BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18608_g2_i1 len=1408 path=[1532:0-631 2164:632-684 2217:685-1246
2779:1247-1272 4256:1273-1407]

Length=1408
                                                                      Score     E

ref|XP_009790990.1|  PREDICTED: guanosine nucleotide diphosphate ...    794   0.0      
ref|XP_009593951.1|  PREDICTED: guanosine nucleotide diphosphate ...    791   0.0      
emb|CAB94202.1|  GDP dissociation inhibitor                             791   0.0      Solanum lycopersicum
ref|XP_004230543.1|  PREDICTED: guanosine nucleotide diphosphate ...    790   0.0      
ref|XP_006351732.1|  PREDICTED: rab GDP dissociation inhibitor al...    788   0.0      
gb|EYU39113.1|  hypothetical protein MIMGU_mgv1a006401mg                766   0.0      
ref|XP_008455143.1|  PREDICTED: guanosine nucleotide diphosphate ...    762   0.0      
ref|XP_007042842.1|  GDP dissociation inhibitor family protein / ...    760   0.0      
ref|XP_006423751.1|  hypothetical protein CICLE_v10029979mg             758   0.0      
ref|XP_004155432.1|  PREDICTED: rab GDP dissociation inhibitor al...    758   0.0      
ref|XP_006487500.1|  PREDICTED: rab GDP dissociation inhibitor al...    758   0.0      
emb|CDO97391.1|  unnamed protein product                                758   0.0      
ref|XP_004137066.1|  PREDICTED: rab GDP dissociation inhibitor al...    758   0.0      
ref|XP_007042843.1|  GDP dissociation inhibitor family protein / ...    756   0.0      
ref|XP_002268877.1|  PREDICTED: guanosine nucleotide diphosphate ...    755   0.0      Vitis vinifera
ref|XP_011092452.1|  PREDICTED: guanosine nucleotide diphosphate ...    754   0.0      
ref|XP_007199860.1|  hypothetical protein PRUPE_ppa005763mg             753   0.0      
ref|XP_008237140.1|  PREDICTED: guanosine nucleotide diphosphate ...    753   0.0      
ref|XP_002522655.1|  protein with unknown function                      747   0.0      Ricinus communis
ref|XP_003529259.1|  PREDICTED: rab GDP dissociation inhibitor al...    746   0.0      
emb|CDY21587.1|  BnaC09g47050D                                          745   0.0      
ref|XP_010422972.1|  PREDICTED: LOW QUALITY PROTEIN: guanosine nu...    744   0.0      
ref|XP_003531017.1|  PREDICTED: rab GDP dissociation inhibitor al...    744   0.0      
ref|XP_006584963.1|  PREDICTED: rab GDP dissociation inhibitor al...    744   0.0      
ref|XP_006289683.1|  hypothetical protein CARUB_v10003247mg             743   0.0      
ref|XP_004504841.1|  PREDICTED: rab GDP dissociation inhibitor al...    743   0.0      
ref|XP_009131116.1|  PREDICTED: guanosine nucleotide diphosphate ...    743   0.0      
ref|XP_009122523.1|  PREDICTED: guanosine nucleotide diphosphate ...    742   0.0      
ref|XP_010452948.1|  PREDICTED: guanosine nucleotide diphosphate ...    742   0.0      
emb|CDY56553.1|  BnaA03g55960D                                          742   0.0      
ref|XP_011023058.1|  PREDICTED: guanosine nucleotide diphosphate ...    742   0.0      
gb|KFK25257.1|  hypothetical protein AALP_AA8G088700                    741   0.0      
ref|XP_002310487.1|  hypothetical protein POPTR_0007s03250g             740   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009125364.1|  PREDICTED: guanosine nucleotide diphosphate ...    739   0.0      
ref|XP_002871374.1|  rab GDP-dissociation inhibitor                     739   0.0      
ref|XP_006399435.1|  hypothetical protein EUTSA_v10013547mg             739   0.0      
ref|NP_196517.3|  RAB GDP-dissociation inhibitor                        739   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010254526.1|  PREDICTED: guanosine nucleotide diphosphate ...    738   0.0      
gb|EPS65861.1|  hypothetical protein M569_08910                         738   0.0      
ref|XP_004288515.1|  PREDICTED: rab GDP dissociation inhibitor al...    733   0.0      
ref|XP_009416240.1|  PREDICTED: guanosine nucleotide diphosphate ...    733   0.0      
emb|CDX81131.1|  BnaC03g03850D                                          731   0.0      
emb|CDY44805.1|  BnaC02g00820D                                          739   0.0      
ref|XP_010030006.1|  PREDICTED: guanosine nucleotide diphosphate ...    731   0.0      
ref|XP_002533685.1|  protein with unknown function                      728   0.0      Ricinus communis
ref|XP_004251972.1|  PREDICTED: guanosine nucleotide diphosphate ...    728   0.0      
ref|XP_010547647.1|  PREDICTED: guanosine nucleotide diphosphate ...    727   0.0      
ref|XP_006584964.1|  PREDICTED: rab GDP dissociation inhibitor al...    726   0.0      
ref|XP_006351084.1|  PREDICTED: rab GDP dissociation inhibitor al...    727   0.0      
ref|XP_006344947.1|  PREDICTED: rab GDP dissociation inhibitor al...    727   0.0      
ref|XP_008236115.1|  PREDICTED: guanosine nucleotide diphosphate ...    727   0.0      
gb|EYU22361.1|  hypothetical protein MIMGU_mgv1a006444mg                726   0.0      
ref|XP_006441986.1|  hypothetical protein CICLE_v10020158mg             726   0.0      
ref|XP_008385671.1|  PREDICTED: guanosine nucleotide diphosphate ...    726   0.0      
ref|NP_001274860.1|  rab GDP dissociation inhibitor alpha-like          726   0.0      
gb|KDP29973.1|  hypothetical protein JCGZ_18740                         726   0.0      
ref|XP_007202054.1|  hypothetical protein PRUPE_ppa005772mg             725   0.0      
ref|XP_010277491.1|  PREDICTED: guanosine nucleotide diphosphate ...    725   0.0      
ref|XP_008243091.1|  PREDICTED: guanosine nucleotide diphosphate ...    724   0.0      
ref|XP_006478491.1|  PREDICTED: rab GDP dissociation inhibitor al...    724   0.0      
ref|XP_009629496.1|  PREDICTED: guanosine nucleotide diphosphate ...    724   0.0      
ref|XP_007205201.1|  hypothetical protein PRUPE_ppa005809mg             724   0.0      
ref|XP_009784522.1|  PREDICTED: guanosine nucleotide diphosphate ...    724   0.0      
ref|XP_009364258.1|  PREDICTED: guanosine nucleotide diphosphate ...    723   0.0      
ref|XP_008394248.1|  PREDICTED: guanosine nucleotide diphosphate ...    723   0.0      
ref|XP_010646794.1|  PREDICTED: guanosine nucleotide diphosphate ...    723   0.0      
ref|XP_010691404.1|  PREDICTED: guanosine nucleotide diphosphate ...    723   0.0      
ref|XP_006852946.1|  hypothetical protein AMTR_s00033p00239520          723   0.0      
emb|CAN64340.1|  hypothetical protein VITISV_031564                     723   0.0      Vitis vinifera
ref|XP_009620915.1|  PREDICTED: guanosine nucleotide diphosphate ...    723   0.0      
ref|XP_003608428.1|  Rab-GDP dissociation inhibitor                     723   0.0      
ref|XP_009380662.1|  PREDICTED: guanosine nucleotide diphosphate ...    722   0.0      
ref|XP_009419946.1|  PREDICTED: guanosine nucleotide diphosphate ...    722   0.0      
ref|XP_009345712.1|  PREDICTED: LOW QUALITY PROTEIN: guanosine nu...    722   0.0      
ref|XP_004138948.1|  PREDICTED: rab GDP dissociation inhibitor al...    721   0.0      
ref|XP_010251442.1|  PREDICTED: guanosine nucleotide diphosphate ...    721   0.0      
gb|AAW78520.1|  GDP dissociation inhibitor 1                            721   0.0      Solanum chilense
ref|XP_008354312.1|  PREDICTED: guanosine nucleotide diphosphate ...    721   0.0      
ref|XP_002513702.1|  protein with unknown function                      721   0.0      Ricinus communis
ref|XP_002280606.1|  PREDICTED: guanosine nucleotide diphosphate ...    721   0.0      Vitis vinifera
ref|XP_004244786.1|  PREDICTED: guanosine nucleotide diphosphate ...    721   0.0      
gb|KDP45816.1|  hypothetical protein JCGZ_17423                         721   0.0      
ref|XP_011074031.1|  PREDICTED: guanosine nucleotide diphosphate ...    721   0.0      
ref|XP_009404932.1|  PREDICTED: guanosine nucleotide diphosphate ...    721   0.0      
ref|XP_010908336.1|  PREDICTED: guanosine nucleotide diphosphate ...    720   0.0      
ref|XP_008788293.1|  PREDICTED: guanosine nucleotide diphosphate ...    720   0.0      
ref|XP_008363741.1|  PREDICTED: guanosine nucleotide diphosphate ...    720   0.0      
ref|XP_003531293.1|  PREDICTED: rab GDP dissociation inhibitor al...    720   0.0      
ref|XP_008441682.1|  PREDICTED: guanosine nucleotide diphosphate ...    720   0.0      
ref|XP_010937652.1|  PREDICTED: guanosine nucleotide diphosphate ...    720   0.0      
ref|XP_010520728.1|  PREDICTED: guanosine nucleotide diphosphate ...    720   0.0      
ref|XP_009410720.1|  PREDICTED: guanosine nucleotide diphosphate ...    720   0.0      
gb|ACN65853.1|  Rab GDP dissociation inhibitor                          719   0.0      Nicotiana benthamiana
ref|XP_007159145.1|  hypothetical protein PHAVU_002G212600g             719   0.0      
ref|XP_008812865.1|  PREDICTED: guanosine nucleotide diphosphate ...    719   0.0      
ref|XP_008784526.1|  PREDICTED: guanosine nucleotide diphosphate ...    719   0.0      
ref|XP_009366269.1|  PREDICTED: guanosine nucleotide diphosphate ...    718   0.0      
ref|XP_006372308.1|  GDP dissociation inhibitor family protein          718   0.0      
ref|XP_011014748.1|  PREDICTED: guanosine nucleotide diphosphate ...    718   0.0      
ref|XP_010277492.1|  PREDICTED: guanosine nucleotide diphosphate ...    717   0.0      
ref|XP_011004551.1|  PREDICTED: guanosine nucleotide diphosphate ...    717   0.0      
gb|AHF81486.1|  small GTP Rab-GDI                                       717   0.0      
ref|XP_007026461.1|  Guanosine nucleotide diphosphate dissociatio...    716   0.0      
ref|XP_006649851.1|  PREDICTED: rab GDP dissociation inhibitor be...    716   0.0      
gb|ABU98948.1|  GDP-dissociation inhibitor                              716   0.0      Lupinus albus
ref|XP_010907542.1|  PREDICTED: guanosine nucleotide diphosphate ...    715   0.0      
ref|XP_008801341.1|  PREDICTED: guanosine nucleotide diphosphate ...    715   0.0      
ref|XP_011074023.1|  PREDICTED: guanosine nucleotide diphosphate ...    715   0.0      
ref|XP_010277857.1|  PREDICTED: guanosine nucleotide diphosphate ...    715   0.0      
ref|NP_001276273.1|  rab GDP dissociation inhibitor alpha-like          715   0.0      
gb|ABK25073.1|  unknown                                                 715   0.0      Picea sitchensis
ref|XP_004983945.1|  PREDICTED: rab GDP dissociation inhibitor al...    714   0.0      
ref|XP_004287194.1|  PREDICTED: rab GDP dissociation inhibitor al...    714   0.0      
ref|XP_010672532.1|  PREDICTED: guanosine nucleotide diphosphate ...    714   0.0      
ref|NP_001150143.1|  rab GDP dissociation inhibitor alpha               712   0.0      Zea mays [maize]
ref|XP_007026462.1|  Guanosine nucleotide diphosphate dissociatio...    712   0.0      
gb|KHG05683.1|  Rab GDP dissociation inhibitor alpha                    711   0.0      
ref|XP_002310371.1|  GDP dissociation inhibitor family protein          711   0.0      Populus trichocarpa [western balsam poplar]
gb|EMT30538.1|  Rab GDP dissociation inhibitor alpha                    712   0.0      
ref|XP_003629947.1|  Rab GDP dissociation inhibitor                     711   0.0      
ref|NP_001266078.1|  rab GDP dissociation inhibitor alpha-like          711   0.0      
ref|XP_010920623.1|  PREDICTED: guanosine nucleotide diphosphate ...    711   0.0      
ref|XP_002465085.1|  hypothetical protein SORBIDRAFT_01g031830          711   0.0      Sorghum bicolor [broomcorn]
ref|XP_006654412.1|  PREDICTED: rab GDP dissociation inhibitor al...    710   0.0      
ref|XP_007159565.1|  hypothetical protein PHAVU_002G248100g             710   0.0      
emb|CAF02075.1|  GDP dissociation inhibitor                             709   0.0      Medicago truncatula
gb|ACL54441.1|  unknown                                                 709   0.0      Zea mays [maize]
ref|XP_010277493.1|  PREDICTED: guanosine nucleotide diphosphate ...    708   0.0      
gb|KHG21656.1|  Rab GDP dissociation inhibitor alpha                    708   0.0      
ref|XP_011005244.1|  PREDICTED: guanosine nucleotide diphosphate ...    709   0.0      
ref|XP_004962068.1|  PREDICTED: rab GDP dissociation inhibitor al...    708   0.0      
ref|XP_010067212.1|  PREDICTED: guanosine nucleotide diphosphate ...    707   0.0      
ref|XP_002439812.1|  hypothetical protein SORBIDRAFT_09g020540          707   0.0      Sorghum bicolor [broomcorn]
gb|EMS53287.1|  Rab GDP dissociation inhibitor alpha                    706   0.0      
dbj|BAJ93199.1|  predicted protein                                      706   0.0      
ref|NP_001055142.1|  Os05g0304400                                       706   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003558226.1|  PREDICTED: guanosine nucleotide diphosphate ...    705   0.0      
ref|XP_008801349.1|  PREDICTED: guanosine nucleotide diphosphate ...    704   0.0      
ref|NP_001049717.1|  Os03g0277000                                       705   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008649650.1|  PREDICTED: guanosine nucleotide diphosphate ...    705   0.0      
ref|XP_010101313.1|  Rab GDP dissociation inhibitor alpha               705   0.0      
ref|NP_001055566.1|  Os05g0418000                                       704   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001183437.1|  Rab GDP dissociation inhibitor alpha               703   0.0      
emb|CDP11069.1|  unnamed protein product                                703   0.0      
ref|XP_010524208.1|  PREDICTED: guanosine nucleotide diphosphate ...    703   0.0      
ref|XP_010107286.1|  Rab GDP dissociation inhibitor alpha               703   0.0      
ref|XP_006654244.1|  PREDICTED: rab GDP dissociation inhibitor al...    702   0.0      
ref|NP_001151199.1|  LOC100284832                                       701   0.0      Zea mays [maize]
ref|XP_004962065.1|  PREDICTED: rab GDP dissociation inhibitor al...    701   0.0      
ref|XP_003568439.1|  PREDICTED: guanosine nucleotide diphosphate ...    700   0.0      
ref|XP_003568438.1|  PREDICTED: guanosine nucleotide diphosphate ...    699   0.0      
dbj|BAK00943.1|  predicted protein                                      699   0.0      
ref|XP_010526899.1|  PREDICTED: guanosine nucleotide diphosphate ...    698   0.0      
ref|XP_006858694.1|  hypothetical protein AMTR_s00066p00096020          698   0.0      
gb|KCW56943.1|  hypothetical protein EUGRSUZ_I02620                     697   0.0      
ref|XP_004984243.1|  PREDICTED: rab GDP dissociation inhibitor al...    697   0.0      
gb|AAR06264.1|  GDP dissociation inhibitor protein                      697   0.0      Hordeum vulgare [barley]
ref|XP_010067472.1|  PREDICTED: guanosine nucleotide diphosphate ...    696   0.0      
gb|AAB69870.1|  GDP dissociation inhibitor protein OsGDI1               696   0.0      Oryza sativa [red rice]
ref|NP_001059344.1|  Os07g0271000                                       695   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006372309.1|  hypothetical protein POPTR_0017s00420g             694   0.0      
ref|XP_006657603.1|  PREDICTED: rab GDP dissociation inhibitor al...    692   0.0      
gb|ABR16699.1|  unknown                                                 691   0.0      Picea sitchensis
gb|EMT13931.1|  Rab GDP dissociation inhibitor alpha                    694   0.0      
ref|XP_002989142.1|  hypothetical protein SELMODRAFT_159958             690   0.0      
ref|NP_001140939.1|  uncharacterized protein LOC100273017               690   0.0      Zea mays [maize]
ref|XP_003557314.1|  PREDICTED: guanosine nucleotide diphosphate ...    690   0.0      
ref|XP_002987358.1|  hypothetical protein SELMODRAFT_271917             688   0.0      
gb|AAB69871.1|  GDP dissociation inhibitor protein OsGDI2               687   0.0      Oryza sativa [red rice]
gb|EMS53634.1|  Rab GDP dissociation inhibitor alpha                    691   0.0      
ref|NP_181938.1|  guanosine nucleotide diphosphate dissociation i...    687   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010067402.1|  PREDICTED: guanosine nucleotide diphosphate ...    686   0.0      
ref|XP_009420147.1|  PREDICTED: guanosine nucleotide diphosphate ...    686   0.0      
ref|XP_010512285.1|  PREDICTED: guanosine nucleotide diphosphate ...    685   0.0      
ref|XP_010413620.1|  PREDICTED: guanosine nucleotide diphosphate ...    685   0.0      
ref|XP_002880083.1|  ATGDI1                                             685   0.0      
ref|XP_006397585.1|  hypothetical protein EUTSA_v10001450mg             684   0.0      
ref|XP_006294223.1|  hypothetical protein CARUB_v10023221mg             684   0.0      
emb|CAA69258.1|  GDP-associated inhibitor                               684   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930328.1|  PREDICTED: guanosine nucleotide diphosphate ...    683   0.0      
gb|AIK01834.1|  GDP dissociation inhibitor                              684   0.0      
ref|XP_002876528.1|  ATGDI2                                             684   0.0      
ref|NP_001288917.1|  guanosine nucleotide diphosphate dissociatio...    684   0.0      
ref|XP_010067325.1|  PREDICTED: guanosine nucleotide diphosphate ...    684   0.0      
ref|XP_010469257.1|  PREDICTED: guanosine nucleotide diphosphate ...    684   0.0      
ref|NP_191551.1|  RAB GDP dissociation inhibitor 2                      683   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHN06485.1|  Rab GDP dissociation inhibitor alpha                    696   0.0      
gb|AAL38263.1|  GDP dissociation inhibitor                              683   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004962067.1|  PREDICTED: rab GDP dissociation inhibitor al...    684   0.0      
gb|AAM64484.1|  GDP dissociation inhibitor                              682   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508340.1|  PREDICTED: guanosine nucleotide diphosphate ...    682   0.0      
ref|XP_010517995.1|  PREDICTED: guanosine nucleotide diphosphate ...    682   0.0      
ref|XP_006291137.1|  hypothetical protein CARUB_v10017252mg             682   0.0      
gb|EEC81843.1|  hypothetical protein OsI_25604                          683   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002461825.1|  hypothetical protein SORBIDRAFT_02g008810          682   0.0      Sorghum bicolor [broomcorn]
gb|KFK37228.1|  hypothetical protein AALP_AA4G230400                    682   0.0      
ref|XP_010506315.1|  PREDICTED: guanosine nucleotide diphosphate ...    680   0.0      
ref|XP_006402639.1|  hypothetical protein EUTSA_v10005975mg             679   0.0      
emb|CDY05962.1|  BnaA09g38180D                                          678   0.0      
emb|CDX98399.1|  BnaC06g17600D                                          678   0.0      
ref|XP_009138891.1|  PREDICTED: guanosine nucleotide diphosphate ...    677   0.0      
ref|XP_009116668.1|  PREDICTED: guanosine nucleotide diphosphate ...    677   0.0      
emb|CDY45775.1|  BnaC04g22610D                                          676   0.0      
gb|KFK35202.1|  hypothetical protein AALP_AA5G253800                    676   0.0      
ref|XP_009104231.1|  PREDICTED: guanosine nucleotide diphosphate ...    675   0.0      
ref|XP_009116667.1|  PREDICTED: guanosine nucleotide diphosphate ...    672   0.0      
ref|NP_001078054.1|  guanosine nucleotide diphosphate dissociatio...    665   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EMS53635.1|  Rab GDP dissociation inhibitor alpha                    663   0.0      
gb|EMT13930.1|  Rab GDP dissociation inhibitor alpha                    662   0.0      
gb|KDO49751.1|  hypothetical protein CISIN_1g013352mg                   661   0.0      
ref|XP_010930327.1|  PREDICTED: guanosine nucleotide diphosphate ...    659   0.0      
ref|XP_006584965.1|  PREDICTED: rab GDP dissociation inhibitor al...    656   0.0      
gb|KDP29761.1|  hypothetical protein JCGZ_18696                         657   0.0      
gb|EEE59061.1|  hypothetical protein OsJ_10849                          655   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010030005.1|  PREDICTED: guanosine nucleotide diphosphate ...    650   0.0      
gb|KCW87997.1|  hypothetical protein EUGRSUZ_A00406                     654   0.0      
gb|KHG17909.1|  Rab GDP dissociation inhibitor alpha                    655   0.0      
ref|XP_001768163.1|  predicted protein                                  651   0.0      
ref|XP_001773747.1|  predicted protein                                  651   0.0      
ref|XP_001766609.1|  predicted protein                                  651   0.0      
gb|KCW87999.1|  hypothetical protein EUGRSUZ_A00408                     640   0.0      
ref|XP_001755959.1|  predicted protein                                  638   0.0      
gb|KDO49754.1|  hypothetical protein CISIN_1g013352mg                   631   0.0      
gb|AFK40299.1|  unknown                                                 620   0.0      
emb|CDY65664.1|  BnaC09g54770D                                          617   0.0      
emb|CDX71860.1|  BnaC08g30140D                                          589   0.0      
ref|XP_004962066.1|  PREDICTED: rab GDP dissociation inhibitor al...    585   0.0      
emb|CDX69899.1|  BnaA10g22480D                                          554   0.0      
ref|XP_002501191.1|  predicted protein                                  558   0.0      Micromonas commoda
ref|XP_002955697.1|  hypothetical protein VOLCADRAFT_83359              553   0.0      
ref|XP_005647685.1|  rab GDP dissociation inhibitor protein             552   0.0      
gb|AAB09058.1|  GDP dissociation inhibitor protein GDIV1p               550   0.0      Volvox carteri f. nagariensis
ref|XP_005847470.1|  hypothetical protein CHLNCDRAFT_35621              549   0.0      
gb|KDD75407.1|  Rab GDP dissociation inhibitor                          548   0.0      
gb|KDO49752.1|  hypothetical protein CISIN_1g013352mg                   537   0.0      
ref|XP_003064630.1|  predicted protein                                  536   0.0      
gb|KFM24244.1|  putative secretory pathway GDP dissociation inhib...    530   0.0      
ref|XP_001694920.1|  rab GDP dissociation inhibitor protein             527   0.0      Chlamydomonas reinhardtii
ref|XP_010101319.1|  Rab GDP dissociation inhibitor alpha               512   4e-177   
ref|XP_006373016.1|  hypothetical protein POPTR_0017s07190g             496   3e-170   
ref|XP_002739493.1|  PREDICTED: rab GDP dissociation inhibitor be...    498   5e-170   Saccoglossus kowalevskii
ref|NP_001018444.1|  rab GDP dissociation inhibitor alpha               498   1e-169   Danio rerio [leopard danio]
ref|XP_002599716.1|  hypothetical protein BRAFLDRAFT_131482             497   1e-169   Branchiostoma floridae
emb|CDQ72013.1|  unnamed protein product                                497   2e-169   
ref|XP_005162229.1|  PREDICTED: rab GDP dissociation inhibitor al...    496   3e-169   
gb|ADF97610.1|  GDP dissociation inhibitor 2                            496   6e-169   
dbj|GAM18823.1|  hypothetical protein SAMD00019534_019980               495   8e-169   
ref|XP_647506.1|  Rab GDP dissociation inhibitor alpha                  495   1e-168   Dictyostelium discoideum AX4
gb|AAQ91240.1|  GDP dissociation inhibitor 2                            494   2e-168   Danio rerio [leopard danio]
ref|XP_005811145.1|  PREDICTED: rab GDP dissociation inhibitor al...    494   2e-168   
ref|XP_009898535.1|  PREDICTED: rab GDP dissociation inhibitor beta     493   3e-168   
gb|KFV67193.1|  Rab GDP dissociation inhibitor beta                     493   4e-168   
ref|XP_009998603.1|  PREDICTED: rab GDP dissociation inhibitor beta     492   5e-168   
gb|KFU91630.1|  Rab GDP dissociation inhibitor beta                     493   6e-168   
ref|XP_006625634.1|  PREDICTED: rab GDP dissociation inhibitor al...    493   6e-168   
ref|XP_003438868.1|  PREDICTED: rab GDP dissociation inhibitor al...    493   7e-168   
gb|KGL75876.1|  Rab GDP dissociation inhibitor beta                     492   8e-168   
gb|KFP85743.1|  Rab GDP dissociation inhibitor beta                     492   9e-168   
ref|XP_002188156.2|  PREDICTED: rab GDP dissociation inhibitor beta     492   9e-168   Taeniopygia guttata
gb|KFV19912.1|  Rab GDP dissociation inhibitor beta                     492   1e-167   
ref|XP_009095691.1|  PREDICTED: rab GDP dissociation inhibitor beta     492   1e-167   
ref|XP_008491283.1|  PREDICTED: rab GDP dissociation inhibitor beta     492   1e-167   
ref|XP_009881279.1|  PREDICTED: rab GDP dissociation inhibitor beta     491   1e-167   
ref|XP_005235389.1|  PREDICTED: rab GDP dissociation inhibitor beta     491   1e-167   
ref|NP_001135205.1|  Rab GDP dissociation inhibitor beta                492   1e-167   Salmo salar
ref|XP_008286063.1|  PREDICTED: rab GDP dissociation inhibitor alpha    492   1e-167   
ref|XP_008627079.1|  PREDICTED: rab GDP dissociation inhibitor beta     491   1e-167   
gb|KFM09803.1|  Rab GDP dissociation inhibitor beta                     491   1e-167   
gb|KGL91659.1|  Rab GDP dissociation inhibitor beta                     491   1e-167   
ref|XP_004339226.1|  GDPassociated inhibitor, putative                  491   2e-167   
ref|XP_010873487.1|  PREDICTED: rab GDP dissociation inhibitor alpha    492   2e-167   
ref|XP_010707648.1|  PREDICTED: rab GDP dissociation inhibitor beta     492   2e-167   
gb|KFO78003.1|  Rab GDP dissociation inhibitor beta                     491   2e-167   
gb|EFA86431.1|  Rab GDP dissociation inhibitor alpha                    491   2e-167   Polysphondylium pallidum PN500
gb|KFP00369.1|  Rab GDP dissociation inhibitor beta                     491   2e-167   
ref|XP_007573030.1|  PREDICTED: rab GDP dissociation inhibitor alpha    492   2e-167   
ref|XP_004560353.1|  PREDICTED: rab GDP dissociation inhibitor al...    492   2e-167   
ref|XP_009646704.1|  PREDICTED: rab GDP dissociation inhibitor beta     491   2e-167   
gb|KFP10734.1|  Rab GDP dissociation inhibitor beta                     491   2e-167   
ref|XP_009582795.1|  PREDICTED: rab GDP dissociation inhibitor beta     491   3e-167   
ref|XP_009076320.1|  PREDICTED: rab GDP dissociation inhibitor beta     491   3e-167   
gb|KFP83600.1|  Rab GDP dissociation inhibitor beta                     491   3e-167   
emb|CDQ78596.1|  unnamed protein product                                491   3e-167   
gb|KFW10936.1|  Rab GDP dissociation inhibitor beta                     491   3e-167   
dbj|BAB97381.1|  rab GDP-dissociation inhibitor                         491   4e-167   
ref|XP_010735363.1|  PREDICTED: rab GDP dissociation inhibitor alpha    491   5e-167   
ref|XP_009329284.1|  PREDICTED: rab GDP dissociation inhibitor beta     489   6e-167   
gb|KFW72048.1|  Rab GDP dissociation inhibitor beta                     490   6e-167   
ref|XP_010210910.1|  PREDICTED: rab GDP dissociation inhibitor beta     492   6e-167   
ref|XP_005531042.1|  PREDICTED: rab GDP dissociation inhibitor be...    490   6e-167   
ref|NP_955949.1|  rab GDP dissociation inhibitor beta                   490   7e-167   
gb|KFW76965.1|  Rab GDP dissociation inhibitor beta                     490   7e-167   
gb|KHG03270.1|  Rab GDP dissociation inhibitor alpha                    484   7e-167   
ref|XP_007616643.1|  PREDICTED: rab GDP dissociation inhibitor beta     490   8e-167   
ref|XP_006265201.1|  PREDICTED: rab GDP dissociation inhibitor beta     490   1e-166   
ref|XP_008932962.1|  PREDICTED: rab GDP dissociation inhibitor beta     489   1e-166   
ref|XP_006035371.1|  PREDICTED: rab GDP dissociation inhibitor beta     490   1e-166   
ref|XP_001422173.1|  predicted protein                                  490   1e-166   
ref|XP_005504379.1|  PREDICTED: rab GDP dissociation inhibitor beta     489   1e-166   
emb|CDQ81740.1|  unnamed protein product                                492   1e-166   
ref|NP_990335.1|  rab GDP dissociation inhibitor beta                   489   2e-166   
gb|EAW86430.1|  GDP dissociation inhibitor 2, isoform CRA_a             488   2e-166   
gb|EMC89472.1|  Rab GDP dissociation inhibitor beta                     489   2e-166   
ref|XP_004645140.1|  PREDICTED: rab GDP dissociation inhibitor al...    489   2e-166   
ref|NP_001080236.1|  GDP dissociation inhibitor 2                       489   2e-166   
ref|XP_006633347.1|  PREDICTED: rab GDP dissociation inhibitor be...    489   3e-166   
ref|XP_009456167.1|  PREDICTED: rab GDP dissociation inhibitor be...    488   3e-166   
ref|XP_006219613.1|  PREDICTED: rab GDP dissociation inhibitor al...    489   3e-166   
ref|XP_004482925.1|  PREDICTED: rab GDP dissociation inhibitor al...    488   3e-166   
gb|ACE79066.1|  GDP dissociation inhibitor 1 (predicted)                489   3e-166   
ref|XP_003494990.1|  PREDICTED: rab GDP dissociation inhibitor beta     488   3e-166   
dbj|BAB25321.1|  unnamed protein product                                488   3e-166   
ref|XP_006990255.1|  PREDICTED: rab GDP dissociation inhibitor beta     488   3e-166   
ref|XP_005311907.1|  PREDICTED: rab GDP dissociation inhibitor beta     488   3e-166   
ref|NP_058972.2|  rab GDP dissociation inhibitor beta                   488   4e-166   
ref|XP_006189977.1|  PREDICTED: LOW QUALITY PROTEIN: rab GDP diss...    488   4e-166   
ref|XP_507638.3|  PREDICTED: rab GDP dissociation inhibitor beta ...    488   4e-166   
ref|XP_007252464.1|  PREDICTED: rab GDP dissociation inhibitor be...    488   4e-166   
ref|XP_009938774.1|  PREDICTED: rab GDP dissociation inhibitor beta     488   4e-166   
gb|KFR15354.1|  Rab GDP dissociation inhibitor beta                     488   4e-166   
dbj|BAG59669.1|  unnamed protein product                                488   4e-166   
gb|EDL32224.1|  guanosine diphosphate (GDP) dissociation inhibito...    488   5e-166   
ref|XP_005701402.1|  PREDICTED: rab GDP dissociation inhibitor alpha    487   6e-166   
ref|NP_001485.2|  rab GDP dissociation inhibitor beta isoform 1         488   6e-166   
ref|XP_003462185.1|  PREDICTED: rab GDP dissociation inhibitor al...    488   6e-166   
ref|XP_005614708.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   6e-166   
gb|AAP36244.1|  Homo sapiens GDP dissociation inhibitor 2               488   6e-166   
ref|XP_007626277.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   7e-166   
dbj|BAA03095.1|  human rab GDI                                          488   7e-166   
ref|XP_005354959.1|  PREDICTED: rab GDP dissociation inhibitor be...    488   7e-166   
ref|XP_004443399.1|  PREDICTED: rab GDP dissociation inhibitor alpha    488   7e-166   
emb|CAA52413.1|  rab GDI alpha                                          488   7e-166   
gb|EFB13348.1|  hypothetical protein PANDA_019987                       487   8e-166   
gb|AAH43955.1|  Gdi2-prov protein                                       488   8e-166   
gb|EHH31218.1|  hypothetical protein EGK_21106                          487   9e-166   
ref|XP_008988353.1|  PREDICTED: rab GDP dissociation inhibitor alpha    488   9e-166   
ref|XP_003286368.1|  Rab GDP dissociation inhibitor alpha               488   9e-166   
gb|KFO55412.1|  Rab GDP dissociation inhibitor beta                     486   9e-166   
gb|ACB21225.1|  GDP dissociation inhibitor 1 (predicted)                488   9e-166   
ref|XP_003963632.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   1e-165   
dbj|BAK62169.1|  rab GDP dissociation inhibitor alpha                   487   1e-165   
ref|NP_001484.1|  rab GDP dissociation inhibitor alpha                  487   1e-165   
ref|XP_005071794.1|  PREDICTED: rab GDP dissociation inhibitor beta     487   1e-165   
ref|XP_007626276.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   1e-165   
gb|ACO09349.1|  Rab GDP dissociation inhibitor beta                     487   1e-165   
ref|XP_005965191.1|  PREDICTED: rab GDP dissociation inhibitor alpha    487   1e-165   
ref|XP_008707437.1|  PREDICTED: rab GDP dissociation inhibitor alpha    487   1e-165   
gb|AAK49815.1|AF251042_1  rab GDP dissociation inhibitor alpha          487   1e-165   
ref|XP_004414560.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   1e-165   
ref|XP_003943958.1|  PREDICTED: rab GDP dissociation inhibitor alpha    487   1e-165   
emb|CAI29668.1|  hypothetical protein                                   487   1e-165   
ref|XP_005340703.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   1e-165   
ref|XP_008587159.1|  PREDICTED: rab GDP dissociation inhibitor alpha    487   1e-165   
gb|ELR45814.1|  Rab GDP dissociation inhibitor alpha                    487   1e-165   
ref|XP_004001071.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   1e-165   
ref|XP_005414257.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   1e-165   
ref|NP_776489.1|  rab GDP dissociation inhibitor alpha                  487   1e-165   
ref|XP_005614707.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   1e-165   
sp|Q7YQM0.1|GDIA_PONPY  RecName: Full=Rab GDP dissociation inhibi...    487   1e-165   
dbj|BAE42320.1|  unnamed protein product                                487   1e-165   
ref|XP_001362742.1|  PREDICTED: rab GDP dissociation inhibitor alpha    487   1e-165   
gb|ERE63095.1|  rab GDP dissociation inhibitor alpha-like protein       486   1e-165   
ref|XP_006739409.1|  PREDICTED: rab GDP dissociation inhibitor alpha    487   2e-165   
gb|AAV74274.1|  GDP dissociation inhibitor 1                            486   2e-165   
ref|XP_010885348.1|  PREDICTED: rab GDP dissociation inhibitor be...    487   2e-165   
ref|XP_003360570.1|  PREDICTED: rab GDP dissociation inhibitor al...    487   2e-165   
ref|NP_058784.2|  rab GDP dissociation inhibitor alpha                  487   2e-165   
ref|NP_001003185.1|  rab GDP dissociation inhibitor alpha               487   2e-165   
dbj|BAE23494.1|  unnamed protein product                                486   2e-165   
emb|CAG03848.1|  unnamed protein product                                487   2e-165   
ref|NP_001162276.1|  rab GDP dissociation inhibitor alpha               487   2e-165   
ref|XP_003774705.1|  PREDICTED: rab GDP dissociation inhibitor alpha    486   2e-165   
ref|NP_034403.1|  rab GDP dissociation inhibitor alpha                  486   2e-165   
ref|XP_005039050.1|  PREDICTED: rab GDP dissociation inhibitor beta     486   2e-165   
emb|CAH92581.1|  hypothetical protein                                   486   2e-165   
pdb|1LV0|A  Chain A, Crystal Structure Of The Rab Effector Guanin...    486   2e-165   
gb|ELV11382.1|  Rab GDP dissociation inhibitor alpha                    486   3e-165   
ref|XP_004049068.1|  PREDICTED: rab GDP dissociation inhibitor be...    486   3e-165   
ref|XP_005886170.1|  PREDICTED: rab GDP dissociation inhibitor al...    486   3e-165   
ref|XP_003802617.1|  PREDICTED: rab GDP dissociation inhibitor alpha    486   3e-165   
gb|EPQ20175.1|  Rab GDP dissociation inhibitor alpha                    485   3e-165   
ref|XP_006877271.1|  PREDICTED: rab GDP dissociation inhibitor al...    486   3e-165   
ref|XP_004780787.1|  PREDICTED: rab GDP dissociation inhibitor al...    486   3e-165   
ref|XP_010735220.1|  PREDICTED: rab GDP dissociation inhibitor be...    486   3e-165   
ref|XP_008157491.1|  PREDICTED: rab GDP dissociation inhibitor alpha    486   3e-165   
ref|XP_003279338.1|  PREDICTED: rab GDP dissociation inhibitor al...    486   3e-165   
ref|XP_004049069.1|  PREDICTED: rab GDP dissociation inhibitor be...    486   3e-165   
ref|XP_006167052.1|  PREDICTED: rab GDP dissociation inhibitor alpha    485   3e-165   
ref|XP_005086964.1|  PREDICTED: rab GDP dissociation inhibitor al...    486   3e-165   
ref|XP_010619731.1|  PREDICTED: rab GDP dissociation inhibitor beta     486   4e-165   
ref|XP_007955331.1|  PREDICTED: rab GDP dissociation inhibitor al...    486   4e-165   
ref|XP_008827816.1|  PREDICTED: rab GDP dissociation inhibitor alpha    486   4e-165   
dbj|BAE29742.1|  unnamed protein product                                488   4e-165   
dbj|BAE25494.1|  unnamed protein product                                488   4e-165   
ref|XP_004919702.1|  PREDICTED: rab GDP dissociation inhibitor al...    486   5e-165   
ref|XP_008314202.1|  PREDICTED: rab GDP dissociation inhibitor be...    486   5e-165   
dbj|BAE39709.1|  unnamed protein product                                485   5e-165   
ref|XP_004717611.1|  PREDICTED: rab GDP dissociation inhibitor al...    486   5e-165   
ref|XP_006862797.1|  PREDICTED: rab GDP dissociation inhibitor be...    485   5e-165   
ref|XP_010637113.1|  PREDICTED: rab GDP dissociation inhibitor alpha    485   6e-165   
ref|XP_005370748.1|  PREDICTED: rab GDP dissociation inhibitor al...    485   6e-165   
gb|ABK24357.1|  unknown                                                 479   6e-165   
ref|XP_004695295.1|  PREDICTED: rab GDP dissociation inhibitor al...    485   7e-165   
pdb|1D5T|A  Chain A, Guanine Nucleotide Dissociation Inhibitor, A...    485   7e-165   
ref|XP_003220802.1|  PREDICTED: LOW QUALITY PROTEIN: rab GDP diss...    485   7e-165   
ref|XP_008070287.1|  PREDICTED: rab GDP dissociation inhibitor alpha    486   7e-165   
ref|XP_008998122.1|  PREDICTED: rab GDP dissociation inhibitor be...    484   7e-165   
ref|NP_001125301.1|  rab GDP dissociation inhibitor beta                485   8e-165   
ref|XP_005414256.1|  PREDICTED: rab GDP dissociation inhibitor al...    488   8e-165   
gb|ACC68908.1|  GDP dissociation inhibitor 1 (predicted)                485   8e-165   
ref|NP_001245097.1|  rab GDP dissociation inhibitor beta                485   9e-165   
gb|EGW11375.1|  Rab GDP dissociation inhibitor alpha                    484   1e-164   
ref|XP_005564625.1|  PREDICTED: rab GDP dissociation inhibitor be...    485   1e-164   
ref|XP_003939096.1|  PREDICTED: rab GDP dissociation inhibitor beta     484   1e-164   
ref|XP_007888513.1|  PREDICTED: rab GDP dissociation inhibitor al...    484   1e-164   
ref|XP_006891928.1|  PREDICTED: rab GDP dissociation inhibitor be...    484   1e-164   
ref|XP_003449793.1|  PREDICTED: rab GDP dissociation inhibitor be...    484   1e-164   
ref|XP_005935394.1|  PREDICTED: rab GDP dissociation inhibitor be...    484   1e-164   
ref|XP_002750065.1|  PREDICTED: rab GDP dissociation inhibitor be...    484   2e-164   
ref|NP_001126688.1|  rab GDP dissociation inhibitor alpha               484   2e-164   
ref|XP_003512331.2|  PREDICTED: rab GDP dissociation inhibitor al...    484   2e-164   
ref|XP_004575313.1|  PREDICTED: rab GDP dissociation inhibitor be...    484   2e-164   
ref|XP_010367537.1|  PREDICTED: rab GDP dissociation inhibitor alpha    486   2e-164   
ref|XP_008567641.1|  PREDICTED: rab GDP dissociation inhibitor beta     484   2e-164   
ref|XP_004828100.1|  PREDICTED: rab GDP dissociation inhibitor alpha    486   2e-164   
ref|XP_004598930.1|  PREDICTED: rab GDP dissociation inhibitor al...    484   2e-164   
gb|EDL29822.1|  guanosine diphosphate (GDP) dissociation inhibito...    486   2e-164   
ref|XP_005742673.1|  PREDICTED: rab GDP dissociation inhibitor be...    484   2e-164   
ref|XP_007538359.1|  PREDICTED: rab GDP dissociation inhibitor al...    484   2e-164   
ref|XP_006120414.1|  PREDICTED: rab GDP dissociation inhibitor beta     485   2e-164   
gb|EHB03852.1|  Rab GDP dissociation inhibitor beta                     483   3e-164   
ref|XP_010589066.1|  PREDICTED: rab GDP dissociation inhibitor beta     484   3e-164   
gb|ABM82975.1|  GDP dissociation inhibitor 1                            484   3e-164   
gb|AAL60197.1|  guanosine diphosphate dissociation inhibitor 1          483   3e-164   
ref|XP_007655188.1|  PREDICTED: rab GDP dissociation inhibitor beta     486   4e-164   
ref|XP_004886169.1|  PREDICTED: rab GDP dissociation inhibitor be...    483   4e-164   
ref|NP_001087753.1|  GDP dissociation inhibitor 1                       483   4e-164   
ref|XP_004319581.1|  PREDICTED: rab GDP dissociation inhibitor alpha    483   5e-164   
ref|XP_008288117.1|  PREDICTED: rab GDP dissociation inhibitor beta     483   5e-164   
ref|XP_006933272.1|  PREDICTED: rab GDP dissociation inhibitor beta     482   5e-164   
gb|EXX67654.1|  Gdi1p                                                   483   5e-164   
gb|EHH18865.1|  hypothetical protein EGK_19428                          483   5e-164   
ref|XP_005008586.1|  PREDICTED: LOW QUALITY PROTEIN: GDP dissocia...    483   6e-164   
ref|XP_007185586.1|  PREDICTED: rab GDP dissociation inhibitor alpha    482   7e-164   
ref|XP_007457497.1|  PREDICTED: rab GDP dissociation inhibitor al...    483   7e-164   
gb|EMP39435.1|  Rab GDP dissociation inhibitor beta                     482   7e-164   
ref|XP_004286714.1|  PREDICTED: rab GDP dissociation inhibitor al...    483   8e-164   
ref|XP_008703627.1|  PREDICTED: rab GDP dissociation inhibitor be...    481   9e-164   
ref|XP_004390647.1|  PREDICTED: rab GDP dissociation inhibitor al...    482   9e-164   
ref|XP_004606649.1|  PREDICTED: rab GDP dissociation inhibitor alpha    482   1e-163   
gb|AAB16909.1|  GDP-dissociation inhibitor                              482   1e-163   
ref|XP_007438704.1|  PREDICTED: rab GDP dissociation inhibitor alpha    482   1e-163   
emb|CAH93371.1|  hypothetical protein                                   482   1e-163   
ref|XP_004892664.1|  PREDICTED: rab GDP dissociation inhibitor al...    481   1e-163   
ref|XP_004875060.1|  PREDICTED: rab GDP dissociation inhibitor al...    482   1e-163   
ref|XP_004379774.1|  PREDICTED: rab GDP dissociation inhibitor be...    482   1e-163   
ref|XP_008000366.1|  PREDICTED: rab GDP dissociation inhibitor beta     482   2e-163   
ref|XP_008515105.1|  PREDICTED: rab GDP dissociation inhibitor beta     481   2e-163   
ref|XP_003230067.1|  PREDICTED: rab GDP dissociation inhibitor alpha    481   3e-163   
gb|EHH64532.1|  hypothetical protein EGM_17774                          481   3e-163   
ref|XP_006734826.1|  PREDICTED: rab GDP dissociation inhibitor be...    481   3e-163   
ref|XP_004757985.1|  PREDICTED: rab GDP dissociation inhibitor beta     480   4e-163   
ref|XP_006150132.1|  PREDICTED: rab GDP dissociation inhibitor be...    481   4e-163   
ref|XP_004482168.1|  PREDICTED: rab GDP dissociation inhibitor beta     480   5e-163   
gb|EFB23094.1|  hypothetical protein PANDA_009130                       480   5e-163   
ref|XP_002920392.1|  PREDICTED: rab GDP dissociation inhibitor be...    480   6e-163   
ref|XP_005320365.1|  PREDICTED: rab GDP dissociation inhibitor be...    480   6e-163   
ref|XP_004411873.1|  PREDICTED: rab GDP dissociation inhibitor be...    480   7e-163   
ref|XP_007056020.1|  PREDICTED: rab GDP dissociation inhibitor beta     484   8e-163   
emb|CEG00803.1|  HSP20-like chaperone                                   480   9e-163   
ref|NP_001005676.1|  GDP dissociation inhibitor 2                       479   1e-162   
ref|XP_005427012.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   1e-162   
ref|XP_008153577.1|  PREDICTED: rab GDP dissociation inhibitor be...    478   1e-162   
ref|XP_001374514.1|  PREDICTED: rab GDP dissociation inhibitor beta     479   1e-162   
ref|XP_006088483.1|  PREDICTED: rab GDP dissociation inhibitor be...    479   2e-162   
ref|XP_004712676.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   2e-162   
ref|XP_007167506.1|  PREDICTED: rab GDP dissociation inhibitor beta     479   2e-162   
ref|XP_006772687.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   2e-162   
gb|KFO34522.1|  Rab GDP dissociation inhibitor beta                     486   2e-162   
ref|XP_010834666.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   2e-162   
gb|ELK23555.1|  Rab GDP dissociation inhibitor beta                     478   2e-162   
gb|EPQ09732.1|  Rab GDP dissociation inhibitor beta                     478   2e-162   
ref|NP_001003184.1|  rab GDP dissociation inhibitor beta                479   2e-162   
ref|XP_005688152.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   3e-162   
ref|XP_004588549.1|  PREDICTED: rab GDP dissociation inhibitor be...    479   3e-162   
gb|KFM69832.1|  Rab GDP dissociation inhibitor beta                     478   3e-162   
ref|XP_007437993.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   3e-162   
ref|XP_010846080.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   3e-162   
ref|XP_010960250.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   3e-162   
ref|XP_004281735.1|  PREDICTED: rab GDP dissociation inhibitor be...    478   3e-162   
ref|XP_007116259.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   3e-162   
ref|XP_005869567.1|  PREDICTED: rab GDP dissociation inhibitor beta     478   3e-162   
ref|XP_004425449.1|  PREDICTED: rab GDP dissociation inhibitor be...    478   3e-162   
ref|NP_001028934.1|  rab GDP dissociation inhibitor beta                478   4e-162   
ref|XP_005992613.1|  PREDICTED: rab GDP dissociation inhibitor al...    478   4e-162   
ref|XP_005901020.1|  PREDICTED: rab GDP dissociation inhibitor be...    478   4e-162   
ref|XP_008317185.1|  PREDICTED: rab GDP dissociation inhibitor alpha    478   5e-162   
ref|NP_001155337.1|  rab GDP dissociation inhibitor beta                478   6e-162   
ref|XP_005984309.1|  PREDICTED: rab GDP dissociation inhibitor beta     477   6e-162   
ref|XP_004605360.1|  PREDICTED: rab GDP dissociation inhibitor be...    477   6e-162   



>ref|XP_009790990.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Nicotiana sylvestris]
Length=445

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/422 (89%), Positives = 401/422 (95%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGESSSL+LIQLWKRFRG D+PPE+LG SKEYNVDMIPKF MAN
Sbjct  24    SVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDKPPEELGTSKEYNVDMIPKFAMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+FEESDPKTH+GMDLN ITAK+FI KYELE DTIDFIGH+LAL+TDDNYL QPA++
Sbjct  144   LYVQDFEESDPKTHEGMDLNKITAKEFIAKYELEADTIDFIGHALALYTDDNYLDQPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK+VKLYAESLARFQ+GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFD++
Sbjct  204   FVKRVKLYAESLARFQAGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSHPIPDTNDSHSAQVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICIMSHPIPDTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFVSTEAETDDPETELKPGVD+LGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPETELKPGVDILGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRFVP++D  ADNCFIS SYD++THFESTV DVL+MY+KITGK VDLSVDLSAASA  
Sbjct  384   TYDRFVPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVVDLSVDLSAASATA  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_009593951.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Nicotiana tomentosiformis]
Length=445

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/422 (88%), Positives = 401/422 (95%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGESSSL+LIQLWKRFRG D+PPE+LG SKEYNVDMIPKF MAN
Sbjct  24    SVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDKPPEELGTSKEYNVDMIPKFAMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+FEE+DPKTH+GMDLN ITAK+FI KYELE DTIDFIGH+LAL+TDDNYL QPA++
Sbjct  144   LYVQDFEETDPKTHEGMDLNKITAKEFIAKYELEADTIDFIGHALALYTDDNYLNQPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK+VKLYAESLARFQ+GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFD++
Sbjct  204   FVKRVKLYAESLARFQAGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSHPIPDTNDSHSAQVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICIMSHPIPDTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFVSTEAETDDP+TELKPGVD+LGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPQTELKPGVDILGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYD+FVP++D  ADNCFIS SYD++THFESTV DVL+MY+KITGK VDLSVDLSAASA  
Sbjct  384   TYDQFVPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVVDLSVDLSAASATA  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>emb|CAB94202.1| GDP dissociation inhibitor [Solanum lycopersicum]
Length=438

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/422 (88%), Positives = 400/422 (95%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGESSSL+LIQLWKRFRG DQPPE+LG SKEYNVDMIPKF MAN
Sbjct  17    SVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDQPPEELGTSKEYNVDMIPKFAMAN  76

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  77    GTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  136

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+FEE+DPKTH+GMDLN ITAK+FI KYELEDDTIDFIGH+LAL TDDNYLAQPA++
Sbjct  137   LYVQDFEETDPKTHEGMDLNKITAKEFIAKYELEDDTIDFIGHALALCTDDNYLAQPAMD  196

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             F+K+VKLYAESLARFQ+GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD 
Sbjct  197   FIKRVKLYAESLARFQAGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDG  256

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSHPIP+TNDSHSAQVILP
Sbjct  257   GKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICIMSHPIPNTNDSHSAQVILP  316

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFVSTEAETDDPE+ELKPGVD+LG VDEIFYE
Sbjct  317   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPESELKPGVDILGAVDEIFYE  376

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRF+P++D  ADNCFIS SYD++THFESTV DVL+MY+KITGK +DLSVDLSAASA  
Sbjct  377   TYDRFIPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVIDLSVDLSAASATA  436

Query  148   EQ  143
             E+
Sbjct  437   EE  438



>ref|XP_004230543.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Solanum lycopersicum]
 emb|CAM97308.1| Rab-GDP dissociation inhibitor [Solanum lycopersicum]
Length=445

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/422 (88%), Positives = 400/422 (95%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGESSSL+LIQLWKRFRG DQPPE+LG SKEYNVDMIPKF MAN
Sbjct  24    SVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDQPPEELGTSKEYNVDMIPKFAMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+FEE+DPKTH+GMDLN ITAK+FI KYELEDDTIDFIGH+LAL TDDNYLAQPA++
Sbjct  144   LYVQDFEETDPKTHEGMDLNKITAKEFIAKYELEDDTIDFIGHALALCTDDNYLAQPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             F+K+VKLYAESLARFQ+GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD 
Sbjct  204   FIKRVKLYAESLARFQAGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDG  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSHPIP+TNDSHSAQVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICIMSHPIPNTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFVSTEAETDDPE+ELKPGVD+LG VDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPESELKPGVDILGAVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRF+P++D  ADNCFIS SYD++THFESTV DVL+MY+KITGK +DLSVDLSAASA  
Sbjct  384   TYDRFIPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVIDLSVDLSAASATA  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_006351732.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum 
tuberosum]
Length=445

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/422 (88%), Positives = 400/422 (95%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGESSSL+LIQLWKRFRG DQPPE+LG SKEYNVDMIPKF MAN
Sbjct  24    SVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDQPPEELGTSKEYNVDMIPKFAMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+FEE+DPKTH+GMDLN ITAK+FI KYELEDDTIDFIGH+LAL TDDNYLAQPA++
Sbjct  144   LYVQDFEETDPKTHEGMDLNKITAKEFIAKYELEDDTIDFIGHALALCTDDNYLAQPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             F+K+VKLYAESLARFQ+GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKPQCKVEFD+ 
Sbjct  204   FIKRVKLYAESLARFQAGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDEG  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSHPIP+TNDSHSAQVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICIMSHPIPNTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFVSTEAETDDPE+ELKPGVD+LG VDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPESELKPGVDILGAVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRFVP++D  ADNCFIS SYD++THFESTV DVL+MY+KITGK +DLSVDLS+ASA  
Sbjct  384   TYDRFVPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITGKVIDLSVDLSSASATA  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>gb|EYU39113.1| hypothetical protein MIMGU_mgv1a006401mg [Erythranthe guttata]
Length=445

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/422 (86%), Positives = 391/422 (93%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGESSSL+L QLWKR RG DQPPEQLGAS+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDKNDYYGGESSSLNLTQLWKRLRGDDQPPEQLGASREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIH +VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHANVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ+FEESDPKTH GM+L+ IT K+ I KYELEDDT+DFIGH+LALHT+D+YL QPAI+
Sbjct  144   VFVQDFEESDPKTHAGMNLDTITGKELIAKYELEDDTVDFIGHALALHTNDSYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQSGSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP CKVEFD++
Sbjct  204   FVKRMKLYAESLARFQSGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPDCKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL DKV  VGKVARA+CIMSHPIPDT +SHSAQVILP
Sbjct  264   GKAIGVTSEGETAKCKKVVCDPSYLPDKVQPVGKVARAICIMSHPIPDTKESHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAP+GKYIAFV TEAETD+PE ELKPGVDLLGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPRGKYIAFVLTEAETDNPEVELKPGVDLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRFVPTND   D+C+IS SYDA+THFESTV DVL MYTKITGK ++LSVDLS ASAG 
Sbjct  384   TYDRFVPTNDTDVDHCYISTSYDATTHFESTVTDVLAMYTKITGKVLNLSVDLSEASAGT  443

Query  148   EQ  143
             EQ
Sbjct  444   EQ  445



>ref|XP_008455143.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Cucumis melo]
Length=445

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/422 (85%), Positives = 391/422 (93%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+LIQLWKRFRG D+PPEQLG SKEYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGASTSLNLIQLWKRFRGNDKPPEQLGLSKEYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EESDPK+H+G+DL+ +TA++ ITKY LEDDTIDFIGH+LALH DD+YL  PA++
Sbjct  144   IYVQDYEESDPKSHEGLDLSKVTARELITKYGLEDDTIDFIGHALALHFDDSYLNGPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL DKV KVGKVARAVCIMSHPIPDTNDSHSAQVILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAVCIMSHPIPDTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGK+IAFVSTEAETD+PE ELKPG+DLLGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR++P N+   D+CFIS SYD STHFESTV+DVL MY+ ITGK VDLSVDLSAASA  
Sbjct  384   TYDRYIPINNHETDSCFISTSYDGSTHFESTVKDVLAMYSNITGKAVDLSVDLSAASAAS  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_007042842.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 1 [Theobroma cacao]
 gb|EOX98673.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 1 [Theobroma cacao]
Length=444

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/421 (84%), Positives = 395/421 (94%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG D+PPEQLGAS+E+NVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLMQLWKRFRGDDKPPEQLGASREFNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR+LIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRILIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E++DPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPA++
Sbjct  144   IYVQDYEDNDPKSHEGLDLNKVTARELISKYGLEDDTIDFIGHALALHIDDSYLDQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETA+CKKVVCDP+YL DKV KVGKVARA+CIMSHPIPDTNDSHSAQVILP
Sbjct  264   GKAIGVTSEGETARCKKVVCDPSYLPDKVQKVGKVARAICIMSHPIPDTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGK+IAFVSTEAETD+PE ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+VPTN+  ADNCFIS SYD +THFE+TV DV+EMY+KITGK +DLSVDLSAASA  
Sbjct  384   TYDRYVPTNNHGADNCFISASYDPTTHFETTVTDVIEMYSKITGKALDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006423751.1| hypothetical protein CICLE_v10029979mg [Citrus clementina]
 gb|ESR36991.1| hypothetical protein CICLE_v10029979mg [Citrus clementina]
Length=445

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/422 (84%), Positives = 393/422 (93%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+N YYGGES+SL+L QLWKRF+G D+PPE+LG+SKEYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNAYYGGESTSLNLTQLWKRFKGDDKPPERLGSSKEYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR+LIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRILIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQE+EE DPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH +D+YL +PA++
Sbjct  144   IYVQEYEEDDPKSHEGLDLNKVTAREIISKYGLEDDTIDFIGHALALHINDSYLEEPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIM+HPIPDTNDSHS QVILP
Sbjct  264   GKVIGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICIMNHPIPDTNDSHSCQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAP G+YIAFVSTEAETD+PE ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPNGQYIAFVSTEAETDNPEVELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRFVPTN+  AD+CFIS+SYDA+THFESTV+DVLEMYTKITGK VDLSVDLSAASA  
Sbjct  384   TYDRFVPTNNHEADHCFISSSYDATTHFESTVQDVLEMYTKITGKAVDLSVDLSAASATA  443

Query  148   EQ  143
             EQ
Sbjct  444   EQ  445



>ref|XP_004155432.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
 gb|KGN43758.1| hypothetical protein Csa_7G065170 [Cucumis sativus]
Length=445

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/422 (85%), Positives = 389/422 (92%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+LIQLWKRFRG D+PPEQLG SKEYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGASTSLNLIQLWKRFRGNDKPPEQLGLSKEYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK+YKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKVYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++ESDPK+H+G+DL+ +TA++ ITKY LEDDTIDFIGH+LALH DD+YL  PA +
Sbjct  144   IYVQDYDESDPKSHEGLDLSKVTARELITKYGLEDDTIDFIGHALALHFDDSYLNGPASD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF   
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFAGD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL DKV KVGKVARAVCIMSHPIPDTNDSHSAQVILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAVCIMSHPIPDTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGK+IAFVSTEAETD+PE ELKPG+DLLGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+VP N+   DNCFIS SYD STHFESTV DVL MY+KITGK VDLSVDLSAASA  
Sbjct  384   TYDRYVPINNHETDNCFISTSYDGSTHFESTVTDVLAMYSKITGKAVDLSVDLSAASAAS  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_006487500.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Citrus 
sinensis]
 gb|KDO51543.1| hypothetical protein CISIN_1g036458mg [Citrus sinensis]
Length=445

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/422 (84%), Positives = 392/422 (93%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+N YYGGES+SL+L QLWKRF+G D+PPE+LG+SKEYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNAYYGGESTSLNLTQLWKRFKGDDKPPERLGSSKEYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR+LIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRILIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQE+EE DPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH +D+YL +PA++
Sbjct  144   IYVQEYEEDDPKSHEGLDLNKVTAREIISKYGLEDDTIDFIGHALALHINDSYLEEPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIM+HPIPDTNDSHS QVILP
Sbjct  264   GKVIGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICIMNHPIPDTNDSHSCQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAP G+YIAFVSTEAETD+PE ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPNGQYIAFVSTEAETDNPEVELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRFVPTN+  AD+CFIS SYDA+THFESTV+DVLEMYTKITGK VDLSVDLSAASA  
Sbjct  384   TYDRFVPTNNHEADHCFISTSYDATTHFESTVQDVLEMYTKITGKAVDLSVDLSAASATA  443

Query  148   EQ  143
             EQ
Sbjct  444   EQ  445



>emb|CDO97391.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/413 (86%), Positives = 386/413 (93%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGESSSL+L QLWKRFRG +QPPE+LG SKEYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDKNDYYGGESSSLNLNQLWKRFRGDEQPPEKLGTSKEYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT+VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRR+RKFF
Sbjct  84    GALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRLRKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ+FEES+PKTH+GMDLN ITA++ I+KYELEDDTIDFIGH+LAL  DD YL QPA+ 
Sbjct  144   IFVQDFEESNPKTHEGMDLNKITARELISKYELEDDTIDFIGHALALQIDDAYLDQPAMA  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK+VKLYAESLARFQ+GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFD +
Sbjct  204   FVKRVKLYAESLARFQAGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDAN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL++KV KVGKVARA+CIMSHPIPDTNDSHS QVILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLSEKVKKVGKVARAICIMSHPIPDTNDSHSCQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAP GKYIAFV+TEAETDDP+ ELKPGVDLLGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPNGKYIAFVATEAETDDPQAELKPGVDLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
             TYDRF PTN   AD CFIS+SYD +THFESTV DV+ MY+KITGK +DLSVDL
Sbjct  384   TYDRFEPTNCPDADGCFISSSYDGTTHFESTVVDVISMYSKITGKALDLSVDL  436



>ref|XP_004137066.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
Length=469

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/422 (85%), Positives = 389/422 (92%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+LIQLWKRFRG D+PPEQLG SKEYNVDMIPKFMMAN
Sbjct  48    SVDGLKVLHMDRNDYYGGASTSLNLIQLWKRFRGNDKPPEQLGLSKEYNVDMIPKFMMAN  107

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK+YKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  108   GGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKVYKVPATDVEALKSPLMGLFEKRRARKFF  167

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++ESDPK+H+G+DL+ +TA++ ITKY LEDDTIDFIGH+LALH DD+YL  PA +
Sbjct  168   IYVQDYDESDPKSHEGLDLSKVTARELITKYGLEDDTIDFIGHALALHFDDSYLNGPASD  227

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF   
Sbjct  228   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFAGD  287

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL DKV KVGKVARAVCIMSHPIPDTNDSHSAQVILP
Sbjct  288   GKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAVCIMSHPIPDTNDSHSAQVILP  347

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGK+IAFVSTEAETD+PE ELKPG+DLLGPVDEIFYE
Sbjct  348   QKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFYE  407

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+VP N+   DNCFIS SYD STHFESTV DVL MY+KITGK VDLSVDLSAASA  
Sbjct  408   TYDRYVPINNHETDNCFISTSYDGSTHFESTVTDVLAMYSKITGKAVDLSVDLSAASAAS  467

Query  148   EQ  143
             E+
Sbjct  468   EE  469



>ref|XP_007042843.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 2 [Theobroma cacao]
 gb|EOX98674.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 2 [Theobroma cacao]
Length=445

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/422 (84%), Positives = 395/422 (94%), Gaps = 1/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG D+PPEQLGAS+E+NVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLMQLWKRFRGDDKPPEQLGASREFNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR+LIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRILIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E++DPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPA++
Sbjct  144   IYVQDYEDNDPKSHEGLDLNKVTARELISKYGLEDDTIDFIGHALALHIDDSYLDQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELP-QAFARLSAVYGGTYMLNKPQCKVEFDD  692
             FVK++KLYAESLARFQ GSPYIYP+YGLGELP QAFARLSAVYGGTYMLNKP+CKVEFD 
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQQAFARLSAVYGGTYMLNKPECKVEFDG  263

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              GKA GVTSEGETA+CKKVVCDP+YL DKV KVGKVARA+CIMSHPIPDTNDSHSAQVIL
Sbjct  264   DGKAIGVTSEGETARCKKVVCDPSYLPDKVQKVGKVARAICIMSHPIPDTNDSHSAQVIL  323

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVSTEAETD+PE ELKPG+DLLGPVDEIFY
Sbjct  324   PQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVELKPGIDLLGPVDEIFY  383

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
             +TYDR+VPTN+  ADNCFIS SYD +THFE+TV DV+EMY+KITGK +DLSVDLSAASA 
Sbjct  384   DTYDRYVPTNNHGADNCFISASYDPTTHFETTVTDVIEMYSKITGKALDLSVDLSAASAA  443

Query  151   GE  146
              E
Sbjct  444   EE  445



>ref|XP_002268877.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Vitis vinifera]
 emb|CBI34015.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/419 (84%), Positives = 390/419 (93%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+G KVLHMD+N+YYGGESSSLSL QLW+RFRG DQPPE LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVNGFKVLHMDRNEYYGGESSSLSLKQLWQRFRGNDQPPESLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE+DPK+H+GMDLN +TA+D I+KY LEDDTIDFIGHSLALH+DD+YL +PA+E
Sbjct  144   IYVQDYEENDPKSHEGMDLNKVTARDLISKYGLEDDTIDFIGHSLALHSDDSYLDEPAME  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD++
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSH IPDTNDSHS QVILP
Sbjct  264   GKAFGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICIMSHSIPDTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFV+TEAETD PE ELK GVDLLGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDQPEVELKRGVDLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
             TYDRF P ND   D+CFIS SYDA+THFESTV++V+ MY+KITG+ +DL+VDLSAASA 
Sbjct  384   TYDRFEPKNDHEVDHCFISTSYDATTHFESTVKNVIAMYSKITGEELDLTVDLSAASAA  442



>ref|XP_011092452.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Sesamum indicum]
Length=445

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/422 (84%), Positives = 390/422 (92%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGES+SL+L QLWKR RG +QPPE LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDKNDYYGGESTSLNLNQLWKRLRGDEQPPEYLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIH +VTKYL FKAVDGSFVYNK KIYKVPATDVEALKS LMGL EKRR RKFF
Sbjct  84    GTLVRVLIHANVTKYLNFKAVDGSFVYNKKKIYKVPATDVEALKSPLMGLLEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             L+VQ+F+ES+PKTH GM+++  T ++ I KYEL+DDTIDFIGH+LALHT+D+YL QPA++
Sbjct  144   LFVQDFDESNPKTHAGMNMDTTTGRELIAKYELDDDTIDFIGHALALHTNDSYLDQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK+VKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFD++
Sbjct  204   FVKRVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAK KK+VCDP+YL DKV ++GKVARA+CIMSHPIPDTN+SHSAQVI+P
Sbjct  264   GKAIGVTSEGETAKGKKIVCDPSYLPDKVQQIGKVARAICIMSHPIPDTNESHSAQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFV TEAETD+PETELKPGVDLLG VDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVLTEAETDNPETELKPGVDLLGKVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TY RFVPTND +ADNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASAG 
Sbjct  384   TYHRFVPTNDGSADNCFISTSYDATTHFESTVMDVLSMYTNITGKVLDLSVDLSAASAGD  443

Query  148   EQ  143
             EQ
Sbjct  444   EQ  445



>ref|XP_007199860.1| hypothetical protein PRUPE_ppa005763mg [Prunus persica]
 gb|EMJ01059.1| hypothetical protein PRUPE_ppa005763mg [Prunus persica]
Length=445

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/422 (83%), Positives = 392/422 (93%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+L QLWKRFRG D+PPE LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFRGDDKPPESLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNK KIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTDVTKYLNFKAVDGSFVYNKKKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+FEE+DPK+H+G+DLN +TA++ ITKY LEDDTIDFIGH+LALH DD+YL +PA+E
Sbjct  144   IYVQDFEENDPKSHEGLDLNKVTAREVITKYGLEDDTIDFIGHALALHIDDSYLDEPAME  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVKK+KLYAESLARF+ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+C+V+FDD+
Sbjct  204   FVKKMKLYAESLARFEGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECQVKFDDN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G A GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSHPIPDTNDSHS QVILP
Sbjct  264   GNAIGVTSEGETAKCKKVVCDPSYLPDKVRKVGKVARAICIMSHPIPDTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGK+IAFVSTEAETDDP+ ELK G+DLLGP+DEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDDPQVELKSGIDLLGPLDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+VPTND   D+C+IS+SYDA+THFESTV+DVL MYTKITGK +DLSVDLSAASA  
Sbjct  384   TYDRYVPTNDHQVDSCYISSSYDATTHFESTVQDVLAMYTKITGKALDLSVDLSAASATA  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_008237140.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Prunus mume]
Length=445

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/422 (83%), Positives = 393/422 (93%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+GLKVLHMD+NDYYGG S+SL+L QLWKRFRG D+PPE LG ++EYNVDMIPKFMMAN
Sbjct  24    SVEGLKVLHMDRNDYYGGASTSLNLNQLWKRFRGDDKPPESLGTNREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNK KIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTDVTKYLNFKAVDGSFVYNKKKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+FEE+DPK+H+G+DLN +TA++ ITKY LEDDTIDFIGH+LALH DD+YL +PA+E
Sbjct  144   IYVQDFEENDPKSHEGLDLNKVTAREVITKYGLEDDTIDFIGHALALHIDDSYLDEPAME  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVKK+KLYAESLARF+ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+C+V+FDD+
Sbjct  204   FVKKMKLYAESLARFEGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECQVKFDDN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G A GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSHPIPDTNDSHS QVILP
Sbjct  264   GNAIGVTSEGETAKCKKVVCDPSYLPDKVRKVGKVARAICIMSHPIPDTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGK+IAFVSTEAETDDP+ ELKPG+DLLGP+DEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDDPQVELKPGIDLLGPLDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+VPTND  AD+C+IS+SYDA+THFESTV+DVL MYTK+TGK +DLSVDLSAASA  
Sbjct  384   TYDRYVPTNDHQADSCYISSSYDATTHFESTVQDVLAMYTKLTGKALDLSVDLSAASATA  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_002522655.1| protein with unknown function [Ricinus communis]
 gb|EEF39742.1| protein with unknown function [Ricinus communis]
Length=443

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/419 (83%), Positives = 390/419 (93%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D+PPE LG SKEYNVDMIPKF++AN
Sbjct  24    SVDGLKVLHMDQNDYYGGESSSLNLNQLWKRFRGSDKPPESLGPSKEYNVDMIPKFIIAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E++DPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPA++
Sbjct  144   IYVQDYEDNDPKSHEGLDLNKVTAREIISKYGLEDDTIDFIGHALALHLDDSYLDQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDAD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL++KV KVGKVARA+CIMSHPIP+T+DSHS Q+ILP
Sbjct  264   GKAIGVTSEGETAKCKKVVCDPSYLSNKVQKVGKVARAICIMSHPIPNTSDSHSVQLILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAP+GKYIAFV+TEAETD PE ELKPG+DLLGPVDEI YE
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPRGKYIAFVTTEAETDTPEVELKPGIDLLGPVDEILYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
             TYDR++P N+  ADNCFIS SYDA+THFE+TV DV+ MY+KITGKT+DLSVDLSAASA 
Sbjct  384   TYDRYIPANNPEADNCFISTSYDATTHFETTVDDVIAMYSKITGKTLDLSVDLSAASAA  442



>ref|XP_003529259.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Glycine 
max]
Length=445

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/422 (82%), Positives = 386/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+L QLWKRFRG D P E LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFRGDDTPSENLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E +DPK+H+G+DLN +TA+  I+KY LEDDT+DFIGH+LALH DD+YL +PA +
Sbjct  144   IYVQDYETNDPKSHEGLDLNQVTARQLISKYGLEDDTVDFIGHALALHRDDSYLDEPAKD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV +VK+YAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD+
Sbjct  204   FVDRVKIYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL+DKV KVGKVARA+CIMSHPIPDTNDSHSAQVILP
Sbjct  264   GKAIGVTSEGETAKCKKVVCDPSYLSDKVQKVGKVARAICIMSHPIPDTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVA KGKYIAFV+TEAETD PE ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDQPEVELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P ND  AD CFIS SYDA+THFE+TV+DV+E+Y+KITGK +DLSVDLSAASA  
Sbjct  384   IYDRFEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAAT  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>emb|CDY21587.1| BnaC09g47050D [Brassica napus]
Length=445

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/422 (82%), Positives = 386/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D P E LGA +EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPEENLGAIREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDGYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKVARAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPG++LLGP+DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN    DNCFIS +YDA+THFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTKITGKTLDLSVDLSAASATA  443

Query  148   EQ  143
             E+
Sbjct  444   EK  445



>ref|XP_010422972.1| PREDICTED: LOW QUALITY PROTEIN: guanosine nucleotide diphosphate 
dissociation inhibitor At5g09550-like [Camelina sativa]
Length=445

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/422 (82%), Positives = 385/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG+D P E LGAS+EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDTPQENLGASREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDDS
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKV RAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS  AETD+PE ELKPG+ LLGPVDEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAAAETDNPEEELKPGIXLLGPVDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN+   DNCFIS +YDA+THFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNNQEEDNCFISATYDATTHFESTVMDVLEMYTKITGKTLDLSVDLSAASAAA  443

Query  148   EQ  143
             E 
Sbjct  444   EN  445



>ref|XP_003531017.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Glycine max]
 gb|KHN46259.1| Rab GDP dissociation inhibitor alpha [Glycine soja]
Length=445

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/422 (82%), Positives = 387/422 (92%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+L QLWKRFRG D P E LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFRGDDTPAENLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT+VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E +DPK+H+G+DLN +TA+  I+KY LEDDT+DFIGH+LALH DDNYL +PA +
Sbjct  144   IYVQDYETNDPKSHEGLDLNQVTARQLISKYGLEDDTVDFIGHALALHRDDNYLDEPAKD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV +VK+YAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD++
Sbjct  204   FVDRVKIYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKK+VCDP+YL+DKV KVGKVARA+CIMSHPIPDT DSHSAQVILP
Sbjct  264   GKAIGVTSEGETAKCKKIVCDPSYLSDKVQKVGKVARAICIMSHPIPDTKDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVA KGKYIAFV+TEAETD+PE ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRF P ND  AD CFIS SYDA+THFE+TV+DV+E+Y+KITGK +DLSVDLSAASA  
Sbjct  384   TYDRFEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAAT  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_006584963.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X2 [Glycine max]
Length=451

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/422 (82%), Positives = 387/422 (92%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+L QLWKRFRG D P E LG+S+EYNVDMIPKFMMAN
Sbjct  30    SVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFRGDDTPAENLGSSREYNVDMIPKFMMAN  89

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT+VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  90    GALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  149

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E +DPK+H+G+DLN +TA+  I+KY LEDDT+DFIGH+LALH DDNYL +PA +
Sbjct  150   IYVQDYETNDPKSHEGLDLNQVTARQLISKYGLEDDTVDFIGHALALHRDDNYLDEPAKD  209

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV +VK+YAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD++
Sbjct  210   FVDRVKIYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEN  269

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKK+VCDP+YL+DKV KVGKVARA+CIMSHPIPDT DSHSAQVILP
Sbjct  270   GKAIGVTSEGETAKCKKIVCDPSYLSDKVQKVGKVARAICIMSHPIPDTKDSHSAQVILP  329

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVA KGKYIAFV+TEAETD+PE ELKPG+DLLGPVDEIFY+
Sbjct  330   QKQLGRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLLGPVDEIFYD  389

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRF P ND  AD CFIS SYDA+THFE+TV+DV+E+Y+KITGK +DLSVDLSAASA  
Sbjct  390   TYDRFEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAAT  449

Query  148   EQ  143
             E+
Sbjct  450   EE  451



>ref|XP_006289683.1| hypothetical protein CARUB_v10003247mg [Capsella rubella]
 gb|EOA22581.1| hypothetical protein CARUB_v10003247mg [Capsella rubella]
Length=445

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/422 (82%), Positives = 385/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG+D P E LGAS+EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDTPQENLGASREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKV RAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS  AETD+PE ELKPG++LLGPVDEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAAAETDNPEEELKPGIELLGPVDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN+   DNCFIS +YDA+THFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNNQEEDNCFISATYDATTHFESTVMDVLEMYTKITGKTLDLSVDLSAASAAA  443

Query  148   EQ  143
             E 
Sbjct  444   EN  445



>ref|XP_004504841.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cicer arietinum]
Length=445

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/422 (82%), Positives = 384/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+L QLWK++RG D+PPE  G+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDQNDYYGGASTSLNLTQLWKQYRGDDKPPENFGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E +DPK+H+G+DLN +TA+  I+KY LEDDTIDFIGH+LALH DD+YL +PA +
Sbjct  144   IYVQDYEANDPKSHEGLDLNQVTARQLISKYGLEDDTIDFIGHALALHLDDSYLDKPAKD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV +VK YAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP C+VEF D 
Sbjct  204   FVDRVKTYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPACRVEFGDD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL DKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP
Sbjct  264   GKAIGVTSEGETAKCKKVVCDPSYLPDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFV+TEAETD PE ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVTTEAETDQPEVELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF PTND   D CFIS SYDA+THFE+TV+DV++MY+KITGK +DLSVDLSAASA  
Sbjct  384   IYDRFEPTNDHATDGCFISTSYDATTHFETTVKDVVQMYSKITGKVLDLSVDLSAASATA  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_009131116.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Brassica rapa]
Length=445

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/422 (82%), Positives = 384/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D P E LGA +EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQENLGAIREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLV+ LIHT+VTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVQTLIHTNVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKVARAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPG++LLGP DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPTDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN    DNCFIS SYDA+THFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNQQEEDNCFISGSYDATTHFESTVSDVLEMYTKITGKTLDLSVDLSAASAAA  443

Query  148   EQ  143
             E 
Sbjct  444   EN  445



>ref|XP_009122523.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Brassica rapa]
Length=445

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/422 (82%), Positives = 386/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D P E LGA +EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQENLGAIREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKVARA CIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAGCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPG++LLGP+DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN    DNCFIS +YDA+THFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTKITGKTLDLSVDLSAASATA  443

Query  148   EQ  143
             E+
Sbjct  444   EK  445



>ref|XP_010452948.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Camelina sativa]
Length=445

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/422 (82%), Positives = 386/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG+D P E LGAS+EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGKSTSLNLTQLWKRFRGSDTPQENLGASREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEAL+S LMGLFEKRRVRKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALQSPLMGLFEKRRVRKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDDS
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKV RAVCIMSHPIPD ND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCIMSHPIPDANDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS  AETD+PE ELKPG++LLGPVDEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAAAETDNPEEELKPGIELLGPVDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN+   DNCFIS +YDA+THFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNNQEEDNCFISATYDATTHFESTVMDVLEMYTKITGKTLDLSVDLSAASAAA  443

Query  148   EQ  143
             E 
Sbjct  444   EN  445



>emb|CDY56553.1| BnaA03g55960D [Brassica napus]
Length=445

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/422 (82%), Positives = 384/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D P E LGA +EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQENLGAVREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLV+ LIHT+VTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVQTLIHTNVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKVARAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPG++LLGP DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPTDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN    DNCFIS SYDA+THFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNQQEEDNCFISGSYDATTHFESTVADVLEMYTKITGKTLDLSVDLSAASATA  443

Query  148   EQ  143
             E 
Sbjct  444   EN  445



>ref|XP_011023058.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Populus euphratica]
Length=444

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/421 (82%), Positives = 390/421 (93%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG+D PPE LGASKEYNVDMIPKF++AN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGSDTPPESLGASKEYNVDMIPKFIIAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE+DPK+H+G+DL  +TA++ I+KY LEDDT+DFIGH+LALH DD+YLAQPA++
Sbjct  144   IYVQDYEENDPKSHEGLDLTKVTAREVISKYGLEDDTVDFIGHALALHLDDSYLAQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYA+SLARFQ GSPYIYP+YGL ELPQ+FARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   FVKRMKLYADSLARFQGGSPYIYPLYGLAELPQSFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL +KV  VGKVARA+CIMSHPIP T+DSHSAQVILP
Sbjct  264   GKAIGVTSEGETAKCKKVVCDPSYLPNKVKNVGKVARAICIMSHPIPATSDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAP+GKYIAFVS EAETD+PE ELKPG+DLLGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPQGKYIAFVSAEAETDNPELELKPGIDLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+VP N    DNCFIS SYDA+THFE+TV+DV+ +Y++ITGKT+DLSVDLSAASA  
Sbjct  384   TYDRYVPINTMKEDNCFISTSYDATTHFETTVQDVIAIYSEITGKTLDLSVDLSAASAAV  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|KFK25257.1| hypothetical protein AALP_AA8G088700 [Arabis alpina]
Length=445

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/421 (82%), Positives = 385/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG+D P E LGAS+EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDIPQENLGASREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEAL S LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALTSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLNKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDDS
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKV RAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPG++LLGP+DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN+   DNCFIS +Y ASTHFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNNQEEDNCFISGTYCASTHFESTVVDVLEMYTKITGKTLDLSVDLSAASATA  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_002310487.1| hypothetical protein POPTR_0007s03250g [Populus trichocarpa]
 gb|EEE90937.1| hypothetical protein POPTR_0007s03250g [Populus trichocarpa]
Length=444

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/421 (82%), Positives = 388/421 (92%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG+D PPE LGASKEYNVDMIPKF++AN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGSDTPPESLGASKEYNVDMIPKFIIAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE+DPK+H+G+DL  +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPA +
Sbjct  144   IYVQDYEENDPKSHEGLDLTKVTAREVISKYGLEDDTIDFIGHALALHLDDSYLDQPASD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYA+SLARFQ GSPYIYP+YGL ELPQ+FARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   FVKRMKLYADSLARFQGGSPYIYPLYGLAELPQSFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL +KV  VGKVARA+CIMSHPIP T+DSHSAQVILP
Sbjct  264   GKAIGVTSEGETAKCKKVVCDPSYLPNKVKNVGKVARAICIMSHPIPATSDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAP+GK+IAFVS EAETD+PE ELKPG+DLLGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPQGKFIAFVSAEAETDNPEIELKPGIDLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+VP N    DNCFIS SYDA+THFE+TV+DV+ MY++ITGKT+DLSVDLSAASA  
Sbjct  384   TYDRYVPINTMKDDNCFISTSYDATTHFETTVQDVIAMYSEITGKTLDLSVDLSAASAAA  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009125364.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Brassica rapa]
Length=445

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/421 (82%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D P E LGA +EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQENLGAIREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD YL QPA++
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDGYLDQPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKV RAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVNRAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD PE ELKPG++LLGP+DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDSPEEELKPGIELLGPIDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN    DNCFIS +YDA+THFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNKQEEDNCFISGTYDATTHFESTVSDVLEMYTKITGKTLDLSVDLSAASATA  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_002871374.1| rab GDP-dissociation inhibitor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47633.1| rab GDP-dissociation inhibitor [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/422 (82%), Positives = 385/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D P E LGAS+EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQENLGASREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKV RAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPG++LLG +DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGSIDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +Y+ +VPTN+   DNCFIS +YDA+THFESTV DVL+MYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYETYVPTNNQEEDNCFISATYDATTHFESTVVDVLDMYTKITGKTLDLSVDLSAASAAA  443

Query  148   EQ  143
             E 
Sbjct  444   EN  445



>ref|XP_006399435.1| hypothetical protein EUTSA_v10013547mg [Eutrema salsugineum]
 gb|ESQ40888.1| hypothetical protein EUTSA_v10013547mg [Eutrema salsugineum]
Length=445

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/422 (81%), Positives = 384/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG+D P E+LGAS+EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDTPQEKLGASREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DDNYL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDNYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD +
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSA  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCD +YL +KV KVGKV RAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDSSYLPNKVKKVGKVTRAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAP GKYIAFVS EAETD+PE ELKPG++LLGP+DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPNGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN+   DNCFIS +YDA+THFESTV DVLEMYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNNQEEDNCFISGTYDATTHFESTVADVLEMYTKITGKTLDLSVDLSAASAAA  443

Query  148   EQ  143
             E 
Sbjct  444   EN  445



>ref|NP_196517.3| RAB GDP-dissociation inhibitor [Arabidopsis thaliana]
 sp|Q9LXC0.1|GDI_ARATH RecName: Full=Guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550; Short=AtGDI [Arabidopsis thaliana]
 emb|CAB89375.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AED91409.1| RAB GDP-dissociation inhibitor [Arabidopsis thaliana]
Length=445

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/422 (82%), Positives = 384/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D P E LGAS+EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPEENLGASREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL++KV KVGKV RAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSEKVKKVGKVTRAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPG++LLGP DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPTDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YD +VPTN    DNCFIS +YDA+THFESTV DVL+MYTKITGKT+DLSVDLSAASA  
Sbjct  384   SYDTYVPTNIQEEDNCFISATYDATTHFESTVVDVLDMYTKITGKTLDLSVDLSAASAAA  443

Query  148   EQ  143
             E 
Sbjct  444   EN  445



>ref|XP_010254526.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Nelumbo nucifera]
Length=445

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/422 (80%), Positives = 386/422 (91%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+L+QLWKRFRG D+PPE LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGASTSLNLVQLWKRFRGNDKPPEHLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKI+KVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIHKVPATDVEALKSQLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE+D K+H+G+DL  + AKD I+KY LED+T+DFIGH+LALH DD Y+ +PA++
Sbjct  144   IYVQDYEENDTKSHEGLDLKKVKAKDLISKYGLEDNTVDFIGHALALHIDDRYIDEPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   FVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETAKCKKVVCDP+YL DKV KVG+VARA+CIMSHPIP T+DSHS QVILP
Sbjct  264   GKAFGVTSEGETAKCKKVVCDPSYLPDKVRKVGRVARAICIMSHPIPHTSDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVSTEAETD PE ELKPG+ LLGPVDE+F++
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSTEAETDQPEVELKPGIGLLGPVDEMFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+  ADNCFIS SYDA+THFESTV+DV+ MY++ITGKT+DL+VDLSAASA  
Sbjct  384   IYDRYEPINNHDADNCFISTSYDATTHFESTVKDVIAMYSQITGKTLDLTVDLSAASAAS  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>gb|EPS65861.1| hypothetical protein M569_08910, partial [Genlisea aurea]
Length=449

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/422 (84%), Positives = 388/422 (92%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGG+S SLSL QLWKRFRG DQPPEQLGAS+EYNVDM+PKFMMAN
Sbjct  28    SVDGLKVLHMDKNDYYGGDSCSLSLNQLWKRFRGDDQPPEQLGASREYNVDMVPKFMMAN  87

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIH +VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVR FF
Sbjct  88    GALVRVLIHANVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRNFF  147

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ+FEE+DP TH+GMDL  +TAK  I KYELEDDTIDFIGH+LAL++D +YL QPAI+
Sbjct  148   IFVQDFEENDPNTHKGMDLQTLTAKQLIAKYELEDDTIDFIGHALALYSDGSYLEQPAID  207

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ+GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNK +CKVEFD  
Sbjct  208   FVKRMKLYAESLARFQAGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKTECKVEFDGD  267

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKK+VCDP+YL DKV KVGKV RA+CIMSHPIP+T+DSHSAQVILP
Sbjct  268   GKAIGVTSEGETAKCKKLVCDPSYLPDKVKKVGKVVRAMCIMSHPIPETSDSHSAQVILP  327

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFV TE E+D+PE ELKPGV+LLG VDEIFYE
Sbjct  328   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVLTEGESDNPEEELKPGVELLGGVDEIFYE  387

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             +YDRFVPTND  ADNCFIS SYDASTHFESTV DVLE+YTKITGK +DLSVDLSAASAG 
Sbjct  388   SYDRFVPTNDSVADNCFISKSYDASTHFESTVLDVLELYTKITGKVLDLSVDLSAASAGS  447

Query  148   EQ  143
             + 
Sbjct  448   DH  449



>ref|XP_004288515.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/421 (81%), Positives = 384/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPESLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGKVHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+FEE+DPKTH+GMDL  +TAK+ I+KY L+D+T+DFIGH+LALH DD YL +PA+ 
Sbjct  144   LYVQDFEENDPKTHEGMDLTKVTAKELISKYGLDDNTVDFIGHALALHRDDTYLEEPALA  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+KP+CKVEFD S
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEFDGS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSHPIP+TNDSHS QVILP
Sbjct  264   GKVIGVTSEGETAKCKKVVCDPSYLPDKVTKVGKVARAICIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFV TEAETD+P+ ELKPG DLLGPVD+IF++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKPGTDLLGPVDDIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ PTN   AD+CFIS SYDA+THFE+TV+DV+ MY  ITGK +DL+VDLSAASA  
Sbjct  384   TYDRYEPTNQSEADHCFISGSYDATTHFETTVQDVIAMYGNITGKVLDLTVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009416240.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Musa acuminata subsp. malaccensis]
Length=446

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/421 (81%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SLSL+QLWKRFR  D+PPE LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLSLVQLWKRFRSNDKPPELLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLI T VTKYL FKAVDGSFVYN GKIYKVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIRTGVTKYLNFKAVDGSFVYNNGKIYKVPATDVEALKSTLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E+ +PK+H+G+DLN +T +D I+KY LED+T+DFIGH+LALH DD+YL +PAI 
Sbjct  144   IYVQDYEDDEPKSHEGLDLNKVTTRDVISKYGLEDNTVDFIGHALALHRDDSYLDEPAIY  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDTD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL DKV KVG+VARA+CIMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSY HNVAPKGKYIAFVSTEAETD PETELKPG+DLLGPVDE F++
Sbjct  324   QKQLGRRSDMYVFCCSYAHNVAPKGKYIAFVSTEAETDHPETELKPGIDLLGPVDETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N    DNCFIS SYDA+THFESTV+DV+ MY KITGK +DLSVDLSAASA G
Sbjct  384   IYDRYEPANHDEQDNCFISTSYDATTHFESTVQDVISMYKKITGKELDLSVDLSAASAAG  443

Query  148   E  146
             E
Sbjct  444   E  444



>emb|CDX81131.1| BnaC03g03850D [Brassica napus]
Length=445

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/413 (83%), Positives = 378/413 (92%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D P E LGA +EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQENLGAIREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKVARAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPG++LLGP+DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGIELLGPIDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
             +YD +VPTN    DNCFIS SYDA+THFESTV DVLEMYTKITGKT+DLSVDL
Sbjct  384   SYDAYVPTNQQEEDNCFISGSYDATTHFESTVADVLEMYTKITGKTLDLSVDL  436



>emb|CDY44805.1| BnaC02g00820D [Brassica napus]
Length=629

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/417 (82%), Positives = 381/417 (91%), Gaps = 0/417 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D P E LGA +EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQENLGAIREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPA++
Sbjct  144   IYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD S
Sbjct  204   FVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSS  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV KVGKV RAVCIMSHPIPDTND+HS Q+ILP
Sbjct  264   GKAVGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVNRAVCIMSHPIPDTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD PE ELKPG++LLGP+DEIFY 
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDSPEDELKPGIELLGPIDEIFYH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAAS  158
             +YD +VPTN    DNCFIS +YDA+THFESTV DVLEMYTKITGKT+DLSVDLSAAS
Sbjct  384   SYDTYVPTNKQEEDNCFISGTYDATTHFESTVADVLEMYTKITGKTLDLSVDLSAAS  440



>ref|XP_010030006.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X2 [Eucalyptus grandis]
Length=457

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/431 (80%), Positives = 386/431 (90%), Gaps = 9/431 (2%)
 Frame = -1

Query  1408  SVDGLKVLH---------MDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVD  1256
             SVDGLKVL+         +DKNDYYGGES+SL+L QLWKRFRG D PPE LG SKEYNVD
Sbjct  24    SVDGLKVLYGADGVNYTNVDKNDYYGGESTSLNLNQLWKRFRGNDNPPESLGPSKEYNVD  83

Query  1255  MIPKFMMANGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLF  1076
             MIPKF MANG LVRVLIHTDVTKYL+FK VDGSFVYNKGKIYKVPATDVEALKS LMGLF
Sbjct  84    MIPKFTMANGALVRVLIHTDVTKYLSFKVVDGSFVYNKGKIYKVPATDVEALKSPLMGLF  143

Query  1075  EKRRVRKFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDD  896
             EKRR RKFF+YVQ+FEESDPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH DD
Sbjct  144   EKRRARKFFIYVQDFEESDPKSHEGLDLNKVTAREVISKYGLEDDTIDFIGHALALHIDD  203

Query  895   NYLAQPAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKP  716
             +Y+ +PA++FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP
Sbjct  204   SYMDKPALDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  263

Query  715   QCKVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTND  536
              CKVEFD SGK  GV+SEGETAKCKKVVCDP+YL  KV KVGKVARA+CIMSHPIPDTND
Sbjct  264   HCKVEFDASGKVIGVSSEGETAKCKKVVCDPSYLPGKVKKVGKVARAICIMSHPIPDTND  323

Query  535   SHSAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLL  356
             SHSAQVILPQKQLGRKSDMYLFCCSY HNVAP+GKYIAFV+ EAETD+P+ ELKPG++LL
Sbjct  324   SHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPQGKYIAFVAAEAETDNPQQELKPGIELL  383

Query  355   GPVDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSV  176
             GPVDE+F++ YDR+VPTN+   DNCFIS SYDASTHFE+TV DVL MY+KITGK ++LSV
Sbjct  384   GPVDEMFFDIYDRYVPTNNPEVDNCFISTSYDASTHFENTVTDVLAMYSKITGKVLNLSV  443

Query  175   DLSAASAGGEQ  143
             DL+AASA  EQ
Sbjct  444   DLNAASAATEQ  454



>ref|XP_002533685.1| protein with unknown function [Ricinus communis]
 gb|EEF28701.1| protein with unknown function [Ricinus communis]
Length=445

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/422 (79%), Positives = 389/422 (92%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LGAS++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPESLGASRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR+LIHTDVTKYL FKAVDGSFVYNKGKI+KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRILIHTDVTKYLNFKAVDGSFVYNKGKIHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+ +DLN + A+D I+KY L+D+T+DFIGH+LAL+ DDNYL +PA++
Sbjct  144   IYVQDYDENDPKSHERLDLNKVKARDVISKYGLDDNTVDFIGHALALYLDDNYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYA+SLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+KP+CKVEFD  
Sbjct  204   FVKRMKLYADSLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEFDVD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL +KV  +GKVARA+CIMSHPIP+T+DSHS QVILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPNKVKTIGKVARAICIMSHPIPNTHDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMYLFCCSYTHNVAPKGKYIAFV+TEAETDDP+TELKPG+DLLGPVDE+F+E
Sbjct  324   QKQLARKSDMYLFCCSYTHNVAPKGKYIAFVTTEAETDDPQTELKPGLDLLGPVDEMFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ PTN    DNCFIS SYDA+THFE+TV+DV+ MY+KITGKT+DL+VDL+AA A  
Sbjct  384   TYDRYEPTNQHDVDNCFISTSYDATTHFETTVQDVIAMYSKITGKTLDLTVDLNAAGAAT  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_004251972.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Solanum lycopersicum]
Length=444

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/421 (80%), Positives = 386/421 (92%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG+D+PP QLG+S++YNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAQLGSSRDYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++ESDPKTH+GMDL  +TA++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYKESDPKTHEGMDLTRVTARELIAKYGLDDNTVDFIGHALALHRDDRYLDKPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLNNKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSD+YLFCCSYTHNVAPKGK+IAFVSTEAETD+PE+ELKPG+DLLG VDEIF+E
Sbjct  324   QKQLGRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   AYDRFEPVNEPSLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010547647.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Tarenaya hassleriana]
Length=445

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/413 (82%), Positives = 379/413 (92%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG+D P + LGAS+EYNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDTPQDNLGASREYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH DD YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLNKVTAREIISKYGLEDDTIDFIGHALALHNDDEYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVKK+KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   FVKKIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL+DKV K GKV+RA+CIMSHPIPDT+D+HS Q+ILP
Sbjct  264   GKAVGVTSAGETAKCKKVVCDPSYLSDKVQKGGKVSRAICIMSHPIPDTSDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPGVDLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPGVDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
             +YD ++P+ND   D+CFIS +YDASTHFESTV DVL+MYTKITGKT+DLSVDL
Sbjct  384   SYDIYLPSNDAEKDHCFISATYDASTHFESTVVDVLQMYTKITGKTLDLSVDL  436



>ref|XP_006584964.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X3 [Glycine max]
Length=413

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/413 (81%), Positives = 378/413 (92%), Gaps = 0/413 (0%)
 Frame = -1

Query  1381  MDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVRVLIH  1202
             MD+NDYYGG S+SL+L QLWKRFRG D P E LG+S+EYNVDMIPKFMMANG LVRVLIH
Sbjct  1     MDRNDYYGGASTSLNLTQLWKRFRGDDTPAENLGSSREYNVDMIPKFMMANGALVRVLIH  60

Query  1201  TDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQEFEES  1022
             T+VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF+YVQ++E +
Sbjct  61    TNVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFFIYVQDYETN  120

Query  1021  DPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKVKLYA  842
             DPK+H+G+DLN +TA+  I+KY LEDDT+DFIGH+LALH DDNYL +PA +FV +VK+YA
Sbjct  121   DPKSHEGLDLNQVTARQLISKYGLEDDTVDFIGHALALHRDDNYLDEPAKDFVDRVKIYA  180

Query  841   ESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYGVTSE  662
             ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD++GKA GVTSE
Sbjct  181   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDENGKAIGVTSE  240

Query  661   GETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLGRKSD  482
             GETAKCKK+VCDP+YL+DKV KVGKVARA+CIMSHPIPDT DSHSAQVILPQKQLGRKSD
Sbjct  241   GETAKCKKIVCDPSYLSDKVQKVGKVARAICIMSHPIPDTKDSHSAQVILPQKQLGRKSD  300

Query  481   MYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDRFVPTN  302
             MYLFCCSY HNVA KGKYIAFV+TEAETD+PE ELKPG+DLLGPVDEIFY+TYDRF P N
Sbjct  301   MYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLLGPVDEIFYDTYDRFEPCN  360

Query  301   DCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGGEQ  143
             D  AD CFIS SYDA+THFE+TV+DV+E+Y+KITGK +DLSVDLSAASA  E+
Sbjct  361   DHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAATEE  413



>ref|XP_006351084.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum 
tuberosum]
Length=444

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 385/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRF+G+D+PP +LG+S++YNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFKGSDKPPAELGSSRDYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLSFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++ESDPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYKESDPKTHEGMDLTKVTTRELIAKYGLDDNTVDFIGHALALHRDDRYLDEPAVD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL  KV KVGKVARA+ IMSHPIP+T++SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPSKVRKVGKVARAIAIMSHPIPNTSESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETD+PE ELKPGV LLGPVDEI YE
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPENELKPGVSLLGPVDEIVYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR  P N+CT DNCF+S SYDA+THFESTV DVL +YTKITGK +DL+VDLSAASA  
Sbjct  384   TYDRSEPVNECTLDNCFVSTSYDATTHFESTVDDVLNLYTKITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006344947.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum 
tuberosum]
Length=444

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 386/421 (92%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG+D+PP QLG+S++YNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAQLGSSRDYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++ESDPKTH+GMDL  +TA++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYKESDPKTHEGMDLTRVTARELIAKYGLDDNTVDFIGHALALHRDDRYLDKPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLNNKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSD+YLFCCSYTHNVAPKGK+IAFVSTEAETD+PE+ELKPG+DLLG VDEIF+E
Sbjct  324   QKQLGRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   AYDRFEPVNEPSLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_008236115.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Prunus mume]
Length=443

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/421 (80%), Positives = 389/421 (92%), Gaps = 1/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPETLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKI+KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+G+DLN +TA++ I+KY L+D+T+DFIGH+LALH DD+YL +PA++
Sbjct  144   IYVQDYDENDPKSHEGLDLNKVTARELISKYGLDDNTVDFIGHALALHQDDSYLGEPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+KP+CKVEF++ 
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEFEN-  262

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETAKCKKVVCDP+YL DKV K+GKVARA+CIMSHPIP T+DSHS QVILP
Sbjct  263   GKAFGVTSEGETAKCKKVVCDPSYLPDKVKKIGKVARAICIMSHPIPSTHDSHSVQVILP  322

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFV TEAETD+P+ ELK G DLLGP+DEIF++
Sbjct  323   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKAGTDLLGPIDEIFFD  382

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ PTN    DNCFIS SYDA+THFE+TV+DV+ MY+KITGKT+DLSVDLSAASA  
Sbjct  383   TYDRYEPTNQNDGDNCFISASYDATTHFETTVQDVIAMYSKITGKTLDLSVDLSAASAAE  442

Query  148   E  146
             E
Sbjct  443   E  443



>gb|EYU22361.1| hypothetical protein MIMGU_mgv1a006444mg [Erythranthe guttata]
Length=444

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/421 (80%), Positives = 384/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG+D+PP QLG+S++YNVDMIPK++MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDKPPPQLGSSRDYNVDMIPKYIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKI+KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKIHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH+GM+L  +T +  I KY L+D+T+DFIGH+LAL  DD YL +PAI+
Sbjct  144   IYVQDYNESDPKTHEGMNLTTVTTRQLIAKYGLDDNTVDFIGHALALQRDDRYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARF  GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFAGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL++KV KVGKVARA+ IMSHPIP+TND HSAQVILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLSNKVRKVGKVARAIVIMSHPIPNTNDCHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETDDPE+ELKPG+DLLGPVDEIF+E
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDDPESELKPGIDLLGPVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRF P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   TYDRFEPVNEPSLDNCFISASYDATTHFESTVVDVLNMYTLITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006441986.1| hypothetical protein CICLE_v10020158mg [Citrus clementina]
 gb|ESR55226.1| hypothetical protein CICLE_v10020158mg [Citrus clementina]
Length=444

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 384/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LIQLWKRFRG +QPP  LG+S++YNVDMIPKF++AN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAHLGSSRDYNVDMIPKFIIAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL++KV KVG+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLSNKVRKVGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVSTEAETD P+TELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_008385671.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Malus domestica]
 ref|XP_008359208.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Malus domestica]
Length=443

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/421 (80%), Positives = 385/421 (91%), Gaps = 1/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LG+SK+YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPETLGSSKDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT+VTKYL FKAVDGSFVYNKGK++KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTNVTKYLNFKAVDGSFVYNKGKVHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+GMDLN +TA++ I KY L+D+T+DFIGH+LALH DDNYLA+PA+ 
Sbjct  144   IYVQDYDENDPKSHEGMDLNKVTARELILKYGLDDNTVDFIGHALALHRDDNYLAEPAMA  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+KP+CKVEF++ 
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEFENK  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
              KA GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+CIMSHPIP+T DSHS QVILP
Sbjct  264   -KAIGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAICIMSHPIPNTQDSHSVQVILP  322

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFV TEAETD+P+ ELKPG DLLG VDEIF++
Sbjct  323   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFD  382

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ PTN    DNCFIS SYDA+THFE+TV+DV+ MY+KITGK +DLSVDLSAASA  
Sbjct  383   TYDRYEPTNQDAGDNCFISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASAAE  442

Query  148   E  146
             E
Sbjct  443   E  443



>ref|NP_001274860.1| rab GDP dissociation inhibitor alpha-like [Solanum tuberosum]
 gb|ABB87112.1| GDP dissociation inhibitor 1-like [Solanum tuberosum]
Length=444

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 386/421 (92%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG+D+PP QLG+S++YNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAQLGSSRDYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++ESDPKTH+GMDL  +TA++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYKESDPKTHEGMDLTRVTARELIAKYGLDDNTVDFIGHALALHRDDRYLDKPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+KP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLNNKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSD+YLFCCSYTHNVAPKGK+IAFVSTEAETD+PE+ELKPG+DLLG VDEIF+E
Sbjct  324   QKQLGRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   AYDRFEPVNEPSLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|KDP29973.1| hypothetical protein JCGZ_18740 [Jatropha curcas]
Length=446

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/413 (82%), Positives = 378/413 (92%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG+D+PPE LG SKEYNVDMIPKF++AN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLNQLWKRFRGSDKPPESLGTSKEYNVDMIPKFIIAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+VYNKGKIYKVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLNFKAVDGSYVYNKGKIYKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E++DPK+H+G+DLN +TA+D I+KY LEDDTIDFIGH+LALH DDNYL QPA++
Sbjct  144   IYVQDYEDNDPKSHEGLDLNKVTARDIISKYGLEDDTIDFIGHALALHLDDNYLDQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKP+CKVEF   
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPECKVEFGAD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+Y+ DKV KVGKV RA+CIMSHPIP+T+DSHS Q+ILP
Sbjct  264   GKAIGVTSEGETAKCKKVVCDPSYMPDKVKKVGKVTRAICIMSHPIPNTSDSHSVQLILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFVSTEAETD PE ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDTPEVELKPGLDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
              YDR+ P N+   DNCF+S SYDA++HFE+TV DV+ MY KITGK +DLSVDL
Sbjct  384   AYDRYEPINNSEDDNCFVSASYDATSHFETTVDDVIAMYCKITGKALDLSVDL  436



>ref|XP_007202054.1| hypothetical protein PRUPE_ppa005772mg [Prunus persica]
 gb|EMJ03253.1| hypothetical protein PRUPE_ppa005772mg [Prunus persica]
Length=444

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGE +SL+L+QLWKRFRG D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDKPPAHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DPKTH+GMDL  +T +D I KY L+D+T+DFIGH+LALH DD YL +PA+E
Sbjct  144   IYVQDYNETDPKTHEGMDLRRVTTRDLIAKYGLDDNTVDFIGHALALHRDDRYLEEPALE  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF+D 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+C KVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVIGVTSEGETARCTKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PETELKPG+DLLGPV+EIF++
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVEEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR++P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYLPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010277491.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X1 [Nelumbo nucifera]
Length=445

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/413 (79%), Positives = 383/413 (93%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+GLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PPE LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVNGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGNDKPPEHLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKG+I+KVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGQIHKVPATDVEALKSQLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE+DPK+H+G+DLN +TA+D I+KY LED+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYEENDPKSHEGLDLNKVTARDVISKYGLEDNTVDFIGHALALHIDDKYLDEPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK+++LYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD++
Sbjct  204   FVKRIRLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETA+CKKVVCDP+YL DKV KVG+VARA+CIMSHPIP+T+DSHS QVILP
Sbjct  264   GKAFGVTSEGETARCKKVVCDPSYLPDKVQKVGRVARAICIMSHPIPNTSDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFV  EAET++PE ELKPG++LLGPV+E+F++
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVLAEAETNEPEVELKPGIELLGPVEEMFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
              YDR+ P N    DNC+IS SYDA+THFESTV+DV+ MY++ITGK +DLSVDL
Sbjct  384   IYDRYEPINKQDVDNCYISTSYDATTHFESTVKDVISMYSRITGKDLDLSVDL  436



>ref|XP_008243091.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Prunus mume]
Length=444

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 381/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGE +SL+L+QLWKRFRG D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDKPPAHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH+GMDL  +T +D I KY L+D+T+DFIGH+LALH DD YL +PA+E
Sbjct  144   IYVQDYNESDPKTHEGMDLRRVTTRDLIAKYGLDDNTVDFIGHALALHRDDRYLDEPALE  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF+D 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+C KVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVIGVTSEGETARCTKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PETELKPG+DLLGPV+EIF++
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVEEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006478491.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Citrus 
sinensis]
 gb|KDO49750.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=444

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 383/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LIQLWKRFRG +QPP  LG+S++YNVDMIPKF++AN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAHLGSSRDYNVDMIPKFIIAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVG+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVSTEAETD P+TELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009629496.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nicotiana tomentosiformis]
Length=444

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 384/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG+D+PP QLG+S++YNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPSQLGSSRDYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVY+KGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYSKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFIGHALALHRDDRYLDEPAVD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YLT+KV KVGKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLTNKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETD+PE+ELKPG+DLLG +DEIF+E
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQIDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P N+ + DNCFIS SYD +THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   AYDRFEPVNEPSLDNCFISTSYDPTTHFESTVDDVLNMYTLITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_007205201.1| hypothetical protein PRUPE_ppa005809mg [Prunus persica]
 gb|EMJ06400.1| hypothetical protein PRUPE_ppa005809mg [Prunus persica]
Length=443

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 389/421 (92%), Gaps = 1/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPETLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKI+KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+G++LN +TA++ I+KY L+D+T+DFIGH+LALH DD+YL +PA++
Sbjct  144   IYVQDYDENDPKSHEGLELNKVTARELISKYGLDDNTVDFIGHALALHRDDSYLGEPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+KP+CKVEF++ 
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEFEN-  262

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETAKCKKVVCDP+YL DKV K+GKVARA+CIMSHPIP T+DSHS QVILP
Sbjct  263   GKAFGVTSEGETAKCKKVVCDPSYLPDKVKKIGKVARAICIMSHPIPSTHDSHSVQVILP  322

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFV TEAETD+P+ ELK G DLLGP+DEIF++
Sbjct  323   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKAGTDLLGPIDEIFFD  382

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ PTN    DNCFIS SYDA+THFE+TV+DV+ MY+KITGKT+DLSVDLSAASA  
Sbjct  383   TYDRYEPTNQNDGDNCFISASYDATTHFETTVQDVIAMYSKITGKTLDLSVDLSAASAAE  442

Query  148   E  146
             E
Sbjct  443   E  443



>ref|XP_009784522.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nicotiana sylvestris]
Length=444

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 384/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG+D+PP QLG+S++YNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPPQLGSSRDYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G+LVRVLIHTDVTKYL FKAVDGSFVY+KGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GSLVRVLIHTDVTKYLYFKAVDGSFVYSKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +P ++
Sbjct  144   IYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFIGHALALHRDDRYLDEPVLD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YLT+KV KVGKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLTNKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETD+PE+ELKPG+DLLG VDEIF+E
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P N+ + DNCFIS SYD +THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   AYDRFEPVNEPSLDNCFISTSYDPTTHFESTVDDVLNMYTLITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009364258.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Pyrus x bretschneideri]
Length=443

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/421 (80%), Positives = 386/421 (92%), Gaps = 1/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LG+SK+YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPETLGSSKDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT+VTKYL FKAVDGSFVYNKGK++KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTNVTKYLNFKAVDGSFVYNKGKVHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+GMDLN +TA++ I+KY L+D+T+DFIGH+LALH DDNYLA+PA+ 
Sbjct  144   IYVQDYDENDPKSHEGMDLNKVTAQELISKYGLDDNTVDFIGHALALHRDDNYLAEPAMA  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+KP+CKVEF+++
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEFENN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
              KA GVTSEGETAKCKKVVCDP+YL DK  KVGKVARA+CIMSHPIP+T DSHS QVILP
Sbjct  264   -KAIGVTSEGETAKCKKVVCDPSYLPDKGKKVGKVARAICIMSHPIPNTQDSHSVQVILP  322

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFV TEAETD+P+ ELKPG DLLG VDEIF++
Sbjct  323   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFD  382

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ PTN    DNCFIS SYDA+THFE+TV+DV+ MY+KITGK +DLSVDLSAASA  
Sbjct  383   TYDRYEPTNQDAGDNCFISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASAAE  442

Query  148   E  146
             E
Sbjct  443   E  443



>ref|XP_008394248.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Malus domestica]
Length=444

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGE +SL+L+QLWKRFRG D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDKPPAHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DPKTH+GM+L  +T +D I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNETDPKTHEGMNLTRVTTRDLIAKYGLDDNTVDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TN+SHS QVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVST+AETD PETEL+PG+DLLGPVDEIF+E
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAETDHPETELRPGIDLLGPVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPTLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010646794.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Vitis vinifera]
Length=445

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 387/421 (92%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+GLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LG+SK+YN+DMIPKFMMAN
Sbjct  24    SVNGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPENLGSSKDYNIDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT+VTKYL FKAVDGSFVYNKGKI+KVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIHKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+ MDL  +TA++ I+KY L+D+T+DFIGH+LAL+TDD YL +PA++
Sbjct  144   IYVQDYDENDPKSHEKMDLRKVTAREVISKYGLDDNTVDFIGHALALYTDDKYLDKPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             F+KK+KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD++
Sbjct  204   FIKKMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETAKCKKVVCDP+YL DKV  VGKVARA+CIMSHPIP+T+DSHS QVILP
Sbjct  264   GKAFGVTSEGETAKCKKVVCDPSYLPDKVGTVGKVARAICIMSHPIPNTSDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFV+TEAETD+PE ELKPG++LLG VDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDNPEIELKPGIELLGQVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N    DNCFIS SYDA+THFESTV DV+ MY++ITGK +DL+VDLSAASA  
Sbjct  384   AYDRYEPANKQDEDNCFISTSYDATTHFESTVEDVIAMYSRITGKNLDLTVDLSAASAAD  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010691404.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/422 (80%), Positives = 380/422 (90%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+L QLWKRFRG D PPE LG SKEYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGASTSLNLNQLWKRFRGDDTPPESLGPSKEYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
               LVR+LIHTDVTKYL FKAVDGSFVYNK KIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    EVLVRILIHTDVTKYLNFKAVDGSFVYNKSKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E+SDPK+H+G+DLN ITA+D I+KY LEDDTIDFIGH+LAL+ +D+YL QPA +
Sbjct  144   IYVQDYEDSDPKSHEGLDLNKITARDLISKYGLEDDTIDFIGHALALYLNDSYLDQPATD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP C V FDD+
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPDCSVVFDDA  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GV+SEGETAKCKKVVCDP+YL +KVHKVG+V RA+CIMSHPIPDT +SHS QVILP
Sbjct  264   GKVIGVSSEGETAKCKKVVCDPSYLPEKVHKVGRVTRAICIMSHPIPDTKESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVA KGKYIAFV+TEAETD+PE ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAAKGKYIAFVTTEAETDNPEAELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ PTN    D+CFIS SYDA+THFESTV+DV+ +Y KITGK +DL+VDL+AASA  
Sbjct  384   TYDRYEPTNSPETDSCFISTSYDATTHFESTVKDVIGLYNKITGKELDLTVDLNAASAAP  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_006852946.1| hypothetical protein AMTR_s00033p00239520 [Amborella trichopoda]
 gb|ERN14413.1| hypothetical protein AMTR_s00033p00239520 [Amborella trichopoda]
Length=448

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/422 (80%), Positives = 379/422 (90%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGES+SL+L QLWKRFRG D+PPE LG+S+EYNVDMIPKF MAN
Sbjct  24    SVDGLKVLHMDKNDYYGGESTSLNLNQLWKRFRGDDKPPEHLGSSREYNVDMIPKFTMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHT+VTKYL FKAVDGS+VYNKGKI+KVPATDVEALKS LMGLFEKRR +KFF
Sbjct  84    GGLVRTLIHTNVTKYLNFKAVDGSYVYNKGKIHKVPATDVEALKSPLMGLFEKRRAQKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ++EESDPKTH GMDL  +T  + ITKY L+ +T+DFIGH+LALH DDNYL +PA++
Sbjct  144   VFVQDYEESDPKTHDGMDLMKVTTSELITKYGLDANTVDFIGHALALHRDDNYLGEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNK +CKVE D  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKQECKVELDAE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK +GVTSEGETAKCKKVVCDP+YL DKV KVG+VARA+CIMSHPIP+T+DSHS QVILP
Sbjct  264   GKVFGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICIMSHPIPNTSDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFVSTEAETD+PE ELKPG+DLLGPVDE F++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDEPEVELKPGIDLLGPVDEKFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ PTN    DNCFIS SYDASTHFESTV DVL MY+KITGK +DL+VDLS ASA G
Sbjct  384   IYDRYEPTNKHDGDNCFISTSYDASTHFESTVEDVLAMYSKITGKVLDLTVDLSGASASG  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>emb|CAN64340.1| hypothetical protein VITISV_031564 [Vitis vinifera]
Length=445

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 387/421 (92%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+GLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LG+SK+YN+DMIPKFMMAN
Sbjct  24    SVNGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPENLGSSKDYNIDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT+VTKYL FKAVDGSFVYNKGKI+KVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIHKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+ MDL  +TA++ I+KY L+D+T+DFIGH+LAL+TDD YL +PA++
Sbjct  144   IYVQDYDENDPKSHEKMDLRKVTAREVISKYGLDDNTVDFIGHALALYTDDKYLDKPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             F+KK+KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD++
Sbjct  204   FIKKMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETAKCKKVVCDP+YL DKV  VGKVARA+CIMSHPIP+T+DSHS QVILP
Sbjct  264   GKAFGVTSEGETAKCKKVVCDPSYLPDKVGTVGKVARAICIMSHPIPNTSDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGKYIAFV+TEAETD+PE ELKPG++LLG VDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDNPEIELKPGIELLGQVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N    DNCFIS SYDA+THFESTV DV+ MY++ITGK +DL+VDLSAASA  
Sbjct  384   AYDRYEPANKQDEDNCFISTSYDATTHFESTVEDVIAMYSRITGKNLDLTVDLSAASAAD  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009620915.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Nicotiana tomentosiformis]
 ref|XP_009757991.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nicotiana sylvestris]
 gb|AAB80717.1| GDP dissociation inhibitor [Nicotiana tabacum]
Length=444

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 384/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG+D+PP +LG+S+++NVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDFNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA +
Sbjct  144   IYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTVDFIGHALALHRDDRYLDEPAQD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETD+PE+ELK GV+LLGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKQGVNLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR  P N+ + DNCFIS SYDA+THFESTV DVL +YTKITGK +DL+VDLSAASA  
Sbjct  384   TYDRSEPVNEPSLDNCFISTSYDATTHFESTVDDVLNLYTKITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_003608428.1| Rab-GDP dissociation inhibitor [Medicago truncatula]
 gb|AES90625.1| GDP dissociation inhibitor [Medicago truncatula]
Length=445

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/413 (81%), Positives = 377/413 (91%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+L QL+KR+RG D+PPE+LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDQNDYYGGASTSLNLTQLFKRYRGDDKPPEELGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E +DPK+H+G+DLN +TA+  I+KY LEDDT+DFIGH+LALH DD+YL +PA +
Sbjct  144   IYVQDYEANDPKSHEGLDLNQVTARQLISKYGLEDDTVDFIGHALALHLDDSYLDKPAKD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV +VK YAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   FVDRVKTYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS+GETAKCKKVVCDP+YL DKV  VGKVARA+CIMSHPIPDTNDSHSAQVILP
Sbjct  264   GKAIGVTSDGETAKCKKVVCDPSYLPDKVQNVGKVARAICIMSHPIPDTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFV+TEAETD P+ ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVTTEAETDQPQVELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
              YDRF PTND   D CFIS SYD +THFE+TV+DV++MY+KITGK +DLSVDL
Sbjct  384   IYDRFEPTNDHATDGCFISTSYDPTTHFETTVKDVVQMYSKITGKVLDLSVDL  436



>ref|XP_009380662.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Musa acuminata subsp. malaccensis]
Length=446

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/421 (80%), Positives = 379/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRF+G D+P E LG+SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFKGNDKPSEHLGSSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTSVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E DPK+H+G+DL+ +T K+ I+KY LED+TIDFIGH+LALH DD+YL +PAI+
Sbjct  144   IYVQDYAEDDPKSHEGLDLHKVTTKEVISKYGLEDNTIDFIGHALALHRDDSYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              +K++KLY++SLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TIKRMKLYSDSLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDAD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL DKV KVG+VARA+CIMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETD PE ELKPG+DLLG VDE F+ 
Sbjct  324   QKQLSRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDHPEMELKPGIDLLGLVDETFFH  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ PTN+   DNCFIS SYDA+THFESTV+DV+ MY KITGK  DL+VDLSAASA  
Sbjct  384   IYDRYEPTNNHEHDNCFISTSYDATTHFESTVQDVISMYRKITGKEPDLTVDLSAASAAT  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009419946.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Musa acuminata subsp. malaccensis]
Length=446

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/414 (80%), Positives = 383/414 (93%), Gaps = 0/414 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRF+GTD+PPE LG SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFKGTDKPPEHLGPSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GGLVRVLIHTSVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSTLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE++PK+H+GMDL+ +T+++ I+KY L+D+TIDFIGH+LALH DD+YL +PAI+
Sbjct  144   IYVQDYEENEPKSHEGMDLHKVTSREVISKYGLDDNTIDFIGHALALHRDDSYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD++
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL  KV KVGKVARA+CIMSHPIP+TNDS S Q+ILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPSKVKKVGKVARAICIMSHPIPNTNDSQSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSYTHNVAPKGKYIAFVSTEAETD PETELKPG+DLLGPV+E F++
Sbjct  324   QKQLGRRSDMYVFCCSYTHNVAPKGKYIAFVSTEAETDHPETELKPGIDLLGPVNETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLS  167
             TYDR+ PTN+   D+CFIS SYDA+THFE+TV DV+ MY KITGK  DL+VDL+
Sbjct  384   TYDRYEPTNNHEEDSCFISTSYDATTHFETTVEDVISMYRKITGKEPDLTVDLN  437



>ref|XP_009345712.1| PREDICTED: LOW QUALITY PROTEIN: guanosine nucleotide diphosphate 
dissociation inhibitor At5g09550-like [Pyrus x bretschneideri]
Length=443

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/421 (80%), Positives = 385/421 (91%), Gaps = 1/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPETLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGKVHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+G+DLN +TA++ I+KY L+D+T+DFIGH+LAL  DDNYLA+PA++
Sbjct  144   IYVQDYDENDPKSHEGLDLNKVTARELISKYGLDDNTVDFIGHALALQQDDNYLAEPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+KP+CKVEF +S
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEF-ES  262

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL +KV   GKVARA+CIMSHPIP+TNDSHS QVILP
Sbjct  263   GKAIGVTSEGETAKCKKVVCDPSYLPNKVKLXGKVARAICIMSHPIPNTNDSHSVQVILP  322

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVA KGKYIAFV TEAETD+P+ ELKPG DLLG VDEIF++
Sbjct  323   QKQLGRKSDMYLFCCSYSHNVAAKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFD  382

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ PTN    DNCFIS SYDA+THFE+TV+DV+ MY+KITGK +DLSVDLSAASA  
Sbjct  383   TYDRYEPTNQGDGDNCFISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASAAE  442

Query  148   E  146
             E
Sbjct  443   E  443



>ref|XP_004138948.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
 ref|XP_004168317.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
 gb|KGN61451.1| hypothetical protein Csa_2G123620 [Cucumis sativus]
Length=444

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 384/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LIQLWKRFRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGDDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL+FKAVDGS+VYNKGKI+KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLSFKAVDGSYVYNKGKIHKVPATDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ+++ES+PKTH+GMDL  +T K+ I KY L+D+TIDFIGH+LALH DD YL  PA++
Sbjct  144   IFVQDYDESNPKTHEGMDLARVTTKELIAKYGLDDNTIDFIGHALALHRDDRYLDLPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL++KV KVGKVARA+ IMSH IP+TNDSHS Q+I+P
Sbjct  264   GKVIGVTSEGETAKCKKVVCDPSYLSNKVRKVGKVARAIAIMSHTIPNTNDSHSVQIIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSY+HNVAP+GK+IAFV+TEAETD PE+ELKPG+DLLG VDEIF++
Sbjct  324   QKQLGRRSDMYVFCCSYSHNVAPRGKFIAFVTTEAETDHPESELKPGIDLLGAVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK VDLSVDLSAASA  
Sbjct  384   TYDRYEPVNEPSLDNCFISMSYDATTHFESTVVDVLNMYTMITGKAVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010251442.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nelumbo nucifera]
 ref|XP_010251443.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nelumbo nucifera]
Length=444

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/421 (78%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGNDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGS+V+NKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK +GVTSEGETA+CKKVVCDP+YL +KV KVGKVARA+CIMSHPIP+TNDSHS QVILP
Sbjct  264   GKVFGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAICIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY HNVAPKGK+IAFV+TEAET+ PE ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYLFCCSYAHNVAPKGKFIAFVTTEAETNQPEVELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT I GK +DL VDLSAASA  
Sbjct  384   VYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTMIIGKVLDLGVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|AAW78520.1| GDP dissociation inhibitor 1 [Solanum chilense]
Length=444

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 385/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG+D+PP QLG+S++YNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAQLGSSRDYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++ESDPKTH+GMDL  +TA++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYKESDPKTHEGMDLTRVTARELIAKYGLDDNTVDFIGHALALHRDDRYLDKPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELP+AFARLSAVYGGTYMLNKP+CKV+FD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPRAFARLSAVYGGTYMLNKPECKVDFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARAV IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLNNKVRKVGKVARAVAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSD+YLFCCSYTHNVAPKGK+IAFVSTEAETD+PE+ELKPG+DLLG VDEIF+E
Sbjct  324   QKQLGRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGQVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P  + + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   AYDRFEPVIEPSLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_008354312.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Malus domestica]
Length=444

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 380/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGE +SL+L+QLWKRFRG D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDKPPAHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMGLFEKRR RKF 
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGLFEKRRARKFI  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ++ E+DPKTH+GMDL  +T +D I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   LYVQDYSETDPKTHEGMDLTRVTTRDLIAKYGLDDNTVDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TN+SHS QVILP
Sbjct  264   GKVIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVST+AETD PETELKPG+DLLGPVDEIF+E
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAETDHPETELKPGIDLLGPVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   TYDRYEPVNEPALDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_002513702.1| protein with unknown function [Ricinus communis]
 gb|EEF48649.1| protein with unknown function [Ricinus communis]
Length=444

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 380/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMDKNDYYGGES+SL+L QLWKRFRG+D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDKNDYYGGESASLNLNQLWKRFRGSDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +K  KV +VARA+ IMSHPIP+TNDSHSAQVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPNKARKVSRVARAIAIMSHPIPNTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGKYIAFVS+EAETD+PE ELKPG+DLLGPVDEIF+E
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKYIAFVSSEAETDNPEVELKPGIDLLGPVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MY+ ITGK +DLSVDLSAASA  
Sbjct  384   VYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYSMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_002280606.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Vitis vinifera]
 emb|CAN70679.1| hypothetical protein VITISV_044153 [Vitis vinifera]
 emb|CBI24770.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/421 (79%), Positives = 384/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LIQLWKRF+G D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFKGNDKPPASLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGS+V+NKGK++KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ+++E+DP+TH+GMDL  +T ++ I KY L+D+TIDFIGH++ALH DD YL +PAI+
Sbjct  144   IFVQDYDENDPRTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHAIALHRDDCYLNEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYSESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETA+CKKVVCDP+YL +KV KVG+VARA+CIMSHPIP+T+DSHS QVILP
Sbjct  264   GKAVGVTSEGETARCKKVVCDPSYLPNKVRKVGRVARAICIMSHPIPNTSDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PE+ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              Y+RF P N+ + D CFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYERFEPVNEPSLDQCFISTSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_004244786.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Solanum lycopersicum]
Length=444

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRF+G+D+PP +LG+S++YNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFKGSDKPPAELGSSRDYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++ESDPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYKESDPKTHEGMDLTKVTTRELIAKYGLDDNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDAE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL  KV KV KVARA+ IMSHPIP+T++SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPSKVRKVSKVARAIAIMSHPIPNTSESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETD+PE ELKPGV LLGPVDEI YE
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPENELKPGVSLLGPVDEIVYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR  P N+CT DNCF+S SYDA+THFESTV DVL +YTKITGK +DL+VDLSAASA  
Sbjct  384   TYDRSEPVNECTLDNCFVSTSYDATTHFESTVDDVLNLYTKITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|KDP45816.1| hypothetical protein JCGZ_17423 [Jatropha curcas]
Length=444

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/421 (79%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGE++SL+LIQLWKRFRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGEAASLNLIQLWKRFRGNDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL  PA++
Sbjct  144   IYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFIGHALALHRDDRYLNDPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+CKKVVCDP+Y+ +KV KVG+VARA+ IMSHPIP+TNDSHSAQVILP
Sbjct  264   GKVCGVTSEGETARCKKVVCDPSYMPNKVRKVGRVARAIAIMSHPIPNTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSYTHNVAPKGK+IAFVS+EAETD PE ELKPG+DLLGPVDEIFYE
Sbjct  324   QKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSSEAETDHPEVELKPGIDLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MY+ ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYSLITGKELDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_011074031.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Sesamum indicum]
Length=444

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/421 (80%), Positives = 380/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG+D+PP  LGAS++YNVDMIPK++MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDKPPAHLGASRDYNVDMIPKYIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GELVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ES+PKTH+GMDL  +T +  I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNESEPKTHEGMDLTKVTTRQLIAKYGLDDNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESL RF  GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLLRFAGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL DKV KVGKVARA+ IMSHPIP TNDSHS QVILP
Sbjct  264   GKACGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAIAIMSHPIPSTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD+PETELKPG+DLLGPVDEIF+E
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPETELKPGIDLLGPVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+   DNCFIS SYDA+THFESTV DVL +YT ITGK +DL+VDLSAASA  
Sbjct  384   TYDRYEPVNEPGQDNCFISTSYDATTHFESTVVDVLNLYTSITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009404932.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Musa acuminata subsp. malaccensis]
Length=444

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 385/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+N+YYGGES+SL+LIQLWKRFRG+D+PP QLG S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNEYYGGESTSLNLIQLWKRFRGSDKPPAQLGPSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V+NKGKI+KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ ++ESDPKTH+G+DL  +T K+FI+K+ L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQNYDESDPKTHEGLDLTRVTTKEFISKFGLDDNTVDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNK +CKVEFD  
Sbjct  204   TVKRIKLYEESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKLECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETA+CKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+T++SHSAQVILP
Sbjct  264   GKACGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTDESHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPVDE+F+E
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDRPEVELKPGIDLLGPVDELFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYD + P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGKT+DLSVDLSAASA  
Sbjct  384   TYDIYEPVNEPSLDNCFISTSYDATTHFESTVMDVLSMYTMITGKTLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010908336.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Elaeis guineensis]
Length=444

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LIQLWKRFRG+D+PP  LG S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGSDKPPAHLGPSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL+FKA DGS+V+NKGKI+KVPATD+EALKS LMGLFEKRR RKF 
Sbjct  84    GTLVRVLIHTDVTKYLSFKAADGSYVFNKGKIHKVPATDIEALKSPLMGLFEKRRARKFI  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+G+DL  +T +  I+KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGLDLTRVTTRALISKYGLDDNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDVE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+T+DSHSAQVILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTDDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK++AFVSTEAETD PE ELKPG+DLLGPVDE+F+E
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFVAFVSTEAETDHPEIELKPGIDLLGPVDELFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR VP N+ + DNCFIS SYDA+THFESTV DVL MY  ITGK VDLSVDLSAASA  
Sbjct  384   TYDRSVPVNEPSLDNCFISTSYDATTHFESTVMDVLHMYRMITGKDVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_008788293.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Phoenix dactylifera]
Length=444

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 383/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LIQLWKRFRG+D+PP  LG S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGSDKPPTHLGPSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL+FKAVDGS+V+NKGKI+KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDIEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+G+DL  +T ++ I+KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGLDLTRVTTRELISKYGLDDNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDVE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+T+ SHS QVILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTDGSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPEMELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRFVP N+ + DNCFIS SYD +THFESTV DVL MY  ITGK VDLSVDLSAASA  
Sbjct  384   TYDRFVPVNEPSLDNCFISTSYDGTTHFESTVMDVLHMYRMITGKDVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_008363741.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Malus domestica]
Length=443

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/421 (80%), Positives = 385/421 (91%), Gaps = 1/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK FRG D+PPE LG+S+EYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKXFRGEDKPPETLGSSREYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGKVHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+G+DLN +TA++ I+KY L+D+T+DFIGH+LAL  DDNYLA+PA++
Sbjct  144   IYVQDYDENDPKSHEGLDLNKVTARELISKYGLDDNTVDFIGHALALQQDDNYLAEPAMD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+KP+CKVEF++ 
Sbjct  204   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEFEN-  262

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL +KV  VGKVARA+CIMSHPIP+TNDSHS QVILP
Sbjct  263   GKAIGVTSEGETAKCKKVVCDPSYLPNKVKIVGKVARAICIMSHPIPNTNDSHSVQVILP  322

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVA KGKYIAFV TEAETD+P+ ELKPG DLLG VDEIF++
Sbjct  323   QKQLGRKSDMYLFCCSYSHNVAAKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFD  382

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ PTN    DNCFIS SYDA+THFE+TV+DV+ MY+KITGK +DLSVDLSAASA  
Sbjct  383   TYDRYEPTNQGDGDNCFISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASAAE  442

Query  148   E  146
             E
Sbjct  443   E  443



>ref|XP_003531293.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Glycine 
max]
 gb|KHN48088.1| Rab GDP dissociation inhibitor alpha [Glycine soja]
Length=444

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 378/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LGAS++YN+DM PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPHLGASRDYNIDMNPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGSFV+NKGK++KVPA D+EALKS LMGLFEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLSFKAVDGSFVFNKGKVHKVPANDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ + ESDPKTH+GMDL  +T K+ I KY L+D+TIDFIGH+LALH+DD YLA+PA++
Sbjct  144   IYVQNYNESDPKTHEGMDLTRVTTKELIAKYGLDDNTIDFIGHALALHSDDRYLAEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL  KV KVG+VARA+ IMSHPIP T+DSHS Q+ILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPGKVRKVGRVARAIAIMSHPIPSTDDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETD P  ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCF+S SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPTLDNCFVSTSYDATTHFESTVDDVLNMYTLITGKVIDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_008441682.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Cucumis melo]
Length=444

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 383/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LIQLWKRFRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGDDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL+FKAVDGS+VYNKGKI+KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLSFKAVDGSYVYNKGKIHKVPATDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ+++ES+PKTH+GMDL  +T K+ I KY L+D+TIDFIGH+LALH DD YL  PA++
Sbjct  144   IFVQDYDESNPKTHEGMDLTRVTTKELIAKYGLDDNTIDFIGHALALHRDDRYLDLPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+CKKVVCDP+YL +KV KVGKVARA+ IMSH IP+TNDSHS Q+I+P
Sbjct  264   GKVIGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAIAIMSHTIPNTNDSHSVQIIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSY+HNVAP+GK+IAFV+TEAETD PE+ELKPG+DLLG +DEIF++
Sbjct  324   QKQLGRRSDMYVFCCSYSHNVAPRGKFIAFVTTEAETDHPESELKPGIDLLGAIDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK VDLSVDLSAASA  
Sbjct  384   TYDRYEPVNEPSLDNCFISMSYDATTHFESTVVDVLNMYTMITGKAVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010937652.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Elaeis guineensis]
Length=446

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/421 (79%), Positives = 381/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKR +G D  PEQLG+SKEYNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRLKGNDNHPEQLGSSKEYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS+LMGLFEKRR RK F
Sbjct  84    GALVRVLIHTGVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSTLMGLFEKRRARKLF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E++DPK+H+G+DLN +  K+ + KY LED+T+DFIGH+LALH DD+YL +PAI+
Sbjct  144   IYVQDYEDNDPKSHEGLDLNKVKTKELMAKYGLEDNTVDFIGHALALHRDDSYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD +
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDAN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETA+CKKVVCDP+YL DKV KVG+VARA+CIMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKAHGVTSEGETARCKKVVCDPSYLPDKVKKVGRVARAICIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQ+ RKSDMY+FCCSYTHNVAPKGKYIAFVSTEAETD PE ELKPG+DLLG VDEIF++
Sbjct  324   QKQIERKSDMYVFCCSYTHNVAPKGKYIAFVSTEAETDQPEVELKPGIDLLGSVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N    DNCFIS SYDA+THFESTV+DV+ MY++ITGK +DL+VDLSAASA  
Sbjct  384   IYDRYEPINKHDEDNCFISTSYDATTHFESTVQDVISMYSRITGKELDLTVDLSAASAAP  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010520728.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Tarenaya hassleriana]
Length=445

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/413 (81%), Positives = 376/413 (91%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D PP+ LG+S+EYNVDM PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGDDAPPDNLGSSREYNVDMTPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+ LIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVEALKSTLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+
Sbjct  144   IYVQDYDEKDPKSHEGLDLNKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVKK+KLYAESLARF  GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   FVKKIKLYAESLARFHGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDSD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTS GETAKCKKVVCDP+YL DKV K GKVA A+ IMSHPIPDT+D+HS Q+ILP
Sbjct  264   GKAVGVTSSGETAKCKKVVCDPSYLPDKVQKGGKVAGAIGIMSHPIPDTSDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETDDPE ELKPGVDLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDDPEAELKPGVDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
             +YD ++P+ND   D+CFIS +YDASTHFESTV DVL+MYTKITGKT+DLSVDL
Sbjct  384   SYDTYLPSNDPEKDHCFISATYDASTHFESTVMDVLQMYTKITGKTLDLSVDL  436



>ref|XP_009410720.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 386/421 (92%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG+D+PP  LGAS++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAHLGASRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+NKGKI+KVPATD+EAL+S LMGLFEKRR RKFF
Sbjct  84    GILVRTLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDMEALRSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+G+DL  +T K+ I+KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGLDLTRVTTKELISKYGLDDNTIDFIGHALALHRDDRYLYEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETA+CKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+T++SHS QVILP
Sbjct  264   GKACGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTDESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD P+ ELKPG+DLLGPVDE+F+E
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDRPDVELKPGIDLLGPVDELFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ + D+CFIS SYDA+THFESTV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   TYDRYEPVNEPSLDHCFISASYDATTHFESTVTDVLSMYTMITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|ACN65853.1| Rab GDP dissociation inhibitor [Nicotiana benthamiana]
Length=444

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/421 (79%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKRFRG+D+PP +LG+S+++NVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDFNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK+ KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVRKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA +
Sbjct  144   IYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTVDFIGHALALHRDDRYLDEPAQD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL  KV KVGKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPSKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETD+PE+EL+ GV+LLGPVDEIFYE
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPESELEQGVNLLGPVDEIFYE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR  P N+ + DNCFIS SYDA+THFESTV DVL +YTKITGK +DL+VDLSAASA  
Sbjct  384   TYDRSEPVNEPSLDNCFISTSYDATTHFESTVDDVLNLYTKITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_007159145.1| hypothetical protein PHAVU_002G212600g [Phaseolus vulgaris]
 gb|ESW31139.1| hypothetical protein PHAVU_002G212600g [Phaseolus vulgaris]
Length=445

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/413 (81%), Positives = 378/413 (92%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG S+SL+L QLWKRFR  D+P E LG+S+EYNVDMIPKFM+AN
Sbjct  24    SVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFREDDKPAEALGSSREYNVDMIPKFMLAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGKI+KVPATDVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIHKVPATDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE+D K+H+G+DLN +TA+  I+KY LEDDTIDFIGH+LALH DD+YL +PA  
Sbjct  144   IYVQDYEENDTKSHEGLDLNQVTARQLISKYGLEDDTIDFIGHALALHRDDSYLDEPAKG  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV++VK+YAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   FVERVKVYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YL+DKVHKVGKV+RA+CIMSHPIP+T+DSHSAQVILP
Sbjct  264   GKAIGVTSEGETAKCKKVVCDPSYLSDKVHKVGKVSRAICIMSHPIPETHDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGK+IAFV+TEAETD PE ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVTTEAETDQPEVELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
              YDRF P ND  AD CFIS SYD +THFE+TV+DV+ MY+KITGK +DL VDL
Sbjct  384   MYDRFEPCNDHEADGCFISTSYDPTTHFETTVKDVVGMYSKITGKILDLCVDL  436



>ref|XP_008812865.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Phoenix dactylifera]
Length=444

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 383/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG+D+PP  LG S++YNVDMIPKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDKPPANLGPSRDYNVDMIPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL+FKAVDGS+V+NKGKI+KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDIEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH G+DL  +T ++ I+KY L+D+T+D IGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHGGLDLTRVTTRELISKYGLDDNTVDVIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDVE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+T+DSHS QVILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTDDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAP+GK+IAFVSTEAETD PE ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPRGKFIAFVSTEAETDRPEIELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRFVP N+ + DNCFIS SYDA+THFESTV DVL MY  ITGK VDLSVDLSAASA  
Sbjct  384   TYDRFVPVNEPSLDNCFISTSYDATTHFESTVMDVLHMYRMITGKNVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_008784526.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Phoenix dactylifera]
Length=446

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/421 (79%), Positives = 378/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWKR +G D+P E LG+SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRLKGNDKPTENLGSSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS+LMGLFEKRR RK F
Sbjct  84    GALVRVLIHTGVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSTLMGLFEKRRARKLF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE+DPK+H+G+DLN +T K+   KY LED+T+DFIGH+LALH DD+YL  PAI+
Sbjct  144   IYVQDYEENDPKSHEGLDLNKVTTKELFAKYGLEDNTVDFIGHALALHRDDSYLNDPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD +
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDAN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSE ETAKCKKVVCDP+YL DKV KVG+VARA+CIMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKAYGVTSESETAKCKKVVCDPSYLPDKVKKVGRVARAICIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSYTHNVAP+GKYIAFVSTEAETD PE ELKPG++LLG VDE F++
Sbjct  324   QKQLGRKSDMYVFCCSYTHNVAPRGKYIAFVSTEAETDQPEVELKPGINLLGSVDETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YD + P N    DNCFIS SYDA+THFESTV+DVL MY++ITGK +DL+VDLSAASA  
Sbjct  384   IYDIYDPVNKHDEDNCFISTSYDATTHFESTVQDVLSMYSRITGKELDLTVDLSAASATA  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009366269.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Pyrus x bretschneideri]
Length=444

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 381/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLH+D+NDYYGGE +SL+L+QLWKRFRG D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHIDRNDYYGGECASLNLVQLWKRFRGDDKPPAHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMGLFEKRR RKF 
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGLFEKRRARKFI  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ++ E+DPKT++GMDL  +T +D I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   LYVQDYSETDPKTYEGMDLTRVTTRDLIAKYGLDDNTVDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TN+SHS QVILP
Sbjct  264   GKIIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVST+AETD PETELKPG+DLLGPVDEIF+E
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAETDHPETELKPGIDLLGPVDEIFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ T DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   TYDRYEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006372308.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
 gb|ABK93982.1| unknown [Populus trichocarpa]
 gb|ABK95445.1| unknown [Populus trichocarpa]
 gb|ERP50105.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
Length=444

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/421 (79%), Positives = 379/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDG +V+NKGK++KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLYFKAVDGGYVFNKGKVHKVPATDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ +E+SDPKTH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQNYEDSDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +K  KVG+VARA+ IMSHPIP T++SHS QVILP
Sbjct  264   GKVAGVTSEGETAKCKKVVCDPSYLPNKARKVGRVARAIAIMSHPIPSTDESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSYTHNVAPKGK+IAFVSTEAETD PE+ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK VDLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_011014748.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Populus euphratica]
Length=444

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/421 (78%), Positives = 381/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+V+NKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ +E++DPKTH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQNYEDNDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVG+VARA+ IMSHPIP T++SHS QVILP
Sbjct  264   GKVAGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPSTDESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSYTHNVAPKGK+IAFVSTEAETD PETELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010277492.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X2 [Nelumbo nucifera]
Length=426

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/413 (79%), Positives = 380/413 (92%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             S D  KVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PPE LG+S+EYNVDMIPKFMMAN
Sbjct  5     SDDMEKVLHMDRNDYYGGESTSLNLIQLWKRFRGNDKPPEHLGSSREYNVDMIPKFMMAN  64

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKG+I+KVPATDVEALKS LMGLFEKRR RKFF
Sbjct  65    GALVRVLIHTDVTKYLNFKAVDGSFVYNKGQIHKVPATDVEALKSQLMGLFEKRRARKFF  124

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE+DPK+H+G+DLN +TA+D I+KY LED+T+DFIGH+LALH DD YL +PA++
Sbjct  125   IYVQDYEENDPKSHEGLDLNKVTARDVISKYGLEDNTVDFIGHALALHIDDKYLDEPAMD  184

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK+++LYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD++
Sbjct  185   FVKRIRLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEN  244

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETA+CKKVVCDP+YL DKV KVG+VARA+CIMSHPIP+T+DSHS QVILP
Sbjct  245   GKAFGVTSEGETARCKKVVCDPSYLPDKVQKVGRVARAICIMSHPIPNTSDSHSVQVILP  304

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGKYIAFV  EAET++PE ELKPG++LLGPV+E+F++
Sbjct  305   QKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVLAEAETNEPEVELKPGIELLGPVEEMFFD  364

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
              YDR+ P N    DNC+IS SYDA+THFESTV+DV+ MY++ITGK +DLSVDL
Sbjct  365   IYDRYEPINKQDVDNCYISTSYDATTHFESTVKDVISMYSRITGKDLDLSVDL  417



>ref|XP_011004551.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Populus euphratica]
Length=444

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/421 (78%), Positives = 381/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+V+NKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ +E++DPKTH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQNYEDNDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLHEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVG+VARA+ IMSHPIP T++SHS QVILP
Sbjct  264   GKVAGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPSTDESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSYTHNVAPKGK+IAFVSTEAETD PETELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|AHF81486.1| small GTP Rab-GDI [Mangifera indica]
Length=444

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/421 (79%), Positives = 377/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG + PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGNEPPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GGLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPKTH+GMDL  +T K+ I KY L+D+ IDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDEKDPKTHEGMDLTRVTTKELIAKYGLDDNAIDFIGHALALHRDDRYLQEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK +GVTSEGETAKCKKVVCDP+YL  KV KVG+VARA+ IMSHPIP TNDSHS QVILP
Sbjct  264   GKVWGVTSEGETAKCKKVVCDPSYLPGKVRKVGRVARAIAIMSHPIPSTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD+PE EL+PG+DLLGPVDE+F+E
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPEAELRPGIDLLGPVDEMFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
               DR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   VLDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_007026461.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
1 [Theobroma cacao]
 gb|EOY06963.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
1 [Theobroma cacao]
Length=444

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/421 (78%), Positives = 383/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWK+FRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGNDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGS+V++KGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSYVFSKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDEKDPKTHEGMDLARVTTRELIAKYGLDDNTVDFIGHALALHRDDCYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+CKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVSGVTSEGETARCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSY+HNVAPKGK+IAFVSTEAETD PETEL+PG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYVFCCSYSHNVAPKGKFIAFVSTEAETDHPETELRPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006649851.1| PREDICTED: rab GDP dissociation inhibitor beta-like [Oryza brachyantha]
Length=447

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/419 (78%), Positives = 380/419 (91%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L +LWKRF+G +  PE LG SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTKLWKRFKGNENTPEHLGVSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL FKAVDGSFVYN GKI+KVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE DPK+H+G+DL+ +T ++ I+KY LEDDT+DFIGH+LALH DDNYL +PAI+
Sbjct  144   IYVQDYEEDDPKSHEGLDLHKVTTREVISKYGLEDDTVDFIGHALALHRDDNYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML+K +CKVEFD++
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKAECKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL DKV KVG+VARA+CIM HPIPDT DSHS Q+ILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICIMKHPIPDTKDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             +KQL RKSDMY+FCCSY HNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPV+E F++
Sbjct  324   KKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
              YDR+VP N    DNCF++NSYDA+THFE+TV+DVL +Y+KITGK +DLSVDL+AASAG
Sbjct  384   IYDRYVPANASEDDNCFVTNSYDATTHFETTVKDVLGLYSKITGKELDLSVDLNAASAG  442



>gb|ABU98948.1| GDP-dissociation inhibitor [Lupinus albus]
Length=444

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/421 (79%), Positives = 380/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFV+NKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSFVFNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++ESDPKTH+GMDL  +T ++ I KY L+D+TIDFIGH++ALH DD YL +PA++
Sbjct  144   IYVQDYDESDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHAIALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GS YIYP+YGLGELPQ F RLSAVYGGTYMLNKP+CKV+FD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSSYIYPLYGLGELPQGFVRLSAVYGGTYMLNKPECKVKFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVG+VARA+ IMSHPIP+TNDSHSAQVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIVIMSHPIPNTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVS EAET  PE+ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETGHPESELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010907542.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Elaeis guineensis]
Length=444

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/421 (79%), Positives = 381/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG+D PP  LG S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDMPPANLGPSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL+FKAVDGS+V+NKGKI+KVPATD+EAL+S LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDMEALRSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH G+DL  +T ++ I+KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHGGLDLTRVTTRELISKYGLDDNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPKCKVEFDVE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVG+VARA+ IMSHPIP+T+DSHS QVILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTDDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVS+EAETD PE ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSSEAETDRPEIELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRF P N+ + DNCFIS SYDA+THFESTV DVL MY  ITGK VDLSVDLS ASA  
Sbjct  384   TYDRFEPVNEPSLDNCFISTSYDATTHFESTVMDVLHMYRMITGKNVDLSVDLSVASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_008801341.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X1 [Phoenix dactylifera]
Length=444

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/421 (79%), Positives = 383/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRF+G D PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFQGNDSPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGS+V+NKGKI+KVPATD+EAL+S LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKIHKVPATDMEALRSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH G+DL  +T ++ I+KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHGGLDLTRVTTRELISKYGLDDNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GV+SEGETA+CKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+T+DSHS QVILP
Sbjct  264   GKVCGVSSEGETARCKKVVCDPSYLPNKVKKVGKVARAIAIMSHPIPNTDDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAET+ P+ ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETNQPQVELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR  P N+   DNCFIS SYDA+THFESTV DVL +YTKITGKT+DLSVDLSAASA  
Sbjct  384   TYDRCEPVNEPLLDNCFISTSYDATTHFESTVMDVLAIYTKITGKTIDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_011074023.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Sesamum indicum]
Length=444

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/421 (78%), Positives = 382/421 (91%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG+D+PP  LG+S++YNVDMIPK++MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDKPPAHLGSSRDYNVDMIPKYIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYN+GKI+KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GELVRVLIHTDVTKYLYFKAVDGSFVYNRGKIHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E DPKTH+G+DL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNECDPKTHEGLDLTRVTTRELIAKYGLDDNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYA+SLARF  GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP CKVEF++ 
Sbjct  204   TVKRIKLYADSLARFAGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPDCKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDSHSAQVILP
Sbjct  264   GQVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PETELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   TYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010277857.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nelumbo nucifera]
Length=444

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/421 (78%), Positives = 380/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGNDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGS+V+NKGKI+KVPATD+EALKS LMG+FEKRR RKF 
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKIHKVPATDMEALKSPLMGIFEKRRARKFL  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ++ E+DPKTH+GMDL  +T ++ I KY L+ +T+DFIGH+LALH DD YL +PA++
Sbjct  144   LYVQDYNENDPKTHEGMDLTRVTTRELIAKYGLDGNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK YGVTSEGETA+CKKVVCDP+YL +KV KVGKVARA+CIMSHPIP+T+DSHSAQVILP
Sbjct  264   GKVYGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAICIMSHPIPNTSDSHSAQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             Q+QLGR+SDMYLFC SY HNVAPKGK+IAFV+TEAET+ PE ELKPG+DLLGP+DEIF++
Sbjct  324   QEQLGRRSDMYLFCSSYAHNVAPKGKFIAFVTTEAETNQPEVELKPGIDLLGPIDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLS+ASA  
Sbjct  384   VYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSSASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|NP_001276273.1| rab GDP dissociation inhibitor alpha-like [Glycine max]
 gb|ACU21333.1| unknown [Glycine max]
Length=444

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/421 (79%), Positives = 376/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LGAS++YN+DM PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPHLGASRDYNIDMNPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+V+NKGK++KVPA D+EALKS LMGLFEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPANDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ + ESDPKTH+GMDL  +T K+ I KY L+D+TIDFIGH+LALH+DD YLA+PA++
Sbjct  144   IYVQNYNESDPKTHEGMDLTRVTTKELIAKYGLDDNTIDFIGHALALHSDDRYLAEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL  KV KVG+VARA+ IMSHPIP T+DSHS Q+ILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPGKVRKVGRVARAIAIMSHPIPSTDDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETD P   LKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPAIGLKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFESTVDDVLNMYTLITGKVIDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|ABK25073.1| unknown [Picea sitchensis]
 gb|ABR17192.1| unknown [Picea sitchensis]
 gb|ACN40669.1| unknown [Picea sitchensis]
Length=444

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/421 (78%), Positives = 378/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGGES+SL+L QLWK+FRG D+PP  LG S++YNVDMIPKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGESTSLNLTQLWKKFRGNDKPPAHLGPSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G+LVRVLIHTDVTKYL FKAVDGS+VYNKGKIYKVPATDVEALKS LMG+FEKRR RKFF
Sbjct  84    GSLVRVLIHTDVTKYLYFKAVDGSYVYNKGKIYKVPATDVEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ ++++DPKTH GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA+E
Sbjct  144   IYVQNYDQNDPKTHDGMDLTRVTTRELIAKYGLDDNTVDFIGHALALHRDDRYLFEPALE  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VKK+KLY ESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKKIKLYEESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+CKKVVCDP+YLT+KV KVGKVARA+CIMSHPIP+TNDS S Q+ILP
Sbjct  264   GKVCGVTSEGETARCKKVVCDPSYLTNKVRKVGKVARAICIMSHPIPNTNDSQSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGKYIAFVS EA+TD PE EL+PG+ LLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKYIAFVSAEADTDQPEVELQPGIALLGPVDEMFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDRFVP N+ + DNCFIS SYDA+THFE+TV+DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   TYDRFVPVNEPSLDNCFISTSYDATTHFETTVQDVLAMYTHITGKVLDLTVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_004983945.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Setaria 
italica]
Length=447

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/418 (78%), Positives = 379/418 (91%), Gaps = 0/418 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+GLKVLHMD+NDYYGGESSSL+L +LWKRF+G D PPE LG SKEYNVDM+PKFMMAN
Sbjct  24    SVEGLKVLHMDRNDYYGGESSSLNLTKLWKRFKGNDSPPEHLGVSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL FKAVDGSFVYN GKI+KVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPK+H+G+DL  +T ++ I+KY LEDDT+DFIGH+LALH DD+YL +PA++
Sbjct  144   IYVQDYDEEDPKSHEGLDLTKVTTREVISKYGLEDDTVDFIGHALALHRDDSYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL +KV KVG+VARA+CIM HPIPDT DSHS Q+ILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPEKVKKVGRVARAICIMKHPIPDTKDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             +KQL RKSDMY+FCCSY HNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPV+E F++
Sbjct  324   KKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASA  155
              YDR+ P N+   D+CF++NSYDASTHFE+TV+DVL +Y KITGK +DLSVDL+AASA
Sbjct  384   IYDRYEPINNPEEDSCFLTNSYDASTHFETTVKDVLSLYNKITGKELDLSVDLNAASA  441



>ref|XP_004287194.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/421 (78%), Positives = 379/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGE +SL+LIQLWKRFRG D+PP QLG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGECASLNLIQLWKRFRGDDKPPAQLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL+FKAVDG FVYNKGK++KVPA D+EALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLSFKAVDGGFVYNKGKVHKVPANDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDP+TH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNESDPRTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKC KVVCDP+YL +KV KVGKVARA+ IMSHPIP+TND HS QVILP
Sbjct  264   GKVIGVTSEGETAKCTKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNDCHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFC SY+HNVAPKGK+IAFVSTEAETD+P+TELKPG+DLLGPV+EIF++
Sbjct  324   QKQLGRRSDMYLFCSSYSHNVAPKGKFIAFVSTEAETDNPQTELKPGIDLLGPVEEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPVLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010672532.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/421 (78%), Positives = 380/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+S++LIQLWKRFRG DQP   LG S++YNVDM+PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSINLIQLWKRFRGNDQPSADLGPSRDYNVDMMPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+NKGK++KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLSFKAVDGSYVFNKGKVHKVPATDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ+FEES+PKTH+G+DL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PAI+
Sbjct  144   IFVQDFEESNPKTHEGLDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDAE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YLT+KV KVGKVARA+ IMSHPIP TNDSHS Q+ILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLTNKVRKVGKVARAIAIMSHPIPSTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSYTHNVAPKGK+IAFVSTEAETD+P+TELK G+DLLGPVDE+F++
Sbjct  324   QKQLGRRSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPQTELKAGIDLLGPVDEMFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYD +THFESTV DVL MYT ITGK +DL+VDL+AASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDGTTHFESTVTDVLNMYTMITGKVLDLNVDLNAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|NP_001150143.1| rab GDP dissociation inhibitor alpha [Zea mays]
 gb|ACG38018.1| rab GDP dissociation inhibitor alpha [Zea mays]
 gb|ACN33222.1| unknown [Zea mays]
 tpg|DAA45893.1| TPA: Rab GDP dissociation inhibitor alpha [Zea mays]
Length=447

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/418 (78%), Positives = 377/418 (90%), Gaps = 0/418 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L +LW RF+G D PPE LG SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTKLWNRFKGNDSPPEHLGVSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLI T VTKYL FKAVDGSFVYN GKI+KVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE DPK+H+G+DLN +T ++ I+KY LEDDT+DFIGH+LALH DD+YL +PAI+
Sbjct  144   IYVQDYEEDDPKSHEGLDLNKVTTREVISKYGLEDDTVDFIGHALALHRDDSYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKK+VCDP+YL DKV KVG+VARA+CIM HPIPDT DSHS Q+ILP
Sbjct  264   GKAYGVTSEGETAKCKKIVCDPSYLPDKVKKVGRVARAICIMKHPIPDTKDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             +KQL RKSDMY+FCCSY HNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPV+E F++
Sbjct  324   KKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASA  155
              YDR+ P N+   D CF++NSYD++THFE+TV+DVL +Y KITGK +DLSVDL+AASA
Sbjct  384   IYDRYEPVNNPDDDCCFLTNSYDSTTHFETTVKDVLALYNKITGKELDLSVDLNAASA  441



>ref|XP_007026462.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
2 [Theobroma cacao]
 gb|EOY06964.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
2 [Theobroma cacao]
Length=445

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/422 (78%), Positives = 383/422 (91%), Gaps = 1/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWK+FRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGNDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGS+V++KGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSYVFSKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDEKDPKTHEGMDLARVTTRELIAKYGLDDNTVDFIGHALALHRDDCYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQ-AFARLSAVYGGTYMLNKPQCKVEFDD  692
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ AFARLSAVYGGTYMLNKP+CKVEFDD
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQQAFARLSAVYGGTYMLNKPECKVEFDD  263

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              GK  GVTSEGETA+CKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS Q+IL
Sbjct  264   EGKVSGVTSEGETARCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQIIL  323

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQKQLGR+SDMY+FCCSY+HNVAPKGK+IAFVSTEAETD PETEL+PG+DLLGPVDEIF+
Sbjct  324   PQKQLGRRSDMYVFCCSYSHNVAPKGKFIAFVSTEAETDHPETELRPGIDLLGPVDEIFF  383

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
             + YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA 
Sbjct  384   DIYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSAASAA  443

Query  151   GE  146
              E
Sbjct  444   EE  445



>gb|KHG05683.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=444

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/421 (77%), Positives = 380/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWK+FRG D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGNDKPPANLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGS+V+NKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E DPKTH+GMDL  +  +  I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDEKDPKTHEGMDLTRVPTRALIAKYGLDDNTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVE+D+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEYDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+CKKVVCDP+YL +KV K+GKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETARCKKVVCDPSYLPNKVRKIGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVSTEAETD PE+ELKPG+DLLGP DEIF++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPFDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYKPVNEPSLDNCFISTSYDATTHFESTVSDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_002310371.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
 gb|EEE90821.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
Length=444

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/421 (78%), Positives = 375/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT+VTKYL FKAVDGSFV NKGK++KVPATD+EALKS LMG+FEKRR RK F
Sbjct  84    GNLVRVLIHTNVTKYLYFKAVDGSFVLNKGKVHKVPATDMEALKSPLMGIFEKRRARKLF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YV  +EESDPKTH+GMDL  +T ++ I K+ L+D+TIDFIGH++ALH DD YL +PA++
Sbjct  144   IYVHNYEESDPKTHEGMDLTRVTTRELIAKFGLDDNTIDFIGHAVALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAES ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP T++SHS QVILP
Sbjct  264   GKVAGVTSEGETAKCKKVVCDPSYLLNKVRKVGKVARAIAIMSHPIPSTDESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSYTHNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPEVELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|EMT30538.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=447

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/419 (78%), Positives = 378/419 (90%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L ++WKRF+G+D  P+ LG SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLAKIWKRFKGSDTTPDHLGVSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLI T VTKYL FKAVDGSFVYN GKI+KVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE D K+H+G+DL+ +T ++ I+KY LEDDT+DFIGH+LALH DDNYL +PAI+
Sbjct  144   IYVQDYEEDDAKSHEGLDLHKVTTRELISKYGLEDDTVDFIGHALALHRDDNYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETAKCKKVVCDP+YL DKV KVG+VARA+CIM HPIPDT DSHS Q+ILP
Sbjct  264   GKAFGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICIMKHPIPDTKDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             +KQL RKSDMY+FCCSY HNVAPKGK++AFVSTEAETD PE ELKPG+DLLGPV+E F++
Sbjct  324   KKQLKRKSDMYVFCCSYAHNVAPKGKFVAFVSTEAETDKPEIELKPGIDLLGPVEETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
              YDRF P N    DNCF++ SYDA+THFE+TV+DVL +Y+KITGK +DLSVDL+AASAG
Sbjct  384   MYDRFEPVNAAEEDNCFLTTSYDATTHFETTVKDVLALYSKITGKELDLSVDLNAASAG  442



>ref|XP_003629947.1| Rab GDP dissociation inhibitor [Medicago truncatula]
 gb|AET04423.1| GDP dissociation inhibitor [Medicago truncatula]
 gb|AFK41459.1| unknown [Medicago truncatula]
Length=444

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/421 (78%), Positives = 376/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWK+FRG D+PP  LG+SK+YN+DM PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGDDKPPPHLGSSKDYNIDMNPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFV+NK K++KVP+ D+EALKS LMG+FEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSFVFNKAKVHKVPSNDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH GMDL  +T K+ I K+ L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNESDPKTHDGMDLTRVTTKELIAKFGLDDNTVDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDQ  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKK+VCDP+YLT+KV KVGKVARA+ IMSHPIP+TNDS S QVILP
Sbjct  264   GKVIGVTSEGETAKCKKLVCDPSYLTNKVRKVGKVARAIAIMSHPIPNTNDSQSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNV PKGK+IAFVSTEAETD P  ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVCPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P N+ T DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   MYDRFEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLTVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|NP_001266078.1| rab GDP dissociation inhibitor alpha-like [Cicer arietinum]
 emb|CAA06731.1| GDP dissociation inhibitor [Cicer arietinum]
Length=444

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/421 (78%), Positives = 375/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+SK+YN+DM PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPHLGSSKDYNIDMNPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFV+NKGK++KVP+ D+EALKS LMG+FEKRR RKFF
Sbjct  84    GMLVRVLIHTDVTKYLYFKAVDGSFVFNKGKVHKVPSNDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH GMDL  +T K+ I K+ L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNESDPKTHDGMDLTRVTTKELIAKFGLDDNTVDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GV+SEGETAKCKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVLGVSSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD P  ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P N+ T DNCF+S SYDA+THFESTV DVL MYT ITGK +DLSVDLSAA A  
Sbjct  384   MYDRFEPVNEPTLDNCFVSTSYDATTHFESTVLDVLNMYTLITGKVLDLSVDLSAAGAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010920623.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Elaeis guineensis]
Length=446

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/413 (79%), Positives = 371/413 (90%), Gaps = 0/413 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKR +G D+P E LG+SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRLKGNDKPEENLGSSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS+LMGLFEKRR RK F
Sbjct  84    GALVRVLIHTGVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSTLMGLFEKRRARKLF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E++DPK+H+G+DLN +T K+   KY LED+T+DFIGH+LALH DD+YL  PAI+
Sbjct  144   IYVQDYEDNDPKSHEGLDLNKVTTKELFAKYGLEDNTVDFIGHALALHRDDSYLDDPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD +
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDAN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSE ETAKCKKVVCDP+YL DKV KVG+V RA+CIMSHPIP TND+HS Q+ILP
Sbjct  264   GKAYGVTSESETAKCKKVVCDPSYLPDKVKKVGRVTRAICIMSHPIPHTNDAHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSYTHNVAPKGKYIAFVSTEAETD PE ELKPG+DLLGPVDE F++
Sbjct  324   QKQLGRKSDMYVFCCSYTHNVAPKGKYIAFVSTEAETDQPEVELKPGIDLLGPVDETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
              YDR+ P N    DNCFIS SYDA+THFESTV+DVL MY +ITGK +DL+VDL
Sbjct  384   IYDRYEPVNKHDEDNCFISTSYDATTHFESTVQDVLSMYGRITGKELDLTVDL  436



>ref|XP_002465085.1| hypothetical protein SORBIDRAFT_01g031830 [Sorghum bicolor]
 gb|EER92083.1| hypothetical protein SORBIDRAFT_01g031830 [Sorghum bicolor]
Length=447

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/414 (79%), Positives = 376/414 (91%), Gaps = 0/414 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LI+LWKRF+G D PPE LG SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIKLWKRFKGNDSPPEHLGISKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL FKAVDGSFVYN GKI+KVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE DPK+H+G+DL  +T K+ I+KY LEDDT+DFIGH+LALH DD+YL +PAI+
Sbjct  144   IYVQDYEEDDPKSHEGLDLTKVTTKEVISKYGLEDDTVDFIGHALALHRDDSYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKK+VCDP+YL +KV KVG+VARA+CIM HPIPDT DSHS Q+ILP
Sbjct  264   GKAYGVTSEGETAKCKKIVCDPSYLPEKVKKVGRVARAICIMKHPIPDTKDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             +KQL RKSDMY+FCCSY HNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPV+E F++
Sbjct  324   KKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLS  167
              YDR+ P N+   D+CF++NSYD++THFE+TV+DVL +Y KITGK +DLSVDL+
Sbjct  384   IYDRYEPINNPEEDSCFLTNSYDSTTHFETTVKDVLALYNKITGKELDLSVDLN  437



>ref|XP_006654412.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Oryza brachyantha]
Length=445

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/421 (78%), Positives = 378/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTHQG+DL  +T ++ I KY L DDT+DFIGH+LALH DD YL  PAI+
Sbjct  144   IYVQDYDEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFIGHALALHRDDRYLNDPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPDCKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPI  TN+SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIGSTNESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSYTHNVAPKGK+IAFVSTEAETD+PE+ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPESELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   TYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_007159565.1| hypothetical protein PHAVU_002G248100g [Phaseolus vulgaris]
 gb|ESW31559.1| hypothetical protein PHAVU_002G248100g [Phaseolus vulgaris]
Length=445

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/422 (78%), Positives = 374/422 (89%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PP QLGAS++YN+DM PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPPQLGASRDYNIDMNPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+NKGK++KVP+ D+EALKS LMGLFEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLSFKAVDGSYVFNKGKVHKVPSNDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ +  SDPK H+GMDL  +T K+ I KY L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQNYNVSDPKAHEGMDLTRVTTKELIAKYGLDDNTVDFIGHALALHRDDRYLTEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL  KV KVGKVARA+ IMSHPIP T+DSHS Q+ILP
Sbjct  264   GKVIGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPSTDDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVS+EAETD P  ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSSEAETDQPAIELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPALDNCFISMSYDATTHFESTVDDVLNMYTMITGKVIDLSVDLSAASAAE  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>emb|CAF02075.1| GDP dissociation inhibitor [Medicago truncatula]
Length=444

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/421 (78%), Positives = 375/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWK+FRG D+PP  LG+SK+YN+DM PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGDDKPPPHLGSSKDYNIDMNPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGSFV+NK K++KVP+ D+EALKS LMG+FEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSFVFNKAKVHKVPSNDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ESDPKTH GMDL  +T K+ I K+ L+D+T+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNESDPKTHDGMDLTRVTTKELIAKFGLDDNTVDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDQ  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKK+VCDP+YLT+KV KVGKVARA+ IMSHPIP+TNDS S QVILP
Sbjct  264   GKVIGVTSEGETAKCKKLVCDPSYLTNKVRKVGKVARAIAIMSHPIPNTNDSQSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNV PKGK+IAFVSTEAETD P  ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVCPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P N+ T DNCFIS SYDA+THFESTV DVL MYT ITGK +DL+VDLS ASA  
Sbjct  384   MYDRFEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTLITGKVLDLTVDLSVASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|ACL54441.1| unknown [Zea mays]
Length=447

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/422 (77%), Positives = 378/422 (90%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L +LW RF+  D PPE LG SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLTKLWNRFKDNDSPPEHLGVSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLI T VTKYL FKAVDGSFVYN GKI+KVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE DPK+H+G+DLN +T ++ I+KY LEDDT+DFIGH+LALH DD+YL +PAI+
Sbjct  144   IYVQDYEEDDPKSHEGLDLNKVTTREVISKYGLEDDTVDFIGHALALHRDDSYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKK+VCDP+YL DKV KVG+VARA+CIM HPIPDT DSHS Q+ILP
Sbjct  264   GKAYGVTSEGETAKCKKIVCDPSYLPDKVKKVGRVARAICIMKHPIPDTKDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             +KQL RKSDMY+FCCSY HNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPV+E F++
Sbjct  324   KKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   D CF++NSYD++THFE+TV+DVL +Y KITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNNPDDDCCFLTNSYDSTTHFETTVKDVLALYNKITGKELDLSVDLNAASATE  443

Query  148   EQ  143
             ++
Sbjct  444   QE  445



>ref|XP_010277493.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X3 [Nelumbo nucifera]
 ref|XP_010277494.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X3 [Nelumbo nucifera]
Length=413

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/404 (79%), Positives = 374/404 (93%), Gaps = 0/404 (0%)
 Frame = -1

Query  1381  MDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVRVLIH  1202
             MD+NDYYGGES+SL+LIQLWKRFRG D+PPE LG+S+EYNVDMIPKFMMANG LVRVLIH
Sbjct  1     MDRNDYYGGESTSLNLIQLWKRFRGNDKPPEHLGSSREYNVDMIPKFMMANGALVRVLIH  60

Query  1201  TDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQEFEES  1022
             TDVTKYL FKAVDGSFVYNKG+I+KVPATDVEALKS LMGLFEKRR RKFF+YVQ++EE+
Sbjct  61    TDVTKYLNFKAVDGSFVYNKGQIHKVPATDVEALKSQLMGLFEKRRARKFFIYVQDYEEN  120

Query  1021  DPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKVKLYA  842
             DPK+H+G+DLN +TA+D I+KY LED+T+DFIGH+LALH DD YL +PA++FVK+++LYA
Sbjct  121   DPKSHEGLDLNKVTARDVISKYGLEDNTVDFIGHALALHIDDKYLDEPAMDFVKRIRLYA  180

Query  841   ESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYGVTSE  662
             ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD++GKA+GVTSE
Sbjct  181   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDENGKAFGVTSE  240

Query  661   GETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLGRKSD  482
             GETA+CKKVVCDP+YL DKV KVG+VARA+CIMSHPIP+T+DSHS QVILPQKQLGRKSD
Sbjct  241   GETARCKKVVCDPSYLPDKVQKVGRVARAICIMSHPIPNTSDSHSVQVILPQKQLGRKSD  300

Query  481   MYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDRFVPTN  302
             MYLFCCSY HNVAPKGKYIAFV  EAET++PE ELKPG++LLGPV+E+F++ YDR+ P N
Sbjct  301   MYLFCCSYAHNVAPKGKYIAFVLAEAETNEPEVELKPGIELLGPVEEMFFDIYDRYEPIN  360

Query  301   DCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
                 DNC+IS SYDA+THFESTV+DV+ MY++ITGK +DLSVDL
Sbjct  361   KQDVDNCYISTSYDATTHFESTVKDVISMYSRITGKDLDLSVDL  404



>gb|KHG21656.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=426

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/405 (81%), Positives = 373/405 (92%), Gaps = 3/405 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK F+G D+PPEQLGAS++YNVDM   FMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTQLWKHFKGEDKPPEQLGASRDYNVDM---FMMAN  80

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G+LVR+LIHTDVTKYL FKAVDGSFVYNK KIYKVPATDVEALKS LMGLFEKRR RKFF
Sbjct  81    GSLVRILIHTDVTKYLNFKAVDGSFVYNKSKIYKVPATDVEALKSPLMGLFEKRRARKFF  140

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+G+DL  +TAK+ I+KY LEDDTIDFIGH+LAL++ DNYL QPA++
Sbjct  141   IYVQDYDENDPKSHEGLDLTKVTAKELISKYGLEDDTIDFIGHALALYSSDNYLDQPALD  200

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CK+E+ D 
Sbjct  201   FVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKIEYGDD  260

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKVARAVCIMSHPIPDTNDSHSAQVI+P
Sbjct  261   GKVIGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAVCIMSHPIPDTNDSHSAQVIVP  320

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY HNVAPKGK+IAFVSTEAETDDP+ EL+PG+ LLGPVDEIFY+
Sbjct  321   QKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDDPKVELEPGIKLLGPVDEIFYD  380

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGK  194
              YDR+ PTND TADNCFIS SYD +THFE+TV DV++MYTKITGK
Sbjct  381   NYDRYEPTNDHTADNCFISASYDPTTHFETTVNDVIQMYTKITGK  425



>ref|XP_011005244.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Populus euphratica]
 ref|XP_011005245.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Populus euphratica]
Length=444

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/421 (78%), Positives = 374/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+V NKGK++KVPATD+EALKS LMG+FEKRR RK F
Sbjct  84    GNLVRVLIHTDVTKYLYFKAVDGSYVLNKGKVHKVPATDMEALKSPLMGIFEKRRARKLF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YV  +EESDPKTH+GMDL  +T ++ I K+ L+D+TIDFIGH++ALH DD YL +PA++
Sbjct  144   IYVHNYEESDPKTHEGMDLTRVTTRELIAKFGLDDNTIDFIGHAVALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAES ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEG TAKCKKVVCDP+YL +KV KVG+VARA+ IMSHPIP T++SHS QVILP
Sbjct  264   GKVAGVTSEGATAKCKKVVCDPSYLLNKVRKVGRVARAIAIMSHPIPSTDESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSYTHNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPEVELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_004962068.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X2 [Setaria italica]
Length=445

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/421 (77%), Positives = 377/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPTHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKIYKVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DPKTHQG+DL  +T ++ I KY L DDT+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNEADPKTHQGLDLTMVTTRELIAKYGLSDDTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+V RA+ IMSHPIP+TN+SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLLNKVRKIGRVVRAIAIMSHPIPNTNESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSYTHNVAP+GK+IAFVS EAETD+P++ELKPG+DLLG VDEIFY+
Sbjct  324   QKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQSELKPGLDLLGSVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010067212.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Eucalyptus grandis]
Length=444

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/421 (76%), Positives = 381/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+GLKVLHMD+NDYYGGES+SL+L+QLWK+FR +D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVNGLKVLHMDRNDYYGGESTSLNLVQLWKKFRNSDKPPAHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVT+YL FKAVDGS+V++KGK++KVPATD+EAL++ LMG+F+KRR RKFF
Sbjct  84    GTLVRVLIHTDVTRYLYFKAVDGSYVFSKGKVHKVPATDMEALQTPLMGMFQKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+TIDFIGH++ALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGMDLTLLTTRELIAKYGLDDNTIDFIGHAMALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF+D 
Sbjct  204   TVKRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+ IM HPIP+TNDSHS QVI+P
Sbjct  264   GQVIGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAISIMGHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVS EAETD PE ELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPEIELKPGLDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   TYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_002439812.1| hypothetical protein SORBIDRAFT_09g020540 [Sorghum bicolor]
 gb|EES18242.1| hypothetical protein SORBIDRAFT_09g020540 [Sorghum bicolor]
Length=445

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/421 (76%), Positives = 377/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKIYKVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DP+THQG+DL  +T ++ I+KY L DDT+DF+GH+LALH DD YL +PA++
Sbjct  144   IYVQDYNEADPRTHQGLDLTRVTTRELISKYGLSDDTVDFVGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+V RA+ IMSHPIP+TN+SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVVRAIAIMSHPIPNTNESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSYTHNVAP+GK+IAFVS EAETD P++ELKPG+DLLG VDEIFY+
Sbjct  324   QKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDSPQSELKPGIDLLGSVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|EMS53287.1| Rab GDP dissociation inhibitor alpha [Triticum urartu]
Length=447

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/419 (77%), Positives = 378/419 (90%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L ++WKRF+G+D  P+ LG SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLAKIWKRFKGSDTTPDHLGVSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLI T VTKYL FKAVDGSFVYN GKI+KVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE D K+H+G++L+ +T ++ I+KY LEDDTIDFIGH+LALH DD+YL +PAI+
Sbjct  144   IYVQDYEEDDAKSHEGLNLHKVTTRELISKYGLEDDTIDFIGHALALHRDDSYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETAKCKKVVCDP+YL DKV KVG+VARA+CIM HPIPDT DSHS Q+ILP
Sbjct  264   GKAFGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICIMKHPIPDTKDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             +KQL RKSDMY+FCCSY HNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPV+E F++
Sbjct  324   KKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
              YDR+ P N    DNCF++ SYDA+THFE+TV+DVL +Y+KITGK +DLSVDL+AASAG
Sbjct  384   MYDRYEPVNAAEEDNCFLTTSYDATTHFETTVKDVLALYSKITGKELDLSVDLNAASAG  442



>dbj|BAJ93199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/421 (76%), Positives = 380/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWK+FRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EALKS LMG+FEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGIFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ++DPKTHQG+DL  +T ++ I K+ L DDTIDFIGH+LALH DD YL++PA++
Sbjct  144   IYVQDYNDADPKTHQGLDLTRMTTRELIAKHGLSDDTIDFIGHALALHRDDRYLSEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+ IMSHPIP+ NDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLANKVRKIGKVARAIAIMSHPIPNANDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSYTHNVAPKGK+IAFVS EAETD+P++ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ +  NCF+S+SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPSLGNCFVSSSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|NP_001055142.1| Os05g0304400 [Oryza sativa Japonica Group]
 dbj|BAF17056.1| Os05g0304400 [Oryza sativa Japonica Group]
 gb|EAY97451.1| hypothetical protein OsI_19382 [Oryza sativa Indica Group]
 dbj|BAG93308.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63167.1| hypothetical protein OsJ_17976 [Oryza sativa Japonica Group]
Length=445

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/421 (77%), Positives = 375/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LG+SK+YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGSSKDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DPKTHQG+DL  +T ++ I KY L DDT+DFIGH+LALH DD YL +PAI+
Sbjct  144   IYVQDYNEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFIGHALALHRDDRYLNEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPDCKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+ IMSHPI  TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAIMSHPIASTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSYTHNVAPKGK+IAFVSTEAETD+P++ELKPG+DLLG VDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPQSELKPGIDLLGQVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKAVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_003558226.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Brachypodium distachyon]
Length=447

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/414 (78%), Positives = 376/414 (91%), Gaps = 0/414 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L ++WKRF+G++  P+ LG SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTKIWKRFKGSESTPDHLGVSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLI T VTKYL FKAVDGSFVYN GKI+KVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE DPK+H+G+DL+ +T ++ I+KY LEDDT+DFIGH+LALH DDNYL +PAI+
Sbjct  144   IYVQDYEEDDPKSHEGLDLHKVTTREVISKYGLEDDTVDFIGHALALHRDDNYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+S
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDES  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA+GVTSEGETAKCKKVVCDP+YLTDKV KVG+VARA+CIM HPIPDT DSHS Q+ILP
Sbjct  264   GKAFGVTSEGETAKCKKVVCDPSYLTDKVKKVGRVARAICIMKHPIPDTKDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             +KQL RKSDMY+FCCSY HNVAPKGK+IAFVSTEAETD PE ELKPG+DLLGPV+E F++
Sbjct  324   KKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPEIELKPGIDLLGPVEETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLS  167
              YDR+ P N    DNCF++NSYDA+THFE+TV+DVL +Y+KITGK +DLSVDL+
Sbjct  384   IYDRYEPVNTPEEDNCFLTNSYDATTHFETTVKDVLALYSKITGKDLDLSVDLN  437



>ref|XP_008801349.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X2 [Phoenix dactylifera]
Length=416

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/415 (78%), Positives = 377/415 (91%), Gaps = 0/415 (0%)
 Frame = -1

Query  1390  VLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVRV  1211
             VLHMD+NDYYGGES+SL+LIQLWKRF+G D PP  LG+S++YNVDMIPKFMMANGTLVRV
Sbjct  2     VLHMDRNDYYGGESTSLNLIQLWKRFQGNDSPPAHLGSSRDYNVDMIPKFMMANGTLVRV  61

Query  1210  LIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQEF  1031
             LIHTDVTKYL FKAVDGS+V+NKGKI+KVPATD+EAL+S LMGLFEKRR RKFF+YVQ++
Sbjct  62    LIHTDVTKYLYFKAVDGSYVFNKGKIHKVPATDMEALRSPLMGLFEKRRARKFFIYVQDY  121

Query  1030  EESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKVK  851
             +E+DPKTH G+DL  +T ++ I+KY L+D+T+DFIGH+LALH DD YL +PA++ VK++K
Sbjct  122   DENDPKTHGGLDLTRVTTRELISKYGLDDNTVDFIGHALALHRDDRYLDEPALDTVKRMK  181

Query  850   LYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYGV  671
             LYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ GK  GV
Sbjct  182   LYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVCGV  241

Query  670   TSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLGR  491
             +SEGETA+CKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+T+DSHS QVILPQKQLGR
Sbjct  242   SSEGETARCKKVVCDPSYLPNKVKKVGKVARAIAIMSHPIPNTDDSHSVQVILPQKQLGR  301

Query  490   KSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDRFV  311
             KSDMYLFCCSY+HNVAPKGK+IAFVSTEAET+ P+ ELKPG+DLLGPVDEIF++TYDR  
Sbjct  302   KSDMYLFCCSYSHNVAPKGKFIAFVSTEAETNQPQVELKPGIDLLGPVDEIFFDTYDRCE  361

Query  310   PTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGGE  146
             P N+   DNCFIS SYDA+THFESTV DVL +YTKITGKT+DLSVDLSAASA  E
Sbjct  362   PVNEPLLDNCFISTSYDATTHFESTVMDVLAIYTKITGKTIDLSVDLSAASAAEE  416



>ref|NP_001049717.1| Os03g0277000 [Oryza sativa Japonica Group]
 gb|ABF95264.1| Rab GDP dissociation inhibitor alpha, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11631.1| Os03g0277000 [Oryza sativa Japonica Group]
 gb|EAY89454.1| hypothetical protein OsI_10987 [Oryza sativa Indica Group]
 gb|EAZ26447.1| hypothetical protein OsJ_10334 [Oryza sativa Japonica Group]
 dbj|BAG94640.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/414 (78%), Positives = 373/414 (90%), Gaps = 0/414 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L +LWKRF+G +  PE LG SKEYNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLTKLWKRFKGNETAPEHLGVSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL FKAVDGSFVYN GKI+KVPATDVEALKS+LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE DPK+H+G+DL+ +T ++ I+KY LEDDT+DFIGH+LALH DDNYL +PAI+
Sbjct  144   IYVQDYEEDDPKSHEGLDLHKVTTREVISKYGLEDDTVDFIGHALALHRDDNYLDEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGL ELPQAFARLSAVYGGTYMLNK +CKVEFD++
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLAELPQAFARLSAVYGGTYMLNKAECKVEFDEN  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL DKV KVG+VARA+CIM HPIPDT DSHS Q+ILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICIMKHPIPDTKDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             +KQL RKSDMY+FCCSY HNVAPKGK+IAFVSTEAE D PE ELKPG+DLLGPV+E F++
Sbjct  324   KKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAEADKPEIELKPGIDLLGPVEETFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLS  167
              YDR+ PTN    DNCF++NSYDA+THFE+TV+DVL +Y+KITGK +DLSVDL+
Sbjct  384   IYDRYEPTNTADEDNCFVTNSYDATTHFETTVKDVLALYSKITGKELDLSVDLN  437



>ref|XP_008649650.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Zea mays]
 gb|AFW78025.1| hypothetical protein ZEAMMB73_176599 [Zea mays]
Length=445

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/421 (76%), Positives = 376/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKIYKVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DP+THQG+DL  +T ++ I KY L DDT+DF+GH+LALH DD YL +PA++
Sbjct  144   IYVQDYNEADPRTHQGLDLTRVTTRELIAKYGLSDDTVDFVGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYA+SLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP CKVEFD  
Sbjct  204   TVKRMKLYADSLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPDCKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+V RA+ IMSHPIP+TN+SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLQNKVRKIGRVVRAIAIMSHPIPNTNESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSYTHNVAP+GK+IAFVS EAETD+P++ELKPG+DLLG VDEIFY+
Sbjct  324   QKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQSELKPGIDLLGSVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010101313.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
 gb|EXB88260.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
Length=452

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/429 (77%), Positives = 379/429 (88%), Gaps = 8/429 (2%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+L QLWKRFRG D PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLNQLWKRFRGNDSPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVR---  1058
             GTLVRVLIHTDVTKYL FKAVDGS+V+NKGK++KVPATD+EALKS LMG+FEKRR R   
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDMEALKSPLMGIFEKRRARNHY  143

Query  1057  -----KFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDN  893
                  KFF+YVQ+++E+DPKTH G DL  +T ++ ++KY L+D+T+DFIGH++ALH DD 
Sbjct  144   KRRARKFFIYVQDYDENDPKTHDGFDLTRVTTRELVSKYGLDDNTLDFIGHAIALHRDDR  203

Query  892   YLAQPAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQ  713
             YL +PA++ VK++KLYAES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGT MLNKP+
Sbjct  204   YLNEPALDTVKRMKLYAESVARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTCMLNKPE  263

Query  712   CKVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDS  533
             CKVEF++ GK  GVTSEGETA+CKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDS
Sbjct  264   CKVEFNEEGKVIGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNDS  323

Query  532   HSAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLG  353
             HS QVILPQKQLGR SDMYLFCCSY+HNVAPKGK+IAFVSTEAETD+PETELKPG DLLG
Sbjct  324   HSVQVILPQKQLGRISDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPETELKPGTDLLG  383

Query  352   PVDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVD  173
             PVDEIFY+ YDR+ P N+ T DNCFIS SYDA+THFESTV DVL MYT ITGK VDLSVD
Sbjct  384   PVDEIFYDMYDRYEPVNEPTLDNCFISTSYDATTHFESTVIDVLNMYTLITGKVVDLSVD  443

Query  172   LSAASAGGE  146
             LSAASA  E
Sbjct  444   LSAASAAEE  452



>ref|NP_001055566.1| Os05g0418000 [Oryza sativa Japonica Group]
 gb|AAU10789.1| putative GDP dissociation inhibitor [Oryza sativa Japonica Group]
 gb|AAV25637.1| putative GDP dissociation inhibitor [Oryza sativa Japonica Group]
 dbj|BAF17480.1| Os05g0418000 [Oryza sativa Japonica Group]
 gb|EAY98071.1| hypothetical protein OsI_19989 [Oryza sativa Indica Group]
 gb|EEE63749.1| hypothetical protein OsJ_18568 [Oryza sativa Japonica Group]
Length=445

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/421 (78%), Positives = 376/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTHQG+DL  +T ++ I KY L DDT+DFIGH+LALH DD YL +PAI+
Sbjct  144   IYVQDYDEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFIGHALALHRDDRYLNEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPDCKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+ IMSHPI +TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAIMSHPIANTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+F CSYTHNVAPKGK+IAFVSTEAETD PE+ELKPG+DLLG VDE+F++
Sbjct  324   QKQLGRKSDMYVFGCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGQVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|NP_001183437.1| Rab GDP dissociation inhibitor alpha [Zea mays]
 gb|ACR36809.1| unknown [Zea mays]
 gb|AFW81914.1| Rab GDP dissociation inhibitor alpha [Zea mays]
 gb|AFW81915.1| Rab GDP dissociation inhibitor alpha [Zea mays]
Length=445

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/421 (76%), Positives = 376/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKIYKVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DP+THQG+DL  +T ++ I KY L DDT+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNEADPRTHQGLDLTRVTTRELIAKYGLSDDTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+V RA+ IMSHPIP+TN+SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVVRAIAIMSHPIPNTNESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSYTHNVAP+GK+IAFVS EAETD+P++ELKPG+DLLG VDEI Y+
Sbjct  324   QKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQSELKPGIDLLGSVDEILYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF++ SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFVTTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>emb|CDP11069.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/421 (77%), Positives = 379/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWK+FRG+D PP  LG+S++YNVDM+PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLVQLWKKFRGSDNPPSNLGSSRDYNVDMMPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+VY+KGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSYVYSKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ + E+DPKTH+GMDL  +T ++FI K+ L+D+T+DFIGH+LAL+ DD+YL +PA++
Sbjct  144   IYVQAYNENDPKTHEGMDLTRVTTREFIAKFGLDDNTMDFIGHALALYRDDHYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK+VKLY ESLARF  GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRVKLYEESLARFGGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GV SEGETAKCKKVVCDP+YLT+KV KVGKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVMGVASEGETAKCKKVVCDPSYLTNKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FC SY+HNVAPKGK+IAFVSTEAETD PETELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYVFCSSYSHNVAPKGKFIAFVSTEAETDHPETELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYD +THFESTV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDPTTHFESTVVDVLNMYTMITGKVLDLNVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010524208.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Tarenaya hassleriana]
Length=444

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/421 (76%), Positives = 380/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG D+ P  LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPAHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+NKGKI+KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDLN +T K+ I+K+ L+D+TIDFIGH++ALH DD+YL+QPA++
Sbjct  144   SYVQDYDEKDPKTHGGMDLNRVTTKELISKFGLDDNTIDFIGHAVALHRDDSYLSQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPY+YP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYLYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV K+G+VARA+ IMSHPIP+TN+SHS Q+ILP
Sbjct  264   GKVAGVTSEGETAKCKKVVCDPSYLADKVRKIGRVARAIAIMSHPIPNTNESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAP+GK+IAFVST+AETD+P+TELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPRGKFIAFVSTDAETDNPQTELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFETTVADVLNMYTLITGKVLDLSVDLSAASASD  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010107286.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
 gb|EXC14619.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
Length=463

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/420 (78%), Positives = 378/420 (90%), Gaps = 7/420 (2%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+GLKVLHMD+N+YYGGES+SL+L QLWKRFR  D PPEQLG+SKEYNVDMIPKFMMAN
Sbjct  24    SVNGLKVLHMDRNEYYGGESTSLNLHQLWKRFRDGDMPPEQLGSSKEYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDG+FVYNKGKI+KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLNFKAVDGNFVYNKGKIHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++E+SDPK+H+G+DLN +TA+D I+KY L+D+T+DFIGH+LAL+ DD YL +PA++
Sbjct  144   IYVQDYEDSDPKSHEGLDLNKVTARDLISKYGLDDNTVDFIGHALALYRDDAYLDEPALD  203

Query  868   FVKKVKL-------YAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQC  710
             FVK+VKL       YAESLARFQ GSPYIYP YGLGELPQ FARLSAVYGGTYML KP+C
Sbjct  204   FVKRVKLGLSFEKLYAESLARFQGGSPYIYPHYGLGELPQGFARLSAVYGGTYMLGKPEC  263

Query  709   KVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSH  530
             KVEFD++G+A+GVTSEGETA+CKKVVCDP+YL DKV KVGKVARA+CIMS PIP TNDSH
Sbjct  264   KVEFDENGRAFGVTSEGETARCKKVVCDPSYLPDKVKKVGKVARAICIMSQPIPHTNDSH  323

Query  529   SAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGP  350
             SAQVILPQKQLGRKSD YLFCCSY+HN+APKGKYIAFV TEAETDDP+ ELKPG+DLLGP
Sbjct  324   SAQVILPQKQLGRKSDTYLFCCSYSHNIAPKGKYIAFVLTEAETDDPKVELKPGIDLLGP  383

Query  349   VDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
             VDEIF++ YDRF PTN   ADNCFIS SYDA+THFE+TV+DV+ MY+KITGK + ++++L
Sbjct  384   VDEIFFDMYDRFEPTNQNDADNCFISTSYDATTHFETTVQDVIAMYSKITGKMLIIAINL  443



>ref|XP_006654244.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Oryza brachyantha]
Length=445

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/421 (77%), Positives = 374/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DPKTHQG+DL  +T ++ I KY L DDT+DFIGH+LALH DD YL +PAI+
Sbjct  144   IYVQDYNEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFIGHALALHRDDRYLNEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP CKVEFD  
Sbjct  204   TVNRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPDCKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+V RA+ IMSHPI +TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVVRAIAIMSHPIGNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+F CSYTHNVAPKGK+IAFVS EAETD+PE+ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFGCSYTHNVAPKGKFIAFVSAEAETDNPESELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|NP_001151199.1| LOC100284832 [Zea mays]
 gb|ACF87775.1| unknown [Zea mays]
 gb|ACG41958.1| rab GDP dissociation inhibitor alpha [Zea mays]
Length=445

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/421 (77%), Positives = 375/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++K KI+KVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKRKIHKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ + E+DP THQG+DL  IT ++ I K+ L DDT+DFIGH+LALH DD YL +PA++
Sbjct  144   VYVQNYNEADPVTHQGLDLTRITTRELILKHGLSDDTVDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDIE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL  KV K+GKVARA+ IMSHPIP+TN+SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPSKVRKIGKVARAIAIMSHPIPNTNESHSIQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSYTHNVAPKGK+IAFVS EAETD+P++ELKPG+DLLG VDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELKPGIDLLGQVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   MYDRYKPVNEPSLDNCFVSMSYDATTHFETTVTDVLSMYTAITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_004962065.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Setaria italica]
Length=445

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/421 (77%), Positives = 377/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWK+FRG D+PP  LGAS++YNVDM+ KFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAHLGASRDYNVDMVLKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ + E+DP THQG+DL  IT ++ I+K+ L DDT+DFIGH+LALH DD YL +PA++
Sbjct  144   VYVQNYNEADPVTHQGLDLTRITTRELISKHGLSDDTVDFIGHALALHRDDCYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSYTHNVAPKGK+IAFVS EAETD+P++EL+PG+DLLG VDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELRPGIDLLGQVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLSMYTAITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_003568439.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Brachypodium distachyon]
Length=445

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/421 (76%), Positives = 377/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWK+FRG ++PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKKFRGEEKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EAL+S LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALRSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ ++DPKTHQG DL  +T K+ I K+ L DDT+DFIGH+LALH DD YL +PAI+
Sbjct  144   IYVQDYNDADPKTHQGCDLTRMTTKELIAKHGLSDDTVDFIGHALALHRDDRYLNEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+ IMSHPIP+ N+SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAIMSHPIPNANESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSYTHNVAPKGK+IAFVS EAETD+P++ELKPG+DLLG VDE+F++
Sbjct  324   QKQLGRRSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELKPGIDLLGSVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPSLDNCFVSASYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_003568438.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Brachypodium distachyon]
Length=444

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/421 (77%), Positives = 377/421 (90%), Gaps = 1/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGSFV++KGKIYKVPATD+EALKS LMGL EKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSFVFSKGKIYKVPATDMEALKSPLMGLLEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DPKTH+G+DL  +T K+ ITK+ L DDT+DFIGH+LALH DD +L +PA++
Sbjct  144   IYVQDYNEADPKTHKGLDLTVLTTKELITKHGLSDDTVDFIGHALALHRDDRHLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYSESLARFQGLSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YLT+KV K+GKVARA+ IMSHPIP+T D+HS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLTNKVRKIGKVARAIAIMSHPIPNT-DAHSVQIILP  322

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSYTHNVAPKGK+IAFVSTEAE+DD  +EL PGVDLLGP+DE+F++
Sbjct  323   QKQLGRKSDMYIFCCSYTHNVAPKGKFIAFVSTEAESDDIRSELMPGVDLLGPIDELFFD  382

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  
Sbjct  383   MYDRYEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTMITGKTVDLSVDLSAASAAE  442

Query  148   E  146
             E
Sbjct  443   E  443



>dbj|BAK00943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/422 (76%), Positives = 378/422 (90%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWK+FRG D+PP  LG+SK+YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAHLGSSKDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGSFV++KGKI+KVPATD+EA+KS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSFVFSKGKIHKVPATDMEAVKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ ++E+DPKTHQG+DL  +T K+ I K+ L DDT+DFIGH+LALH DD +L +PA++
Sbjct  144   IYVQNYDEADPKTHQGLDLTTLTTKELIAKHGLSDDTVDFIGHALALHRDDRHLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYML KP+CKVEFD  
Sbjct  204   TVKRMKLYSESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLCKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETAKCKKVVCDP+YLT+KV K+GKVARA+ IMSHPIP+TN+SHS Q+ILP
Sbjct  264   GKACGVTSEGETAKCKKVVCDPSYLTNKVRKIGKVARAIAIMSHPIPNTNESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR SDMY+FCCSYTHNVAPKGK+IAFVS EAE+D+ ++ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRNSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQSELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   MYDRYEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTMITGKAIDLTVDLSAASAAE  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_010526899.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Tarenaya hassleriana]
Length=444

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/421 (76%), Positives = 378/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG D+ P  LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPAHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+NKGK +KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFNKGKTHKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E++PKTH GMDLN +T K+ I+K+ L+D+TIDFIGH++ALH DD YL+QPAI+
Sbjct  144   SYVQDYDETNPKTHDGMDLNRVTTKELISKFGLDDNTIDFIGHAVALHLDDRYLSQPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLY+ESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYSESLARFQGSSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPGVDLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGVDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFETTVVDVLNMYTLITGKVLDLSVDLSAASASE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006858694.1| hypothetical protein AMTR_s00066p00096020 [Amborella trichopoda]
 gb|ERN20161.1| hypothetical protein AMTR_s00066p00096020 [Amborella trichopoda]
Length=444

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/421 (76%), Positives = 378/421 (90%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+N+YYGGES+SL+L QLWKRFRG ++PP  LG S++YNVDMIPKFMMAN
Sbjct  24    SVDRLKVLHMDRNEYYGGESTSLNLNQLWKRFRGDEKPPVHLGPSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHT+VTKYL+FKAVDGS+V+NKGKI+KVPA D+EALKS LMG+FEKRR RKFF
Sbjct  84    GTLVRVLIHTEVTKYLSFKAVDGSYVFNKGKIHKVPANDLEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++EE+DPKTH GM+L  +T ++ I K+ L+D+T+D IGH+LALH DD YL QPA++
Sbjct  144   MYVQDYEETDPKTHDGMNLTRVTTRELIAKFGLDDNTVDVIGHALALHRDDYYLDQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY+ES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYSESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+CKKVVCDP+YL +KV K+GKVARA+CIMSHPIP+TNDSHS Q+ILP
Sbjct  264   GKVSGVTSEGETARCKKVVCDPSYLPNKVRKIGKVARAICIMSHPIPNTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+H VAPKGK+IAFV+ +AET+ PE ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYSHMVAPKGKFIAFVAADAETNKPEIELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCFIS SYDA+THFESTV+DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   VYDRYEPVNEPSLDNCFISTSYDATTHFESTVQDVLSMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|KCW56943.1| hypothetical protein EUGRSUZ_I02620 [Eucalyptus grandis]
Length=427

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/401 (81%), Positives = 364/401 (91%), Gaps = 0/401 (0%)
 Frame = -1

Query  1345  SLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVRVLIHTDVTKYLTFKAV  1166
             S+  ++LWKRFRG D PPE LG SKEYNVDMIPKF MANG LVRVLIHTDVTKYL+FK V
Sbjct  24    SVDGLKLWKRFRGNDNPPESLGPSKEYNVDMIPKFTMANGALVRVLIHTDVTKYLSFKVV  83

Query  1165  DGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQEFEESDPKTHQGMDLNA  986
             DGSFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF+YVQ+FEESDPK+H+G+DLN 
Sbjct  84    DGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFFIYVQDFEESDPKSHEGLDLNK  143

Query  985   ITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKVKLYAESLARFQSGSPY  806
             +TA++ I+KY LEDDTIDFIGH+LALH DD+Y+ +PA++FVK++KLYAESLARFQ GSPY
Sbjct  144   VTAREVISKYGLEDDTIDFIGHALALHIDDSYMDKPALDFVKRMKLYAESLARFQGGSPY  203

Query  805   IYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYGVTSEGETAKCKKVVCD  626
             IYP+YGLGELPQAFARLSAVYGGTYMLNKP CKVEFD SGK  GV+SEGETAKCKKVVCD
Sbjct  204   IYPLYGLGELPQAFARLSAVYGGTYMLNKPHCKVEFDASGKVIGVSSEGETAKCKKVVCD  263

Query  625   PTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYTHNV  446
             P+YL  KV KVGKVARA+CIMSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSY HNV
Sbjct  264   PSYLPGKVKKVGKVARAICIMSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNV  323

Query  445   APKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDRFVPTNDCTADNCFISNS  266
             AP+GKYIAFV+ EAETD+P+ ELKPG++LLGPVDE+F++ YDR+VPTN+   DNCFIS S
Sbjct  324   APQGKYIAFVAAEAETDNPQQELKPGIELLGPVDEMFFDIYDRYVPTNNPEVDNCFISTS  383

Query  265   YDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGGEQ  143
             YDASTHFE+TV DVL MY+KITGK ++LSVDL+AASA  EQ
Sbjct  384   YDASTHFENTVTDVLAMYSKITGKVLNLSVDLNAASAATEQ  424



>ref|XP_004984243.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Setaria 
italica]
Length=446

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/418 (77%), Positives = 377/418 (90%), Gaps = 0/418 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG+S+SL+L QLWKRF+G + PP Q+GAS++YNVDM+PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEETPPSQIGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL+FKAVDGS+V+NKGKI+KVP+TD+EALKS LMGLFEKRR  KFF
Sbjct  84    GALVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDMEALKSPLMGLFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+++E+DP TH+G DL  +T K  I+KY L+D+TIDFIGH++ALH DD+YL++PAI+
Sbjct  144   LYVQDYKENDPSTHKGYDLTKLTTKQLISKYGLDDNTIDFIGHAVALHRDDSYLSEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV KVGKV RA+ IMSHPIP+T +SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPDKVRKVGKVFRAIAIMSHPIPNTAESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVA KGK+IAFVS +AETD+PETELKPG+DLLGPVDE+F +
Sbjct  324   QKQLSRKSDMYVFCCSYSHNVASKGKFIAFVSAQAETDNPETELKPGIDLLGPVDELFID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASA  155
             TYDR+ PTND ++DNC+IS SYDA+THFESTV DVL +YTKITGK VDLSVDLSAASA
Sbjct  384   TYDRYEPTNDSSSDNCYISTSYDATTHFESTVMDVLSLYTKITGKAVDLSVDLSAASA  441



>gb|AAR06264.1| GDP dissociation inhibitor protein [Hordeum vulgare]
Length=445

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/419 (76%), Positives = 378/419 (90%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG+S+SL+L QLWKRF+G   PP  +GAS++YNVDM+PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGDGTPPANIGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL+FKAVDGS+V+NKGKI+KVP+TD+EALKS LMGLFEKRR  KFF
Sbjct  84    GALVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDMEALKSPLMGLFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+++E+DP TH+G+DL  +T+K  I+KY L+D+TIDFIGH++ALH DD+YL++PAIE
Sbjct  144   LYVQDYKENDPSTHKGLDLTKMTSKQLISKYGLDDNTIDFIGHAVALHKDDSYLSEPAIE  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   IVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+Y+ DKV KVGKV RA+ IMSHPIP+T +SHS Q+I+P
Sbjct  264   GKVRGVTSEGETAKCKKVVCDPSYVPDKVKKVGKVFRAIAIMSHPIPNTAESHSVQIIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSY+HNVA KGK+IAFVS +AE+D+PE ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRRSDMYVFCCSYSHNVASKGKFIAFVSAQAESDNPEAELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
             TYDR+ P ND ++DNCFIS SYDA+THFESTV DVL +YTKITGKTVDLSVDLSAASA 
Sbjct  384   TYDRYEPANDPSSDNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAA  442



>ref|XP_010067472.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X3 [Eucalyptus grandis]
Length=450

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/427 (76%), Positives = 379/427 (89%), Gaps = 6/427 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYG ES+SL+LIQLWK+FR +D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGAESTSLNLIQLWKKFRNSDKPPPHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDG +V+NKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLYFKAVDGGYVFNKGKVHKVPATDMEALKSPLMGMFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD +L +PA++
Sbjct  144   IYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFIGHALALHRDDRFLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGETAKCKKVVCDP+YLT+KV K+GKV+RA+CIMSHPIP+TNDSHS QVI+P
Sbjct  264   GQVIGVTSEGETAKCKKVVCDPSYLTNKVRKIGKVSRAICIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVS EAETD PE ELKPGVDLLGPVDEIFY+
Sbjct  324   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPEIELKPGVDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFIS----NSYDAS--THFESTVRDVLEMYTKITGKTVDLSVDLS  167
             TYDR+ P N+ + DNCFIS    N  D    + FESTV DVL MYT ITGK +DLSVDLS
Sbjct  384   TYDRYEPVNEPSLDNCFISTVTINYIDIMLISCFESTVMDVLNMYTMITGKVLDLSVDLS  443

Query  166   AASAGGE  146
             AASA  E
Sbjct  444   AASAAEE  450



>gb|AAB69870.1| GDP dissociation inhibitor protein OsGDI1 [Oryza sativa]
Length=445

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/419 (77%), Positives = 372/419 (89%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTHQG+DL  +T ++ I KY L DDT+DFIGH+LALH DD YL +PAI+
Sbjct  144   IYVQDYDEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFIGHALALHRDDRYLNEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESL RFQ GSP IYP+YGLGELPQ FARL AVYGGTYMLNKP CKVEFD  
Sbjct  204   TVKRMKLYAESLPRFQGGSPSIYPLYGLGELPQGFARLRAVYGGTYMLNKPDCKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGE+AKCKKVVCDP+YL +KV K+GKVARA+ IMSHPI +TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGESAKCKKVVCDPSYLPNKVRKIGKVARAIAIMSHPIANTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+F CSYTHNVAPKGK+IAFVSTEAETD PE+ELKPG+DLLG VDE+F++
Sbjct  324   QKQLGRKSDMYVFGCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGQVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA 
Sbjct  384   IYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASAA  442



>ref|NP_001059344.1| Os07g0271000 [Oryza sativa Japonica Group]
 dbj|BAC79568.1| putative GDP dissociation inhibitor [Oryza sativa Japonica Group]
 dbj|BAF21258.1| Os07g0271000 [Oryza sativa Japonica Group]
 dbj|BAG91529.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/419 (76%), Positives = 377/419 (90%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG+S+SL+L QLWKRF+G   PP Q+GAS++YNVDMIPKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEGTPPAQIGASRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHT VTKYL+FKAVDGS+V+NKGKI+KVP+TD+EALKS LMGLFEKRR  KFF
Sbjct  84    GTLVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDMEALKSPLMGLFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             L+VQ+++E+DP TH+G DLN +T K+ I+KY L+D+TIDFIGH++ALH +DNYL +PAI+
Sbjct  144   LFVQDYKENDPSTHKGYDLNKMTTKELISKYGLDDNTIDFIGHAVALHKEDNYLTEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ RFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CK+EF+D 
Sbjct  204   TVKRMKLYAESVGRFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKIEFNDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+Y+ DKV KVGKV RA+ IMSHPIP+T DSHS Q+I+P
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYIPDKVRKVGKVFRAIAIMSHPIPNTADSHSVQIIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVA KGK+IAFVS +AE+++P  ELKPG+DLLGPVDE+F +
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVASKGKFIAFVSAQAESENPAAELKPGIDLLGPVDELFID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
             TYDRF PTND ++DNCFIS SYDA+THFESTV DVL +YTKITGKTVDLSVDLSAASA 
Sbjct  384   TYDRFEPTNDPSSDNCFISTSYDATTHFESTVMDVLSIYTKITGKTVDLSVDLSAASAA  442



>ref|XP_006372309.1| hypothetical protein POPTR_0017s00420g [Populus trichocarpa]
 gb|ERP50106.1| hypothetical protein POPTR_0017s00420g [Populus trichocarpa]
Length=454

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/406 (79%), Positives = 366/406 (90%), Gaps = 0/406 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LG+S++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAHLGSSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDG +V+NKGK++KVPATD+EALKS LMGLFEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLYFKAVDGGYVFNKGKVHKVPATDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ +E+SDPKTH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQNYEDSDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +K  KVG+VARA+ IMSHPIP T++SHS QVILP
Sbjct  264   GKVAGVTSEGETAKCKKVVCDPSYLPNKARKVGRVARAIAIMSHPIPSTDESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSYTHNVAPKGK+IAFVSTEAETD PE+ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKT  191
              YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK 
Sbjct  384   IYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKV  429



>ref|XP_006657603.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Oryza brachyantha]
Length=446

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/419 (76%), Positives = 375/419 (89%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG+S+SL+L QLWKRF+G + PP  +GAS++YNVDMIPKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEETPPAHIGASRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL+FKAVDGS+V+NKGKI+KVP+TD+EALKS LMGLFEKRR  KFF
Sbjct  84    GALVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDMEALKSPLMGLFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+++E+DP TH+G DL  +T K+ I+KY L+D+TIDFIGH++ALH +DNYL +PAI+
Sbjct  144   LYVQDYKENDPSTHKGYDLTKMTTKELISKYGLDDNTIDFIGHAVALHKEDNYLTEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP CKVEF+D 
Sbjct  204   TVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPGCKVEFNDQ  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+Y+ DKV KVGKV RA+ IMSHPIP+T DSHS Q+I+P
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYIPDKVRKVGKVFRAIAIMSHPIPNTADSHSVQIIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVA KGK+IAFVS +AE+++PE ELKPG+DLLGPVDE+F +
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVASKGKFIAFVSAQAESENPEAELKPGIDLLGPVDELFID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
             TYDRF P ND ++DNCFIS SYDA+THFESTV DVL +YTKITGKTVDLSVDLSAASA 
Sbjct  384   TYDRFEPANDPSSDNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAA  442



>gb|ABR16699.1| unknown [Picea sitchensis]
Length=444

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/421 (76%), Positives = 374/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGGES+SL+L QLWK+FR +  PP  LG+S++YNVDM PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGESASLNLNQLWKKFRSSSSPPTHLGSSRDYNVDMSPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+VYNKGKI+KVP TD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSYVYNKGKIHKVPTTDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQE+ E+DPKTH G+DL  ITAK+  TKY L+D+T+DFIGH+LAL+ DD YL +PA+E
Sbjct  144   IYVQEYLETDPKTHDGLDLTRITAKELFTKYGLDDNTVDFIGHALALYRDDRYLCEPALE  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KL AESLARFQ GSPYIYP+YGLGELPQAF+RLSAVYGGTYMLNKP CKV FD+ 
Sbjct  204   TVKRIKLCAESLARFQGGSPYIYPLYGLGELPQAFSRLSAVYGGTYMLNKPDCKVTFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GVTSEGETA+CKKVVCDP+YL +KV KVGKV+RA+CIMSHPIP+TNDS S Q+ILP
Sbjct  264   GKANGVTSEGETARCKKVVCDPSYLPNKVKKVGKVSRAICIMSHPIPNTNDSQSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCS++HNVAPKGKYIAFVSTEAETD PE EL+PG++LLG VDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSHSHNVAPKGKYIAFVSTEAETDQPEKELQPGLNLLGAVDEMFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYD + P N+ + DNCFIS SYDA+THFE+TV+DVL MYT+ITGK +DLSVDLSAASA  
Sbjct  384   TYDIYEPVNEPSLDNCFISKSYDATTHFETTVQDVLAMYTQITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|EMT13931.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=541

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/418 (76%), Positives = 375/418 (90%), Gaps = 0/418 (0%)
 Frame = -1

Query  1396  LKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLV  1217
             L VLHMD+NDYYGG+S+SL+L QLWK+FRG D+PP  LG+SK+YNVDM+PKFMMANGTLV
Sbjct  123   LMVLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAHLGSSKDYNVDMVPKFMMANGTLV  182

Query  1216  RVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQ  1037
             R LIHT+VTKYL+FKAVDGSFV++KGKI+KVPATD+EALKS LMGLFEKRR R FF+YVQ
Sbjct  183   RTLIHTNVTKYLSFKAVDGSFVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFFIYVQ  242

Query  1036  EFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKK  857
              ++E+DPKTHQG+DL  +T K+ I KY L DDT+DFIGH+LALH DD +L +PA++ VK+
Sbjct  243   NYDEADPKTHQGLDLTTLTTKELIAKYGLVDDTVDFIGHALALHRDDRHLNEPALDTVKR  302

Query  856   VKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAY  677
             +KLY+ESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYML+KP+CKVEFD  GKA 
Sbjct  303   MKLYSESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLSKPECKVEFDMEGKAC  362

Query  676   GVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQL  497
             GVTSEGETAKCKKVVCDP+YLT+KV K+GKVARA+ IMSHPIP+TN+SHS Q+ILPQKQL
Sbjct  363   GVTSEGETAKCKKVVCDPSYLTNKVRKIGKVARAIAIMSHPIPNTNESHSVQIILPQKQL  422

Query  496   GRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDR  317
             GR SDMY+FCCSYTHNVAPKGK+IAFVS EAE+D+ ++ELKPG+DLLGPVDE+F++ YDR
Sbjct  423   GRNSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQSELKPGIDLLGPVDELFFDMYDR  482

Query  316   FVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGGEQ  143
             + P N+ + DNCFIS SYDA+THFE+TV DVL MYT ITGKT+DLSVDLSAASA  E+
Sbjct  483   YEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTMITGKTIDLSVDLSAASAAEEE  540



>ref|XP_002989142.1| hypothetical protein SELMODRAFT_159958 [Selaginella moellendorffii]
 gb|EFJ09736.1| hypothetical protein SELMODRAFT_159958 [Selaginella moellendorffii]
Length=444

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/421 (76%), Positives = 369/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGGES+SL+L+QL+++FR +D+PP  LG S++YNVDMIPKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGESASLNLVQLYQKFRNSDKPPPSLGPSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEA+KS+LMG+FEKRR RKFF
Sbjct  84    GQLVRVLIHTDVTKYLAFKAVDGSFVYTKGKIYKVPATDVEAIKSTLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DP+TH GMDL+ +T K+    + L+D+TIDFIGHSLALH DD YL++PA+E
Sbjct  144   IYVQDYNEADPRTHDGMDLSRVTTKELFAHFGLDDNTIDFIGHSLALHRDDRYLSEPALE  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK+ KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML KP C +EFD+ 
Sbjct  204   TVKRFKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLQKPDCTIEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+ KKVVCDP+Y  +KV KVGKV RA+CIMSHPIP+TNDS S QVILP
Sbjct  264   GKVRGVTSEGETARTKKVVCDPSYARNKVRKVGKVVRAICIMSHPIPNTNDSSSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSY+HNVAPKGK+IAFVSTE ET +PE EL+PG+ LLGPVDE+F +
Sbjct  324   QKQLGRRSDMYVFCCSYSHNVAPKGKFIAFVSTEVETSEPEKELQPGLSLLGPVDEMFID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P ND T DNCFIS SYD +THFE+TV+DVL MYT+ITGK +DLSVDLSAASA  
Sbjct  384   VYDRFEPVNDWTLDNCFISKSYDPTTHFETTVQDVLAMYTRITGKVLDLSVDLSAASAAD  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|NP_001140939.1| uncharacterized protein LOC100273017 [Zea mays]
 gb|ACF85003.1| unknown [Zea mays]
 tpg|DAA39802.1| TPA: hypothetical protein ZEAMMB73_457429 [Zea mays]
Length=446

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/419 (76%), Positives = 376/419 (90%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG+S+SL+L QLWKRF+G + PP  +GAS++YNVDM+PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEETPPAHIGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHT VTKY++FKAVDGS+V+NKGKI+KVP+TD+EALKS LMGLFEKRR  KFF
Sbjct  84    GTLVRVLIHTGVTKYMSFKAVDGSYVFNKGKIHKVPSTDMEALKSPLMGLFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+++E+DP TH+G +L  +T K+ I+KY L+D+TIDFIGH++ALH DD+YL +PAI+
Sbjct  144   LYVQDYKENDPSTHKGYNLTKLTTKELISKYGLDDNTIDFIGHAVALHRDDSYLTEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYML+KP+CKVEFDD 
Sbjct  204   TVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLSKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL DKV K+GKV RA+ IMSHPIP+T +SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPDKVKKIGKVFRAIAIMSHPIPNTAESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSY+HNVA KGK+IAFVS +AETD+PE ELKPG+DLLG VDE+F +
Sbjct  324   QKQLGRRSDMYVFCCSYSHNVASKGKFIAFVSAQAETDNPEKELKPGIDLLGKVDELFID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
              YDR+ PTND +ADNCFIS SYDA+THFESTV DVL +YTKITGKTVDLSVDLSAASA 
Sbjct  384   IYDRYEPTNDSSADNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAA  442



>ref|XP_003557314.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Brachypodium distachyon]
Length=446

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/419 (76%), Positives = 376/419 (90%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG+S+SL+L QLWKRF+G   PP  +GAS++YNVDM+PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEGTPPAHIGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKYL+FKAVDGS+V+NKGKI+KVP+TD+EALKS LMGLFEKRR  KFF
Sbjct  84    GALVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDMEALKSPLMGLFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+++E+DP TH+G+DL  +T+K+ I+KY L+D+TIDFIGH++ALH DD+YL++PAIE
Sbjct  144   LYVQDYKENDPSTHKGLDLTKMTSKELISKYGLDDNTIDFIGHAVALHKDDSYLSEPAIE  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   IVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKC+KVVCDP+Y+ +KV KVGKV RA+ IMSHPIP+T +SHS Q+I+P
Sbjct  264   GKVCGVTSEGETAKCRKVVCDPSYVPEKVKKVGKVFRAIAIMSHPIPNTAESHSVQIIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVA KGK+IAFVS +AE+D+PE ELKPG+DLLGPVDE+F +
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVASKGKFIAFVSAQAESDNPEAELKPGIDLLGPVDELFID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
              YDR  P ND ++DNCFIS SYDA+THFESTV DVL +YTKITGKTVDLSVDLSAASA 
Sbjct  384   IYDRSEPANDPSSDNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAA  442



>ref|XP_002987358.1| hypothetical protein SELMODRAFT_271917 [Selaginella moellendorffii]
 gb|EFJ11673.1| hypothetical protein SELMODRAFT_271917 [Selaginella moellendorffii]
Length=444

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/421 (75%), Positives = 368/421 (87%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGGES+SL+L+QL+++FR +D+PP  LG S++YNVDMIPKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGESASLNLVQLYQKFRNSDKPPPSLGPSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVY KGKIYKVPATDVEA+KS+LMG+FEKRR RKFF
Sbjct  84    GQLVRVLIHTDVTKYLAFKAVDGSFVYTKGKIYKVPATDVEAIKSTLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DP+T  GMDL+ +T K+    + L+D+TIDFIGHSLALH DD YL++PA+E
Sbjct  144   IYVQDYNEADPRTQDGMDLSRVTTKELFAHFGLDDNTIDFIGHSLALHRDDRYLSEPALE  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK+ KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYML KP C +EFD+ 
Sbjct  204   TVKRFKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLQKPDCTIEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+ KKVVCDP+Y  +KV KVGKV RA+CIMSHPIP+TNDS S QVILP
Sbjct  264   GKVRGVTSEGETARTKKVVCDPSYARNKVRKVGKVVRAICIMSHPIPNTNDSSSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSY+HNVAPKGK+IAFVSTE ET +PE EL+PG+ LLGPVDE+F +
Sbjct  324   QKQLGRRSDMYVFCCSYSHNVAPKGKFIAFVSTEVETSEPEKELQPGLSLLGPVDEMFID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDRF P ND T DNCFIS SYD +THFE+TV+DVL MYT+ITGK +DLSVDLSAASA  
Sbjct  384   VYDRFEPVNDWTLDNCFISKSYDPTTHFETTVQDVLAMYTRITGKVLDLSVDLSAASAAD  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|AAB69871.1| GDP dissociation inhibitor protein OsGDI2 [Oryza sativa]
Length=445

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/421 (76%), Positives = 370/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LG+SK+YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAHLGSSKDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DPKTHQG+DL  +T ++ I KY L DDT+DFIGH+LALH DD YL +PAI+
Sbjct  144   IYVQDYNEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFIGHALALHKDDRYLNEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++K+YAESLA FQ GSP IYP+YGLGELPQ  ARLSAVYGGTY+LNKP CKVEFD  
Sbjct  204   TVKRMKVYAESLAPFQGGSPSIYPLYGLGELPQGHARLSAVYGGTYILNKPDCKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K  KVARA+ IMSHPI  TNDSHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKDRKVARAIAIMSHPIASTNDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSYTHNVAPKGK+IAFVSTEAETD+P++ELKPG+DLLG VDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPQSELKPGIDLLGQVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK VDLSVDLSAASA  
Sbjct  384   IYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTLITGKAVDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|EMS53634.1| Rab GDP dissociation inhibitor alpha [Triticum urartu]
Length=544

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/416 (76%), Positives = 373/416 (90%), Gaps = 0/416 (0%)
 Frame = -1

Query  1390  VLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVRV  1211
             VLHMD+NDYYGG+S+SL+L QLWK+FRG D+PP  LG+SK+YNVDM+PKFMMANGTLVR 
Sbjct  128   VLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAHLGSSKDYNVDMVPKFMMANGTLVRT  187

Query  1210  LIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQEF  1031
             LIHT+VTKYL+FKAVDGSFV++KGKI+KVPATD+EALKS LMGLFEKRR R FF+YVQ +
Sbjct  188   LIHTNVTKYLSFKAVDGSFVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFFIYVQNY  247

Query  1030  EESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKVK  851
             +E+DPKTHQG+DL  +T K+ I KY L DDT+DFIGH+LALH DD +L +PA++ VK++K
Sbjct  248   DEADPKTHQGLDLTTLTTKELIAKYGLVDDTVDFIGHALALHRDDRHLNEPALDTVKRMK  307

Query  850   LYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYGV  671
             LY+ESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYML+KP+CKVEFD  GKA GV
Sbjct  308   LYSESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLSKPECKVEFDMEGKACGV  367

Query  670   TSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLGR  491
             TSEGETAKCKKVVCDP+YLT+KV K+GKVARA+ IMSHPIP+TN+SHS Q+ILPQKQLGR
Sbjct  368   TSEGETAKCKKVVCDPSYLTNKVRKIGKVARAIAIMSHPIPNTNESHSVQIILPQKQLGR  427

Query  490   KSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDRFV  311
              SDMY+FCCSYTHNVAPKGK+IAFVS EAE+D+ ++ELKPG+DLLGPVDE+F++ YDR+ 
Sbjct  428   NSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQSELKPGIDLLGPVDELFFDMYDRYE  487

Query  310   PTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGGEQ  143
             P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGKT+DLSVDLSAASA  E+
Sbjct  488   PVNEPYLDNCFISTSYDATTHFETTVTDVLNMYTMITGKTIDLSVDLSAASAAEEE  543



>ref|NP_181938.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
 sp|Q96254.1|GDI1_ARATH RecName: Full=Guanosine nucleotide diphosphate dissociation inhibitor 
1; Short=AtGDI1 [Arabidopsis thaliana]
 gb|AAK32814.1|AF361801_1 At2g44100/F6E13.23 [Arabidopsis thaliana]
 dbj|BAA11944.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAC23429.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAK91434.1| At2g44100/F6E13.23 [Arabidopsis thaliana]
 gb|AAM47344.1| At2g44100/F6E13.23 [Arabidopsis thaliana]
 dbj|BAE98797.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 dbj|BAE99631.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AEC10374.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
Length=445

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/422 (75%), Positives = 375/422 (89%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ +GK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH GMDL  +T KD I K+ L++DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YLT+KV K+G+VARA+ IMSHPIP+TNDS S QVILP
Sbjct  264   GKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAIMSHPIPNTNDSQSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TEL+PG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_010067402.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like isoform X2 [Eucalyptus grandis]
 gb|KCW87998.1| hypothetical protein EUGRSUZ_A00407 [Eucalyptus grandis]
Length=444

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/421 (75%), Positives = 370/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWK+FR +D+PP  LG+S++YNVDM+PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRNSDKPPAHLGSSRDYNVDMVPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKY+ FKAVDGS+V+NKGK++KVPAT +EAL++ LMG+FEK R RKFF
Sbjct  84    GALVRVLIHTDVTKYMYFKAVDGSYVFNKGKVHKVPATAMEALQTPLMGMFEKYRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YV ++ E+DP+TH+GMDL  +T +  I KY L DD I+FIGH+LALH DD YL +PA++
Sbjct  144   TYVHDYNENDPRTHEGMDLTRVTTRKLIAKYGLGDDAIEFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY ES ARFQ GSPYIYP+YGLGELPQAFARLSAVYGG YMLNK +CKVEF+D 
Sbjct  204   TVKRMKLYEESFARFQGGSPYIYPLYGLGELPQAFARLSAVYGGIYMLNKRECKVEFNDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+CIMSHPIP+TN S S QVI+P
Sbjct  264   GQVIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAICIMSHPIPNTNYSQSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             Q+QLGRKSDMYLFCCS +H VAPKGK+IAFVS EAETD PE ELKPGV+LLGPVDEIFY+
Sbjct  324   QRQLGRKSDMYLFCCSNSHKVAPKGKFIAFVSAEAETDRPEIELKPGVNLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ + DNCFIS+SYDA+THFESTV+DVL MYTKITGK +DLSVDLSAASA  
Sbjct  384   TYDRYEPVNESSVDNCFISSSYDATTHFESTVKDVLNMYTKITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009420147.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Musa acuminata subsp. malaccensis]
Length=444

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/421 (75%), Positives = 372/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG KVLHMD+N YYGGES+SL+LIQ+WKRFRG+D+PP  LG S++YNVDMIPKFMMAN
Sbjct  24    SVDGFKVLHMDRNGYYGGESTSLNLIQIWKRFRGSDKPPAYLGPSRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTL+  L+HT+VTKYL+FK VDGS+V+NKGKI+KVPATD+EALKSSLMGLFEKRR RKFF
Sbjct  84    GTLMCTLVHTNVTKYLSFKTVDGSYVFNKGKIHKVPATDMEALKSSLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ ++ESDPKTH+G++L+ +T +  I+KY L D+T +FIGH+LALH DD YL +PA++
Sbjct  144   IYVQNYDESDPKTHEGLNLSRVTTRQLISKYGLNDNTTEFIGHALALHRDDQYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++K+YA SL+RFQ GSPYIYP+YGLGELPQAFARLSA YGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKMYAASLSRFQGGSPYIYPLYGLGELPQAFARLSAAYGGTYMLNKPECKVEFDMR  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEG TA+CKKVVCDP+YL +KV KVGKVARA+ IMSHPIPDTN SHS Q+ILP
Sbjct  264   GKAYGVTSEGTTARCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPDTNWSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY H VAPKGK+IAFVSTEAETD PE ELKPG+DLLGPVDE+F+E
Sbjct  324   QKQLGRKSDMYLFCCSYLHKVAPKGKFIAFVSTEAETDRPEVELKPGIDLLGPVDELFFE  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N  ++D+C+IS S+DA+THFESTV DVL MYT ITGKT+DL++D SAA    
Sbjct  384   TYDRYKPINTPSSDHCYISTSHDATTHFESTVMDVLSMYTMITGKTIDLNMDPSAAGIAI  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010512285.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Camelina sativa]
Length=444

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/421 (75%), Positives = 370/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              +VQE++E DPKTH GMDL  +T K+ I K+ L+D+TIDFIGH++ALHT+D +L QPA +
Sbjct  144   SFVQEYDEKDPKTHNGMDLTRVTTKELIAKFGLDDNTIDFIGHAVALHTNDQHLHQPAFD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFDD 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010413620.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Camelina sativa]
Length=444

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/421 (75%), Positives = 371/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              +VQE++E DPKTH GMDL  +T K+ I K+ L+D+TIDFIGH++ALHT+D +L QPA +
Sbjct  144   SFVQEYDEKDPKTHNGMDLTRVTTKELIAKFGLDDNTIDFIGHAVALHTNDQHLHQPAFD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL++KV K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLSNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_002880083.1| ATGDI1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56342.1| ATGDI1 [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/422 (75%), Positives = 374/422 (89%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EA KS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEAFKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH GMDL  +T KD I K+ L +DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLGEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL++KV K+G+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLSNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P++ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQSELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_006397585.1| hypothetical protein EUTSA_v10001450mg [Eutrema salsugineum]
 gb|ESQ39038.1| hypothetical protein EUTSA_v10001450mg [Eutrema salsugineum]
Length=444

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/421 (75%), Positives = 375/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH G+DL  +T K+ I K+ L+++TIDFIGH++ALH++DN+L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGVDLKRVTTKELIAKFGLDENTIDFIGHAVALHSNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006294223.1| hypothetical protein CARUB_v10023221mg [Capsella rubella]
 gb|EOA27121.1| hypothetical protein CARUB_v10023221mg [Capsella rubella]
Length=444

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/421 (75%), Positives = 373/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+ND+YGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGIKVLHMDRNDHYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH GMDL  +T KD I K+ L +DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLGEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>emb|CAA69258.1| GDP-associated inhibitor [Arabidopsis thaliana]
Length=445

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/422 (75%), Positives = 374/422 (89%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ +GK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH GMDL  +T KD I K+ L++DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YLT+KV K+G+VARA+ IMSHPIP+TNDS S QVILP
Sbjct  264   GKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAIMSHPIPNTNDSQSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TEL+PG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+ ASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNPASAAE  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_010930328.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X2 [Elaeis guineensis]
Length=412

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/412 (77%), Positives = 369/412 (90%), Gaps = 0/412 (0%)
 Frame = -1

Query  1381  MDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVRVLIH  1202
             MD+NDYYGG+S+SL LIQLWKRF+  D+ P  LG+S+ YNVDMIPKFMMANGTLVR LIH
Sbjct  1     MDRNDYYGGDSTSLDLIQLWKRFQENDEAPADLGSSRAYNVDMIPKFMMANGTLVRALIH  60

Query  1201  TDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQEFEES  1022
             TDVTKYL FKAVDGS+V+NKGKI+KVPATD+EAL+S LMGLFEKRR RKFF+YVQ+++E+
Sbjct  61    TDVTKYLYFKAVDGSYVFNKGKIHKVPATDMEALRSPLMGLFEKRRARKFFIYVQDYDEN  120

Query  1021  DPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKVKLYA  842
             DPKTH G+DL  +T ++ I+KY L+D+T+DFIGH+LALH DD YL +PA++ VK++KLYA
Sbjct  121   DPKTHGGLDLTRVTTRELISKYGLDDNTVDFIGHALALHRDDCYLDEPALDTVKRMKLYA  180

Query  841   ESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYGVTSE  662
             ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ GK  GVTSE
Sbjct  181   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVCGVTSE  240

Query  661   GETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLGRKSD  482
             GETA+CKKVVCDP+YL  KV KVGKVARA+ IMSHPIP+T++SHS QVILPQKQLGRKSD
Sbjct  241   GETARCKKVVCDPSYLPHKVKKVGKVARAIAIMSHPIPNTDESHSVQVILPQKQLGRKSD  300

Query  481   MYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDRFVPTN  302
             MYLFCCSY+HNVAPKGK+IAFVSTEAET+ PE ELKPG+DLLGPVD IF++TYDR+ P N
Sbjct  301   MYLFCCSYSHNVAPKGKFIAFVSTEAETNQPELELKPGIDLLGPVDAIFFDTYDRYEPVN  360

Query  301   DCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGGE  146
             +   D+CFIS SYDA+THFESTV DVL +YTKITGKTVDLSVDLSAASA  E
Sbjct  361   EPLLDSCFISTSYDATTHFESTVMDVLAIYTKITGKTVDLSVDLSAASAAKE  412



>gb|AIK01834.1| GDP dissociation inhibitor [Brassica napus]
 emb|CDY17885.1| BnaC04g03340D [Brassica napus]
Length=444

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/421 (75%), Positives = 375/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG D+ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGIKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT VEALKSSLMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPVEALKSSLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH G+DL  +T K+ I K+ L+++TIDFIGH++ALH++D++L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGVDLKRVTTKELIAKFGLDENTIDFIGHAVALHSNDSHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG+DLLG VDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGQVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_002876528.1| ATGDI2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52787.1| ATGDI2 [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/421 (75%), Positives = 372/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKSSLMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSSLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              +VQE++E DPKTH GMDL+ +T K+ I KY L+ +TIDFIGH++ALHT+D +L QPA++
Sbjct  144   SFVQEYDEKDPKTHDGMDLSRVTTKELIAKYGLDGNTIDFIGHAVALHTNDQHLDQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVLRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKK+VCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETAKCKKIVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPELDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|NP_001288917.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Brassica 
rapa]
 dbj|BAF81523.1| GDP dissociation inhibitor [Brassica rapa]
 gb|AIK01835.1| GDP dissociation inhibitor [Brassica napus]
 emb|CDX79782.1| BnaA05g03740D [Brassica napus]
Length=444

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/421 (75%), Positives = 375/421 (89%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG D+ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGIKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT VEALKSSLMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPVEALKSSLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH G+DL  +T K+ I K+ L+++TIDFIGH++ALH++D++L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGVDLKRVTTKELIAKFGLDENTIDFIGHAVALHSNDSHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVMGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG+DLLG VDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGQVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010067325.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like isoform X1 [Eucalyptus grandis]
Length=444

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/421 (75%), Positives = 368/421 (87%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWK+FR +D+PP  LG+S++YNVDM+PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRNSDKPPAHLGSSRDYNVDMVPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKY+ FKAVDGS+V+NKGK++KVPAT +EAL++ LMG+FEK R RKFF
Sbjct  84    GALVRVLIHTDVTKYMYFKAVDGSYVFNKGKVHKVPATAMEALQTPLMGMFEKYRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YV ++ E+DP+TH+GMDL  +T +  I KY L DD I+FIGH+LALH DD YL +PA++
Sbjct  144   TYVHDYNENDPRTHEGMDLTRVTTRKLIAKYGLGDDAIEFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLY ES ARFQ GSPYIYP+YGLGELPQAFARLSAVYGG YMLNK +CKVEF+D 
Sbjct  204   TVKRMKLYEESFARFQGGSPYIYPLYGLGELPQAFARLSAVYGGIYMLNKRECKVEFNDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGETAKCKKVVCDP+YL +KV KVGKVARA+CIMSHPIP+TN S S QVI+P
Sbjct  264   GQVIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAICIMSHPIPNTNYSQSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             Q+QLGRKSDMYLFCCS +H VAPKGK+IAFVS EAETD PE ELKPGV+LLGPVDEIFY+
Sbjct  324   QRQLGRKSDMYLFCCSNSHKVAPKGKFIAFVSAEAETDRPEIELKPGVNLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ + DNCFIS+SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   TYDRYEPVNESSVDNCFISSSYDATTHFESTVMDVLNMYTMITGKVLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010469257.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Camelina sativa]
Length=444

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/421 (75%), Positives = 370/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              +VQE++E DPKTH GMDL  +T K+ I K+ L+D+TIDFIGH++ALHT+D +L QPA +
Sbjct  144   SFVQEYDEKDPKTHNGMDLTRVTTKELIAKFGLDDNTIDFIGHAVALHTNDQHLHQPAFD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|NP_191551.1| RAB GDP dissociation inhibitor 2 [Arabidopsis thaliana]
 sp|O24653.1|GDI2_ARATH RecName: Full=Guanosine nucleotide diphosphate dissociation inhibitor 
2; Short=AtGDI2 [Arabidopsis thaliana]
 dbj|BAA22504.1| AtGDI2 [Arabidopsis thaliana]
 emb|CAA04727.1| GDI2 [Arabidopsis thaliana]
 emb|CAB75811.1| Rab GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAL91158.1| Rab GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAN15330.1| Rab GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AEE79985.1| RAB GDP dissociation inhibitor 2 [Arabidopsis thaliana]
Length=444

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/421 (75%), Positives = 370/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKSSLMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSSLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              +VQE++E DPKTH GMDL  +T K+ I KY L+ +TIDFIGH++ALHT+D +L QPA +
Sbjct  144   SFVQEYDEKDPKTHDGMDLTRVTTKELIAKYGLDGNTIDFIGHAVALHTNDQHLDQPAFD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEG  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKK+VCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPELDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|KHN06485.1| Rab GDP dissociation inhibitor alpha [Glycine soja]
Length=761

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/406 (79%), Positives = 364/406 (90%), Gaps = 0/406 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+LIQLWKRFRG D+PP  LGAS++YN+DM PKF+MAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPHLGASRDYNIDMNPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+V+NKGK++KVPA D+EALKS LMGLFEKRR RKFF
Sbjct  84    GNLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPANDMEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ + ESDPKTH+GMDL  +T K+ I KY L+D+TIDFIGH+LALH+DD YLA+PA++
Sbjct  144   IYVQNYNESDPKTHEGMDLTRVTTKELIAKYGLDDNTIDFIGHALALHSDDRYLAEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL  KV KVG+VARA+ IMSHPIP T+DSHS Q+ILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPGKVRKVGRVARAIAIMSHPIPSTDDSHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETD P  ELKPG+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKT  191
              YDR+ P N+ T DNCFIS SYDA+THFESTV DVL MYT ITGK 
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFESTVDDVLNMYTLITGKA  429



>gb|AAL38263.1| GDP dissociation inhibitor [Arabidopsis thaliana]
Length=445

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/422 (75%), Positives = 374/422 (89%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ +GK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH GMDL  +T KD I K+ L++DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLG+LPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGKLPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YLT+KV K+G+VARA+ IMSHPIP+TNDS S QVILP
Sbjct  264   GKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAIMSHPIPNTNDSQSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TEL+PG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK  DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKEPDLSVDLNAASAAE  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_004962067.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Setaria italica]
Length=462

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/410 (76%), Positives = 365/410 (89%), Gaps = 0/410 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGG+S+SL+L QLWKRFRG D+PP  LGAS++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPTHLGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVR LIHTDVTKYL+FKAVDGS+V++KGKIYKVPATD+EALKS LMGLFEKRR R FF
Sbjct  84    GTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDMEALKSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ++ E+DPKTHQG+DL  +T ++ I KY L DDT+DFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYNEADPKTHQGLDLTMVTTRELIAKYGLSDDTVDFIGHALALHRDDRYLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CKVEFD  
Sbjct  204   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDME  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+V RA+ IMSHPIP+TN+SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLLNKVRKIGRVVRAIAIMSHPIPNTNESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSYTHNVAP+GK+IAFVS EAETD+P++ELKPG+DLLG VDEIFY+
Sbjct  324   QKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQSELKPGLDLLGSVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLS  179
              YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK   +S
Sbjct  384   IYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTMITGKVTYIS  433



>gb|AAM64484.1| GDP dissociation inhibitor [Arabidopsis thaliana]
Length=445

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/422 (75%), Positives = 374/422 (89%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ +GK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH GMDL  +T KD I K+ L++DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YLT+KV K+G+VARA+ IMSHPIP+TNDS S QVILP
Sbjct  264   GKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAIMSHPIPNTNDSQSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FC SY+HNVAPKGK+IAFVST+AETD+P+TEL+PG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCFSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_010508340.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Camelina sativa]
Length=444

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/421 (75%), Positives = 372/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGIKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I  + L +DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQDYDEKDPKTHNGMDLRRVTTKELIATFGLGEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_010517995.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Camelina sativa]
Length=444

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/421 (75%), Positives = 372/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGIKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH GMDL  +T K+ I  + L +DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQEYDEKDPKTHNGMDLRRVTTKELIATFGLGEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P++ELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQSELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006291137.1| hypothetical protein CARUB_v10017252mg [Capsella rubella]
 gb|EOA24035.1| hypothetical protein CARUB_v10017252mg [Capsella rubella]
Length=444

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/421 (75%), Positives = 371/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              +VQE++E+DPKTH GMDL  +T K+ I K+ L+D+TIDFIGH++ALHT+D +L QPA +
Sbjct  144   SFVQEYDETDPKTHNGMDLTRVTTKELIAKFGLDDNTIDFIGHAVALHTNDQHLHQPAFD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL R+SDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG DLLGPVDEIF++
Sbjct  324   QKQLARRSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DL+VDLSAASA  
Sbjct  384   MYDRYEPVNEPGLDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLTVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|EEC81843.1| hypothetical protein OsI_25604 [Oryza sativa Indica Group]
Length=469

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/442 (72%), Positives = 377/442 (85%), Gaps = 23/442 (5%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG+S+SL+L QLWKRF+G   PP Q+GAS++YNVDMIPKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEGTPPAQIGASRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHT VTKYL+FKAVDGS+V+NKGKI+KVP+TD+EALKS LMGLFEKRR  KFF
Sbjct  84    GTLVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDMEALKSPLMGLFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             L+VQ+++E+DP TH+G DLN +T K+ I+KY L+D+TIDFIGH++ALH +DNYL +PAI+
Sbjct  144   LFVQDYKENDPSTHKGYDLNKMTTKELISKYGLDDNTIDFIGHAVALHKEDNYLTEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ RFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CK+EF+D 
Sbjct  204   TVKRMKLYAESVGRFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKIEFNDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+Y+ DKV KVGKV RA+ IMSHPIP+T DSHS Q+I+P
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYIPDKVRKVGKVFRAIAIMSHPIPNTADSHSVQIIIP  323

Query  508   QKQLGRKSDM-----------------------YLFCCSYTHNVAPKGKYIAFVSTEAET  398
             QKQLGRKSDM                       Y+FCCSY+HNVA KGK+IAFVS +AE+
Sbjct  324   QKQLGRKSDMQITLGLLVISIIVTKECSLVHARYVFCCSYSHNVASKGKFIAFVSAQAES  383

Query  397   DDPETELKPGVDLLGPVDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLE  218
             ++P  ELKPG+DLLGPVDE+F +TYDRF PTND ++DNCFIS SYDA+THFESTV DVL 
Sbjct  384   ENPAAELKPGIDLLGPVDELFIDTYDRFEPTNDPSSDNCFISTSYDATTHFESTVMDVLS  443

Query  217   MYTKITGKTVDLSVDLSAASAG  152
             +YTKITGKTVDLSVDLSAASA 
Sbjct  444   IYTKITGKTVDLSVDLSAASAA  465



>ref|XP_002461825.1| hypothetical protein SORBIDRAFT_02g008810 [Sorghum bicolor]
 gb|EER98346.1| hypothetical protein SORBIDRAFT_02g008810 [Sorghum bicolor]
Length=446

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/419 (75%), Positives = 371/419 (89%), Gaps = 0/419 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG+S+SL+L QLWKRF+G   PP  +GAS++YNVDM+PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEQTPPAHIGASRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHT VTKY++FKAVDGS+V+NKGKI+KVP+ D+EALKS LMGLFEKRR  KFF
Sbjct  84    GALVRVLIHTGVTKYMSFKAVDGSYVFNKGKIHKVPSNDMEALKSPLMGLFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+++E D  TH+G DL  +T K+ I+KY L+D+TIDFIGH++ALH DD+YL +PAI+
Sbjct  144   LYVQDYKEDDRSTHKGYDLTKLTTKELISKYGLDDNTIDFIGHAVALHRDDSYLTEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYML+KP+CKVEFD  
Sbjct  204   TVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLSKPECKVEFDSE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVGKV RA+ IMSHPIP+T +SHS Q+ILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVKKVGKVFRAIAIMSHPIPNTAESHSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCSY+HNVA KGKYIAFVS +AETD+PE ELKPG+DLLG VDE+F +
Sbjct  324   QKQLGRRSDMYVFCCSYSHNVASKGKYIAFVSAQAETDNPEKELKPGIDLLGTVDELFID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
             TYDR+ P+ND +ADNCFIS SYDA+THFESTV DVL +YTKITGKTVDLSVDLSAASA 
Sbjct  384   TYDRYEPSNDSSADNCFISTSYDATTHFESTVMDVLSLYTKITGKTVDLSVDLSAASAA  442



>gb|KFK37228.1| hypothetical protein AALP_AA4G230400 [Arabis alpina]
Length=445

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 374/422 (89%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I K+ L +DTIDFIGH++ALH++DN+L QPA +
Sbjct  144   SYVQDYDEKDPKTHDGMDLTRVTTKELIAKFGLNEDTIDFIGHAVALHSNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+C VEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECTVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TN+SHS QVILP
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNESHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TEL+PG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   EQ  143
             E+
Sbjct  444   EE  445



>ref|XP_010506315.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Camelina sativa]
Length=444

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/421 (75%), Positives = 371/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLW +FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGIKVLHMDRNDYYGGESTSLNLNQLWNKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I  + L +DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQDYDEKDPKTHNGMDLRRVTTKELIATFGLGEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +DLSVDL+AASA  
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKELDLSVDLNAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_006402639.1| hypothetical protein EUTSA_v10005975mg [Eutrema salsugineum]
 gb|ESQ44092.1| hypothetical protein EUTSA_v10005975mg [Eutrema salsugineum]
Length=444

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/421 (74%), Positives = 371/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+F+G ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFKGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I K+ L+++TIDFIGH++ALHT+D +L QPA++
Sbjct  144   SYVQDYDEKDPKTHNGMDLTKVTTKELIAKFGLDENTIDFIGHAVALHTNDQHLHQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELKPG+DLLG VDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGIDLLGAVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>emb|CDY05962.1| BnaA09g38180D [Brassica napus]
Length=444

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/421 (74%), Positives = 371/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLYLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EA+KS+LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEAVKSNLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E +PKTH GMDL  +T K+ ITK+ L+D+TIDFIGH++ALHT+D +L QPA++
Sbjct  144   GYVQDYDEKEPKTHNGMDLTKLTTKEMITKFGLDDNTIDFIGHAIALHTNDQHLHQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP C VEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGSSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPDCTVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV+K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVNKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELK G+DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+  +DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPASDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>emb|CDX98399.1| BnaC06g17600D [Brassica napus]
 emb|CDX67817.1| BnaA07g18570D [Brassica napus]
Length=444

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/421 (74%), Positives = 369/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I K+ L+D+TIDFIGH++ALHT+D +L QPA++
Sbjct  144   SYVQDYDEKDPKTHNGMDLTKVTTKELIAKFGLDDNTIDFIGHAVALHTNDQHLNQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYML KP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLCKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKK+VCDP+YL +KV K+G VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGTVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELK G+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009138891.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Brassica rapa]
 emb|CDX89038.1| BnaA04g01480D [Brassica napus]
Length=444

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/421 (74%), Positives = 369/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG D+ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I K+ L+++TIDFIGH++ALHT+D +L QPA++
Sbjct  144   SYVQDYDEKDPKTHNGMDLTRLTTKELIAKFGLDENTIDFIGHAVALHTNDQHLNQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+CKK+VCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETARCKKIVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELK G+DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAAS   
Sbjct  384   VYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASTEE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009116668.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X2 [Brassica rapa]
Length=444

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/421 (74%), Positives = 370/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KV+HMD+NDYYGGES+SL L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVIHMDRNDYYGGESTSLYLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EA+KS+LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEAMKSNLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I K+ L+D+TIDFIGH++ALHT+D +L QPA++
Sbjct  144   GYVQDYDEKDPKTHNGMDLTKLTTKELIAKFGLDDNTIDFIGHAIALHTNDEHLHQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP C VEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGSSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPDCTVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV+K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVNKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELK G+DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+  +DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPASDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>emb|CDY45775.1| BnaC04g22610D [Brassica napus]
Length=444

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/421 (74%), Positives = 369/421 (88%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG D+ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I K+ L+++T+DFIGH++ALHT+D +L QPA++
Sbjct  144   SYVQDYDEKDPKTHNGMDLTRLTTKELIAKFGLDENTVDFIGHAVALHTNDQHLNQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETA+CKK+VCDP+YL +KV K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVIGVTSEGETARCKKIVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELK G+DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAAS   
Sbjct  384   VYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASTEE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|KFK35202.1| hypothetical protein AALP_AA5G253800 [Arabis alpina]
Length=444

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/421 (74%), Positives = 368/421 (87%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I K+ L+D+TIDFIGH++ALHT+D +L QPA++
Sbjct  144   SYVQDYDEKDPKTHNGMDLTKVTTKELIAKFGLDDNTIDFIGHAVALHTNDQHLNQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKK+VCDP+YL +KV K+G VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGTVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AET +P+TELK G+DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETGNPQTELKAGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPGLDNCFISTSYDATTHFETTVADVLNMYTLITGKELDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009104231.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Brassica rapa]
Length=444

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/421 (74%), Positives = 368/421 (87%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD+NDYYGGES+SL+L QLWK+FR  ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRREEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I K+ L+D+TIDFIGH++ALHT+D +L QPA++
Sbjct  144   SYVQDYDEKDPKTHNGMDLTKVTTKELIAKFGLDDNTIDFIGHAVALHTNDQHLNQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYML KP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLCKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKK+VCDP+YL +KV K+G VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGTVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELK G+DLLGPVDEIF++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YDR+ P N+   DNCFIS SYDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  384   MYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_009116667.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X1 [Brassica rapa]
Length=445

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/422 (74%), Positives = 370/422 (88%), Gaps = 1/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KV+HMD+NDYYGGES+SL L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVIHMDRNDYYGGESTSLYLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EA+KS+LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEAMKSNLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++E DPKTH GMDL  +T K+ I K+ L+D+TIDFIGH++ALHT+D +L QPA++
Sbjct  144   GYVQDYDEKDPKTHNGMDLTKLTTKELIAKFGLDDNTIDFIGHAIALHTNDEHLHQPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP C VEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGSSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPDCTVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV+K+G+VARA+ IMSHPIP+TNDSHS QVI+P
Sbjct  264   GKVTGVTSEGETAKCKKVVCDPSYLPNKVNKIGRVARAIAIMSHPIPNTNDSHSVQVIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELK G+DLLGPVDEIF++
Sbjct  324   QKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGK-TVDLSVDLSAASAG  152
              YDR+ P N+  +DNCFIS SYDA+THFE+TV DVL MYT ITGK  +DLSVDLSAASA 
Sbjct  384   MYDRYEPVNEPASDNCFISTSYDATTHFETTVADVLNMYTLITGKQQLDLSVDLSAASAA  443

Query  151   GE  146
              E
Sbjct  444   EE  445



>ref|NP_001078054.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
 dbj|BAH19638.1| AT2G44100 [Arabidopsis thaliana]
 gb|AEC10375.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
Length=431

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/407 (75%), Positives = 362/407 (89%), Gaps = 0/407 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWK+FRG ++ P  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAHLGSSRDYNVDMMPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL+FKAVDGS+V+ +GK+ KVPAT +EALKS LMG+FEKRR  KFF
Sbjct  84    GKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPMEALKSPLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQE++E DPKTH GMDL  +T KD I K+ L++DTIDFIGH++ALH +DN+L QPA +
Sbjct  144   SYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFIGHAVALHCNDNHLHQPAYD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V ++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YLT+KV K+G+VARA+ IMSHPIP+TNDS S QVILP
Sbjct  264   GKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAIMSHPIPNTNDSQSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TEL+PG+DLLGPVDE+F++
Sbjct  324   QKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELQPGIDLLGPVDELFFD  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTV  188
              YDR+ P N+ T DNCFIS SYDA+THF++TV DVL MY  ITGK +
Sbjct  384   IYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKLITGKVM  430



>gb|EMS53635.1| Rab GDP dissociation inhibitor alpha [Triticum urartu]
Length=424

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/400 (76%), Positives = 359/400 (90%), Gaps = 0/400 (0%)
 Frame = -1

Query  1345  SLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVRVLIHTDVTKYLTFKAV  1166
             S+  ++LWK+FRG ++PP  LGAS++YNVDM+PKFMMANGTLVR LIHTDVTKYL+FKAV
Sbjct  24    SVDGLKLWKKFRGEEKPPAHLGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAV  83

Query  1165  DGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQEFEESDPKTHQGMDLNA  986
             DGSFV++KGKI+KVPATD+EALKS LMG+FEKRR R FF+YVQ++ ++DP+THQG+DL  
Sbjct  84    DGSFVFSKGKIHKVPATDMEALKSPLMGIFEKRRARNFFIYVQDYNDADPRTHQGLDLTR  143

Query  985   ITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKVKLYAESLARFQSGSPY  806
             +T ++ I K+ L DDTIDFIGH+LALH DD YL++PAI+ VK++KLY+ESLARFQ GSPY
Sbjct  144   MTTRELIAKHGLSDDTIDFIGHALALHRDDRYLSEPAIDTVKRMKLYSESLARFQGGSPY  203

Query  805   IYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYGVTSEGETAKCKKVVCD  626
             IYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  GK  GVTSEGETAKCKKVVCD
Sbjct  204   IYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCD  263

Query  625   PTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYTHNV  446
             P+YL +KV K+GKVARA+ IMSHPIP+ NDSHS Q+ILPQKQLGRKSDMY+FCCSYTHNV
Sbjct  264   PSYLANKVRKIGKVARAIAIMSHPIPNANDSHSIQIILPQKQLGRKSDMYVFCCSYTHNV  323

Query  445   APKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDRFVPTNDCTADNCFISNS  266
             APKGK+IAFVS EAETD+P++ELKPG+DLLGPVDE+F++ YDR+ P N+ + DNCF+S+S
Sbjct  324   APKGKFIAFVSAEAETDNPQSELKPGIDLLGPVDELFFDMYDRYEPVNEPSLDNCFVSSS  383

Query  265   YDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGGE  146
             YDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA  E
Sbjct  384   YDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASAAEE  423



>gb|EMT13930.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=424

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/398 (76%), Positives = 358/398 (90%), Gaps = 0/398 (0%)
 Frame = -1

Query  1345  SLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVRVLIHTDVTKYLTFKAV  1166
             S+  ++LWK+FRG ++PP  LGAS++YNVDM+PKFMMANGTLVR LIHTDVTKYL+FKAV
Sbjct  24    SVDGLKLWKKFRGEEKPPAHLGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAV  83

Query  1165  DGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQEFEESDPKTHQGMDLNA  986
             DGS+V++KGKI+KVPATD+EALKS LMGLFEKRR R FF+YVQ++ ++DP+THQG+DL  
Sbjct  84    DGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFFIYVQDYNDADPRTHQGLDLTR  143

Query  985   ITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKVKLYAESLARFQSGSPY  806
             +T ++ I K+ L DDTIDFIGH+LALH DD YL++PAI+ VK++KLY+ESLARFQ GSPY
Sbjct  144   MTTRELIAKHGLSDDTIDFIGHALALHRDDRYLSEPAIDTVKRMKLYSESLARFQGGSPY  203

Query  805   IYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYGVTSEGETAKCKKVVCD  626
             IYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD  GK  GVTSEGETAKCKKVVCD
Sbjct  204   IYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCD  263

Query  625   PTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYTHNV  446
             P+YL +KV K+GKVARA+ IMSHPIP+ NDSHS Q+ILPQKQLGRKSDMY+FCCSYTHNV
Sbjct  264   PSYLANKVRKIGKVARAIAIMSHPIPNANDSHSIQIILPQKQLGRKSDMYVFCCSYTHNV  323

Query  445   APKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDRFVPTNDCTADNCFISNS  266
             APKGK+IAFVS EAETD+P++ELKPG+DLLGPVDE+F++ YDR+ P N+ + DNCF+S+S
Sbjct  324   APKGKFIAFVSAEAETDNPQSELKPGIDLLGPVDELFFDMYDRYEPVNEPSLDNCFVSSS  383

Query  265   YDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAG  152
             YDA+THFE+TV DVL MYT ITGKTVDLSVDLSAASA 
Sbjct  384   YDATTHFETTVTDVLNMYTLITGKTVDLSVDLSAASAA  421



>gb|KDO49751.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=419

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/379 (79%), Positives = 348/379 (92%), Gaps = 0/379 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LIQLWKRFRG +QPP  LG+S++YNVDMIPKF++AN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAHLGSSRDYNVDMIPKFIIAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVG+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVSTEAETD P+TELKPG+DLLGPVDEIFY+
Sbjct  324   QKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLLGPVDEIFYD  383

Query  328   TYDRFVPTNDCTADNCFIS  272
              YDR+ P N+ + DNCFIS
Sbjct  384   IYDRYEPVNEPSLDNCFIS  402



>ref|XP_010930327.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X1 [Elaeis guineensis]
Length=444

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/397 (77%), Positives = 356/397 (90%), Gaps = 0/397 (0%)
 Frame = -1

Query  1381  MDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVRVLIH  1202
             MD+NDYYGG+S+SL LIQLWKRF+  D+ P  LG+S+ YNVDMIPKFMMANGTLVR LIH
Sbjct  1     MDRNDYYGGDSTSLDLIQLWKRFQENDEAPADLGSSRAYNVDMIPKFMMANGTLVRALIH  60

Query  1201  TDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQEFEES  1022
             TDVTKYL FKAVDGS+V+NKGKI+KVPATD+EAL+S LMGLFEKRR RKFF+YVQ+++E+
Sbjct  61    TDVTKYLYFKAVDGSYVFNKGKIHKVPATDMEALRSPLMGLFEKRRARKFFIYVQDYDEN  120

Query  1021  DPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKVKLYA  842
             DPKTH G+DL  +T ++ I+KY L+D+T+DFIGH+LALH DD YL +PA++ VK++KLYA
Sbjct  121   DPKTHGGLDLTRVTTRELISKYGLDDNTVDFIGHALALHRDDCYLDEPALDTVKRMKLYA  180

Query  841   ESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYGVTSE  662
             ESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ GK  GVTSE
Sbjct  181   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVCGVTSE  240

Query  661   GETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLGRKSD  482
             GETA+CKKVVCDP+YL  KV KVGKVARA+ IMSHPIP+T++SHS QVILPQKQLGRKSD
Sbjct  241   GETARCKKVVCDPSYLPHKVKKVGKVARAIAIMSHPIPNTDESHSVQVILPQKQLGRKSD  300

Query  481   MYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYETYDRFVPTN  302
             MYLFCCSY+HNVAPKGK+IAFVSTEAET+ PE ELKPG+DLLGPVD IF++TYDR+ P N
Sbjct  301   MYLFCCSYSHNVAPKGKFIAFVSTEAETNQPELELKPGIDLLGPVDAIFFDTYDRYEPVN  360

Query  301   DCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKT  191
             +   D+CFIS SYDA+THFESTV DVL +YTKITGKT
Sbjct  361   EPLLDSCFISTSYDATTHFESTVMDVLAIYTKITGKT  397



>ref|XP_006584965.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X4 [Glycine max]
Length=371

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/371 (82%), Positives = 342/371 (92%), Gaps = 0/371 (0%)
 Frame = -1

Query  1255  MIPKFMMANGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLF  1076
             MIPKFMMANG LVRVLIHT+VTKYL FKAVDGSFVYNKGKIYKVPATDVEALKS LMGLF
Sbjct  1     MIPKFMMANGALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLF  60

Query  1075  EKRRVRKFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDD  896
             EKRR RKFF+YVQ++E +DPK+H+G+DLN +TA+  I+KY LEDDT+DFIGH+LALH DD
Sbjct  61    EKRRARKFFIYVQDYETNDPKSHEGLDLNQVTARQLISKYGLEDDTVDFIGHALALHRDD  120

Query  895   NYLAQPAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKP  716
             NYL +PA +FV +VK+YAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP
Sbjct  121   NYLDEPAKDFVDRVKIYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  180

Query  715   QCKVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTND  536
             +CKVEFD++GKA GVTSEGETAKCKK+VCDP+YL+DKV KVGKVARA+CIMSHPIPDT D
Sbjct  181   ECKVEFDENGKAIGVTSEGETAKCKKIVCDPSYLSDKVQKVGKVARAICIMSHPIPDTKD  240

Query  535   SHSAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLL  356
             SHSAQVILPQKQLGRKSDMYLFCCSY HNVA KGKYIAFV+TEAETD+PE ELKPG+DLL
Sbjct  241   SHSAQVILPQKQLGRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLL  300

Query  355   GPVDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSV  176
             GPVDEIFY+TYDRF P ND  AD CFIS SYDA+THFE+TV+DV+E+Y+KITGK +DLSV
Sbjct  301   GPVDEIFYDTYDRFEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSV  360

Query  175   DLSAASAGGEQ  143
             DLSAASA  E+
Sbjct  361   DLSAASAATEE  371



>gb|KDP29761.1| hypothetical protein JCGZ_18696 [Jatropha curcas]
Length=422

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/413 (75%), Positives = 357/413 (86%), Gaps = 27/413 (7%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGES+SL+L QLWKRFRG D+PPE LGAS++YNVDMIPKFMMAN
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGGDKPPESLGASRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR+LIHTDVTKYL FKAVDGSFVYNKGKI+KVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRILIHTDVTKYLNFKAVDGSFVYNKGKIHKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPK+H+G+DL  + A+D I+KY LED+T+DFIGH+LAL+ +D++L +PA++
Sbjct  144   IYVQDYDENDPKSHEGLDLTKVKARDVISKYGLEDNTVDFIGHALALYVEDSFLDEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FV ++KLYAESLARF+ GSPYIYP+YGLGELPQAFARLSAVYGGTYML KP+CKVEFD  
Sbjct  204   FVNRMKLYAESLARFRGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLCKPECKVEFDAD  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKAYGVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+CIMSHPIP T+DSHS QVILP
Sbjct  264   GKAYGVTSEGETAKCKKVVCDPSYLPEKVKKIGKVARAICIMSHPIPHTSDSHSVQVILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQL RKSDMYLFCCSYTHNVAPKGKYIAFV+TEAETDDPETELKPG+DLLG        
Sbjct  324   QKQLKRKSDMYLFCCSYTHNVAPKGKYIAFVTTEAETDDPETELKPGIDLLG--------  375

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDL  170
                                +SYDA+THFE+TV DV+ MY+KITGK +DL VDL
Sbjct  376   -------------------SSYDATTHFETTVEDVIAMYSKITGKKLDLKVDL  409



>gb|EEE59061.1| hypothetical protein OsJ_10849 [Oryza sativa Japonica Group]
Length=431

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/418 (73%), Positives = 363/418 (87%), Gaps = 15/418 (4%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG+S+SL+L QLWKRF+G   PP Q+GAS++YNVDMIPKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEGTPPAQIGASRDYNVDMIPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHT VTKYL+FKAVDGS+V+NKGKI+KVP+TD+EALKS LMGLFEKRR  KFF
Sbjct  84    GTLVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDMEALKSPLMGLFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             L+VQ+++E+DP TH+G DLN +T K+ I+KY L+D+TIDFIGH++ALH +DNYL +PAI+
Sbjct  144   LFVQDYKENDPSTHKGYDLNKMTTKELISKYGLDDNTIDFIGHAVALHKEDNYLTEPAID  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ RFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP+CK+EF+D 
Sbjct  204   TVKRMKLYAESVGRFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKIEFNDE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+Y+ DKV KVGKV RA+ IMSHPIP+T DSHS Q+I+P
Sbjct  264   GKVCGVTSEGETAKCKKVVCDPSYIPDKVRKVGKVFRAIAIMSHPIPNTADSHSVQIIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDM               ++IAFVS +AE+++P  ELKPG+DLLGPVDE+F +
Sbjct  324   QKQLGRKSDM---------------QFIAFVSAQAESENPAAELKPGIDLLGPVDELFID  368

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASA  155
             TYDRF PTND ++DNCFIS SYDA+THFESTV DVL +YTKITGKTVDLSVDLSAASA
Sbjct  369   TYDRFEPTNDPSSDNCFISTSYDATTHFESTVMDVLSIYTKITGKTVDLSVDLSAASA  426



>ref|XP_010030005.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X1 [Eucalyptus grandis]
Length=374

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/371 (81%), Positives = 340/371 (92%), Gaps = 0/371 (0%)
 Frame = -1

Query  1255  MIPKFMMANGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLF  1076
             MIPKF MANG LVRVLIHTDVTKYL+FK VDGSFVYNKGKIYKVPATDVEALKS LMGLF
Sbjct  1     MIPKFTMANGALVRVLIHTDVTKYLSFKVVDGSFVYNKGKIYKVPATDVEALKSPLMGLF  60

Query  1075  EKRRVRKFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDD  896
             EKRR RKFF+YVQ+FEESDPK+H+G+DLN +TA++ I+KY LEDDTIDFIGH+LALH DD
Sbjct  61    EKRRARKFFIYVQDFEESDPKSHEGLDLNKVTAREVISKYGLEDDTIDFIGHALALHIDD  120

Query  895   NYLAQPAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKP  716
             +Y+ +PA++FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP
Sbjct  121   SYMDKPALDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  180

Query  715   QCKVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTND  536
              CKVEFD SGK  GV+SEGETAKCKKVVCDP+YL  KV KVGKVARA+CIMSHPIPDTND
Sbjct  181   HCKVEFDASGKVIGVSSEGETAKCKKVVCDPSYLPGKVKKVGKVARAICIMSHPIPDTND  240

Query  535   SHSAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLL  356
             SHSAQVILPQKQLGRKSDMYLFCCSY HNVAP+GKYIAFV+ EAETD+P+ ELKPG++LL
Sbjct  241   SHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPQGKYIAFVAAEAETDNPQQELKPGIELL  300

Query  355   GPVDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSV  176
             GPVDE+F++ YDR+VPTN+   DNCFIS SYDASTHFE+TV DVL MY+KITGK ++LSV
Sbjct  301   GPVDEMFFDIYDRYVPTNNPEVDNCFISTSYDASTHFENTVTDVLAMYSKITGKVLNLSV  360

Query  175   DLSAASAGGEQ  143
             DL+AASA  EQ
Sbjct  361   DLNAASAATEQ  371



>gb|KCW87997.1| hypothetical protein EUGRSUZ_A00406, partial [Eucalyptus grandis]
Length=475

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/379 (78%), Positives = 348/379 (92%), Gaps = 0/379 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYG ES+SL+LIQLWK+FR +D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  96    SVDGLKVLHMDRNDYYGAESTSLNLIQLWKKFRNSDKPPPHLGSSRDYNVDMVPKFMMAN  155

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDG +V+NKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  156   GTLVRVLIHTDVTKYLYFKAVDGGYVFNKGKVHKVPATDMEALKSPLMGMFEKRRARKFF  215

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+T+DFIGH+LALH DD +L +PA++
Sbjct  216   IYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFIGHALALHRDDRFLDEPALD  275

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEF++ 
Sbjct  276   TVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFNEE  335

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGETAKCKKVVCDP+YLT+KV K+GKV+RA+CIMSHPIP+TNDSHS QVI+P
Sbjct  336   GQVIGVTSEGETAKCKKVVCDPSYLTNKVRKIGKVSRAICIMSHPIPNTNDSHSVQVIIP  395

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVS EAETD PE ELKPGVDLLGPVDEIFY+
Sbjct  396   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPEIELKPGVDLLGPVDEIFYD  455

Query  328   TYDRFVPTNDCTADNCFIS  272
             TYDR+ P N+ + DNCFIS
Sbjct  456   TYDRYEPVNEPSLDNCFIS  474



>gb|KHG17909.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=532

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/400 (79%), Positives = 355/400 (89%), Gaps = 7/400 (2%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPK-----  1244
             SVDGLKVLHMD+NDYYGGES+SL+L+QLWK F+G D+PPEQLG S+EYNVDMIPK     
Sbjct  24    SVDGLKVLHMDRNDYYGGESTSLNLMQLWKHFKGNDKPPEQLGTSREYNVDMIPKACKFN  83

Query  1243  --FMMANGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEK  1070
               FMMANG+LVR+LIHT VTKYL FKAVDGS+VY K KIYKVPATDVEALKS LMGLFEK
Sbjct  84    LFFMMANGSLVRILIHTGVTKYLNFKAVDGSYVYKKKKIYKVPATDVEALKSPLMGLFEK  143

Query  1069  RRVRKFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNY  890
             RR RKFF+YVQ+++E+DPK+H+ +DLN +TAK+ I+KY LEDDTIDFIGH+LALH +D+Y
Sbjct  144   RRARKFFIYVQDYDENDPKSHEKLDLNKVTAKELISKYGLEDDTIDFIGHALALHNEDSY  203

Query  889   LAQPAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQC  710
             LAQPA+ FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+C
Sbjct  204   LAQPALNFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPEC  263

Query  709   KVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSH  530
             KVEFD  GK  GVTSEGETAKC KVVCDP+YL+DKV KVGKVARAVC+MSHPIPDTNDSH
Sbjct  264   KVEFDGDGKVIGVTSEGETAKCNKVVCDPSYLSDKVKKVGKVARAVCVMSHPIPDTNDSH  323

Query  529   SAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGP  350
             SAQVILPQKQLGRKSDMY+FCCSY HNVAPKGKYIAFVS EAETD+PE ELKPGVDLLG 
Sbjct  324   SAQVILPQKQLGRKSDMYVFCCSYAHNVAPKGKYIAFVSAEAETDNPEQELKPGVDLLGS  383

Query  349   VDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVR  230
             VDEIFY+TYDR+VPTND  ADNCFIS       + E  +R
Sbjct  384   VDEIFYDTYDRYVPTNDHQADNCFISALPSCPCNIERILR  423


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  268  SYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGGE  146
            SYD++THFE+TV DV+EMYTKITGK +DLSVDLSAASA  E
Sbjct  492  SYDSTTHFETTVIDVMEMYTKITGKVLDLSVDLSAASAAEE  532



>ref|XP_001768163.1| predicted protein [Physcomitrella patens]
 gb|EDQ67036.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/421 (73%), Positives = 363/421 (86%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG S+SL+L QLWK+FRG ++PP  LG+SKEYNVDM+PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGASASLNLNQLWKKFRGDEKPPAFLGSSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGS+VYN+GK+YKVP+ DVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLLFKAVDGSYVYNQGKVYKVPSNDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ +EE+D KTH+GMDL A+  K+   K+ L+ +TIDF+GHSLALH DD +L +PA++
Sbjct  144   IFVQNYEEADAKTHEGMDLRAVPTKELFEKFGLDANTIDFVGHSLALHRDDRFLTEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK+VKLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYML KP+CKVEFD+ 
Sbjct  204   TVKRVKLYAESMARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLAKPECKVEFDEM  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGET K KKVVCDP+YL +KV KVGKV RA+C MSHPIP+T+DS S Q+ILP
Sbjct  264   GQVVGVTSEGETVKAKKVVCDPSYLPNKVKKVGKVVRAICFMSHPIPNTSDSDSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCS++HNVAPKGKYIAFVS E ET++PE EL+PG+ LLG +DE   +
Sbjct  324   QKQLGRRSDMYVFCCSHSHNVAPKGKYIAFVSAEVETENPEAELEPGLALLGKIDEKIID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YD + P ND + DNCFIS SYD +THFE+TV+DVL MYTKITGK +DLSVDLSAASA  
Sbjct  384   MYDMYEPVNDSSLDNCFISKSYDPTTHFETTVQDVLSMYTKITGKNLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_001773747.1| predicted protein [Physcomitrella patens]
 gb|EDQ61364.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/421 (72%), Positives = 362/421 (86%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG ++SL+L QLW++FRG ++PP  LG+SKEYNVDM+PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGAAASLNLNQLWQKFRGNEKPPASLGSSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+VY +GK+YKVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLLFKAVDGSYVYKQGKVYKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ ++E D KTH+GMDL  +T K+   K+ L+ +T+DFIGHSLALH DD +L++PA++
Sbjct  144   IFVQNYDEEDAKTHEGMDLRTVTTKEVFEKFGLDANTVDFIGHSLALHRDDRFLSEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK+VKLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYML KP+CKVEFD+ 
Sbjct  204   FVKRVKLYAESMARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLAKPECKVEFDEM  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGETAK KKVVCDP+YL +KV KVGKV RA+C MSHPIP+T DS S Q+ILP
Sbjct  264   GQVMGVTSEGETAKAKKVVCDPSYLPNKVKKVGKVVRAICFMSHPIPNTGDSDSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCS++HNVAPKGKYIAFVS E ET++PE EL+PG+ LLG +DE   +
Sbjct  324   QKQLGRRSDMYVFCCSHSHNVAPKGKYIAFVSAEVETENPEAELQPGLALLGQIDEKIID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YD + P ND + DNCFIS SYD +THFE+TV+DVL MYT+ITGK +DLSVDLSAASA  
Sbjct  384   MYDMYEPVNDSSLDNCFISKSYDPTTHFETTVQDVLSMYTRITGKNLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>ref|XP_001766609.1| predicted protein [Physcomitrella patens]
 gb|EDQ68674.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/421 (72%), Positives = 362/421 (86%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG ++SL+L QLW++FRG ++PP  LG+SKEYNVDM+PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGAAASLNLNQLWQKFRGDEKPPASLGSSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGS+VY +GK+YKVPA DVEALKS LMGLFEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLLFKAVDGSYVYKQGKVYKVPANDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ ++E D KTH+GMDL  +T K+   K+ L+ +T+DFIGHSLALH DD +L++PA++
Sbjct  144   IFVQNYDEEDAKTHEGMDLRTVTTKEVFEKFGLDANTVDFIGHSLALHRDDRFLSEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
             FVK+VKLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYML KP+CKVEFD+ 
Sbjct  204   FVKRVKLYAESMARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLAKPECKVEFDEM  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGETAK KKVVCDP+YL +KV KVGKV RA+C MSHPIP+T DS S Q+ILP
Sbjct  264   GQVMGVTSEGETAKAKKVVCDPSYLPNKVKKVGKVVRAICFMSHPIPNTGDSDSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCS++HNVAPKGKYIAFVS E ET++PE EL+PG+ LLG +DE   +
Sbjct  324   QKQLGRRSDMYVFCCSHSHNVAPKGKYIAFVSAEVETENPEAELQPGLSLLGQIDEKIID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YD + P ND + DNCFIS SYD +THFE+TV+DVL MYT+ITGK +DLSVDLSAASA  
Sbjct  384   MYDMYEPVNDSSLDNCFISKSYDPTTHFETTVQDVLSMYTRITGKNLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|KCW87999.1| hypothetical protein EUGRSUZ_A00408 [Eucalyptus grandis]
Length=417

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/421 (71%), Positives = 356/421 (85%), Gaps = 27/421 (6%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+GLKVLHMD+NDYYGGES+SL+L+QLWK+FR +D+PP  LG+S++YNVDM+PKFMMAN
Sbjct  24    SVNGLKVLHMDRNDYYGGESTSLNLVQLWKKFRNSDKPPAHLGSSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVT+YL FKAVDGS+V++KGK++KVPATD+EAL++ LMG+F+KRR RKFF
Sbjct  84    GTLVRVLIHTDVTRYLYFKAVDGSYVFSKGKVHKVPATDMEALQTPLMGMFQKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+TIDFIGH++ALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGMDLTLLTTRELIAKYGLDDNTIDFIGHAMALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++K                           AFARLSAVYGGTYMLNKP+CKVEF+D 
Sbjct  204   TVKRMK---------------------------AFARLSAVYGGTYMLNKPECKVEFNDE  236

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+ IM HPIP+TNDSHS QVI+P
Sbjct  237   GQVIGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAISIMGHPIPNTNDSHSVQVIIP  296

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVS EAETD PE ELKPG+DLLGPVDEIFY+
Sbjct  297   QKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPEIELKPGLDLLGPVDEIFYD  356

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
             TYDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSVDLSAASA  
Sbjct  357   TYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTLITGKVLDLSVDLSAASAAE  416

Query  148   E  146
             E
Sbjct  417   E  417



>ref|XP_001755959.1| predicted protein [Physcomitrella patens]
 gb|EDQ79244.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/421 (72%), Positives = 359/421 (85%), Gaps = 0/421 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD LKVLHMD+NDYYGG ++SL+L QLWK+F+G ++PP  LG+SKEYNVDM+PKFMMAN
Sbjct  24    SVDRLKVLHMDRNDYYGGAAASLNLNQLWKKFKGDEKPPAFLGSSKEYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             GTLVRVLIHTDVTKYL FKAVDGS+VY +GK+YKVP+ DVEALKS LMGLFEKRR RKFF
Sbjct  84    GTLVRVLIHTDVTKYLLFKAVDGSYVYKQGKVYKVPSNDVEALKSPLMGLFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ ++E+D KTH GM+L  +T K+   K+ L+ +TIDFIGHSLALH DD +L++PA++
Sbjct  144   IFVQNYDEADAKTHDGMNLQTVTTKELFEKFGLDANTIDFIGHSLALHRDDRFLSEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK+VKLYAES+ARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYML KP+CKVEFD+ 
Sbjct  204   TVKRVKLYAESMARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLAKPECKVEFDEM  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             G+  GVTSEGET K KKVVCDP+YL +KV KVGKV RA+C MSHPIP+TN+S S Q+ILP
Sbjct  264   GQVMGVTSEGETVKAKKVVCDPSYLPNKVKKVGKVVRAICFMSHPIPNTNNSDSVQIILP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQLGR+SDMY+FCCS++HN+A K KYIAFVS E ETD PE EL+PG+ LLG +DE   +
Sbjct  324   QKQLGRRSDMYVFCCSHSHNIAAKDKYIAFVSAEVETDTPEAELEPGLALLGHIDEKIID  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
              YD + P ND + DNCFIS SYD +THFE+TV+DVL MYTKITGK +DLSVDLSAASA  
Sbjct  384   MYDMYEPVNDPSLDNCFISKSYDPTTHFETTVQDVLSMYTKITGKNLDLSVDLSAASAAE  443

Query  148   E  146
             E
Sbjct  444   E  444



>gb|KDO49754.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=370

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/370 (79%), Positives = 335/370 (91%), Gaps = 0/370 (0%)
 Frame = -1

Query  1255  MIPKFMMANGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLF  1076
             MIPKF++ANG LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+F
Sbjct  1     MIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIF  60

Query  1075  EKRRVRKFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDD  896
             EKRR RKFF+YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD
Sbjct  61    EKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDD  120

Query  895   NYLAQPAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKP  716
              YL +PA++ VK++KLYAES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP
Sbjct  121   RYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  180

Query  715   QCKVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTND  536
             +CKVEFD+ GK  GVTSEGETAKCKKVVCDP+YL +KV KVG+VARA+ IMSHPIP+TND
Sbjct  181   ECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTND  240

Query  535   SHSAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLL  356
             SHS QVILPQKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVSTEAETD P+TELKPG+DLL
Sbjct  241   SHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLL  300

Query  355   GPVDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSV  176
             GPVDEIFY+ YDR+ P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSV
Sbjct  301   GPVDEIFYDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSV  360

Query  175   DLSAASAGGE  146
             DLSAASA  E
Sbjct  361   DLSAASAAEE  370



>gb|AFK40299.1| unknown [Lotus japonicus]
Length=370

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/370 (79%), Positives = 327/370 (88%), Gaps = 0/370 (0%)
 Frame = -1

Query  1255  MIPKFMMANGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLF  1076
             M PKF+MANG LVRVLIHTDVTKYL FKAVDGSFV+NKGK++KVP+ D+EALKS LMG+F
Sbjct  1     MNPKFIMANGNLVRVLIHTDVTKYLYFKAVDGSFVFNKGKVHKVPSNDMEALKSPLMGIF  60

Query  1075  EKRRVRKFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDD  896
             EKRR RKFF+YVQ+++E DPKTH GMDL  +T K+ I K+ L+D+TIDFIGHSLALH D+
Sbjct  61    EKRRARKFFIYVQDYDEKDPKTHDGMDLTRVTTKELIAKFGLDDNTIDFIGHSLALHRDE  120

Query  895   NYLAQPAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKP  716
              YL +PA+E VK++KLYAESLARFQ GSPYIYP+YGLGELPQ FARLSAVYGGTYMLNKP
Sbjct  121   RYLHEPALETVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKP  180

Query  715   QCKVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTND  536
             +CKVEFD+ GK  GVTSEGETAKCKKVVCDP+YL  KV KVGKVARA+CIMSHPIP+TND
Sbjct  181   ECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPSKVRKVGKVARAICIMSHPIPNTND  240

Query  535   SHSAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLL  356
             S S QVILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD P  ELKPG+DLL
Sbjct  241   SPSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLL  300

Query  355   GPVDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSV  176
             GPVDEIF++ YDRF P N+ + DNCFIS SYDA+THFESTV DVL MYT ITGK +DLSV
Sbjct  301   GPVDEIFFDMYDRFEPVNEPSLDNCFISTSYDATTHFESTVVDVLNMYTMITGKVLDLSV  360

Query  175   DLSAASAGGE  146
             DLSAASA  E
Sbjct  361   DLSAASAAEE  370



>emb|CDY65664.1| BnaC09g54770D [Brassica napus]
Length=410

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/399 (74%), Positives = 336/399 (84%), Gaps = 23/399 (6%)
 Frame = -1

Query  1393  KVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANGTLVR  1214
             +VLHMD+ND YGGESSSL+L QLWKRFRG+D P E LGA +EYNVDMIPKF+MANG L+ 
Sbjct  17    QVLHMDRNDSYGGESSSLNLTQLWKRFRGSDTPQENLGAIREYNVDMIPKFIMANGLLL-  75

Query  1213  VLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFLYVQE  1034
                               SFVYNKGKIYKVPATDVEALKS LMGLFEKRR RKFF+YVQ+
Sbjct  76    ------------------SFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFFIYVQD  117

Query  1033  FEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEFVKKV  854
             ++E D K+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LALH DD+YL QPAI+FVK++
Sbjct  118   YDEKDSKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAIDFVKRI  177

Query  853   KLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSGKAYG  674
             KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD SGKA G
Sbjct  178   KLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGSGKAIG  237

Query  673   VTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQKQLG  494
             VTS GETAKCKKVVCDP+YL+DKV KVGKV RAVCIMSHPIPDTN++HS Q+ILPQKQLG
Sbjct  238   VTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCIMSHPIPDTNEAHSVQIILPQKQLG  297

Query  493   RKSDMYLFCC----SYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYET  326
             RKSD+    C    S  HNVAPKGKYIAFVS EAETD+PE ELK G++LLGP+DEIFY +
Sbjct  298   RKSDINHSDCVGTYSVAHNVAPKGKYIAFVSAEAETDNPEEELKAGIELLGPIDEIFYHS  357

Query  325   YDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYT  209
             YD +VPTN    DNCFIS +YDA+THFESTV DVLEMYT
Sbjct  358   YDTYVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYT  396



>emb|CDX71860.1| BnaC08g30140D [Brassica napus]
Length=409

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/423 (67%), Positives = 341/423 (81%), Gaps = 39/423 (9%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG+KVLHMD++DYYGGES+SL+L QLWK+FRG ++ PE LGAS++YNVDM+PKFMM N
Sbjct  24    SVDGVKVLHMDRSDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR LIHTDVTKYL+FKAVDGS+V+ KGK+ KVP T +EA+KS+LMG+FEKRR  KFF
Sbjct  84    GKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPMEAMKSNLMGIFEKRRAGKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFI--TKYELEDDTIDFIGHSLALHTDDNYLAQPA  875
              Y+                 A+   + +   K+ L+D+TI+FIGH++ALHT+D +L QPA
Sbjct  144   GYL-----------------ALRVANHLDGWKFGLDDNTIEFIGHAIALHTNDQHLHQPA  186

Query  874   IEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFD  695
             ++ V ++KLYAESLARFQ  SPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP C VEFD
Sbjct  187   LDTVMRMKLYAESLARFQGSSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPDCTVEFD  246

Query  694   DSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVI  515
             + GK  GVTSEGETAKCKKVVCDP+YL +KV+K+G+VARA+ IMSHPIP+TNDSHS QVI
Sbjct  247   EEGKVTGVTSEGETAKCKKVVCDPSYLPNKVNKIGRVARAIAIMSHPIPNTNDSHSVQVI  306

Query  514   LPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIF  335
             +PQKQL RKSDMY+FCCSY+HNVAPKGK+IAFVST+AETD+P+TELK G+DLLGPVDEIF
Sbjct  307   IPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKAGIDLLGPVDEIF  366

Query  334   YETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASA  155
             ++                     YDA+THFE+TV DVL MYT ITGK +DLSVDLSAASA
Sbjct  367   FDI--------------------YDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASA  406

Query  154   GGE  146
               E
Sbjct  407   AEE  409



>ref|XP_004962066.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X2 [Setaria italica]
Length=374

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/374 (73%), Positives = 321/374 (86%), Gaps = 2/374 (1%)
 Frame = -1

Query  1240  MMANGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRV  1061
             MMANGTLVR LIHTDVTKYL+FKAVDGS+V++KGKI+KVPATD+EALKS LMGLFEKRR 
Sbjct  1     MMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRA  60

Query  1060  RKFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQ  881
             R FF+YVQ + E+DP THQG+DL  IT ++ I+K+ L DDT+DFIGH+LALH DD YL +
Sbjct  61    RNFFVYVQNYNEADPVTHQGLDLTRITTRELISKHGLSDDTVDFIGHALALHRDDCYLNE  120

Query  880   PAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVE  701
             PA++ VK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVE
Sbjct  121   PALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVE  180

Query  700   FDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQ  521
             FD  GK  GVTSEGETAKCKKVVCDP+YL +KV K+GKVARA+ IMSHPIP+TNDSHS Q
Sbjct  181   FDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAIMSHPIPNTNDSHSVQ  240

Query  520   VILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDE  341
             +ILPQKQLGRKSDMY+FCCSYTHNVAPKGK+IAFVS EAETD+P++EL+PG+DLLG VDE
Sbjct  241   IILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELRPGIDLLGQVDE  300

Query  340   IFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKT--VDLSVDLS  167
             +F++ YDR+ P N+ + DNCF+S SYDA+THFE+TV DVL MYT ITGK   +  S  LS
Sbjct  301   LFFDMYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLSMYTAITGKVSFIITSFYLS  360

Query  166   AASAGGEQ*VYFSY  125
              A    +Q  Y  Y
Sbjct  361   NAFFCSQQSRYIRY  374



>emb|CDX69899.1| BnaA10g22480D [Brassica napus]
Length=315

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/315 (81%), Positives = 289/315 (92%), Gaps = 0/315 (0%)
 Frame = -1

Query  1087  MGLFEKRRVRKFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLAL  908
             MGLFEKRR RKFF+YVQ+++E DPK+H+G+DL+ +TA++ I+KY LEDDTIDFIGH+LAL
Sbjct  1     MGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALAL  60

Query  907   HTDDNYLAQPAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYM  728
             H DD+YL QPAI+FVK++KLYAESLARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYM
Sbjct  61    HNDDDYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYM  120

Query  727   LNKPQCKVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIP  548
             LNKP+CKVEFD SGKA GVTS GETAKCKKVVCDP+YL+DKV KVGKVARAVCIMSHPIP
Sbjct  121   LNKPECKVEFDGSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCIMSHPIP  180

Query  547   DTNDSHSAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPG  368
             DTND+HS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGKYIAFVS EAETD+PE ELKPG
Sbjct  181   DTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPG  240

Query  367   VDLLGPVDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTV  188
             ++LLGP+DEIFY +YD +VPTN    DNCFIS +YDA+THFESTV DVLEMYTKITGKT+
Sbjct  241   IELLGPIDEIFYHSYDTYVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTKITGKTL  300

Query  187   DLSVDLSAASAGGEQ  143
             DLSVDLSAASA  E+
Sbjct  301   DLSVDLSAASATAEK  315



>ref|XP_002501191.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62449.1| predicted protein [Micromonas sp. RCC299]
Length=445

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/422 (62%), Positives = 329/422 (78%), Gaps = 0/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG K+LHMD+N YYGGES+SL+L QL+++F+   + P   G  +++N DM+PKFMM N
Sbjct  24    SVDGKKILHMDRNSYYGGESASLNLKQLYEKFKPGQELPPHYGRWQDWNFDMVPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVL+HT V KYL FKAVDGS+V   GK YKVPA D +AL+SSLMG+FEK R R FF
Sbjct  84    GLLVRVLVHTGVHKYLEFKAVDGSYVVKGGKTYKVPANDKDALRSSLMGMFEKYRARSFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             ++VQ++E+ DP+TH+G DL+ IT+++   +Y L+ +T+DFIGH+LAL TDD+++ QPA +
Sbjct  144   IFVQDYEKDDPRTHKGYDLDVITSRELFKEYGLDPNTVDFIGHALALQTDDSFMDQPARK  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V  VKLY+ESLARF++ SPYIYP+YGLGELPQ FARLSAVYGGTYML KP  +V +D++
Sbjct  204   MVMAVKLYSESLARFETNSPYIYPLYGLGELPQGFARLSAVYGGTYMLAKPDAEVVYDEA  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GKA GV+SEGETAK K VV DP+Y   KV +VG+V RA+CI+SHPIP+  DSHS Q+I+P
Sbjct  264   GKACGVSSEGETAKAKYVVGDPSYFPGKVRRVGQVVRAICILSHPIPNVGDSHSVQIIIP  323

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQ GR+SDMY+F CS+ HNV  KGKY+AFVST  ET +P  EL PG+ LLG +DE F +
Sbjct  324   QKQTGRQSDMYVFGCSFAHNVCAKGKYLAFVSTAVETANPTAELIPGLQLLGAIDEYFVQ  383

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
               D   P ND + D C+IS  YDA+THF+STV DVLEMY KITGK V+L  D  AA+AG 
Sbjct  384   VSDVMEPVNDGSEDGCYISKGYDATTHFQSTVEDVLEMYKKITGKDVNLDADDPAATAGQ  443

Query  148   EQ  143
             EQ
Sbjct  444   EQ  445



>ref|XP_002955697.1| hypothetical protein VOLCADRAFT_83359 [Volvox carteri f. nagariensis]
 gb|EFJ43337.1| hypothetical protein VOLCADRAFT_83359 [Volvox carteri f. nagariensis]
Length=443

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/416 (63%), Positives = 325/416 (78%), Gaps = 3/416 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD  KVLH+D+N+YYGGES+SLSLIQL++RFRG D+PPE+LG S++YNVDM+PKFMMAN
Sbjct  24    SVDKKKVLHVDRNNYYGGESASLSLIQLYERFRGGDKPPEKLGPSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVL+HTDV KYL FKAVDGS+V  KGK++KVPA D EAL S LMGLFEKRR R FF
Sbjct  84    GKLVRVLLHTDVVKYLEFKAVDGSYVLQKGKVHKVPANDTEALSSQLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ++EESDPKTH+G+DL  +T  +   +Y+L +DT DFIGH+L LH DD YL QPA+ 
Sbjct  144   LYVQDYEESDPKTHKGLDLKRMTMSELYKQYDLSEDTQDFIGHALGLHRDDAYLTQPALA  203

Query  868   FVKKVKLYAESLARFQS-GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
              V ++KLY ESL R++   SPY+YP YGLGELPQAFARLSAVYGGTYMLN+P  +V +++
Sbjct  204   TVLRIKLYHESLFRYEGLKSPYLYPRYGLGELPQAFARLSAVYGGTYMLNQPSMEVLYEN  263

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              G A G+ +  + A+ K VV DP+Y   K   V KV RA+ IMSHPIP+T+ +HS Q+IL
Sbjct  264   -GVAVGIKNGDDVARAKLVVGDPSYFPGKTRVVSKVVRAIAIMSHPIPNTDSAHSVQIIL  322

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQKQ GRKSDMY+FCCSY HNVA K K++AFVST  ET +PE +L PG+ LLGPVDE F 
Sbjct  323   PQKQTGRKSDMYVFCCSYAHNVAAKDKWLAFVSTTMETPNPEVDLAPGLALLGPVDEKFV  382

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSV-DLS  167
             E  +   P  D   D C+IS  YDA+THFE+TV DVL+MY +ITG+ +DL+  DLS
Sbjct  383   EVREVCEPLEDGARDKCYISKGYDATTHFETTVEDVLDMYRRITGRDLDLTAKDLS  438



>ref|XP_005647685.1| rab GDP dissociation inhibitor protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23141.1| rab GDP dissociation inhibitor protein [Coccomyxa subellipsoidea 
C-169]
Length=442

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 331/419 (79%), Gaps = 3/419 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLH+D+N+YYGGES+SLSL QL++RFR   QPP+ LG S++YNVDM+PKF+M +
Sbjct  24    SVDGLKVLHIDRNNYYGGESASLSLQQLFERFRPGQQPPKSLGPSRDYNVDMVPKFIMNS  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVL+HTDVTKYL FK VDGSFV NKG++ KVPATD EAL+S L+GLFEKRR+R F 
Sbjct  84    GELVRVLVHTDVTKYLEFKGVDGSFVQNKGRVEKVPATDYEALRSPLLGLFEKRRLRNFL  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             L+VQE++ES+PKT +G DL  +       +Y L+  T+DFIGH++ALH DD Y+ +PA+ 
Sbjct  144   LFVQEYDESNPKTQKGYDLRRMPMAALYKEYGLDPMTVDFIGHAIALHRDDAYMGEPALA  203

Query  868   FVKKVKLYAESLARFQ-SGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
              VKK++LY +SL RF+ + SPYIYP+YGLGELPQAFARLSAVYGGTYML+KP  +V +++
Sbjct  204   TVKKIRLYYDSLMRFEGTSSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPDAQVAYEN  263

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              G A GVT++GETAK K VV DP+Y  DKV K  +V RA CI+SHPIP+TN+S SAQ+IL
Sbjct  264   -GVAVGVTADGETAKAKLVVGDPSYFPDKVSKTSRVVRAACILSHPIPNTNNSASAQIIL  322

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQKQ+ R+SD+Y+F CS +HNV PK K++AFVST  ET +PE EL PG+ LLGP DE F 
Sbjct  323   PQKQVNRRSDIYVFSCSASHNVVPKDKWLAFVSTTVETSNPEAELAPGLALLGPFDEKFV  382

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSV-DLSAAS  158
             +  D + P      D CFIS  YDA++HFE+TV D+LEMYT+ITGK +DLS  D+S A+
Sbjct  383   DVVDVYEPLESGQRDKCFISKGYDATSHFETTVEDILEMYTRITGKVLDLSSKDVSQAA  441



>gb|AAB09058.1| GDP dissociation inhibitor protein GDIV1p [Volvox carteri f. 
nagariensis]
Length=443

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/416 (63%), Positives = 324/416 (78%), Gaps = 3/416 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD  KVLH+D+N+YYGGES+SLSLIQL++RFRG D+PPE+LG S++YNVDM+PKFMMAN
Sbjct  24    SVDKKKVLHVDRNNYYGGESASLSLIQLYERFRGGDKPPEKLGPSRDYNVDMVPKFMMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVL+HTDV KYL FKAVDGS+V  KGK++KVPA   EAL S LMGLFEKRR R FF
Sbjct  84    GKLVRVLLHTDVVKYLEFKAVDGSYVLQKGKVHKVPANRSEALSSQLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ++EESDPKTH+G+DL  +T  +   +Y+L +DT DFIGH+L LH DD YL QPA+ 
Sbjct  144   LYVQDYEESDPKTHKGLDLKRMTMSELYKQYDLSEDTQDFIGHALGLHRDDAYLTQPALA  203

Query  868   FVKKVKLYAESLARFQS-GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
              V ++KLY ESL R++   SPY+YP YGLGELPQAFARLSAVYGGTYMLN+P  +V +++
Sbjct  204   TVLRIKLYHESLFRYEGLKSPYLYPRYGLGELPQAFARLSAVYGGTYMLNQPSMEVLYEN  263

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              G A G+ +  + A+ K VV DP+Y   K   V KV RA+ IMSHPIP+T+ +HS Q+IL
Sbjct  264   -GVAVGIKNGDDVARAKLVVGDPSYFPGKTRVVSKVVRAIAIMSHPIPNTDSAHSVQIIL  322

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQKQ GRKSDMY+FCCSY HNVA K K++AFVST  ET +PE +L PG+ LLGPVDE F 
Sbjct  323   PQKQTGRKSDMYVFCCSYAHNVAAKDKWLAFVSTTMETPNPEVDLAPGLALLGPVDEKFV  382

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSV-DLS  167
             E  +   P  D   D C+IS  YDA+THFE+TV DVL+MY +ITG+ +DL+  DLS
Sbjct  383   EVREVCEPLEDGARDKCYISKGYDATTHFETTVEDVLDMYRRITGRDLDLTAKDLS  438



>ref|XP_005847470.1| hypothetical protein CHLNCDRAFT_35621 [Chlorella variabilis]
 gb|EFN55368.1| hypothetical protein CHLNCDRAFT_35621 [Chlorella variabilis]
Length=445

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/410 (62%), Positives = 326/410 (80%), Gaps = 1/410 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLH+D+N+YYGG+S+SL+L QL++RFR   +PP +LG S++YNVD++PKF+MAN
Sbjct  24    SVDGLKVLHIDRNNYYGGQSASLNLNQLFERFRPGQKPPAELGPSRDYNVDLVPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVL+HTDVTKYL FKAVDGS+V NK ++ KVPATD EALKS LMGLFEKRR  KFF
Sbjct  84    GNLVRVLVHTDVTKYLEFKAVDGSYVLNKAQVQKVPATDWEALKSPLMGLFEKRRAAKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              + Q+++E +P+T +  DL+ +T  +   ++ L+  TIDFIGH++ALH +D Y+ QPA+ 
Sbjct  144   SFCQQYDERNPQTWRNWDLSRMTMHELYAQFGLDAMTIDFIGHAIALHQNDAYMMQPAMG  203

Query  868   FVKKVKLYAESLARFQS-GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
              V+K+KLY +S+ R++   SPYIYP+YGLGELPQAFARLSAVYGGTYML KP  +V +D+
Sbjct  204   TVQKIKLYYDSMMRYEGLTSPYIYPLYGLGELPQAFARLSAVYGGTYMLAKPDVEVVYDE  263

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
             +G A GV+SEGETA+ K VV DPTY  DKV K  +V RA+CI+SHPIP TNDSHS Q+IL
Sbjct  264   AGAAVGVSSEGETARAKFVVGDPTYFPDKVRKSARVVRAMCILSHPIPSTNDSHSVQIIL  323

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQKQL R+ D+Y+FCCSY+HNVAP+ K+IAFVST  ET DP +EL PG+ LLG +DE F 
Sbjct  324   PQKQLNRRHDIYVFCCSYSHNVAPRDKWIAFVSTTVETSDPASELAPGLQLLGRIDEKFV  383

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDL  182
             E  D F P  D +AD  FIS  YDA++HFE+ + DVL++Y +ITGK +DL
Sbjct  384   EVVDVFEPLGDGSADKAFISKGYDATSHFETEIHDVLDLYQRITGKPLDL  433



>gb|KDD75407.1| Rab GDP dissociation inhibitor [Helicosporidium sp. ATCC 50920]
Length=446

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/411 (61%), Positives = 328/411 (80%), Gaps = 1/411 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+N+YYGG+S+SL+L QL++RFR   +PP +LGAS++YNVD++PKF+MA 
Sbjct  24    SVDGLKVLHMDRNNYYGGQSASLNLNQLYERFRPGQKPPPELGASRDYNVDLVPKFIMAG  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+VL+HT+VTKYL FKAVDGS+VYNKG++ KVPATD EAL+S L+GLFEKRRV KF 
Sbjct  84    GLLVKVLVHTEVTKYLEFKAVDGSYVYNKGRVEKVPATDWEALRSPLLGLFEKRRVAKFL  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ +  +D  + Q  DL  +   D   ++ L+  +IDF+GH+LALH DD+Y+ QPA E
Sbjct  144   TYVQRWRAADRSSWQECDLQRMPMADLYKQFGLDAMSIDFLGHALALHRDDDYMRQPAAE  203

Query  868   FVKKVKLYAESLARFQS-GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
              V+K+KLY ES+ R++   SPYIYP+YGLGELPQAFARLSAVYGGTYML KP  +VE+D+
Sbjct  204   TVEKIKLYYESMVRYEGMTSPYIYPLYGLGELPQAFARLSAVYGGTYMLAKPDVQVEYDE  263

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
             +GKA GV SEG+TAK   VV DP+Y   KV K  +V RA+C++SHPIP TND+ SAQ+I+
Sbjct  264   AGKAVGVVSEGQTAKASFVVGDPSYFPGKVSKASRVVRALCLLSHPIPATNDAPSAQIIV  323

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQKQ+GR+SD+Y+FCCSYTH+VAPK +++AFVST  ET DP+ EL PG+ LLG +DE+F 
Sbjct  324   PQKQVGRRSDIYIFCCSYTHSVAPKNRWLAFVSTTVETADPKAELAPGLGLLGRIDEMFV  383

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLS  179
             E  D + P      D CFIS  YDA++HFE+ ++DVL++YT+ITGK++DLS
Sbjct  384   EVADVYEPDESGQRDKCFISRGYDATSHFETEIQDVLDIYTRITGKSLDLS  434



>gb|KDO49752.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=342

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/310 (79%), Positives = 285/310 (92%), Gaps = 0/310 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDGLKVLHMD+NDYYGGESSSL+LIQLWKRFRG +QPP  LG+S++YNVDMIPKF++AN
Sbjct  24    SVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAHLGSSRDYNVDMIPKFIIAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALKS LMG+FEKRR RKFF
Sbjct  84    GALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+DPKTH+GMDL  +T ++ I KY L+D+TIDFIGH+LALH DD YL +PA++
Sbjct  144   IYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              VK++KLYAES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGTYMLNKP+CKVEFD+ 
Sbjct  204   TVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEE  263

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK  GVTSEGETAKCKKVVCDP+YL +KV KVG+VARA+ IMSHPIP+TNDSHS QVILP
Sbjct  264   GKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTNDSHSVQVILP  323

Query  508   QKQLGRKSDM  479
             QKQLGR+SD+
Sbjct  324   QKQLGRRSDI  333



>ref|XP_003064630.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51535.1| predicted protein [Micromonas pusilla CCMP1545]
Length=447

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/421 (60%), Positives = 320/421 (76%), Gaps = 3/421 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+G+K+LHMD+N YYGGES+SL+L QLW++FR  +  P   G  +++  DM+PKFMM N
Sbjct  24    SVEGMKILHMDRNSYYGGESASLNLRQLWEKFRPGEPEPTHYGRWQDWAFDMVPKFMMGN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVR L+HT V  YL FKAVDGS+V   GK YKVPATD++ALKSSLMG+FEKRR R FF
Sbjct  84    GLLVRTLVHTSVHNYLQFKAVDGSYVVKGGKTYKVPATDMDALKSSLMGMFEKRRARSFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ+++E+ P T +G +LN +T+++   K+ L+D T++FIGH+LAL+ DD YL +PA++
Sbjct  144   MYVQDYDETKPDTTKGHNLNVMTSRELFAKFGLQDGTVEFIGHALALNVDDAYLDRPALK  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFD-D  692
              VK VKLY ESLARF +GSPYIYP+YGLGELPQ FARLSAVYGGTYML KP  +V +D +
Sbjct  204   MVKAVKLYEESLARFNTGSPYIYPLYGLGELPQGFARLSAVYGGTYMLAKPDVEVTYDPE  263

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
             + +A GVTSEGE+A+ K VV DP+Y   K  ++G+V RA+CI+SHPIP+  D+HS Q+IL
Sbjct  264   TKRATGVTSEGESARAKFVVGDPSYFPGKTRRIGRVVRAICILSHPIPNCGDAHSVQIIL  323

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLG--PVDEI  338
             PQ Q GR+SDMY+F CS+ HNV  KGKY+AFVST  ET +P  E++PG+ LLG  P    
Sbjct  324   PQAQTGRQSDMYVFGCSWAHNVCAKGKYLAFVSTTVETANPHLEIEPGLALLGASPFVLF  383

Query  337   FYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAAS  158
             F    D   P  D   D CFIS  YDA+THFESTV DVL+MYT+ITGKT+DLS    AA+
Sbjct  384   FINVTDVMTPIADGKEDGCFISAGYDATTHFESTVLDVLDMYTRITGKTLDLSEKDPAAA  443

Query  157   A  155
             A
Sbjct  444   A  444



>gb|KFM24244.1| putative secretory pathway GDP dissociation inhibitor 1 [Auxenochlorella 
protothecoides]
Length=448

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/412 (60%), Positives = 322/412 (78%), Gaps = 2/412 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVDG KVLH+D+N+YYGG+S+SL+L QL++RFR   +P  +LG S+++NVD++PKF+MAN
Sbjct  24    SVDGYKVLHIDRNNYYGGQSASLNLNQLFERFRPGQKPQTELGPSRDFNVDLVPKFIMAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV+VLIHTDVTKYL FKAVDGSFV NK ++ KVPA+D EALKS L+GLFEKRR  KF 
Sbjct  84    GNLVKVLIHTDVTKYLEFKAVDGSFVLNKNRVEKVPASDWEALKSPLLGLFEKRRAAKFL  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
              YVQ+++ +DP+T++G DL  +T  +  ++Y L+  T+DF+GH+LALH+DD+Y+ +PA+E
Sbjct  144   GYVQQYDPADPQTYKGQDLRRVTMAELYSQYGLDAMTVDFMGHALALHSDDSYMRRPALE  203

Query  868   FVKKVKLYAESLARFQS-GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFD-  695
              V K+KLY +S+ R++   SPYIYP+YGLGELPQAFARLSAVYGGTYML K   +V +D 
Sbjct  204   TVLKIKLYYDSMMRYEGLKSPYIYPLYGLGELPQAFARLSAVYGGTYMLAKADAEVVYDA  263

Query  694   DSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVI  515
             DSG+A GV SEG+TA  K VV D +Y   KV +  +V RA+C++SHPIP T DSHS Q+I
Sbjct  264   DSGRAMGVKSEGQTATAKFVVGDASYFPSKVQRTSRVVRALCVLSHPIPSTGDSHSVQLI  323

Query  514   LPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIF  335
             LPQKQ+GR+SD+Y+FCCSY+H+VAPK K++AFVST  ET DP  EL  G+ LLG +DE F
Sbjct  324   LPQKQVGRRSDIYVFCCSYSHHVAPKDKWLAFVSTTVETTDPTAELAAGLQLLGKIDEKF  383

Query  334   YETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLS  179
              E  D F P      D CFIS  YDA++HFE+ + DVL+MY +ITGK +DLS
Sbjct  384   VEVVDVFEPLESGQRDGCFISRGYDATSHFETEIEDVLDMYLRITGKVLDLS  435



>ref|XP_001694920.1| rab GDP dissociation inhibitor protein [Chlamydomonas reinhardtii]
 gb|EDP02072.1| rab GDP dissociation inhibitor protein [Chlamydomonas reinhardtii]
Length=442

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/411 (63%), Positives = 322/411 (78%), Gaps = 2/411 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SVD  KVLH+D+N+YYGGES+SL+LIQL++RFR    PP  LG S++YNVDM+PKFM+AN
Sbjct  24    SVDKKKVLHVDRNNYYGGESASLNLIQLFERFRAGAAPPPSLGPSRDYNVDMVPKFMLAN  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LVRVL+HTDV KYL FKAVDGS+V  KGKI+KVPA D EAL+S LMGLFEKRR R FF
Sbjct  84    GKLVRVLLHTDVVKYLEFKAVDGSYVLQKGKIHKVPANDSEALRSPLMGLFEKRRARNFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             LYVQ+++ESDPKTH+G+DLN +T  +    Y+L +DT DFIGH+LALH DD YL Q A+ 
Sbjct  144   LYVQDYDESDPKTHKGLDLNRMTMAELYKHYDLTEDTQDFIGHALALHRDDAYLTQSAMP  203

Query  868   FVKKVKLYAESLARFQS-GSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
              V ++KLY ESL R++   SPY+YP YGLGELPQAFARLSAVYGGTYMLN+P  +V +++
Sbjct  204   TVLRIKLYHESLFRYEGLNSPYLYPRYGLGELPQAFARLSAVYGGTYMLNQPAVEVLYEN  263

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              G A G+ +  + A+ K VV DP+Y  DKV  VGKV RA+ IM+HPIP+T+++HS Q+IL
Sbjct  264   -GVAVGIKNGADVARAKLVVGDPSYFPDKVRVVGKVVRAIAIMNHPIPNTDNAHSVQIIL  322

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQKQ GRKSDMY+FCCSY HNVA K K++AFVST  ET +PE EL  G+ LLGPV+E + 
Sbjct  323   PQKQTGRKSDMYVFCCSYAHNVAAKDKWLAFVSTTMETANPEAELSAGMALLGPVEEKYI  382

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLS  179
             E  D   P +D T D  FIS  YDA+THFE+TV DVL+MY +ITG+ +DL+
Sbjct  383   EVRDICEPLDDGTKDQAFISKGYDATTHFETTVDDVLDMYRRITGRDLDLT  433



>ref|XP_010101319.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
 gb|EXB88266.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
Length=334

 Score =   512 bits (1318),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 237/309 (77%), Positives = 273/309 (88%), Gaps = 0/309 (0%)
 Frame = -1

Query  1072  KRRVRKFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDN  893
             KRR RKFF+YVQ+++E+DPKTH G DL  +T ++ ++KY L+D T+DFIGH++ALH DD 
Sbjct  26    KRRARKFFIYVQDYDENDPKTHDGFDLTRVTTRELVSKYGLDDKTLDFIGHAIALHRDDR  85

Query  892   YLAQPAIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQ  713
             YL +PA++ VK++KLYAES+ARFQ GSPYIYP+YGLGELPQAFARLSAVYGGT MLNKP+
Sbjct  86    YLNEPALDTVKRMKLYAESVARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTCMLNKPE  145

Query  712   CKVEFDDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDS  533
             CKVEF++ GK  GVTSEGETA+CKKVVCDP+YL +KV KVGKVARA+ IMSHPIP+TNDS
Sbjct  146   CKVEFNEEGKVIGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNDS  205

Query  532   HSAQVILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLG  353
             HS QVILPQKQLGR SDMYLFCCSY+HNVAPKGK+IAFVSTEAETD+PETELKPG DLLG
Sbjct  206   HSVQVILPQKQLGRISDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPETELKPGTDLLG  265

Query  352   PVDEIFYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVD  173
             PVDEIFY+ YDR+ P N+ T DNCFIS SYDA+THFESTV DVL MYT ITGK VDLSVD
Sbjct  266   PVDEIFYDMYDRYEPVNEPTLDNCFISTSYDATTHFESTVIDVLNMYTLITGKVVDLSVD  325

Query  172   LSAASAGGE  146
             LSAASA  E
Sbjct  326   LSAASAAEE  334



>ref|XP_006373016.1| hypothetical protein POPTR_0017s07190g [Populus trichocarpa]
 gb|ERP50813.1| hypothetical protein POPTR_0017s07190g [Populus trichocarpa]
Length=385

 Score =   496 bits (1278),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 257/432 (59%), Positives = 306/432 (71%), Gaps = 84/432 (19%)
 Frame = -1

Query  1405  VDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMANG  1226
             VDGLKVLHMD+NDYY GES+SL+L QLWK F+G++QPPE LGASKEYN+DMIPKF++AN 
Sbjct  26    VDGLKVLHMDRNDYYEGESTSLNLNQLWKCFKGSNQPPESLGASKEYNIDMIPKFIIAND  85

Query  1225  TLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFFL  1046
              LVR+LIHT VTK L FK+VDG+FVYNKGKI+KVPATD+EALK  LMGLFEK R RKFF+
Sbjct  86    GLVRILIHTYVTKCLNFKSVDGTFVYNKGKIHKVPATDIEALKLPLMGLFEKCRARKFFI  145

Query  1045  YVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIEF  866
             YVQ++E++DPK+++G+DL  +TA+                              +PA++F
Sbjct  146   YVQDYEDNDPKSYEGLDLTKVTAR------------------------------EPALDF  175

Query  865   VKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDSG  686
             VK+VKLYAES ARFQ GSPYIYP+YGL     +FARLSA+YGGTY+LNKP+ K+EFD + 
Sbjct  176   VKRVKLYAESFARFQGGSPYIYPLYGL-----SFARLSAIYGGTYILNKPEYKIEFDKNR  230

Query  685   KAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILPQ  506
             K  GV SEGET +CKKVVC+ +YL +K  KVG VA A+CIMSHPIPDT+DSHSAQVILPQ
Sbjct  231   KVIGVISEGETTRCKKVVCNSSYLPNK--KVGMVAHAICIMSHPIPDTSDSHSAQVILPQ  288

Query  505   KQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYET  326
             K        YLFCCSY HNVAPK KYI FVSTE E D+PETELK G+DLL          
Sbjct  289   K--------YLFCCSYAHNVAPKRKYITFVSTETEIDNPETELKLGIDLL----------  330

Query  325   YDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGK------------TVDL  182
                              S SYD +THFE+TV+DV+ MY+KITGK            T DL
Sbjct  331   -----------------SLSYDTTTHFETTVQDVIAMYSKITGKQSTYNLVFVLIQTFDL  373

Query  181   SVDLSAASAGGE  146
             SVDLS  SA  E
Sbjct  374   SVDLSVVSATAE  385



>ref|XP_002739493.1| PREDICTED: rab GDP dissociation inhibitor beta-like [Saccoglossus 
kowalevskii]
Length=444

 Score =   498 bits (1282),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 237/413 (57%), Positives = 317/413 (77%), Gaps = 4/413 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLS-LIQLWKRF-RGTDQPPEQLGASKEYNVDMIPKFMM  1235
             SV+G KVLHMD+N YYGGES+SL+ L +L+++F    +  PE  G  +++NVD+IPKF+M
Sbjct  24    SVNGRKVLHMDRNKYYGGESASLTPLSELYEKFGLKAEDVPESFGRQRDWNVDLIPKFLM  83

Query  1234  ANGTLVRVLIHTDVTKYLTFKAVDGSFVYNKG-KIYKVPATDVEALKSSLMGLFEKRRVR  1058
             ANG LV++LIH+ VTKYL FK +DGS+VY KG KIYKVPA + EAL +SLMG+FEKRR R
Sbjct  84    ANGQLVKLLIHSGVTKYLEFKTLDGSYVYKKGDKIYKVPADEKEALSTSLMGIFEKRRYR  143

Query  1057  KFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQP  878
             KF +YV +F+ +DPKT+ G+D    T++D   K+ L+D+T DF GH+LALH DD+Y  + 
Sbjct  144   KFLIYVNDFDINDPKTYHGIDPKTATSQDLYHKHGLDDNTADFTGHALALHRDDSYKQEN  203

Query  877   AIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEF  698
              ++ ++++KLY+ SL+R+   SPY+YP+YGLGELPQ FARLSA+YGGTYML+KP   + +
Sbjct  204   VLDTIERIKLYSSSLSRY-GKSPYLYPLYGLGELPQGFARLSAIYGGTYMLDKPIEAIVY  262

Query  697   DDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQV  518
             DD+G+  GVTS GETAKCK VVCDPTY+ DKV KV +V RA+CIM+HPIP TND+ S Q+
Sbjct  263   DDNGEVCGVTSGGETAKCKTVVCDPTYVKDKVKKVAQVVRAICIMNHPIPRTNDNSSCQI  322

Query  517   ILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEI  338
             I+PQ Q+GRKSD+Y+ C S TH VA KG YIA VST  ETD+PE EL+PG+DLLGP+ + 
Sbjct  323   IIPQNQVGRKSDIYVSCVSSTHCVAVKGFYIAMVSTTVETDNPEAELQPGLDLLGPLKQK  382

Query  337   FYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLS  179
             F    D  VP +D      F++ SYDA+THFE+T  D+L+++T++TG+  D S
Sbjct  383   FVSVSDILVPIDDGKKSKVFVTTSYDATTHFETTCSDILDVWTRMTGEEFDFS  435



>ref|NP_001018444.1| rab GDP dissociation inhibitor alpha [Danio rerio]
 gb|AAH95329.1| GDP dissociation inhibitor 1 [Danio rerio]
 gb|AAI64533.1| Gdi1 protein [Danio rerio]
Length=447

 Score =   498 bits (1281),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 229/410 (56%), Positives = 313/410 (76%), Gaps = 3/410 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLS-LIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMA  1232
             SV+G KVLHMD+N YYGGESSS++ L +L+KRF  +D PPE +G  +++NVD+IPKF+MA
Sbjct  24    SVNGKKVLHMDRNPYYGGESSSITPLEELYKRFGISDSPPESMGRGRDWNVDLIPKFLMA  83

Query  1231  NGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKF  1052
             NG LV++L++T+VT+YL FK V+GSFVY  GKIYKVP+T+ EAL S+LMG+FEKRR RKF
Sbjct  84    NGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKF  143

Query  1051  FLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAI  872
              ++V  F+E+DPKT +G+D    T  +   K++L  D IDF GH+LAL+  D+YL QP +
Sbjct  144   LVFVANFDENDPKTFEGVDPKLTTMGEVYKKFDLGQDVIDFTGHALALYRTDDYLEQPCL  203

Query  871   EFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
             E + ++KLY+ESLAR+   SPY+YP+YGLGELPQ FARLSA+YGGTYMLNKP  ++   +
Sbjct  204   ETINRIKLYSESLARY-GKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDEIVM-E  261

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              G   GV SEGE A+CK+++CDP+Y+ ++VHKVG+V R +C++SHPI +TND++S Q+I+
Sbjct  262   GGHVVGVKSEGEVARCKQLICDPSYIPERVHKVGQVVRVICVLSHPIKNTNDANSCQIII  321

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQ Q+ RKSD+Y+   SY HNVA +GKYIA VST  ET DPE E++P ++LL P+D+ F 
Sbjct  322   PQNQVNRKSDIYVCMISYAHNVAAQGKYIAIVSTTVETSDPEAEIEPALELLEPIDQKFV  381

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDL  182
                D + PT+D T    F S SYDA+THFE+T  D+ ++Y ++TG   D 
Sbjct  382   AISDMYEPTDDGTESQVFASRSYDATTHFETTCNDIKDIYKRMTGSDFDF  431



>ref|XP_002599716.1| hypothetical protein BRAFLDRAFT_131482 [Branchiostoma floridae]
 emb|CAB46230.1| rab GDP-dissociation inhibitor [Branchiostoma floridae]
 gb|EEN55728.1| hypothetical protein BRAFLDRAFT_131482 [Branchiostoma floridae]
Length=446

 Score =   497 bits (1280),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 315/413 (76%), Gaps = 5/413 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLS-LIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMA  1232
             SV G KVLHMD+N YYGGES+S++ L +L+++F G   PPE +G  +++NVD+IPKF+MA
Sbjct  24    SVSGKKVLHMDRNKYYGGESASITPLEELYEKF-GLGSPPESMGRGRDWNVDLIPKFLMA  82

Query  1231  NGTLVRVLIHTDVTKYLTFKAVDGSFVYNKG--KIYKVPATDVEALKSSLMGLFEKRRVR  1058
             NG LV++LIH+ VT+YL FK+ +GS+VY  G  KI+KVP T+ EAL +SLMG+FEKRR R
Sbjct  83    NGMLVKLLIHSGVTRYLEFKSCEGSYVYKSGGNKIHKVPVTEKEALSTSLMGMFEKRRYR  142

Query  1057  KFFLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQP  878
             KF ++V + +ES+PKTH  +D+   T ++  T + L+++T DF GH+LAL  DDNY  Q 
Sbjct  143   KFLMWVNDIDESNPKTHGDIDIGKATMQEVYTHFGLDENTADFTGHALALWRDDNYKQQS  202

Query  877   AIEFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEF  698
              I+ ++++KLY+ESLAR+   +PY+YP+YGLGELPQ FARLSA+YGGTYML+KP+CK+ F
Sbjct  203   CIDTIRRIKLYSESLARYGK-TPYLYPLYGLGELPQGFARLSAIYGGTYMLDKPECKIHF  261

Query  697   DDSGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQV  518
             D++GK  GV S+GETAKC  VVCDP Y  DKV KVG+V R +CI+SHP+P+T DS S Q+
Sbjct  262   DENGKVTGVESDGETAKCSAVVCDPGYAGDKVKKVGQVVRCICILSHPVPNTKDSLSCQL  321

Query  517   ILPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEI  338
             I+PQ Q+ RKSD+Y+ C S+ HNVA KGK++A  ST  ETD+PE ELKP ++LLGP+D+ 
Sbjct  322   IIPQNQVDRKSDIYVCCVSHAHNVASKGKFLAICSTTVETDNPEAELKPALNLLGPIDQK  381

Query  337   FYETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLS  179
             F    D + P  D T    F+S++YDA+THFE+T  D+L++Y + TG+  D +
Sbjct  382   FVSVSDLYEPIEDGTNSKLFVSSTYDATTHFETTCLDILDIYKRYTGEEFDFT  434



>emb|CDQ72013.1| unnamed protein product [Oncorhynchus mykiss]
Length=447

 Score =   497 bits (1279),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/410 (56%), Positives = 313/410 (76%), Gaps = 3/410 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLS-LIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMA  1232
             SV+G KVLHMD+N YYGGESSS++ L +L+KRF   D PPE +G  +++NVD+IPKF+MA
Sbjct  24    SVNGKKVLHMDRNPYYGGESSSITPLEELYKRFELPDSPPESMGRGRDWNVDLIPKFLMA  83

Query  1231  NGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKF  1052
             NG LV++L++T+VT+YL FK V+GSFVY  GKIYKVP+T+ EAL S+LMG+FEKRR RKF
Sbjct  84    NGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKF  143

Query  1051  FLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAI  872
              ++V  F+E+DPKT +G+D    T +D   K++L  D IDF GH+LAL+  D+YL  P +
Sbjct  144   LVFVANFDENDPKTFEGVDPKVTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDVPCL  203

Query  871   EFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
             E + ++KLY+ESLAR+   SPY+YP+YGLGELPQ FARLSA+YGGTYMLNKP  ++  +D
Sbjct  204   ETINRIKLYSESLARY-GKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVEEIVMED  262

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              G   GV SEGE A+CK+++CDP+Y+ D+V K G+V R +CI+SHPI DTND++S Q+I+
Sbjct  263   -GHVVGVKSEGEVARCKQLICDPSYIQDRVRKAGQVIRVICILSHPIKDTNDANSCQIII  321

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQ Q+ RKSD+Y+   SY HNVA +GKYIA VST  ET++PE E++P ++LL P+D+ F 
Sbjct  322   PQNQVNRKSDIYVCMISYAHNVAAQGKYIAIVSTTVETNEPEAEIEPALELLEPIDQKFV  381

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDL  182
                D + PT+D T    F S++YDA+THFE+T  D+ ++Y ++TG   D 
Sbjct  382   SLSDLYEPTDDGTESQIFASSAYDATTHFETTCNDIKDIYKRMTGSDFDF  431



>ref|XP_005162229.1| PREDICTED: rab GDP dissociation inhibitor alpha isoform X1 [Danio 
rerio]
Length=447

 Score =   496 bits (1278),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 228/410 (56%), Positives = 313/410 (76%), Gaps = 3/410 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLS-LIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMA  1232
             SV+G KVLHMD+N YYGGESSS++ L +L+KRF  +D PPE +G  +++NVD+IPKF+MA
Sbjct  24    SVNGKKVLHMDRNPYYGGESSSITPLEELYKRFGISDSPPESMGRGRDWNVDLIPKFLMA  83

Query  1231  NGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKF  1052
             NG LV++L++T+VT+YL FK V+GSFVY  GKIYKVP+T+ EAL S+LMG+FEKRR RKF
Sbjct  84    NGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKF  143

Query  1051  FLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAI  872
              ++V  F+E+DPKT +G+D    T  +   K++L  D IDF GH+LAL+  D+YL QP +
Sbjct  144   LVFVANFDENDPKTFEGVDPKLTTMGEVYKKFDLGQDVIDFTGHALALYRTDDYLEQPCL  203

Query  871   EFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
             E + ++KLY+ESLAR+   SPY+YP+YGLGELPQ FARLSA+YGGTYMLNKP  ++   +
Sbjct  204   ETINRIKLYSESLARY-GKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDEIVM-E  261

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              G   GV SEG+ A+CK+++CDP+Y+ ++VHKVG+V R +C++SHPI +TND++S Q+I+
Sbjct  262   GGHVVGVKSEGQVARCKQLICDPSYIPERVHKVGQVVRVICVLSHPIKNTNDANSCQIII  321

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQ Q+ RKSD+Y+   SY HNVA +GKYIA VST  ET DPE E++P ++LL P+D+ F 
Sbjct  322   PQNQVNRKSDIYVCMISYAHNVAAQGKYIAIVSTTVETSDPEAEIEPALELLEPIDQKFV  381

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDL  182
                D + PT+D T    F S SYDA+THFE+T  D+ ++Y ++TG   D 
Sbjct  382   AISDMYEPTDDGTESQVFASRSYDATTHFETTCNDIKDIYKRMTGSDFDF  431



>gb|ADF97610.1| GDP dissociation inhibitor 2 [Hypophthalmichthys molitrix]
Length=448

 Score =   496 bits (1276),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 230/411 (56%), Positives = 313/411 (76%), Gaps = 3/411 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQ-LWKRFRGTDQPPEQLGASKEYNVDMIPKFMMA  1232
             SV G KVLHMD+N YYGGES+S++ ++ L+KRF     PPE +G  +++NVD+IPKF+MA
Sbjct  24    SVKGKKVLHMDRNSYYGGESASITPLEDLYKRFSLPGSPPESMGKGRDWNVDLIPKFLMA  83

Query  1231  NGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKF  1052
             NG LVR+L+ T VT+YL FK ++GSFVY KG IYKVP+T+ EAL SSLMGLFEKRR RKF
Sbjct  84    NGQLVRMLLITQVTRYLDFKVIEGSFVYKKGSIYKVPSTETEALASSLMGLFEKRRFRKF  143

Query  1051  FLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAI  872
              ++V  F+E+DPKT +G+D    T +D   K++L  D +DF GH+LAL+  D+YL QP I
Sbjct  144   LVFVANFDENDPKTLEGVDPKKTTMRDVYKKFDLGQDVVDFTGHALALYRTDDYLDQPCI  203

Query  871   EFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
             E + ++KLY+ESLAR+   SPY+YP+YGLGELPQ FARLSA+YGGTYMLNKP  ++  ++
Sbjct  204   ETINRIKLYSESLARY-GKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIVVEN  262

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              GK  GV SEGE A+CK+++CDP+Y+ D+V+KVG+V R +CIMSHPI +T+D++S Q+I+
Sbjct  263   -GKVVGVKSEGEIARCKQLICDPSYVMDRVNKVGQVIRVICIMSHPIKNTSDANSCQIII  321

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQ Q+ RK D+Y+   SY HNVA +GKY+A VST  ET+DPE E+KP +DLL PV++ F 
Sbjct  322   PQNQVNRKHDIYVCMISYAHNVAAQGKYVAIVSTTVETNDPEKEIKPALDLLEPVEQKFV  381

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLS  179
                D++ PT+  +    FIS SYDA+THFE+T  D+ ++Y ++TG   D +
Sbjct  382   SISDQYAPTDLGSDSQVFISRSYDATTHFETTCDDIKDIYKRMTGTEFDFA  432



>dbj|GAM18823.1| hypothetical protein SAMD00019534_019980 [Acytostelium subglobosum 
LB1]
Length=445

 Score =   495 bits (1275),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 235/422 (56%), Positives = 314/422 (74%), Gaps = 2/422 (0%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMAN  1229
             SV+G +VLHMD+N YYGGES+SL+L Q++++FR   +P E LG+ ++YN+D++PKF++A+
Sbjct  24    SVEGKRVLHMDRNSYYGGESASLNLQQMYEKFRNGAKPSETLGSYRDYNIDLVPKFILAS  83

Query  1228  GTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKFF  1049
             G LV++L+HTDVT+YL FK VDGSFVY   KI+KVPATD EAL S LMG FEK   +KFF
Sbjct  84    GLLVKMLLHTDVTRYLDFKVVDGSFVYKTPKIHKVPATDSEALSSPLMGFFEKFSCKKFF  143

Query  1048  LYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAIE  869
             +YVQ FEE  P TH+ +DL  +T K    K+ L++DTIDFIGHSLALH +D YL +PA++
Sbjct  144   VYVQNFEEDKPATHENLDLKKMTMKQLFAKFGLKEDTIDFIGHSLALHLNDEYLEKPALD  203

Query  868   FVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDDS  689
              V K+KLYA+SLAR+ S SPYIYP+YGLGELPQAFARLSA+YGGTYMLNKP  KV   + 
Sbjct  204   TVLKIKLYADSLARY-SHSPYIYPLYGLGELPQAFARLSAIYGGTYMLNKPIDKVYRGED  262

Query  688   GKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVILP  509
             GK   V S+GETA C  V+ DP+Y  DKV   GK+ R++CI++ PIP+TN+S S Q+I+P
Sbjct  263   GKM-RVESQGETATCDYVIADPSYFPDKVKVTGKIIRSICILNAPIPNTNNSESVQIIIP  321

Query  508   QKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFYE  329
             QKQ+GRK+D+Y+   S+ HNV  KGKYIA  ST  ET+DPE EL+P   LLGP+ E F  
Sbjct  322   QKQVGRKNDIYVGEISFAHNVCAKGKYIAICSTTVETNDPEKELEPAYKLLGPIVEKFIT  381

Query  328   TYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSVDLSAASAGG  149
               + + P  D   DN ++S SYDA++HFE+T +D++++Y ++  K + L  +      GG
Sbjct  382   VSNYYEPIADGCNDNIYLSESYDATSHFETTCQDIMDIYKRVLKKDLVLITNRKTQQQGG  441

Query  148   EQ  143
             E+
Sbjct  442   EE  443



>ref|XP_647506.1| Rab GDP dissociation inhibitor alpha [Dictyostelium discoideum 
AX4]
 gb|EAL73470.1| Rab GDP dissociation inhibitor alpha [Dictyostelium discoideum 
AX4]
Length=454

 Score =   495 bits (1274),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 237/413 (57%), Positives = 311/413 (75%), Gaps = 3/413 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQLWKRFRGTDQ-PPEQLGASKEYNVDMIPKFMMA  1232
             SVDG KVLHMD+N YYGGES+SL++ QLW++  G ++  PE LG+S++YNVD+IPKF+++
Sbjct  24    SVDGKKVLHMDRNGYYGGESASLNMNQLWEKSHGKEKKAPETLGSSRDYNVDLIPKFILS  83

Query  1231  NGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKF  1052
             +G LV++L+HTDVT+YL FK VDGS+VY+ GKI KVP+TD EAL SSL+GL +K  +RKF
Sbjct  84    SGLLVKMLLHTDVTRYLDFKVVDGSYVYSSGKINKVPSTDTEALTSSLVGLLDKLPLRKF  143

Query  1051  FLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAI  872
             F++VQ +EE++P TH G++L   T      KY L ++ +DFIGH+LAL+ DD+YL QPA 
Sbjct  144   FIFVQNYEENNPATHDGLNLKITTMDALFKKYGLRENIVDFIGHALALYLDDSYLQQPAH  203

Query  871   EFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
             + + ++KLYA+SLAR+ S SPYIYP+YGLGELPQAFARLSA+YGGTYMLNKP   + FD+
Sbjct  204   DTIMRMKLYADSLARY-SKSPYIYPLYGLGELPQAFARLSAIYGGTYMLNKPIENIVFDE  262

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDS-HSAQVI  515
               K   VTSEGET  C K+VCDP+Y  +KV K GK+ R++CI++ PIP  +    S Q+I
Sbjct  263   EKKIIKVTSEGETVTCDKIVCDPSYFPNKVQKKGKIIRSICILNGPIPSADKKFESLQII  322

Query  514   LPQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIF  335
             +PQKQ+ R+SDMY+   S  H V PKGKYIA VS   ET++PE EL P   LLGP+ E F
Sbjct  323   IPQKQVKRQSDMYVGVMSSAHCVCPKGKYIAIVSATVETNEPEKELAPAYALLGPIQEKF  382

Query  334   YETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLSV  176
                 D   P  D TADN FIS SYDA++HFE+T  DV++MY +ITGK + L+V
Sbjct  383   VYISDFIEPIADGTADNVFISKSYDATSHFETTCEDVMDMYKRITGKDLVLTV  435



>gb|AAQ91240.1| GDP dissociation inhibitor 2 [Danio rerio]
 gb|AAH73176.1| Gdi2 protein [Danio rerio]
Length=448

 Score =   494 bits (1273),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 231/411 (56%), Positives = 312/411 (76%), Gaps = 3/411 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLSLIQ-LWKRFRGTDQPPEQLGASKEYNVDMIPKFMMA  1232
             SV G KVLHMD+N YYGGES+S++ ++ L+KRF     PPE +G  +++NVD+IPKF+MA
Sbjct  24    SVKGKKVLHMDRNSYYGGESASITPLEDLFKRFSLPGSPPESMGKGRDWNVDLIPKFLMA  83

Query  1231  NGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKF  1052
             NG LVR+L+ T VT+YL FK ++GSFVY KG IYKVP+T+ EAL SSLMGLFEKRR RKF
Sbjct  84    NGQLVRMLLITQVTRYLDFKVIEGSFVYKKGSIYKVPSTETEALASSLMGLFEKRRFRKF  143

Query  1051  FLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAI  872
              ++V  F+E+DPKT +G+D    T +D   K++L  D IDF GH+LAL+  D+YL QP I
Sbjct  144   LVFVANFDENDPKTMEGVDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCI  203

Query  871   EFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
             E + ++KLY+ESLAR+   SPY+YP+YGLGELPQ FARLSA+YGGTYMLNKP  ++  ++
Sbjct  204   ETINRIKLYSESLARY-GKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIVIEN  262

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              GK  GV SEGE A+CK+++CDP+Y+ D+V+KVG+V R +CI+SHPI +T+D++S Q+I+
Sbjct  263   -GKVVGVKSEGEIARCKQLICDPSYIKDRVNKVGQVIRVICILSHPIKNTSDANSCQIII  321

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQ Q+ RK D+Y+   SY HNVA +GKYIA VST  ET+DPE E+KP +DLL PV++ F 
Sbjct  322   PQNQVNRKHDIYVCMISYAHNVAAQGKYIAIVSTTVETNDPEKEIKPALDLLEPVEQKFV  381

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDLS  179
                D + PT+  +    FIS SYDA+THFE+T  D+ ++Y ++TG   D +
Sbjct  382   SISDLYSPTDVGSDSQIFISRSYDATTHFETTCDDIKDIYKRMTGTEFDFA  432



>ref|XP_005811145.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Xiphophorus maculatus]
Length=447

 Score =   494 bits (1272),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 229/410 (56%), Positives = 310/410 (76%), Gaps = 3/410 (1%)
 Frame = -1

Query  1408  SVDGLKVLHMDKNDYYGGESSSLS-LIQLWKRFRGTDQPPEQLGASKEYNVDMIPKFMMA  1232
             SV+G KVLHMD+N YYGGESSS++ L +L+KRF   D PPE +G  +++NVD+IPKF+MA
Sbjct  24    SVNGKKVLHMDRNPYYGGESSSITPLEELYKRFTLPDSPPESMGRGRDWNVDLIPKFLMA  83

Query  1231  NGTLVRVLIHTDVTKYLTFKAVDGSFVYNKGKIYKVPATDVEALKSSLMGLFEKRRVRKF  1052
             NG LV++L++T+VT+YL FK V+GSFVY  GKIYKVP+T+ EAL S+LMG+FEKRR RKF
Sbjct  84    NGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKF  143

Query  1051  FLYVQEFEESDPKTHQGMDLNAITAKDFITKYELEDDTIDFIGHSLALHTDDNYLAQPAI  872
              ++V  F+E+DPKT +G+D    T +D   K++L  D IDF GH+LAL+  D+YL  P +
Sbjct  144   LVFVANFDENDPKTFEGVDPKTTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDVPCL  203

Query  871   EFVKKVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAVYGGTYMLNKPQCKVEFDD  692
             E + ++KLY+ESLAR+   SPY+YP+YGLGELPQ FARLSA+YGGTYMLNKP  ++   D
Sbjct  204   ETINRIKLYSESLARY-GKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDEIVM-D  261

Query  691   SGKAYGVTSEGETAKCKKVVCDPTYLTDKVHKVGKVARAVCIMSHPIPDTNDSHSAQVIL  512
              GK  GV SEGE A+CK+++CDP+Y+ D+V K G+V R +CI+SHPI +TND++S Q+I+
Sbjct  262   GGKVIGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRVICILSHPIKNTNDANSCQIII  321

Query  511   PQKQLGRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDDPETELKPGVDLLGPVDEIFY  332
             PQ Q+ R SD+Y+   SY HNVA +GKYIA VST  ET +PE E++P ++LL P+D+ F 
Sbjct  322   PQNQVNRNSDIYVCMISYAHNVAAQGKYIAIVSTTVETSEPEAEIEPALELLEPIDQKFV  381

Query  331   ETYDRFVPTNDCTADNCFISNSYDASTHFESTVRDVLEMYTKITGKTVDL  182
                D + PT+D T    F S SYDA+THFE+T  D+ ++Y ++TG   D 
Sbjct  382   AISDLYEPTDDGTESQVFASRSYDATTHFETTCNDIKDIYKRMTGTDFDF  431



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3756859799544