LKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMY  543

Query  2242  EDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT------PGKGLPD  2397
             E+   +KK++  F+SAL G +        +   +DN  SK+L  ++T       G+  PD
Sbjct  544   EETTYSKKKIIDFLSALEGFKVACKIIEIMEEVVDNFKSKILKQVITLQTKNSEGR-FPD  602

Query  2398  VKLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGD  2577
             + + + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G 
Sbjct  603   LTIELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGC  662

Query  2578  TSINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETE  2754
              +I Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K +  L  AE  
Sbjct  663   RTIVYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEER  722

Query  2755  RESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPS  2934
             R+  LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP 
Sbjct  723   RDVSLKDCMRRLFFNFDKNYKDWQSAVECIAILDVLLCLANYSRGGDGPMCRPVIL-LPE  781

Query  2935  QDNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA-------GHSSFILLTGPNMGGK  3093
             +   P L  +   HP + T +     F+ ND+ +G         G +  +L+TGPNMGGK
Sbjct  782   EGTPPFLDLRGSRHPCI-TKTFFGDDFIPNDILIGCEEEEEEENGKAYCVLVTGPNMGGK  840

Query  3094  STLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASM  3273
             STL+RQ  L  ++AQVG  +PA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+
Sbjct  841   STLMRQAGLLAVMAQVGCYIPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASI  900

Query  3274  LSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDR  3453
             L+ AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++ 
Sbjct  901   LTHATAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNV  960

Query  3454  QVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKS  3627
              V L HMAC +         E +TFLYK   G CP+SYG N ARLA +P+ V++K   K+
Sbjct  961   AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANIPEEVIQKGHRKA  1020

Query  3628  REFE  3639
             REFE
Sbjct  1021  REFE  1024



>ref|XP_005709474.1| PREDICTED: LOW QUALITY PROTEIN: mutS homolog 6 [Capra hircus]
Length=1262

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/960 (40%), Positives = 553/960 (58%), Gaps = 68/960 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYE++ MDA IG  EL L
Sbjct  291   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYEMYHMDALIGVSELGL  350

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETP+ +E R +K +     D+VV
Sbjct  351   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPDMMEARCRKMAHTSKYDRVV  410

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
              REIC VITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  411   MREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEESSGHT--RVYGVCFVDTSLG  467

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             +  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  468   RFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSTETKMILKSSLSSSLQEGLIPGSQ  527

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + + ++ ++ D  +  LP VL  +      
Sbjct  528   FWDAAKTLRTLLE-----------------EGYFTDKLNEDGGVM-LPQVLRGMTAESDS  569

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  570   VGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYVPLDSDMVHATRPGAVFTK  629

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL +  AI
Sbjct  630   ANQRMVLDAVTLSNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPHAI  689

Query  2077  KERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYED  2247
              +R DA+  L  V    + E    L +LPD+ERLL++I    +  ++     ++ ++YE+
Sbjct  690   NDRLDAIEDLMVVP-DKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEE  748

Query  2248  A--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKL  2406
                +KK++  F+SAL G + +      +   +D+  SK+L  +LT     P    PD+  
Sbjct  749   TTYSKKKIIDFLSALEGFKVICKVIGVMEEVIDDFKSKILKQVLTLQTKNPEGRFPDLTS  808

Query  2407  VIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSI  2586
              + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  +I
Sbjct  809   ELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTI  868

Query  2587  NYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERES  2763
              Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K + +L +AE  R++
Sbjct  869   VYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLADLIKAEERRDT  928

Query  2764  KLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDN  2943
              LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D 
Sbjct  929   SLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLTNYSRGGDGPMCRPIIL-LPEEDT  987

Query  2944  VPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA------GHSSFILLTGPNMGGKSTLL  3105
              P L  K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKSTL+
Sbjct  988   PPFLDLKGSRHPCI-TKTFFGDDFIPNDILIGXEEEEEENGKAYCVLVTGPNMGGKSTLM  1046

Query  3106  RQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSA  3285
             RQ  L  I+AQ+G  VPA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+L+ A
Sbjct  1047  RQAGLLAIMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILTHA  1106

Query  3286  TRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSL  3465
             T +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V L
Sbjct  1107  TAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNIAVRL  1166

Query  3466  CHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
              HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1167  GHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1226



>ref|XP_007190110.1| PREDICTED: DNA mismatch repair protein Msh6 [Balaenoptera acutorostrata 
scammoni]
Length=1360

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/1053 (38%), Positives = 593/1053 (56%), Gaps = 77/1053 (7%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN---KSTQSKAPTATGGVKVIESVTNN----LECVKASNGDDILTG-  795
             V+ K K++ +G  +   KS++ + P+AT     I S T N        + S     ++G 
Sbjct  296   VAPKRKRMVTGNGSLKRKSSRKEMPSATKRATGISSETKNTLSAFSAPQNSESQAHISGG  355

Query  796   -NSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
              + + R ++   E L +L + +R    RR     ++D+ TLY+P DFL   + G R+WW+
Sbjct  356   CDDSSRPTIWYHETLEWLKEEKRRDTHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ  415

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   ++ L +
Sbjct  416   IKSQNFDLVIFYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ  475

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPD--  1311
             KGY+V  VEQ ETPE +E R +K +     D+VV+REIC VITKGT T   +L   P   
Sbjct  476   KGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRVITKGTQTYS-VLEGDPSEN  534

Query  1312  -ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
              + YL+++ E    S+     R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  535   YSKYLLSLKEKEDDSSGH--ARVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV  592

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYS  1668
             +++     LS ET+ +L     + L   L+P S+FWDA KT+  +               
Sbjct  593   QVLFEKGNLSVETKMILKSSLSSSLQEGLIPGSQFWDAAKTLRTLLE-------------  639

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQA  1824
                 + + ++ ++ D+ +  LP VL  +        +  GE    ALSALGG +FYLK+ 
Sbjct  640   ----EGYFTDKLNEDSGVM-LPQVLKGMTSESDSVGLTPGEKSELALSALGGCVFYLKKC  694

Query  1825  FLDVSLLKFAEFE-LLPFSHFGMIAQKP---------YMVLDAAALENLEIFENSKNCGS  1974
              +D  LL  A FE  +P     + A +P          MVLDA  L NLEIF N  N  +
Sbjct  695   LIDQELLSMANFEEYIPLDSDTVRATRPGAVFAKANQRMVLDAVTLNNLEIFLNGTNGST  754

Query  1975  SGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKELS  2154
              GTL  +++ C T FGKRLL+ WL  PL +   I +R DA+  L  V    + E    L 
Sbjct  755   EGTLLEKIDTCHTPFGKRLLKQWLCAPLCNPYVISDRLDAIEDLMVVP-DRISEVVDLLK  813

Query  2155  RLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNACF  2319
             +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + +     
Sbjct  814   KLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVLCKIIG  873

Query  2320  SLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCEGV  2484
              +   +D+  SK+L  +LT     P    PD+ L + ++   FD  +A  +G I P  G 
Sbjct  874   VMEEVIDDFKSKILKQVLTLQTKNPEGRFPDLTLELNRWDTAFDHEKARKTGLITPKAGF  933

Query  2485  DEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVPQE  2661
             D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+ +   +P+E
Sbjct  934   DSDYDQALADIRENEQSLLEYLEKQRSRIGCRTIVYWGIGRNRYQLEIPENFITRNLPEE  993

Query  2662  YELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELIST  2841
             YEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+  +  
Sbjct  994   YELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQAAVEC  1053

Query  2842  IAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAFVS  3021
             IA LDVL+ L+  S   +GP CRP I  LP +D  P L  K   HP + T +     F+ 
Sbjct  1054  IAVLDVLLCLANYSRGGDGPMCRPVIL-LPEEDTPPFLDLKGSRHPCI-TKTFFGDDFIP  1111

Query  3022  NDVTLGGA-----GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSPVD  3186
             ND+ +G       G +  +L+TGPNMGGKSTL+RQ  L V++AQ+G  VPA    L+P+D
Sbjct  1112  NDILIGCEEEEENGKAYCVLVTGPNMGGKSTLMRQAGLLVVMAQMGCYVPAEVCRLTPID  1171

Query  3187  RIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAESV  3366
             R+F R+GA D IM+G+STF  EL ETAS+L+ AT +SLV +DELGRGT+T DG AIA +V
Sbjct  1172  RVFTRLGASDRIMSGESTFFVELSETASILTHATAHSLVLVDELGRGTATFDGTAIANAV  1231

Query  3367  LEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKLTL  3540
             ++     ++CR +FSTHYH L  DY ++  V L HMAC +         E +TFLYK   
Sbjct  1232  VKELAENIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQETITFLYKFIK  1291

Query  3541  GTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
             G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1292  GACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1324



>ref|XP_004877705.1| PREDICTED: DNA mismatch repair protein Msh6-like [Heterocephalus 
glaber]
Length=1375

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/963 (40%), Positives = 554/963 (58%), Gaps = 72/963 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  406   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  465

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     DKVV
Sbjct  466   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDKVV  525

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  526   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RLYGVCFVDTSLG  582

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  583   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSVETKTILKGTLSSSLQEGLIPGSQ  642

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                     + +E ++ D  +  LP VL  +      
Sbjct  643   FWDATKTLQTLLE-----------------GGYFTEKLNEDTGVM-LPTVLKGMSSESDS  684

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     M++ +P      
Sbjct  685   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDS-DMVSIRPGAIFTK  743

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLE+F N  N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  744   ANQRMVLDAVTLNNLEVFLNGTNGSTEGTLLERIDTCYTPFGKRLLKQWLCAPLCSPFAI  803

Query  2077  KERQDAVAGLKGVNLPG-VLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYE  2244
              +R DAV  L  +++P  + E    L +LPD+ERLL++I    +  ++     ++ ++YE
Sbjct  804   NDRLDAVEDL--MDVPDKISEVADLLKKLPDLERLLSRIHNVGSPLKSQKHPDSRAIMYE  861

Query  2245  DA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVK  2403
             +   +KK++  F+SAL G + M      +   +D   SK+L  ++T     P    PD+ 
Sbjct  862   ETTYSKKKIIDFLSALEGFKVMCKIVEIMEEVVDEFKSKILKQVITLQTKNPEGRFPDLT  921

Query  2404  LVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTS  2583
             + + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L +Q+   G  +
Sbjct  922   IELNRWDTAFDHEKARRTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRIGCRT  981

Query  2584  INYVTVGKDAYLLEVPESLC-ELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERE  2760
             I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+
Sbjct  982   IVYWGIGRNRYQLEIPENFTTHNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRD  1041

Query  2761  SKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQD  2940
               LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D
Sbjct  1042  VSLKDCMRRLFYNFDKNYKDWQCAVDCIAVLDVLLCLANYSQGGDGPMCRPVIL-LPGED  1100

Query  2941  NVPCLVAKSLGHP-ILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGKSTL  3102
             N P L  K   HP I++T   D   F+ ND+ +G       G +  +L+TGPNMGGKSTL
Sbjct  1101  NPPFLELKGSRHPCIMKTFFGDD--FIPNDILIGCEEQEENGKAYCVLVTGPNMGGKSTL  1158

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             +RQ  L  ++AQ+G  VPA    L+PVDR+F R+GA D IM+G+STF  EL ETAS+L  
Sbjct  1159  IRQAGLLTVMAQMGCYVPAEVCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILRH  1218

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V 
Sbjct  1219  ATGHSLVLVDELGRGTATFDGTAIANAVVKELAETIRCRTLFSTHYHSLVEDYSKNVAVR  1278

Query  3463  LCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REF
Sbjct  1279  LGHMACMVENECEDPSQENITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREF  1338

Query  3637  EGV  3645
             E V
Sbjct  1339  EKV  1341



>ref|XP_004839467.1| PREDICTED: DNA mismatch repair protein Msh6-like [Heterocephalus 
glaber]
Length=1359

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/963 (40%), Positives = 554/963 (58%), Gaps = 72/963 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  390   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  449

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     DKVV
Sbjct  450   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDKVV  509

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  510   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RLYGVCFVDTSLG  566

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  567   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSVETKTILKGTLSSSLQEGLIPGSQ  626

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                     + +E ++ D  +  LP VL  +      
Sbjct  627   FWDATKTLQTLLE-----------------GGYFTEKLNEDTGVM-LPTVLKGMSSESDS  668

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     M++ +P      
Sbjct  669   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDS-DMVSIRPGAIFTK  727

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLE+F N  N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  728   ANQRMVLDAVTLNNLEVFLNGTNGSTEGTLLERIDTCYTPFGKRLLKQWLCAPLCSPFAI  787

Query  2077  KERQDAVAGLKGVNLPG-VLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYE  2244
              +R DAV  L  +++P  + E    L +LPD+ERLL++I    +  ++     ++ ++YE
Sbjct  788   NDRLDAVEDL--MDVPDKISEVADLLKKLPDLERLLSRIHNVGSPLKSQKHPDSRAIMYE  845

Query  2245  DA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVK  2403
             +   +KK++  F+SAL G + M      +   +D   SK+L  ++T     P    PD+ 
Sbjct  846   ETTYSKKKIIDFLSALEGFKVMCKIVEIMEEVVDEFKSKILKQVITLQTKNPEGRFPDLT  905

Query  2404  LVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTS  2583
             + + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L +Q+   G  +
Sbjct  906   IELNRWDTAFDHEKARRTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRIGCRT  965

Query  2584  INYVTVGKDAYLLEVPESLC-ELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERE  2760
             I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+
Sbjct  966   IVYWGIGRNRYQLEIPENFTTHNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRD  1025

Query  2761  SKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQD  2940
               LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D
Sbjct  1026  VSLKDCMRRLFYNFDKNYKDWQCAVDCIAVLDVLLCLANYSQGGDGPMCRPVIL-LPGED  1084

Query  2941  NVPCLVAKSLGHP-ILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGKSTL  3102
             N P L  K   HP I++T   D   F+ ND+ +G       G +  +L+TGPNMGGKSTL
Sbjct  1085  NPPFLELKGSRHPCIMKTFFGDD--FIPNDILIGCEEQEENGKAYCVLVTGPNMGGKSTL  1142

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             +RQ  L  ++AQ+G  VPA    L+PVDR+F R+GA D IM+G+STF  EL ETAS+L  
Sbjct  1143  IRQAGLLTVMAQMGCYVPAEVCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILRH  1202

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V 
Sbjct  1203  ATGHSLVLVDELGRGTATFDGTAIANAVVKELAETIRCRTLFSTHYHSLVEDYSKNVAVR  1262

Query  3463  LCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REF
Sbjct  1263  LGHMACMVENECEDPSQENITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREF  1322

Query  3637  EGV  3645
             E V
Sbjct  1323  EKV  1325



>ref|XP_006225732.2| PREDICTED: DNA mismatch repair protein Msh6 [Rattus norvegicus]
Length=1435

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/962 (40%), Positives = 543/962 (56%), Gaps = 74/962 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             +Y+S TLY+P DFL   + G R+WW+FKS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  466   DYNSSTLYVPEDFLNSCTPGMRRWWQFKSQNFDLVIFYKVGKFYELYHMDAVIGVSELGL  525

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  526   IFMKGNWAHSGFPEIAFGRFSDSLVQKGYKVARVEQTETPEMMEARCRKMAHVSKFDRVV  585

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+  +  R YGVC VD +  
Sbjct  586   RREICRIITKGTQTY-SVLDGDPSENYSRYLLSLKEKEEDSSGHM--RAYGVCFVDTSLG  642

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  LGQF+DD  CS L +L+  + PV+I+     LS ET+ VL     + L   L+P S+
Sbjct  643   KFFLGQFSDDRHCSRLRTLVAHYPPVQILFEKGNLSTETKTVLKGSLSSCLQEGLIPGSQ  702

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSELVN----  1758
             FWDA KT+  +                    L       N+     LP VL  + +    
Sbjct  703   FWDATKTLRTL--------------------LEGGYFTGNEGSGAELPPVLKAMTSESDS  742

Query  1759  ----AGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE------------LLPFSHFGM  1890
                  GE    +LSALGG +FYLK+  +D  LL  A FE            + P + F  
Sbjct  743   VGLTPGEESELSLSALGGCVFYLKKCLIDQELLSMANFEEYFPLDSDMVGTVKPGAVFTK  802

Query  1891  IAQKPYMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLE  2070
              +Q+  MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    
Sbjct  803   ASQR--MVLDAVTLSNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLCAPLCSPS  860

Query  2071  AIKERQDAVAGLKGVNLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLY  2241
             AI +R DA+  L  V    V E    L +LPD+ERLL++I    +  ++      + ++Y
Sbjct  861   AISDRLDAIEDLMAVP-DKVAEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDTRAIMY  919

Query  2242  EDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDV  2400
             E+   +KK++  F+SAL G + M      +    D   SK L  ++T     P    PD+
Sbjct  920   EETTYSKKKIIDFLSALEGFKVMCKITRLMEDVADGFKSKTLKQVVTLQTKSPKGRFPDL  979

Query  2401  KLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDT  2580
                + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L +Q+   G  
Sbjct  980   TAELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRIGCR  1039

Query  2581  SINYVTVGKDAYLLEVPESLCEL-VPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETER  2757
             +I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW  VI K +  L  AE  R
Sbjct  1040  NIVYWGIGRNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKVIEKKLSNLINAEERR  1099

Query  2758  ESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQ  2937
             ++ LK  ++RL   F ++H  W+  +   A LDVL+ L+  S   +GP CRP +  LP +
Sbjct  1100  DASLKDCMRRLFYNFDKNHKDWQSAVECTAVLDVLLCLASYSQGGDGPMCRP-VLLLPGE  1158

Query  2938  DNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLG------GAGHSSFILLTGPNMGGKST  3099
             D  P L  K   HP + T +     F+ ND+ +G        G +  +L+TGPNMGGKST
Sbjct  1159  DTHPFLELKGSRHPCI-TKTFFGDDFIPNDILIGCEEDAEADGKAYCVLVTGPNMGGKST  1217

Query  3100  LLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLS  3279
             L+RQ  L  ++AQ+G  VPA    L+PVDR+F R+GA D IM+G+STF  EL ETAS+L 
Sbjct  1218  LIRQAGLLAVMAQMGCYVPAELCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILR  1277

Query  3280  SATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQV  3459
              AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V
Sbjct  1278  HATAHSLVLVDELGRGTATFDGTAIASAVVKELAETIKCRTLFSTHYHSLVEDYSKNVCV  1337

Query  3460  SLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSRE  3633
              L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+RE
Sbjct  1338  RLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKARE  1397

Query  3634  FE  3639
             FE
Sbjct  1398  FE  1399



>ref|XP_009972937.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein Msh6 
[Tyto alba]
Length=1260

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/995 (40%), Positives = 569/995 (57%), Gaps = 82/995 (8%)
 Frame = +1

Query  802   AERFSMREMEKLGFLgkgrrdadrrrpg-dVNYDSRTLYLPSDFLKGLSGGQRQWWEFKS  978
             A  F++ E EKL +L +G+R    RR   D +YD  TLY+P D+L   + G R+WW+ KS
Sbjct  263   ASGFALWEHEKLDWLQEGKRKDAHRRRQGDPDYDPCTLYVPEDYLNKCTPGMRRWWQLKS  322

Query  979   KHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLARKGY  1158
             ++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +KGY
Sbjct  323   QNFDAVIFYKVGKFYELYHMDAVTGVNELGLIFMKGTWAHSGFPETAFGRFSDVLVQKGY  382

Query  1159  RVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPDAS---  1317
             +V  VEQ ETPE +E R K  +     DKVV+REIC +ITKGT T   +L   P  +   
Sbjct  383   KVARVEQTETPEMMETRYKAMAHPTKFDKVVRREICRIITKGTQTYS-VLDCDPSENHNK  441

Query  1318  YLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPVEII  1497
             YL++V E   +S    G+R YGVC VD +  K  +GQF+DD  CS   +L+  + PV+++
Sbjct  442   YLLSVKEKEDSS----GQRVYGVCFVDTSVGKFFVGQFSDDRHCSRFRTLVAHYTPVQVL  497

Query  1498  KPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV--KNMYQRLNNTPIPYSQ  1671
                  LS +T+++L     + +   L+  S+FW+A KT+  +  +  ++  +N     S+
Sbjct  498   YEKGNLSADTQKILKGSLVSCIQEGLISGSQFWNASKTLKVLLEEGYFKEKHN-----SE  552

Query  1672  NEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQAF  1827
             N                 +LP+VL+ L        +  GEN   ALSALGG +FYLK+  
Sbjct  553   NGC---------------SLPSVLNSLTSESDSLGLTPGENSELALSALGGCVFYLKKCL  597

Query  1828  LDVSLLKFAEFE-LLPF-----------SHFGMIAQKPYMVLDAAALENLEIFENSKNCG  1971
             +D  LL  A FE  +P            S F    Q+  MVLD   L NLE+ +N  N  
Sbjct  598   IDQELLSLANFEEYVPVDIDTAKTMSSGSFFAKTGQR--MVLDGVTLMNLEVLQNGTNGT  655

Query  1972  SSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVL-EFRKE  2148
             + GTL  +++ C T FGKRLL+ WL  PL + ++I +R DA+  L  V  P  L E  + 
Sbjct  656   TEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPKSINDRLDAIEDLLAV--PDKLSEVSEH  713

Query  2149  LSRLPDMERLLAQIFASS---EANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNA  2313
             L +LPD+ERLL++I +     ++     ++ + YE+   +KK++  F+SAL G + M   
Sbjct  714   LKKLPDLERLLSKIHSIGSPLKSQNHPDSRAIFYEEIKYSKKKIADFLSALEGFKVMNEI  773

Query  2314  CFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCE  2478
                +     +  SK+L  L+T     P    PD+   +K++   FD  +A  +G I P  
Sbjct  774   VDVMEEVASDFKSKVLKQLVTRKAKNPDGRFPDLSAELKRWDTAFDHNQARKTGVITPKA  833

Query  2479  GVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVP  2655
             G D +YD A   ++ VE  L K+L +Q+KL G  S+ Y   GK+ Y +E+PES +   +P
Sbjct  834   GFDPDYDKALQDIKTVEEDLHKYLDKQRKLLGFKSVLYWGAGKNRYQMEIPESAISRNLP  893

Query  2656  QEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELI  2835
             +EYEL+S++KGY RYW   I K++  +  AE    + LK  ++RL   F ++   W+  +
Sbjct  894   EEYELKSTRKGYKRYWTKEIEKMLAAMVNAE--EXAALKDCMRRLFYNFDKNSKDWQTAV  951

Query  2836  STIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAF  3015
               IA LDVL+SL+  S   +GP CRP I  LP     P L  K+  HP + T +     F
Sbjct  952   ECIAVLDVLMSLANYSQDGDGPLCRPVIL-LPVDSAPPFLELKNSRHPCI-TKTFFGDDF  1009

Query  3016  VSNDVTLGG-----AGHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSP  3180
             + ND+ +G      +  +S +L+TGPNMGGKSTL+RQ  L VI+AQ+G  VPA    L+P
Sbjct  1010  IPNDIVIGSKDEDSSSEASCVLVTGPNMGGKSTLMRQAGLLVIMAQLGCYVPAEVCRLTP  1069

Query  3181  VDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAE  3360
             +DR+F R+GA D IM+G+STF  EL ET+S+L  AT +SLV +DELGRGT+T DG AIA 
Sbjct  1070  IDRVFTRLGASDRIMSGESTFFVELSETSSILQHATEHSLVLVDELGRGTATFDGTAIAS  1129

Query  3361  SVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKL  3534
             +V++    K++CR +FSTHYH L  DY     V L HMAC +         E +TFLYK 
Sbjct  1130  AVVKELAEKIKCRTLFSTHYHSLVEDYSHTAAVRLGHMACMVENECEDPSQETITFLYKF  1189

Query  3535  TLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
               G CP+SYG N ARLA +P+ V++K   K++EFE
Sbjct  1190  IEGACPKSYGFNAARLADIPEEVIQKGHRKAKEFE  1224



>ref|XP_004328245.1| PREDICTED: DNA mismatch repair protein Msh6 isoform 1 [Tursiops 
truncatus]
Length=1361

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/1055 (38%), Positives = 594/1055 (56%), Gaps = 81/1055 (8%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN---KSTQSKAPTATGGVKVIESVTNN----LECVKASNGDDILTG-  795
             V+ K K++ +G  +   KS++ + P+AT     I S T N        + S     ++G 
Sbjct  297   VAPKRKRMITGNGSLKRKSSRKEMPSATKRATGISSETKNTLSAFSAPQNSESQAHVSGG  356

Query  796   -NSAERFSMREMEKLGFLgkgrrdadrrrpgd-VNYDSRTLYLPSDFLKGLSGGQRQWWE  969
              + + R ++   E L +L + +R    RR  D  ++D+ TLY+P DFL   + G R+WW+
Sbjct  357   CDDSSRPTIWYHETLEWLKEEKRRDKHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ  416

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+F+K+GKFYEL+ MDA  G  EL L +MKG   H GFPE  F   ++ L +
Sbjct  417   IKSQNFDLVIFYKVGKFYELYHMDALTGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ  476

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPD--  1311
             KGY+V  VEQ ETPE +E R +K +     D+VV+REIC VITKGT T   +L   P   
Sbjct  477   KGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRVITKGTQTYS-VLEGDPSEN  535

Query  1312  -ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
              + YL+++ E  + S+     R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  536   YSKYLLSLKEKEEDSSGH--ARVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV  593

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEVKNMYQRLNNTPIPYS  1668
             +++     LS ET+ +L     + L   L+P S+FWDA KT+  +               
Sbjct  594   QVLFEKGNLSVETKMILKGSLSSSLQEGLIPGSQFWDAAKTLRTLLE-------------  640

Query  1669  QNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQA  1824
                 + + ++ ++ D+ +  LP VL  +        +  GE    ALSALGG +FYLK+ 
Sbjct  641   ----EGYFTDKLNEDSGVM-LPQVLKGMTSESDSVGLTPGEKSELALSALGGCVFYLKKC  695

Query  1825  FLDVSLLKFAEFE------------LLPFSHFGMIAQKPYMVLDAAALENLEIFENSKNC  1968
              +D  LL  A FE            + P + F   +Q+  MVLDA  L NLEIF N  N 
Sbjct  696   LIDQELLSMANFEEYIPLDSDTVRAIGPGAVFAKASQR--MVLDAVTLSNLEIFLNGTNG  753

Query  1969  GSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGVNLPGVLEFRKE  2148
              + GTL  +++ C T FGKRLL+ WL  PL +   I +R DA+  L  V    + E    
Sbjct  754   STEGTLLDKIDTCYTPFGKRLLKQWLCAPLCNPYVISDRLDAIEDLMVVP-DKISEVVDL  812

Query  2149  LSRLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVNA  2313
             L +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + +   
Sbjct  813   LKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVLCKI  872

Query  2314  CFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPCE  2478
                +   +D+  SK+L  +LT     P    PD+ L + ++   FD  +A  +G I P  
Sbjct  873   IGVMEEVIDDFKSKILKQVLTLQAKNPEGRFPDLTLELNRWDTAFDHEKARKTGLITPKA  932

Query  2479  GVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPES-LCELVP  2655
             G D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+ +   +P
Sbjct  933   GFDSDYDQALADIRENEQSLLEYLEKQRSRIGCRTIVYWGIGRNRYQLEIPENFITRNLP  992

Query  2656  QEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWRELI  2835
             +EYEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+  +
Sbjct  993   EEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQAAV  1052

Query  2836  STIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGAF  3015
               IA LDVL+ L+  S   +GP CRP I  LP +D  P L  K   HP + T +     F
Sbjct  1053  ECIAVLDVLLCLANYSRGGDGPMCRPVIL-LPGEDTPPFLDLKGSRHPCI-TKTFFGDDF  1110

Query  3016  VSNDVTLGGA-----GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDLSP  3180
             + ND+ +G       G +  +L+TGPNMGGKSTL+RQ  L V++AQ+G  VPA    L+P
Sbjct  1111  IPNDILIGCEEEEENGKAYCVLVTGPNMGGKSTLMRQAGLLVVMAQMGCYVPAEVCRLTP  1170

Query  3181  VDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAIAE  3360
             +DR+F R+GA D IM+G+STF  EL ETAS+L  AT +SLV +DELGRGT+T DG AIA 
Sbjct  1171  IDRVFTRLGASDRIMSGESTFFVELSETASILKHATAHSLVLVDELGRGTATFDGTAIAN  1230

Query  3361  SVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLYKL  3534
             +V++     ++CR +FSTHYH L  DY ++  V L HMAC +         E +TFLYK 
Sbjct  1231  AVVKELAENIKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQETITFLYKF  1290

Query  3535  TLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREFE  3639
               G CP+SYG N ARLA LP+ V++K   K+REFE
Sbjct  1291  IKGACPKSYGFNAARLANLPEEVIQKGHRKAREFE  1325



>ref|XP_004403448.1| PREDICTED: DNA mismatch repair protein Msh6 isoform 2 [Odobenus 
rosmarus divergens]
Length=1233

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/964 (39%), Positives = 550/964 (57%), Gaps = 74/964 (8%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D  TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  260   DFDVSTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVSELGL  319

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     D+VV
Sbjct  320   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVV  379

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC VITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  380   RREICRVITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RAYGVCFVDTSLG  436

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  437   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSTETKMILKGSLSSSLQEGLIPGSQ  496

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                   + +  E ++ D+ +  LP VL  +      
Sbjct  497   FWDAAKTLRTLLE-----------------EGYFKEKLNEDSGVM-LPQVLKGMTSESDS  538

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     + A +P      
Sbjct  539   LGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDMVSATRPGAVFAK  598

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLEIF N  N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  599   ANQRMVLDAVTLSNLEIFMNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCAPLCSPYAI  658

Query  2077  KERQDAVAGLKGV--NLPGVLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLY  2241
              +R DA+  L  V   +  V++    L +LPD+ERLL++I    +  ++     ++ ++Y
Sbjct  659   NDRLDAIEDLMVVPDKISDVVDL---LKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMY  715

Query  2242  EDA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDV  2400
             E+   +KK++  F+SAL G + +      +   +DN  SK+L  ++T     P    PD+
Sbjct  716   EETTYSKKKIIDFLSALEGFKVICKIIEIMEEGVDNFKSKILKQVITLQTKNPEGRFPDL  775

Query  2401  KLVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDT  2580
              + + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L++Q+   G  
Sbjct  776   TIELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSRIGCR  835

Query  2581  SINYVTVGKDAYLLEVPES-LCELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETER  2757
             +I Y  +G++ Y LE+PE+ +   +P+EYEL+S+KKG  RYW   I K +  L  AE  R
Sbjct  836   TIVYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERR  895

Query  2758  ESKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQ  2937
             +  LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +
Sbjct  896   DVSLKDCMRRLFFNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIL-LPEE  954

Query  2938  DNVPCLVAKSLGHPILRTDSLDKGAFVSNDVTLGGA--------GHSSFILLTGPNMGGK  3093
                P L  +   HP + T +     F+ ND+ +G          G +  +L+TGPNMGGK
Sbjct  955   GTPPFLDLRGSRHPCI-TKTFFGDDFIPNDILIGCEEEEEEEENGKAYCVLVTGPNMGGK  1013

Query  3094  STLLRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASM  3273
             STL+RQ  L  ++AQ G  +PA    L+P+DR+F R+GA D IM+G+STF  EL ETAS+
Sbjct  1014  STLMRQAGLLAVMAQTGCYIPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASI  1073

Query  3274  LSSATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDR  3453
             L+ AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++ 
Sbjct  1074  LTHATAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNV  1133

Query  3454  QVSLCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKS  3627
              V L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+
Sbjct  1134  AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKA  1193

Query  3628  REFE  3639
             REFE
Sbjct  1194  REFE  1197



>gb|EHA98524.1| DNA mismatch repair protein Msh6 [Heterocephalus glaber]
Length=1363

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/963 (40%), Positives = 554/963 (58%), Gaps = 72/963 (7%)
 Frame = +1

Query  892   NYDSRTLYLPSDFLKGLSGGQRQWWEFKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDL  1071
             ++D+ TLY+P DFL   + G R+WW+ KS++ D V+F+K+GKFYEL+ MDA IG  EL L
Sbjct  394   DFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGL  453

Query  1072  QYMKGEQPHCGFPEKNFSMNAEKLARKGYRVLVVEQIETPEQLELRRKKGSK----DKVV  1239
              +MKG   H GFPE  F   ++ L +KGY+V  VEQ ETPE +E R +K +     DKVV
Sbjct  454   VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDKVV  513

Query  1240  KREICAVITKGTLTEGEMLTVSPD---ASYLIAVTESCQTSANQLGERTYGVCVVDVATS  1410
             +REIC +ITKGT T   +L   P    + YL+++ E  + S+     R YGVC VD +  
Sbjct  514   RREICRIITKGTQTYS-VLEGDPSENYSKYLLSLKEKEEDSSGHT--RLYGVCFVDTSLG  570

Query  1411  KVILGQFAddsdcsslcsllYEFRPVEIIKPAKLLSHETERVLHRHTRNPLVNELVPLSE  1590
             K  +GQF+DD  CS   +L+  + PV+++     LS ET+ +L     + L   L+P S+
Sbjct  571   KFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNLSVETKTILKGTLSSSLQEGLIPGSQ  630

Query  1591  FWDAEKTISEVKNMYQRLNNTPIPYSQNEADLHPSESIDNDAQLRNLPNVLSEL------  1752
             FWDA KT+  +                     + +E ++ D  +  LP VL  +      
Sbjct  631   FWDATKTLQTLLE-----------------GGYFTEKLNEDTGVM-LPTVLKGMSSESDS  672

Query  1753  --VNAGENGTYALSALGGTLFYLKQAFLDVSLLKFAEFE-LLPFSHFGMIAQKP------  1905
               +  GE    ALSALGG +FYLK+  +D  LL  A FE  +P     M++ +P      
Sbjct  673   IGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDS-DMVSIRPGAIFTK  731

Query  1906  ---YMVLDAAALENLEIFENSKNCGSSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAI  2076
                 MVLDA  L NLE+F N  N  + GTL  +++ C T FGKRLL+ WL  PL    AI
Sbjct  732   ANQRMVLDAVTLNNLEVFLNGTNGSTEGTLLERIDTCYTPFGKRLLKQWLCAPLCSPFAI  791

Query  2077  KERQDAVAGLKGVNLPG-VLEFRKELSRLPDMERLLAQIF---ASSEANGRNANKVVLYE  2244
              +R DAV  L  +++P  + E    L +LPD+ERLL++I    +  ++     ++ ++YE
Sbjct  792   NDRLDAVEDL--MDVPDKISEVADLLKKLPDLERLLSRIHNVGSPLKSQKHPDSRAIMYE  849

Query  2245  DA--AKKQLQQFISALRGCETMVNACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVK  2403
             +   +KK++  F+SAL G + M      +   +D   SK+L  ++T     P    PD+ 
Sbjct  850   ETTYSKKKIIDFLSALEGFKVMCKIVEIMEEVVDEFKSKILKQVITLQTKNPEGRFPDLT  909

Query  2404  LVIKQFKDGFDWVEANSSGRIIPCEGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTS  2583
             + + ++   FD  +A  +G I P  G D +YD A   +R+ E SL ++L +Q+   G  +
Sbjct  910   IELNRWDTAFDHEKARRTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRIGCRT  969

Query  2584  INYVTVGKDAYLLEVPESLC-ELVPQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERE  2760
             I Y  +G++ Y LE+PE+     +P+EYEL+S+KKG  RYW   I K +  L  AE  R+
Sbjct  970   IVYWGIGRNRYQLEIPENFTTHNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRD  1029

Query  2761  SKLKSILQRLIGRFCEHHSTWRELISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQD  2940
               LK  ++RL   F +++  W+  +  IA LDVL+ L+  S   +GP CRP I  LP +D
Sbjct  1030  VSLKDCMRRLFYNFDKNYKDWQCAVDCIAVLDVLLCLANYSQGGDGPMCRPVIL-LPGED  1088

Query  2941  NVPCLVAKSLGHP-ILRTDSLDKGAFVSNDVTLGGA-----GHSSFILLTGPNMGGKSTL  3102
             N P L  K   HP I++T   D   F+ ND+ +G       G +  +L+TGPNMGGKSTL
Sbjct  1089  NPPFLELKGSRHPCIMKTFFGDD--FIPNDILIGCEEQEENGKAYCVLVTGPNMGGKSTL  1146

Query  3103  LRQVCLAVILAQVGADVPAASFDLSPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSS  3282
             +RQ  L  ++AQ+G  VPA    L+PVDR+F R+GA D IM+G+STF  EL ETAS+L  
Sbjct  1147  IRQAGLLTVMAQMGCYVPAEVCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILRH  1206

Query  3283  ATRNSLVALDELGRGTSTSDGQAIAESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVS  3462
             AT +SLV +DELGRGT+T DG AIA +V++     ++CR +FSTHYH L  DY ++  V 
Sbjct  1207  ATGHSLVLVDELGRGTATFDGTAIANAVVKELAETIRCRTLFSTHYHSLVEDYSKNVAVR  1266

Query  3463  LCHMACHIGEGL--GGLEEVTFLYKLTLGTCPRSYGVNVARLAGLPDNVLEKAAAKSREF  3636
             L HMAC +         E +TFLYK   G CP+SYG N ARLA LP+ V++K   K+REF
Sbjct  1267  LGHMACMVENECEDPSQENITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREF  1326

Query  3637  EGV  3645
             E V
Sbjct  1327  EKV  1329



>ref|XP_010362592.1| PREDICTED: DNA mismatch repair protein Msh6 [Rhinopithecus roxellana]
Length=1261

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/1057 (38%), Positives = 592/1057 (56%), Gaps = 85/1057 (8%)
 Frame = +1

Query  640   VSTKAKKIKSGGNN---KSTQSKAPTATGGVKVIESVT-NNLECVKASNGDDILT-----  792
             V+ K K++ +G  +   KS++ + P+AT     I S T N L    A    +        
Sbjct  197   VARKRKRVVTGNGSLKRKSSRKEMPSATKRATGISSETKNTLSAFSAPQNSESQAHVSGG  256

Query  793   GNSAERFSMREMEKLGFLgkgrrdadrrrp-gdVNYDSRTLYLPSDFLKGLSGGQRQWWE  969
             G+ + R ++   E L +L + +R  + RR     ++++ TLY+P DFL   + G R+WW+
Sbjct  257   GDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFNASTLYVPEDFLNSCTPGMRKWWQ  316

Query  970   FKSKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQYMKGEQPHCGFPEKNFSMNAEKLAR  1149
              KS++ D V+ +K+GKFYEL+ MDA IG  EL L +MKG   H GFPE  F   ++ L +
Sbjct  317   IKSQNFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ  376

Query  1150  KGYRVLVVEQIETPEQLELRRKKGSK----DKVVKREICAVITKGTLTEGEMLTVSPD--  1311
             KGY+V  VEQ ETPE +E R +K +     D+VV+REIC +ITKGT T   +L   P   
Sbjct  377   KGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYS-VLEGDPSEN  435

Query  1312  -ASYLIAVTESCQTSANQLGERTYGVCVVDVATSKVILGQFAddsdcsslcsllYEFRPV  1488
              + YL+++ E  + S+     R YGVC VD +  K  +GQF+DD  CS   +L+  + PV
Sbjct  436   YSKYLLSLKEKEEDSSGHT--RAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV  493

Query  1489  EIIKPAKLLSHETERVLHRHTRNPLVNELVPLSEFWDAEKTISEV-KNMYQRLNNTPIPY  1665
             +++     LS ET+ +L     + L   L+P S+FWDA KT+  + +  Y R        
Sbjct  494   QVLFEKGNLSKETKTILKSSLSSSLQEGLIPGSQFWDASKTLRTLLEEGYFR--------  545

Query  1666  SQNEADLHPSESIDNDAQLRNLPNVLSEL--------VNAGENGTYALSALGGTLFYLKQ  1821
                       E + +D  +  LP VL  +        +  GE    ALSALGG +FYLK+
Sbjct  546   ----------EKLSDDIGV-TLPQVLKGMTSESDSIGLTPGEKSELALSALGGCIFYLKK  594

Query  1822  AFLDVSLLKFAEFE--------LLPFSHFGMIAQKPY--MVLDAAALENLEIFENSKNCG  1971
               +D  LL  A FE        ++  +  G I  K Y  MVLDA  L NLEIF N  N  
Sbjct  595   CLIDQELLSMANFEEYIPLDSDIVSTTRSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGS  654

Query  1972  SSGTLYAQMNHCVTAFGKRLLRTWLARPLYHLEAIKERQDAVAGLKGV--NLPGVLEFRK  2145
             + GTL  +++ C T FGKRLL+ WL  PL    AI +R DA+  L  V   +  V+E   
Sbjct  655   TEGTLLERVDTCHTPFGKRLLKQWLCAPLCSPYAINDRLDAIEDLMVVPDKISEVVEL--  712

Query  2146  ELSRLPDMERLLAQIF---ASSEANGRNANKVVLYEDA--AKKQLQQFISALRGCETMVN  2310
              L +LPD+ERLL++I    +  ++     ++ ++YE+   +KK++  F+SAL G + M  
Sbjct  713   -LKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCK  771

Query  2311  ACFSLGATLDNTDSKLLHDLLT-----PGKGLPDVKLVIKQFKDGFDWVEANSSGRIIPC  2475
                 +   +D+  SK+L  +++     P    PD+   + ++   FD  +A  +G I P 
Sbjct  772   IIGIMEEVIDDFKSKILKQVISLQTKNPEGRFPDLTTELNRWDTAFDHEKARKTGLITPK  831

Query  2476  EGVDEEYDAACGSLRKVELSLAKHLKEQQKLFGDTSINYVTVGKDAYLLEVPESLCEL-V  2652
              G D +YD A   +R+ E SL ++L++Q+   G  +I Y  +G++ Y LE+PE+     +
Sbjct  832   AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNL  891

Query  2653  PQEYELQSSKKGYFRYWNPVIRKLMGELSQAETERESKLKSILQRLIGRFCEHHSTWREL  2832
             P+EYEL+S+KKG  RYW   I K +  L  AE  R+  LK  ++RL   F +++  W+  
Sbjct  892   PEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSA  951

Query  2833  ISTIAELDVLISLSIASDYYEGPTCRPHIRELPSQDNVPCLVAKSLGHPILRTDSLDKGA  3012
             +  IA LDVL+ L+  S   +GP CRP I  L  +D  P L  K   HP + T +     
Sbjct  952   VECIAVLDVLLCLANYSRGGDGPMCRPVI--LLPEDTPPFLELKGSRHPCI-TKTFFGDD  1008

Query  3013  FVSNDVTLGGA------GHSSFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAASFDL  3174
             F+ ND+ +G        G +S +L+TGPNMGGKSTL+RQ  L  ++AQ+G  VPA    L
Sbjct  1009  FIPNDILIGCEEEEQENGKASCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAEVCRL  1068

Query  3175  SPVDRIFVRMGAKDHIMAGQSTFLTELLETASMLSSATRNSLVALDELGRGTSTSDGQAI  3354
             +P+DR+F R+GA D IM+G+STF  EL ETAS+L+ AT +SLV +DELGRGT+T DG AI
Sbjct  1069  TPIDRVFTRLGASDRIMSGESTFFVELSETASILTHATAHSLVLVDELGRGTATFDGTAI  1128

Query  3355  AESVLEHFVHKVQCRGMFSTHYHRLAIDYQEDRQVSLCHMACHIGEGL--GGLEEVTFLY  3528
             A +V++     ++CR +FSTHYH L  D