BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18562_g1_i2 len=1011 path=[991:0-174 1166:175-175 1167:176-778
1770:779-1010]

Length=1011
                                                                      Score     E

gb|KDP45740.1|  hypothetical protein JCGZ_17347                         145   1e-37   
ref|XP_009369559.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...    144   4e-37   
emb|CBI15893.3|  unnamed protein product                                138   2e-36   
ref|XP_008384739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...    142   2e-36   
ref|XP_002274679.2|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     142   2e-36   Vitis vinifera
ref|XP_002298500.1|  CONSTANS-like family protein                       141   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_004294775.1|  PREDICTED: uncharacterized protein LOC101310098    142   2e-36   
ref|XP_008233500.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     141   6e-36   
ref|XP_007016977.1|  CCT motif family protein isoform 2                 140   2e-35   
ref|XP_006425148.1|  hypothetical protein CICLE_v10029146mg             139   4e-35   
ref|XP_007206389.1|  hypothetical protein PRUPE_ppa018053mg             138   9e-35   
ref|XP_008354841.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   1e-34   
ref|XP_006488582.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   2e-34   
gb|KHN40106.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                  136   2e-34   
ref|XP_003544900.2|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...    136   3e-34   
ref|XP_009354295.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   6e-34   
ref|XP_011003377.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     134   6e-34   
ref|XP_003615824.1|  Zinc finger protein CONSTANS-like protein          135   7e-34   
emb|CDP09243.1|  unnamed protein product                                132   1e-33   
ref|XP_006574444.1|  PREDICTED: uncharacterized protein LOC100803...    134   1e-33   
ref|XP_007142158.1|  hypothetical protein PHAVU_008G257300g             133   3e-33   
ref|XP_008354834.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    133   5e-33   
ref|XP_006417850.1|  hypothetical protein EUTSA_v10008808mg             131   9e-33   
ref|XP_011024893.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   3e-32   
ref|XP_009354286.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   3e-32   
emb|CDY06672.1|  BnaA10g04510D                                          129   5e-32   
ref|XP_009119001.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...    129   6e-32   
emb|CDY10244.1|  BnaC05g04870D                                          129   7e-32   
ref|XP_010099464.1|  Protein CHLOROPLAST IMPORT APPARATUS 2             129   2e-31   
gb|KDO67019.1|  hypothetical protein CISIN_1g025320mg                   128   3e-31   
ref|XP_009110963.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   4e-31   
ref|XP_006425147.1|  hypothetical protein CICLE_v10029146mg             128   4e-31   
ref|XP_007016976.1|  CCT motif family protein isoform 1                 128   5e-31   
emb|CDY66177.1|  BnaC08g46470D                                          126   6e-31   
gb|KHN46121.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                  125   2e-30   
ref|XP_006596439.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...    126   2e-30   
ref|XP_010264549.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     125   3e-30   
ref|XP_010685899.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     125   4e-30   
ref|XP_010557193.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8     124   4e-30   
ref|XP_007142159.1|  hypothetical protein PHAVU_008G257300g             123   2e-29   
gb|KFK43009.1|  hypothetical protein AALP_AA1G067400                    121   3e-29   
ref|XP_002892377.1|  predicted protein                                  119   3e-28   
ref|XP_004490653.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...    119   3e-28   
ref|XP_010457868.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    119   3e-28   
ref|XP_010487064.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    119   3e-28   
ref|NP_563778.1|  CCT motif family protein                              115   6e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006379128.1|  hypothetical protein POPTR_0009s08080g             110   1e-25   
ref|XP_010487055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   4e-25   
ref|XP_006305953.1|  hypothetical protein CARUB_v10011200mg             107   5e-24   
ref|XP_004490652.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...    108   9e-24   
ref|NP_001242642.1|  uncharacterized protein LOC100803772               106   1e-23   
gb|KFK25676.1|  hypothetical protein AALP_AA8G144900                    107   5e-23   
ref|XP_004231827.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    104   5e-22   
ref|XP_006399947.1|  hypothetical protein EUTSA_v10014044mg             103   7e-22   
gb|AAM63153.1|  unknown                                                 103   8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568300.1|  CCT motif family protein                              102   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121672.1|  PREDICTED: uncharacterized protein LOC103846490    102   1e-21   
emb|CDX69586.1|  BnaA10g19350D                                          102   2e-21   
emb|CDX70561.1|  BnaC03g06450D                                        98.6    3e-21   
ref|XP_002873661.1|  hypothetical protein ARALYDRAFT_488277             102   3e-21   
ref|XP_002961709.1|  hypothetical protein SELMODRAFT_438000             102   4e-21   
ref|XP_002964778.1|  hypothetical protein SELMODRAFT_266834             102   5e-21   
emb|CDY09849.1|  BnaC09g43120D                                          101   5e-21   
ref|XP_009125969.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.8    6e-21   
gb|KDO45660.1|  hypothetical protein CISIN_1g017778mg                   100   9e-21   
emb|CDX78575.1|  BnaA03g04870D                                        99.8    1e-20   
ref|XP_007014423.1|  Chloroplast import apparatus 2, putative iso...    100   1e-20   
ref|XP_009354303.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.2    1e-20   
ref|XP_008230480.1|  PREDICTED: uncharacterized protein LOC103329755  99.8    2e-20   
ref|XP_004507897.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...    100   2e-20   
emb|CDX85600.1|  BnaA02g02130D                                        99.4    2e-20   
ref|XP_010453557.1|  PREDICTED: uncharacterized protein LOC104735456  99.4    3e-20   
emb|CDX91067.1|  BnaC02g05300D                                        99.0    3e-20   
ref|XP_010492239.1|  PREDICTED: uncharacterized protein LOC104769672  99.4    3e-20   
gb|EYU18216.1|  hypothetical protein MIMGU_mgv1a007342mg              99.8    4e-20   
ref|XP_006447220.1|  hypothetical protein CICLE_v10015864mg           98.6    4e-20   
ref|XP_002268213.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  99.0    5e-20   Vitis vinifera
emb|CAN72725.1|  hypothetical protein VITISV_015092                   99.0    5e-20   Vitis vinifera
ref|XP_006286526.1|  hypothetical protein CARUB_v10001375mg           98.6    5e-20   
ref|XP_002520096.1|  hypothetical protein RCOM_1709850                92.4    5e-20   Ricinus communis
ref|XP_009131400.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.8    5e-20   
ref|XP_001765504.1|  predicted protein                                  100   5e-20   
ref|XP_010420071.1|  PREDICTED: uncharacterized protein LOC104705709  98.2    6e-20   
emb|CBI40095.3|  unnamed protein product                              98.6    6e-20   
ref|XP_009590839.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.2    6e-20   
ref|XP_007216840.1|  hypothetical protein PRUPE_ppa022528mg           97.8    6e-20   
gb|KDP46366.1|  hypothetical protein JCGZ_10206                       97.8    8e-20   
ref|XP_006338638.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  97.4    1e-19   
ref|XP_008223874.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  98.6    1e-19   
ref|XP_007225066.1|  hypothetical protein PRUPE_ppa018578mg           97.4    2e-19   
ref|XP_002276181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  97.1    2e-19   Vitis vinifera
ref|XP_003543009.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  97.1    3e-19   
ref|XP_009126853.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  96.7    4e-19   
emb|CAN73757.1|  hypothetical protein VITISV_026326                   97.4    4e-19   Vitis vinifera
ref|XP_010938521.1|  PREDICTED: uncharacterized protein LOC105057575  94.0    5e-19   
gb|KDP41094.1|  hypothetical protein JCGZ_03224                       96.3    5e-19   
ref|XP_008797174.1|  PREDICTED: uncharacterized protein LOC103712429  93.6    6e-19   
emb|CDY47926.1|  BnaA02g08300D                                        95.9    7e-19   
ref|XP_010483220.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  96.3    7e-19   
ref|XP_010273555.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  95.5    8e-19   
ref|XP_004145240.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.0    9e-19   
emb|CAB87776.1|  putative protein                                     94.7    9e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451861.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  96.3    1e-18   
emb|CDY42238.1|  BnaC02g11770D                                        95.1    1e-18   
ref|XP_006850881.1|  hypothetical protein AMTR_s00025p00156240        95.9    1e-18   
ref|XP_009801175.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  95.5    1e-18   
ref|XP_009602362.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  95.1    1e-18   
ref|XP_010443395.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  95.9    1e-18   
ref|XP_002268929.1|  PREDICTED: uncharacterized protein LOC100254358  93.6    2e-18   Vitis vinifera
ref|XP_006280489.1|  hypothetical protein CARUB_v10026429mg           95.1    2e-18   
ref|XP_004236986.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  95.1    2e-18   
ref|XP_002867585.1|  hypothetical protein ARALYDRAFT_354188           94.7    2e-18   
gb|KFK27272.1|  hypothetical protein AALP_AA8G360600                  95.1    2e-18   
emb|CBI17712.3|  unnamed protein product                              93.6    2e-18   
ref|XP_002864503.1|  hypothetical protein ARALYDRAFT_495815           94.7    2e-18   
ref|XP_011094103.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  94.4    2e-18   
ref|XP_002308112.2|  hypothetical protein POPTR_0006s07490g           95.5    2e-18   Populus trichocarpa [western balsam poplar]
emb|CDP15779.1|  unnamed protein product                              94.7    2e-18   
emb|CAN75558.1|  hypothetical protein VITISV_028190                   92.8    3e-18   Vitis vinifera
ref|XP_009593986.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  94.4    3e-18   
ref|XP_010031966.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.7    3e-18   
ref|NP_567737.1|  CIA2-like transcription factor                      93.6    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690879.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  94.4    3e-18   
ref|XP_010320765.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.0    4e-18   
ref|XP_006401232.1|  hypothetical protein EUTSA_v10013517mg           94.4    4e-18   
ref|XP_011010948.1|  PREDICTED: uncharacterized protein LOC105115687  92.4    4e-18   
ref|XP_001769011.1|  predicted protein                                94.7    4e-18   
ref|XP_009403041.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  94.0    4e-18   
ref|XP_004238926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.0    5e-18   
ref|XP_009410222.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  93.6    5e-18   
gb|KHG04097.1|  Zinc finger CONSTANS-LIKE 16 -like protein            93.2    7e-18   
ref|XP_002324691.2|  hypothetical protein POPTR_0018s13890g           93.6    7e-18   Populus trichocarpa [western balsam poplar]
emb|CDY52734.1|  BnaC09g53340D                                        92.8    7e-18   
emb|CDY38274.1|  BnaA10g11220D                                        92.8    7e-18   
ref|XP_006367940.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.2    7e-18   
ref|XP_001771896.1|  predicted protein                                93.6    8e-18   
ref|XP_004242804.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  93.2    8e-18   
ref|XP_011017668.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  93.6    8e-18   
ref|XP_009349161.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  90.9    8e-18   
ref|XP_009765495.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.4    1e-17   
ref|XP_002451540.1|  hypothetical protein SORBIDRAFT_04g003470        93.2    1e-17   Sorghum bicolor [broomcorn]
ref|XP_010433566.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.0    1e-17   
ref|XP_011020038.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.8    1e-17   
ref|XP_003549301.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.0    1e-17   
ref|XP_008645243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.8    2e-17   
ref|XP_009120241.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.0    2e-17   
emb|CDP00619.1|  unnamed protein product                              92.4    2e-17   
gb|AIE41596.1|  zinc finger protein CONSTANS-LIKE 5                   91.7    2e-17   
ref|XP_009383142.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.9    2e-17   
ref|XP_010111554.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           92.4    2e-17   
ref|XP_007210807.1|  hypothetical protein PRUPE_ppa017267mg           92.0    2e-17   
ref|NP_001169082.1|  uncharacterized protein LOC100382924             92.4    2e-17   Zea mays [maize]
ref|XP_010448341.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  91.3    2e-17   
ref|XP_010248760.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   90.9    2e-17   
ref|XP_006344138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.0    3e-17   
ref|XP_009777706.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  91.7    3e-17   
ref|XP_008677196.1|  PREDICTED: LOC100281423 isoform X1               91.7    4e-17   
ref|XP_006374368.1|  hypothetical protein POPTR_0015s06480g           90.9    4e-17   
ref|XP_011097346.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.7    4e-17   
ref|NP_001147813.1|  LOC100281423                                     91.7    4e-17   Zea mays [maize]
ref|XP_006362450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  90.9    4e-17   
ref|XP_008451201.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  91.3    5e-17   
ref|XP_007152761.1|  hypothetical protein PHAVU_004G157300g           90.5    5e-17   
emb|CDY04230.1|  BnaC06g25850D                                        87.8    6e-17   
ref|XP_001759088.1|  predicted protein                                91.3    6e-17   
ref|XP_006283882.1|  hypothetical protein CARUB_v10004999mg           90.1    6e-17   
ref|NP_568852.2|  chloroplast import apparatus 2 protein              90.5    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887511.1|  zinc finger (B-box type) family protein          90.1    7e-17   
ref|XP_011016373.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.5    7e-17   
gb|KDO45661.1|  hypothetical protein CISIN_1g017778mg                 89.7    7e-17   
ref|XP_007160372.1|  hypothetical protein PHAVU_002G316100g           89.7    7e-17   
ref|XP_010539413.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  90.5    9e-17   
ref|XP_009359939.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  90.1    1e-16   
ref|XP_010438814.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.4    1e-16   
ref|XP_010927568.1|  PREDICTED: uncharacterized protein LOC105049568  87.0    1e-16   
ref|XP_002526951.1|  hypothetical protein RCOM_0531220                87.8    1e-16   Ricinus communis
ref|XP_007154713.1|  hypothetical protein PHAVU_003G141200g           89.4    1e-16   
ref|XP_008799492.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  89.7    1e-16   
ref|XP_006656860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.6    1e-16   
gb|ACF84125.1|  unknown                                               87.0    1e-16   Zea mays [maize]
ref|XP_001769217.1|  predicted protein                                90.5    1e-16   
ref|XP_008811451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.7    1e-16   
ref|XP_010524282.1|  PREDICTED: uncharacterized protein LOC104802388  89.0    1e-16   
emb|CDO98435.1|  unnamed protein product                              89.7    1e-16   
ref|XP_008388630.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.7    1e-16   
ref|XP_010929359.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  89.4    1e-16   
gb|ACL53155.1|  unknown                                               85.1    2e-16   Zea mays [maize]
ref|XP_011098790.1|  PREDICTED: uncharacterized protein LOC105177...  87.8    2e-16   
gb|KDP20116.1|  hypothetical protein JCGZ_05885                       89.4    2e-16   
ref|XP_010927244.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.4    2e-16   
emb|CDY42769.1|  BnaA03g47700D                                        86.7    2e-16   
gb|AFW87599.1|  zinc finger protein CONSTANS-LIKE 16                  89.4    2e-16   
ref|NP_001149457.1|  zinc finger protein CONSTANS-LIKE 16             89.4    2e-16   Zea mays [maize]
ref|XP_009420122.1|  PREDICTED: uncharacterized protein LOC103999941  87.4    2e-16   
ref|XP_004296491.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.0    2e-16   
emb|CDY07383.1|  BnaA07g24620D                                        85.9    3e-16   
ref|XP_009137564.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.2    3e-16   
ref|XP_011076793.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  89.0    3e-16   
ref|XP_009410221.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.6    3e-16   
ref|XP_006440964.1|  hypothetical protein CICLE_v10020440mg           88.2    3e-16   
gb|KGN61175.1|  hypothetical protein Csa_2G061540                     88.6    3e-16   
ref|XP_006413244.1|  hypothetical protein EUTSA_v10025322mg           88.6    3e-16   
emb|CDX89377.1|  BnaA01g15160D                                        88.2    3e-16   
ref|XP_009627333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.6    3e-16   
ref|XP_008799931.1|  PREDICTED: uncharacterized protein LOC103714457  86.3    3e-16   
gb|ABF00989.1|  putative stress resistance-related protein            89.0    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007036519.1|  Transcription factor, putative                   88.6    3e-16   
ref|NP_001048022.1|  Os02g0731700                                     87.0    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010428333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.2    4e-16   
ref|XP_002533412.1|  transcription factor, putative                   88.2    4e-16   Ricinus communis
ref|XP_010236261.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.2    4e-16   
ref|XP_003560836.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  88.2    4e-16   
ref|XP_009371730.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   87.4    4e-16   
ref|XP_007014424.1|  Chloroplast import apparatus 2, putative iso...  87.8    5e-16   
ref|XP_003637430.1|  Zinc finger protein CONSTANS-like protein        84.0    5e-16   
gb|EEC73943.1|  hypothetical protein OsI_08813                        86.7    5e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006453246.1|  hypothetical protein CICLE_v10008308mg           88.2    5e-16   
gb|AEF12200.1|  CONSTANS-like zinc finger protein                     87.4    5e-16   
ref|XP_006829901.1|  hypothetical protein AMTR_s00073p00061640        87.4    5e-16   
ref|XP_004499509.1|  PREDICTED: uncharacterized protein LOC101500...  86.7    5e-16   
ref|XP_009340847.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    5e-16   
ref|XP_010263709.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  88.2    6e-16   
gb|KHN05568.1|  Zinc finger protein CONSTANS-LIKE 16                  85.1    6e-16   
gb|AAG52391.1|AC011915_5  putative B-box zinc finger protein; 520...  87.4    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.8    6e-16   
ref|NP_564932.1|  zinc finger protein CONSTANS-LIKE 6                 87.4    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646882.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    6e-16   
ref|XP_003530677.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    6e-16   
ref|XP_006485786.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    7e-16   
ref|XP_009105041.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    7e-16   
ref|XP_006649016.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.3    7e-16   
ref|XP_010029065.1|  PREDICTED: uncharacterized protein LOC104419187  86.7    7e-16   
ref|XP_009370323.1|  PREDICTED: uncharacterized protein LOC103959692  86.7    7e-16   
ref|XP_008363941.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    8e-16   
gb|ADK63396.1|  B-box type zinc finger protein                        85.1    8e-16   
ref|XP_007142909.1|  hypothetical protein PHAVU_007G027200g           87.0    8e-16   
ref|XP_010046933.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.0    8e-16   
ref|NP_001140584.1|  uncharacterized protein LOC100272654             87.4    8e-16   Zea mays [maize]
ref|XP_010690870.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    9e-16   
ref|XP_009139739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.7    9e-16   
ref|XP_004305701.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    9e-16   
emb|CDP16632.1|  unnamed protein product                              87.0    9e-16   
ref|NP_177528.1|  zinc finger protein CONSTANS-LIKE 7                 87.0    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888669.1|  zinc finger (B-box type) family protein          87.0    1e-15   
gb|KHG01643.1|  chloroplast import apparatus 2 -like protein          87.0    1e-15   
ref|XP_004235805.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    1e-15   
ref|XP_010415472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    1e-15   
gb|EYU38741.1|  hypothetical protein MIMGU_mgv1a008071mg              86.3    1e-15   
ref|XP_007044348.1|  B-box type zinc finger protein with CCT doma...  87.0    1e-15   
ref|XP_006391130.1|  hypothetical protein EUTSA_v10018663mg           86.7    1e-15   
gb|AEF12205.1|  CONSTANS-like zinc finger protein                     86.7    1e-15   
ref|XP_007031686.1|  CCT motif family protein, putative               85.9    1e-15   
ref|XP_006302328.1|  hypothetical protein CARUB_v10020384mg           86.7    1e-15   
ref|XP_004965182.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.7    1e-15   
ref|XP_004304686.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.9    2e-15   
ref|XP_010475457.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.8    2e-15   
ref|XP_010457869.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.4    2e-15   
ref|XP_003553886.1|  PREDICTED: uncharacterized protein LOC100811815  85.5    2e-15   
ref|XP_011072947.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   86.3    2e-15   
gb|KHG21982.1|  Zinc finger CONSTANS-LIKE 7 -like protein             85.5    2e-15   
dbj|BAD15937.1|  zinc finger protein-like                             86.7    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751672.1|  predicted protein                                86.7    2e-15   
gb|AHI45078.1|  COL domain class transcription factor                 86.3    2e-15   
ref|XP_010487070.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.4    2e-15   
ref|NP_001278940.1|  zinc finger protein CONSTANS-LIKE 16-like        86.3    2e-15   
ref|XP_010103762.1|  Zinc finger protein CONSTANS-LIKE 16             86.3    2e-15   
gb|AAM61001.1|  putative B-box zinc finger protein                    85.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KHG17662.1|  Zinc finger CONSTANS-LIKE 16 -like protein            85.9    2e-15   
ref|XP_008379178.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   85.1    2e-15   
ref|XP_006341612.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.9    3e-15   
gb|AFX73409.1|  constans-like protein 5                               85.9    3e-15   
ref|XP_009127638.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   85.5    3e-15   
gb|KEH44219.1|  zinc finger constans-like protein                     85.9    3e-15   
gb|ACX42573.1|  CONSTANS-like zinc finger protein                     85.1    3e-15   Glycine max [soybeans]
dbj|BAJ92256.1|  predicted protein                                    85.9    3e-15   
ref|XP_002282578.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  85.9    3e-15   Vitis vinifera
ref|XP_010265147.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.9    3e-15   
emb|CDY44890.1|  BnaA02g13920D                                        85.5    3e-15   
ref|XP_007140857.1|  hypothetical protein PHAVU_008G147400g           84.7    3e-15   
emb|CDX92740.1|  BnaC07g39980D                                        85.5    3e-15   
emb|CDX81527.1|  BnaC02g18310D                                        85.5    3e-15   
ref|XP_010470801.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.5    3e-15   
ref|XP_003525256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.7    4e-15   
ref|XP_004164409.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.0    4e-15   
gb|EYU45446.1|  hypothetical protein MIMGU_mgv1a026677mg              84.7    5e-15   
ref|XP_004497095.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.1    6e-15   
emb|CDY65591.1|  BnaC05g50730D                                        84.0    6e-15   
ref|XP_010471465.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   84.7    6e-15   
ref|XP_008646195.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.1    6e-15   
ref|XP_008811450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.7    6e-15   
ref|XP_009126854.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.3    7e-15   
ref|XP_002315940.1|  Zinc finger protein CONSTANS-LIKE 6              84.7    8e-15   
ref|XP_008240273.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.7    8e-15   
gb|AGI62031.1|  CONSTANS-like 7                                       83.2    8e-15   
ref|XP_010527538.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.3    8e-15   
gb|AGM20692.1|  COL6-2                                                84.3    8e-15   
emb|CDY67920.1|  BnaAnng25560D                                        83.6    8e-15   
gb|AFX97570.1|  K                                                     80.9    9e-15   
ref|XP_010927243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.3    9e-15   
ref|XP_009115317.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.0    1e-14   
ref|XP_003555902.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.0    1e-14   
gb|AHI45077.1|  COL domain class transcription factor                 84.3    1e-14   
ref|XP_002436824.1|  hypothetical protein SORBIDRAFT_10g009480        84.3    1e-14   
gb|KHN11420.1|  Zinc finger protein CONSTANS-LIKE 16                  84.0    1e-14   
ref|XP_009603861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.0    1e-14   
ref|NP_001239992.1|  uncharacterized protein LOC100802113             83.2    1e-14   
ref|XP_002311458.2|  zinc finger family protein                       84.3    1e-14   
ref|XP_011022115.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   84.0    1e-14   
gb|KFK36040.1|  hypothetical protein AALP_AA4G070200                  82.8    1e-14   
ref|XP_010667660.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.0    1e-14   
ref|NP_849445.1|  CIA2-like transcription factor                      83.6    1e-14   
dbj|BAK04456.1|  predicted protein                                    83.6    1e-14   
ref|XP_009360161.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.0    1e-14   
emb|CDX77359.1|  BnaC08g04040D                                        79.7    1e-14   
ref|XP_004300528.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.0    1e-14   
ref|XP_010932278.1|  PREDICTED: uncharacterized protein LOC105052987  81.6    1e-14   
gb|KGN63817.1|  hypothetical protein Csa_1G023050                     83.2    1e-14   
ref|XP_010511849.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.6    2e-14   
ref|XP_009144991.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   82.4    2e-14   
ref|XP_010500456.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.4    2e-14   
gb|AFX97569.1|  K                                                     80.1    2e-14   
gb|EYU34766.1|  hypothetical protein MIMGU_mgv1a008504mg              82.8    2e-14   
ref|XP_010323337.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.6    2e-14   
ref|XP_006302335.1|  hypothetical protein CARUB_v10020393mg           83.2    2e-14   
ref|XP_009798338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.2    2e-14   
emb|CAB39664.1|  putative protein                                     82.8    2e-14   
emb|CDY53119.1|  BnaCnng24470D                                        82.8    2e-14   
ref|XP_004142772.1|  PREDICTED: uncharacterized protein LOC101217596  82.0    2e-14   
ref|XP_004156700.1|  PREDICTED: uncharacterized LOC101217596          82.0    2e-14   
ref|XP_006468698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.2    2e-14   
emb|CDY03851.1|  BnaC07g10760D                                        82.4    2e-14   
ref|XP_010416209.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.8    2e-14   
ref|XP_009347093.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.2    2e-14   
ref|XP_008360050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.2    2e-14   
ref|XP_008389292.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.2    2e-14   
ref|XP_006401233.1|  hypothetical protein EUTSA_v10013517mg           83.2    3e-14   
ref|XP_002452605.1|  hypothetical protein SORBIDRAFT_04g028920        83.2    3e-14   
ref|XP_010551268.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.8    3e-14   
ref|XP_006448477.1|  hypothetical protein CICLE_v10015173mg           83.2    3e-14   
gb|EAZ00428.1|  hypothetical protein OsI_22452                        82.8    3e-14   
emb|CDX94392.1|  BnaC01g17920D                                        82.4    3e-14   
gb|AEF12203.1|  CONSTANS-like zinc finger protein                     82.8    3e-14   
ref|XP_003547688.2|  PREDICTED: DNA topoisomerase 1-like isoform X1   82.0    3e-14   
ref|XP_002518229.1|  CIL, putative                                    82.4    3e-14   
ref|XP_006599067.1|  PREDICTED: DNA topoisomerase 1-like isoform X2   81.6    4e-14   
ref|XP_008458850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   80.9    5e-14   
ref|XP_008453390.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  81.3    6e-14   
ref|NP_001149548.1|  CCT motif family protein                         81.6    6e-14   
ref|XP_007153446.1|  hypothetical protein PHAVU_003G036000g           81.6    6e-14   
gb|EPS64862.1|  hypothetical protein M569_09916                       76.3    6e-14   
ref|XP_006415872.1|  hypothetical protein EUTSA_v10007685mg           81.6    7e-14   
ref|XP_004512860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.6    7e-14   
gb|AGI62036.1|  CONSTANS-like 12                                      80.9    7e-14   
gb|AIE41597.1|  zinc finger protein CONSTANS-LIKE 6                   81.3    7e-14   
ref|XP_011020039.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.6    7e-14   
ref|XP_002531628.1|  conserved hypothetical protein                   81.6    7e-14   
ref|XP_001754240.1|  predicted protein                                75.5    7e-14   
ref|XP_004135402.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.3    8e-14   
ref|XP_002894160.1|  hypothetical protein ARALYDRAFT_891757           80.5    8e-14   
ref|XP_008446600.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  81.3    8e-14   
ref|XP_009356747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.6    8e-14   
ref|XP_008374747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   81.6    9e-14   
ref|XP_001769056.1|  predicted protein                                75.1    9e-14   
gb|KGN52081.1|  hypothetical protein Csa_5G609670                     81.3    9e-14   
gb|EAZ36554.1|  hypothetical protein OsJ_20892                        81.6    9e-14   
gb|EPS70097.1|  hypothetical protein M569_04667                       75.5    9e-14   
gb|KFK44524.1|  hypothetical protein AALP_AA1G267800                  81.3    9e-14   
gb|EEE59794.1|  hypothetical protein OsJ_12314                        78.2    9e-14   
ref|XP_010066724.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  81.3    1e-13   
ref|XP_006362451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.3    1e-13   
ref|XP_007222133.1|  hypothetical protein PRUPE_ppa005713mg           81.3    1e-13   
ref|XP_008802436.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.3    1e-13   
gb|AAG50803.1|AC079281_5  zinc finger protein, putative               81.3    1e-13   
ref|XP_011007901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.3    1e-13   
gb|EPS73837.1|  hypothetical protein M569_00919                       80.9    1e-13   
emb|CDY51133.1|  BnaA07g37160D                                        80.9    1e-13   
ref|NP_173915.2|  zinc finger protein CONSTANS-LIKE 16                80.9    1e-13   
ref|XP_009120242.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.9    1e-13   
ref|XP_004138344.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.3    1e-13   
gb|AAM13173.1|  unknown protein                                       80.9    1e-13   
ref|XP_008243227.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.3    1e-13   
ref|XP_010907326.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.5    1e-13   
ref|XP_004140861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.1    1e-13   
gb|AFK49208.1|  unknown                                               77.8    1e-13   
ref|XP_009103068.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.9    1e-13   
gb|EMS53816.1|  Zinc finger protein CONSTANS-LIKE 16                  79.3    1e-13   
ref|XP_008445668.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.1    1e-13   
gb|KHM99279.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                77.4    1e-13   
ref|NP_001051053.1|  Os03g0711100                                     80.9    1e-13   
gb|KDP29405.1|  hypothetical protein JCGZ_18326                       80.9    1e-13   
ref|XP_008352923.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.9    2e-13   
ref|XP_008339676.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   80.9    2e-13   
ref|XP_010916170.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.5    2e-13   
ref|XP_004299078.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.5    2e-13   
ref|XP_006305351.1|  hypothetical protein CARUB_v10009731mg           79.3    2e-13   
ref|XP_011097348.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.3    2e-13   
ref|XP_008775153.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  80.5    2e-13   
dbj|BAJ87752.1|  predicted protein                                    80.5    2e-13   
ref|XP_003610054.1|  Zinc finger protein CONSTANS-like protein        80.1    2e-13   
ref|XP_009356271.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.5    2e-13   
gb|ABF98510.1|  CCT motif family protein, expressed                   79.7    2e-13   
ref|XP_009397482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.1    2e-13   
ref|XP_003622266.1|  CONSTANS-like zinc finger protein                79.7    2e-13   
ref|XP_004953820.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.1    3e-13   
ref|XP_004953821.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.1    3e-13   
ref|XP_011007910.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.1    3e-13   
ref|XP_001752335.1|  predicted protein                                73.9    3e-13   
ref|XP_004953822.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.1    3e-13   
ref|XP_006393307.1|  hypothetical protein EUTSA_v10011633mg           79.0    3e-13   
gb|EMT27110.1|  hypothetical protein F775_43077                       79.0    3e-13   
ref|XP_007154712.1|  hypothetical protein PHAVU_003G141200g           79.3    3e-13   
ref|XP_008451210.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.7    3e-13   
ref|XP_010479338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.0    3e-13   
ref|NP_001057333.2|  Os06g0264200                                     79.7    3e-13   
ref|XP_009410076.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.7    3e-13   
ref|XP_010500455.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.0    4e-13   
ref|XP_006393308.1|  hypothetical protein EUTSA_v10011633mg           79.0    4e-13   
gb|EMS59726.1|  Zinc finger protein CONSTANS-LIKE 6                   75.9    4e-13   
ref|NP_851201.1|  chloroplast import apparatus 2 protein              79.3    5e-13   
ref|XP_001758440.1|  predicted protein                                79.0    6e-13   
ref|NP_001031160.1|  zinc finger protein CONSTANS-LIKE 8              77.8    6e-13   
ref|XP_003559520.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   79.0    6e-13   
gb|AAF69700.1|AC016041_5  F27J15.10                                   77.8    6e-13   
dbj|BAK01505.1|  predicted protein                                    79.0    6e-13   
ref|XP_009409257.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.0    6e-13   
ref|XP_003630849.1|  CONSTANS-like zinc finger protein                79.0    7e-13   
ref|XP_004499508.1|  PREDICTED: uncharacterized protein LOC101500...  77.8    7e-13   
ref|NP_175339.2|  zinc finger protein CONSTANS-LIKE 8                 77.8    7e-13   
gb|EYU29978.1|  hypothetical protein MIMGU_mgv1a007591mg              78.6    7e-13   
ref|XP_004164163.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  78.2    9e-13   
ref|XP_002890690.1|  hypothetical protein ARALYDRAFT_472829           78.6    9e-13   
ref|XP_010094760.1|  Zinc finger protein CONSTANS-LIKE 16             78.6    1e-12   
ref|XP_003573014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  78.2    1e-12   
ref|XP_010499109.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  77.8    1e-12   
ref|XP_009381448.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.8    1e-12   
ref|XP_010460379.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.8    1e-12   
ref|XP_010460378.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.8    1e-12   
ref|XP_011098789.1|  PREDICTED: uncharacterized protein LOC105177...  76.6    1e-12   
ref|XP_006307606.1|  hypothetical protein CARUB_v10009230mg           77.8    2e-12   
gb|AFK37106.1|  unknown                                               77.8    2e-12   
ref|XP_010460380.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.8    2e-12   
emb|CDY24402.1|  BnaCnng04690D                                        77.4    2e-12   
ref|XP_010477926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.4    2e-12   
ref|XP_004149511.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  77.8    2e-12   
ref|XP_009109881.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.4    2e-12   
gb|EYU26768.1|  hypothetical protein MIMGU_mgv1a006045mg              77.4    2e-12   
ref|XP_002993117.1|  hypothetical protein SELMODRAFT_136568           71.6    2e-12   
ref|NP_001045888.1|  Os02g0148000                                     77.4    2e-12   
ref|XP_010926126.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.0    2e-12   
gb|KDO61918.1|  hypothetical protein CISIN_1g0135002mg                76.6    3e-12   
ref|XP_006453244.1|  hypothetical protein CICLE_v10008308mg           77.0    3e-12   
gb|EMS51379.1|  Zinc finger protein CONSTANS-LIKE 6                   75.1    3e-12   
ref|XP_006453248.1|  hypothetical protein CICLE_v10008308mg           76.6    3e-12   
gb|KDO61917.1|  hypothetical protein CISIN_1g0135002mg                76.6    3e-12   
ref|XP_004982006.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  76.3    4e-12   
ref|XP_008801158.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  75.9    5e-12   
ref|XP_010111661.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           75.5    6e-12   
ref|XP_002466587.1|  hypothetical protein SORBIDRAFT_01g010420        75.5    9e-12   
dbj|BAK01784.1|  predicted protein                                    74.3    1e-11   
gb|KHN27582.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                72.8    1e-11   
gb|EMT01944.1|  hypothetical protein F775_21198                       74.7    1e-11   
gb|EMT12233.1|  hypothetical protein F775_25319                       71.6    1e-11   
ref|XP_010511850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  74.3    2e-11   
ref|XP_002962768.1|  hypothetical protein SELMODRAFT_141010           72.8    2e-11   
gb|EMT29986.1|  hypothetical protein F775_13638                       72.8    3e-11   
gb|EEC81257.1|  hypothetical protein OsI_24346                        73.6    5e-11   
ref|XP_003560511.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.4    9e-11   
ref|XP_010048577.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.6    2e-10   
ref|XP_001776067.1|  predicted protein                                66.2    2e-10   
dbj|BAJ85986.1|  predicted protein                                    70.1    2e-10   
ref|XP_002964550.1|  hypothetical protein SELMODRAFT_38981            65.9    3e-10   
ref|NP_001058473.1|  Os06g0699600                                     70.9    3e-10   
ref|XP_010519197.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  69.7    8e-10   
ref|XP_010519196.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  69.3    1e-09   
ref|XP_006657299.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.9    1e-09   
gb|EMS57534.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                65.9    2e-09   
gb|EEE56300.1|  hypothetical protein OsJ_05375                        67.8    4e-09   
gb|EAY84475.1|  hypothetical protein OsI_05849                        67.8    4e-09   
emb|CDY09224.1|  BnaA02g06500D                                        63.9    4e-09   
ref|XP_007037716.1|  JHL10I11.10 protein, putative isoform 2          67.0    5e-09   
ref|XP_007037715.1|  JHL10I11.10 protein, putative isoform 1          67.0    6e-09   
ref|XP_010455952.1|  PREDICTED: two-component response regulator-...  67.0    7e-09   
ref|XP_010455969.1|  PREDICTED: two-component response regulator-...  66.6    7e-09   
gb|ACF81408.1|  unknown                                               63.5    9e-09   
ref|NP_001140225.1|  uncharacterized protein LOC100272264             63.5    1e-08   
gb|AFW86339.1|  constans1                                             62.4    1e-08   
gb|ACF79190.1|  unknown                                               62.8    1e-08   
dbj|BAJ53164.1|  JHL10I11.10                                          65.9    1e-08   
dbj|BAJ83827.1|  circadian response regulator 1b                      65.9    2e-08   
ref|XP_002436860.1|  hypothetical protein SORBIDRAFT_10g010050        65.5    2e-08   
gb|AIB05333.1|  C2C2-CO-like transcription factor                     64.7    2e-08   
ref|XP_006828277.1|  hypothetical protein AMTR_s00023p00221340        65.5    2e-08   
ref|XP_008804437.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  65.1    2e-08   
ref|XP_008669218.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  64.7    3e-08   
ref|XP_008669219.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  64.7    3e-08   
ref|XP_008645244.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  65.1    3e-08   
ref|XP_007218143.1|  hypothetical protein PRUPE_ppa007290mg           64.7    3e-08   
ref|XP_004972989.1|  PREDICTED: uncharacterized protein LOC101775441  64.3    3e-08   
dbj|BAC92733.1|  Hd1-like protein                                     64.7    3e-08   
gb|ADR51712.1|  Hd1-like protein                                      64.3    3e-08   



>gb|KDP45740.1| hypothetical protein JCGZ_17347 [Jatropha curcas]
Length=238

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 87/108 (81%), Gaps = 5/108 (5%)
 Frame = +2

Query  482  HQEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEER  661
             ++ K   SLNL+LNYQ VLDAWSDR +LWA D +A S+    +N  YMGEVPVM  EE 
Sbjct  136  EKKKKESVSLNLNLNYQEVLDAWSDRGSLWANDCSA-SMA--TSNTYYMGEVPVM--EEE  190

Query  662  STRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
             TRREASVMRYKEKRQTRLFSKKIRYQVRKLNA+KRPRLKGRFV++ S
Sbjct  191  KTRREASVMRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  238



>ref|XP_009369559.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Pyrus x bretschneideri]
Length=234

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 107/264 (41%), Positives = 139/264 (53%), Gaps = 55/264 (21%)
 Frame = +2

Query  62   SPKKEEQEVPDPD-------IITCSSVVSDNHCHRESNHTVDLHHPNKDYFSSFMDDMEL  220
            SPKKEEQ+VPD           T ++ + D + + +++H VD+           MDD E 
Sbjct  9    SPKKEEQQVPDCTHNSGEEFSDTTNTKLYDVYTNGDNDHEVDI-----------MDDWER  57

Query  221  DDDGSLFAIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAYWDF----EFTSSDH  388
                              I   Q  E GK   D   +GH+      WDF    EF + + 
Sbjct  58   ------------------ILGIQEEEDGKWPSDNMYSGHKLN----WDFMDWDEFPNGEE  95

Query  389  DGGLSSVNEDSGDQKPILSqqqeqdnddde------YHQEMKMEASLNLSLNYQHVLDAW  550
            +G         G  K    ++        +      +  + + +  LNL+LNYQ VLDAW
Sbjct  96   EGEEIEQKVYQGTDKCFFEEESYYKKKVVKSESVGFWDDDDEKKVQLNLNLNYQEVLDAW  155

Query  551  SDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKK  730
            SDR +LWA D +  S+ +N N   YMGEVPVM  EE  TRREASV+RYKEKRQ+RLFSKK
Sbjct  156  SDRGSLWADDCSLSSMASNGN---YMGEVPVM--EEDKTRREASVLRYKEKRQSRLFSKK  210

Query  731  IRYQVRKLNAEKRPRLKGRFVRKA  802
            IRYQVRKLNA+KRPRLKGRFV++ 
Sbjct  211  IRYQVRKLNADKRPRLKGRFVKRV  234



>emb|CBI15893.3| unnamed protein product [Vitis vinifera]
Length=101

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 81/99 (82%), Gaps = 7/99 (7%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASV  685
            SLNL+LNYQ VL+AWSDR +LWA D  + S  N     SYMGEVPVM  EE  TRREASV
Sbjct  3    SLNLNLNYQEVLEAWSDRGSLWA-DDCSLSFKNT----SYMGEVPVM--EEEKTRREASV  55

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            +RYKEKRQTRLFSKKIRYQVRKLNA+KRPRLKGRFV++ 
Sbjct  56   LRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRV  94



>ref|XP_008384739.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Malus 
domestica]
Length=234

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 137/259 (53%), Gaps = 45/259 (17%)
 Frame = +2

Query  62   SPKKEEQEVPDPDIITCSSVVSDNHCHRESNHTVDLHHPN--KDYFSSFMDDMELDDDGS  235
            SPKKEEQ+VPD     C+   S       +N  +D  + N   D+    MDD E      
Sbjct  9    SPKKEEQQVPD-----CTHN-SGEEFSDTTNTKLDCVYTNGDNDHEVDIMDDWE-----R  57

Query  236  LFAIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAYWDF----EFTSSDHDGGLS  403
            +  I  +             E GK   D   +GH+      WDF    EF + + +G   
Sbjct  58   ILGIEEE-------------EDGKLPSDNMYSGHKLN----WDFMDWDEFPNGEEEGEEI  100

Query  404  SVNEDSGDQKPILSqqqeqdnddde------YHQEMKMEASLNLSLNYQHVLDAWSDRRT  565
                  G  K    ++        +      +  + + +  LNL+LNYQ VLDAWSDR +
Sbjct  101  EQKVYQGTNKCFFEEESYYKKKVVKSESVGFWDDDDEKKVQLNLNLNYQEVLDAWSDRGS  160

Query  566  LWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQV  745
            LWA D +  S+ +N N   YMGEVPVM  EE  TRREASV+RYKEKRQ+RLFSKKIRYQV
Sbjct  161  LWADDCSLSSMASNGN---YMGEVPVM--EEDKTRREASVLRYKEKRQSRLFSKKIRYQV  215

Query  746  RKLNAEKRPRLKGRFVRKA  802
            RKLNA+KRPRLKGRFV++ 
Sbjct  216  RKLNADKRPRLKGRFVKRV  234



>ref|XP_002274679.2| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Vitis vinifera]
Length=218

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 112/255 (44%), Positives = 134/255 (53%), Gaps = 61/255 (24%)
 Frame = +2

Query  62   SPKKEEQEVPDPDIITCSSVVSDNHCHRESNHTVDLHHPNKDYFSSFMDDMELDDDGSLF  241
            SPKKEEQ+VPD  I+T  S     + H +                  MD MEL+      
Sbjct  10   SPKKEEQQVPDT-ILTKFSDAKQVYGHED------------------MDIMELEG-----  45

Query  242  AIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAYWDF--------EFTSSDHDGG  397
             +  D  D++ I        GK +     AGH       WDF             D   G
Sbjct  46   FLGIDEEDEEKI-------PGKSMC---GAGHLN-----WDFMDWEEEFPVGEEEDEQLG  90

Query  398  LSSVNEDSGDQKPILSqqqeqdndddeYHQEMKMEASLNLSLNYQHVLDAWSDRRTLWAR  577
                NE++   K I  +     + D+      KM  SLNL+LNYQ VL+AWSDR +LWA 
Sbjct  91   EQKFNEENHYGKVIKREDFGSGDGDE------KM-MSLNLNLNYQEVLEAWSDRGSLWA-  142

Query  578  DKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLN  757
            D  + S  N     SYMGEVPVM  EE  TRREASV+RYKEKRQTRLFSKKIRYQVRKLN
Sbjct  143  DDCSLSFKNT----SYMGEVPVM--EEEKTRREASVLRYKEKRQTRLFSKKIRYQVRKLN  196

Query  758  AEKRPRLKGRFVRKA  802
            A+KRPRLKGRFV++ 
Sbjct  197  ADKRPRLKGRFVKRV  211



>ref|XP_002298500.1| CONSTANS-like family protein [Populus trichocarpa]
 gb|EEE83305.1| CONSTANS-like family protein [Populus trichocarpa]
Length=207

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/255 (42%), Positives = 134/255 (53%), Gaps = 63/255 (25%)
 Frame = +2

Query  62   SPKKEEQEVPDPDIITCSSVVSDNHCHRESNHTVDLHHPNKDYFSSFMDDMELDDDGSLF  241
            SPKKEEQEVPD  +   S++  +++     N  +D+           +D++E      +F
Sbjct  9    SPKKEEQEVPDTVVPQLSNIKEESY----GNGEIDV-----------VDELE-----GIF  48

Query  242  AIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAY-------WDFEFTSSDHDGGL  400
             I  D     D    Q       + + PAA    GS  +         FEF  S +    
Sbjct  49   GIEHDEMLSSDNMYGQLGWDFMDLEEYPAAEDEEGSEMFKFGDSRSSFFEFEESHY----  104

Query  401  SSVNEDSGDQKPILSqqqeqdndddeYHQEMKMEASLNLSLNYQHVLDAWSDRRTLWARD  580
             S++   GD+K +                      SLNL+LNYQ VL+AWSDR  L A D
Sbjct  105  -SID---GDEKGV----------------------SLNLNLNYQEVLEAWSDRGPLLADD  138

Query  581  KTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNA  760
                SL    N H YMGEVPVM  EE  TRREASV+RYKEKRQTRLFSKKIRYQVRKLNA
Sbjct  139  H---SLSTASNGH-YMGEVPVM--EEDRTRREASVLRYKEKRQTRLFSKKIRYQVRKLNA  192

Query  761  EKRPRLKGRFVRKAS  805
            +KRPRLKGRFV++ +
Sbjct  193  DKRPRLKGRFVKRVT  207



>ref|XP_004294775.1| PREDICTED: uncharacterized protein LOC101310098 [Fragaria vesca 
subsp. vesca]
Length=236

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 143/264 (54%), Gaps = 52/264 (20%)
 Frame = +2

Query  62   SPKKEEQEVPDPDIITCSSVVSDNHCHRESNHTVDLHHPNKDYFSSFMDDMELDDDGSLF  241
            SPKKEEQ+VPD      S   SD       N  VD+           MDD+E      ++
Sbjct  9    SPKKEEQQVPDS--ANSSEEFSDTTKDGYVNGKVDI-----------MDDLE-----RIW  50

Query  242  AIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAY--WDF----EFTSSDHDGGLS  403
             I  D  ++DD K              P   H   +G    WDF    EF + +   G  
Sbjct  51   GIDEDGDEEDDEK--------------PQKNHNMFAGQELNWDFMDWDEFPNGEEGDG-E  95

Query  404  SVNEDSGDQKPILSqqqeqdndddeYH----------QEMKMEASLNLSLNYQHVLDAWS  553
              NE  GD +    +++       +            ++MK +  LNL+LNYQ VLDAWS
Sbjct  96   VENEVFGDSERCFFEEESYCKKVVKKESSTVGFWNDDEDMK-KVQLNLNLNYQEVLDAWS  154

Query  554  DRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKI  733
            DR +LWA D ++ S     +N +YMGEVPVM+ EE+S RREASV+RY+EKRQ+RLFSKKI
Sbjct  155  DRGSLWAEDCSSHS-SMAASNGNYMGEVPVME-EEKSIRREASVLRYREKRQSRLFSKKI  212

Query  734  RYQVRKLNAEKRPRLKGRFVRKAS  805
            RYQVRKLNA+KRPRLKGRFV++ S
Sbjct  213  RYQVRKLNADKRPRLKGRFVKRVS  236



>ref|XP_008233500.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Prunus mume]
Length=241

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 102/258 (40%), Positives = 133/258 (52%), Gaps = 39/258 (15%)
 Frame = +2

Query  62   SPKKEEQEVPDPDIITCSSVVSDNHCHRESNHTVD--LHHPNKDYFSSFMDDMELDDDGS  235
            SPKKEEQ+VPD  I       SD      +   +D   +    D+    MDD E      
Sbjct  10   SPKKEEQQVPDS-INNSGEEFSDTTTTTTTTTKLDDAFNTNGDDHVVDIMDDWE-----R  63

Query  236  LFAIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAYWDF----EFTSSDHDGGLS  403
            +  I  +             E GK   +    GH+      WDF    EF   +    + 
Sbjct  64   ILGIEEE-------------EDGKLPSENMYGGHKLN----WDFMDWDEFPKGEEGEEIE  106

Query  404  SVNEDSGDQ-----KPILSqqqeqdndddeYHQEMKMEASLNLSLNYQHVLDAWSDRRTL  568
                 + D+     +    ++  +      + ++ +    LNL+LNYQ VLDAWSDR  L
Sbjct  107  QKVFQTADRCFFEDESYYERKVVKSESVVFWDEDDEKRVQLNLNLNYQEVLDAWSDRGPL  166

Query  569  WARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVR  748
            WA D +  S+ +N N   YMGEVP+M  EE  TRREASV+RY+EKRQ+RLFSKKIRYQVR
Sbjct  167  WADDCSRSSMASNGN---YMGEVPIM--EEERTRREASVLRYREKRQSRLFSKKIRYQVR  221

Query  749  KLNAEKRPRLKGRFVRKA  802
            KLNA+KRPRLKGRFVR+ 
Sbjct  222  KLNADKRPRLKGRFVRRC  239



>ref|XP_007016977.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
 gb|EOY34596.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
Length=240

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 82/101 (81%), Gaps = 6/101 (6%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             SLNL+LNYQ VLDAWSDR +LWA D   +S+    N + YMGEVPVM  EE   RREAS
Sbjct  146  VSLNLNLNYQDVLDAWSDRGSLWADD---YSISKASNGY-YMGEVPVM--EEERARREAS  199

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            V+RYKEKRQTRLFSKKIRYQVRKLNA+KRPRLKGRFV++ S
Sbjct  200  VLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  240



>ref|XP_006425148.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|ESR38388.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|KDO67018.1| hypothetical protein CISIN_1g025320mg [Citrus sinensis]
Length=244

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 5/100 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            +SLNL+LNYQ VLDAWSDR  LW  D   FSL + P++  YMGEVPVM  EE  TRREAS
Sbjct  150  SSLNLNLNYQQVLDAWSDRGPLWTDD---FSLSSVPSHGYYMGEVPVM--EEDKTRREAS  204

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            V+RY+EKRQ+RLFSK+IRYQVRKLNA+KRPRLKGRFV++ 
Sbjct  205  VLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKRV  244



>ref|XP_007206389.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
 gb|EMJ07588.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
Length=241

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 132/258 (51%), Gaps = 39/258 (15%)
 Frame = +2

Query  62   SPKKEEQEVPDPDIITCSSVVSDNHCHRESNHTVD--LHHPNKDYFSSFMDDMELDDDGS  235
            SPKKEEQ+VPD  I       SD      +   +D        D+    MDD E      
Sbjct  10   SPKKEEQQVPDS-INNSGEESSDTTTTTTTTTKLDDAFITNGDDHVVDIMDDWER-----  63

Query  236  LFAIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAYWDF----EFTSSDHDGGLS  403
                         I   +  E GK   +   +GH+      WDF    EF   +    + 
Sbjct  64   -------------IMGIEEEEDGKLQSENMYSGHKLN----WDFMDWDEFPKGEEGEEIE  106

Query  404  SVNEDSGDQ-----KPILSqqqeqdndddeYHQEMKMEASLNLSLNYQHVLDAWSDRRTL  568
                 + D+     +    ++  +      + ++ +    LNL+LNYQ VLDAWSDR  L
Sbjct  107  QKVFQTADRCFFEDESYYERKVVKSESVAFWDEDDEKRVHLNLNLNYQEVLDAWSDRGPL  166

Query  569  WARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVR  748
            WA D +  S+ +N N   YMGEVP+M  EE  TRREASV+RY+EKRQ+RLFSKKIRYQVR
Sbjct  167  WADDCSRSSMASNGN---YMGEVPIM--EEDRTRREASVLRYREKRQSRLFSKKIRYQVR  221

Query  749  KLNAEKRPRLKGRFVRKA  802
            KLNA+KRPRLKGRFV++ 
Sbjct  222  KLNADKRPRLKGRFVKRC  239



>ref|XP_008354841.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Malus domestica]
Length=234

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 80/100 (80%), Gaps = 5/100 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
              LNL+LNYQ V+DAWSDR TLWA D +  S+ +N N   Y+GEVPVM  EE   RREA 
Sbjct  140  VQLNLNLNYQEVMDAWSDRGTLWADDCSLSSMASNGN---YIGEVPVM--EEEKARREAR  194

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            V+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPRLKGRFV++ 
Sbjct  195  VLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKRV  234



>ref|XP_006488582.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Citrus sinensis]
Length=246

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 5/98 (5%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            LNL+LNYQ VLDAWSDR  LW  D   FSL + P++  YMGEVPVM  EE  TRREASV+
Sbjct  154  LNLNLNYQQVLDAWSDRGPLWTDD---FSLSSVPSHSYYMGEVPVM--EEDKTRREASVL  208

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            RY+EKRQ+RLFSK+IRYQVRKLNA+KRPRLKGRFV++ 
Sbjct  209  RYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKRV  246



>gb|KHN40106.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Glycine soja]
Length=220

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 5/99 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             +LNL+LNYQ VLDAWSDR +LWA D  + S P N  N  YMGEVPV+  EE   RREAS
Sbjct  126  VALNLNLNYQEVLDAWSDRGSLWA-DDCSLSFPTN--NAYYMGEVPVL--EEERARREAS  180

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            V+RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+KGRFV++
Sbjct  181  VLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  219



>ref|XP_003544900.2| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Glycine max]
Length=240

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 5/99 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             +LNL+LNYQ VLDAWSDR +LWA D  + S P N  N  YMGEVPV+  EE   RREAS
Sbjct  146  VALNLNLNYQEVLDAWSDRGSLWA-DDCSLSFPTN--NAYYMGEVPVL--EEERARREAS  200

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            V+RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+KGRFV++
Sbjct  201  VLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  239



>ref|XP_009354295.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009341688.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
Length=234

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 139/264 (53%), Gaps = 55/264 (21%)
 Frame = +2

Query  62   SPKKEEQEVPDPD-------IITCSSVVSDNHCHRESNHTVDLHHPNKDYFSSFMDDMEL  220
            S KKEEQ+VPD           T ++ + D + + +++H VD+           MDD E 
Sbjct  9    SLKKEEQQVPDSTHNSGEEFSDTNTTKLDDAYTNGDNDHEVDI-----------MDDWE-  56

Query  221  DDDGSLFAIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAYWDF----EFTSSDH  388
                 +  I  +             E GK   D   +GH       WDF    EF + + 
Sbjct  57   ----QILGIKME-------------EDGKLPSDNMYSGHELN----WDFMHWDEFPNGEE  95

Query  389  DGGLSSVNEDSGDQKPILSqqqeqdnddde------YHQEMKMEASLNLSLNYQHVLDAW  550
            +G       D G  K    ++     +  +      +  + + +  LNL+LNYQ V+DAW
Sbjct  96   EGEEIEQKVDQGIDKCFFEEESYYKKNVVKCESLGFWDDDDEKKVRLNLNLNYQEVMDAW  155

Query  551  SDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKK  730
            SDR TLWA D +  S+ +N N   Y+GEVPVM++E+   RREA V+RYKEKRQ+RLFSKK
Sbjct  156  SDRGTLWADDCSLSSMASNGN---YIGEVPVMEDEK--ARREARVLRYKEKRQSRLFSKK  210

Query  731  IRYQVRKLNAEKRPRLKGRFVRKA  802
            IRYQVRKLNA+KRPR KGRFV++ 
Sbjct  211  IRYQVRKLNADKRPRFKGRFVKRV  234



>ref|XP_011003377.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Populus euphratica]
Length=207

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 81/101 (80%), Gaps = 6/101 (6%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             SLNL+LNYQ VLDAWSDR +L A D   +SL    N + Y GEVPVM  EE  TRREAS
Sbjct  113  VSLNLNLNYQEVLDAWSDRGSLLADD---YSLSMGSNCY-YKGEVPVM--EEDRTRREAS  166

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            V+RY+EKRQTRLFSKKIRYQVRKLNA+KRPRLKGRFV++ S
Sbjct  167  VLRYREKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  207



>ref|XP_003615824.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
 gb|ACJ84105.1| unknown [Medicago truncatula]
 gb|AES98782.1| CCT motif protein [Medicago truncatula]
 gb|AFK39776.1| unknown [Medicago truncatula]
Length=217

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 83/99 (84%), Gaps = 6/99 (6%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKT-AFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            +LNL+LNYQ VLDAWS+R +LWA D + +FS   + NN SYMGEVP++  EE   RREAS
Sbjct  123  ALNLNLNYQEVLDAWSNRGSLWANDCSLSFS---SSNNGSYMGEVPIL--EEERARREAS  177

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            V+RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+KGRFV++
Sbjct  178  VLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>emb|CDP09243.1| unnamed protein product [Coffea canephora]
Length=135

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 83/101 (82%), Gaps = 4/101 (4%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASV  685
            SLNLSLNYQ VLDAWSDR TL A + ++  +  N N +  MGEVPV+++E R  RREASV
Sbjct  35   SLNLSLNYQEVLDAWSDR-TLCADESSSIFVSAN-NAYVRMGEVPVIEDERR--RREASV  90

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASD  808
            +RYKEKRQTRLFSKKIRYQVRKLNA+KRPR KGRFV++ ++
Sbjct  91   LRYKEKRQTRLFSKKIRYQVRKLNADKRPRFKGRFVKRVAE  131



>ref|XP_006574444.1| PREDICTED: uncharacterized protein LOC100803772 isoform X1 [Glycine 
max]
Length=217

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 78/99 (79%), Gaps = 5/99 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             +LNL+LNYQ VLDAWSDR +LWA D    SL    NN  YMGEVPV+  EE   RREA 
Sbjct  123  VALNLNLNYQEVLDAWSDRGSLWADD---CSLSFATNNAYYMGEVPVL--EEERARREAC  177

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            V+RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+KGRFV++
Sbjct  178  VLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_007142158.1| hypothetical protein PHAVU_008G257300g [Phaseolus vulgaris]
 gb|ESW14152.1| hypothetical protein PHAVU_008G257300g [Phaseolus vulgaris]
Length=217

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 5/98 (5%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASV  685
            SLNL+LNYQ VLDAWS+R +LWA D+ + SL  N  N  Y GEVPV+  EE   RREASV
Sbjct  124  SLNLNLNYQEVLDAWSNRGSLWA-DECSLSLATN--NSCYNGEVPVL--EEERARREASV  178

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            +RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+KGRFV++
Sbjct  179  LRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_008354834.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Malus domestica]
Length=235

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 6/101 (6%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
              LNL+LNYQ V+DAWSDR TLWA D +  S+ +N N   Y+GEVPVM  EE   RREA 
Sbjct  140  VQLNLNLNYQEVMDAWSDRGTLWADDCSLSSMASNGN---YIGEVPVM--EEEKARREAR  194

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK-GRFVRKA  802
            V+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPRLK GRFV++ 
Sbjct  195  VLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKQGRFVKRV  235



>ref|XP_006417850.1| hypothetical protein EUTSA_v10008808mg [Eutrema salsugineum]
 gb|ESQ36203.1| hypothetical protein EUTSA_v10008808mg [Eutrema salsugineum]
Length=201

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 7/104 (7%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRT--LWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            E  L L+LN+Q V+DAWSDRR   LW    T  S+   P N  Y GEVPVMD EER+TRR
Sbjct  103  ELGLKLNLNHQEVIDAWSDRRQELLW----TDTSMLMAPANALYRGEVPVMD-EERNTRR  157

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            EASV+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR KGRFV++ +
Sbjct  158  EASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKRET  201



>ref|XP_011024893.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Populus euphratica]
Length=225

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 104/248 (42%), Positives = 136/248 (55%), Gaps = 31/248 (13%)
 Frame = +2

Query  62   SPKKEEQEVPDPDIITCSSVVSDNHCHRESNHTVDLHHPNKDYFSSFMDDMELDDDGSLF  241
            SPKKEEQEVPD  +   S++  +++     N  +D+    +  F    D+M L +D    
Sbjct  9    SPKKEEQEVPDTVVPQLSNIKEESY----GNGEIDVVDELEGIFGIEHDEM-LSNDNMYS  63

Query  242  AIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAYWDFEFTSSDHDGGLSSVNEDS  421
             +  D  D ++   ++  E  + V        + G      FEF  S +  G        
Sbjct  64   QLGWDFMDLEEYPAAEDEEGSEMV--------KFGDSRSSFFEFEESHYSIG--------  107

Query  422  GDQKPILSqqqeqdndddeYHQEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLP  601
                 ++ ++     D D    E  +  +LNL+LNYQ VL+AWSDR  L A D    SL 
Sbjct  108  ----KVIKEESIGFGDGDGDGDEKGVSLNLNLNLNYQEVLEAWSDRGPLLADDH---SLS  160

Query  602  NNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
               N H YMGEVPVM  EE  TRREASV+RYKEKRQTRLFSKKIRYQVRKLNA+KRPRLK
Sbjct  161  TASNGH-YMGEVPVM--EEDRTRREASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLK  217

Query  782  GRFVRKAS  805
            GRFV++ +
Sbjct  218  GRFVKRVT  225



>ref|XP_009354286.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009341687.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
Length=235

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 139/265 (52%), Gaps = 56/265 (21%)
 Frame = +2

Query  62   SPKKEEQEVPDPD-------IITCSSVVSDNHCHRESNHTVDLHHPNKDYFSSFMDDMEL  220
            S KKEEQ+VPD           T ++ + D + + +++H VD+           MDD E 
Sbjct  9    SLKKEEQQVPDSTHNSGEEFSDTNTTKLDDAYTNGDNDHEVDI-----------MDDWE-  56

Query  221  DDDGSLFAIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAYWDF----EFTSSDH  388
                 +  I  +             E GK   D   +GH       WDF    EF + + 
Sbjct  57   ----QILGIKME-------------EDGKLPSDNMYSGHELN----WDFMHWDEFPNGEE  95

Query  389  DGGLSSVNEDSGDQKPILSqqqeqdnddde------YHQEMKMEASLNLSLNYQHVLDAW  550
            +G       D G  K    ++     +  +      +  + + +  LNL+LNYQ V+DAW
Sbjct  96   EGEEIEQKVDQGIDKCFFEEESYYKKNVVKCESLGFWDDDDEKKVRLNLNLNYQEVMDAW  155

Query  551  SDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKK  730
            SDR TLWA D +  S+ +N N   Y+GEVPVM++E+   RREA V+RYKEKRQ+RLFSKK
Sbjct  156  SDRGTLWADDCSLSSMASNGN---YIGEVPVMEDEK--ARREARVLRYKEKRQSRLFSKK  210

Query  731  IRYQVRKLNAEKRPRLK-GRFVRKA  802
            IRYQVRKLNA+KRPR K GRFV++ 
Sbjct  211  IRYQVRKLNADKRPRFKQGRFVKRV  235



>emb|CDY06672.1| BnaA10g04510D [Brassica napus]
Length=202

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 7/104 (7%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRT--LWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            E  L L+LN+Q V+DAWSDRR   LW    T  S+   P +  Y GEVPVMD EER+TRR
Sbjct  104  ELGLKLNLNHQEVIDAWSDRRQQPLW----TDTSMLMAPASALYRGEVPVMD-EERNTRR  158

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            EASV+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR KGRFVR+ +
Sbjct  159  EASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVRRET  202



>ref|XP_009119001.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Brassica rapa]
Length=203

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 7/104 (7%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRT--LWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            E  L L+LN+Q V+DAWSDRR   LW    T  S+   P +  Y GEVPVMD EER+TRR
Sbjct  105  ELGLKLNLNHQEVIDAWSDRRQQPLW----TDTSMLMAPASALYRGEVPVMD-EERNTRR  159

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            EASV+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR KGRFVR+ +
Sbjct  160  EASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVRRET  203



>emb|CDY10244.1| BnaC05g04870D [Brassica napus]
Length=202

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 7/104 (7%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRR--TLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            E  L L+LN+Q V+DAWSDRR  +LW    T  S+   P N  Y GEVPVMD EER+TRR
Sbjct  104  ELGLKLNLNHQEVIDAWSDRRQQSLW----TDTSMLMAPANALYRGEVPVMD-EERNTRR  158

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            EASV+RYKEKRQ+RLFSKKIRY+VRK NA+KRPR KGRFVR+ +
Sbjct  159  EASVLRYKEKRQSRLFSKKIRYEVRKFNADKRPRFKGRFVRRET  202



>ref|XP_010099464.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Morus notabilis]
 gb|EXB78539.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Morus notabilis]
Length=240

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 5/96 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             SLNL+LNYQ VLDAWS+R +L A D   +SL    N  +YMGEVPVM  EE  TRREAS
Sbjct  138  VSLNLNLNYQEVLDAWSNRGSLRADD---YSLSMATNGCNYMGEVPVM--EEEKTRREAS  192

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRF  790
            V+RYKEKRQTRLFSKKIRYQVRKLNA+KRPRLK R+
Sbjct  193  VLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKERY  228



>gb|KDO67019.1| hypothetical protein CISIN_1g025320mg [Citrus sinensis]
Length=254

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 5/93 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            +SLNL+LNYQ VLDAWSDR  LW  D   FSL + P++  YMGEVPVM  EE  TRREAS
Sbjct  150  SSLNLNLNYQQVLDAWSDRGPLWTDD---FSLSSVPSHGYYMGEVPVM--EEDKTRREAS  204

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
            V+RY+EKRQ+RLFSK+IRYQVRKLNA+KRPRLK
Sbjct  205  VLRYREKRQSRLFSKRIRYQVRKLNADKRPRLK  237



>ref|XP_009110963.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Brassica 
rapa]
 emb|CDY15597.1| BnaA08g28810D [Brassica napus]
Length=196

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 7/104 (7%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDR--RTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            E  L L+LN+Q V++AWSDR  + LW    T  SL   P N  Y GEVPVMD E R+TRR
Sbjct  98   ELGLKLNLNHQEVINAWSDRPQQPLW----TNTSLLRGPANALYSGEVPVMD-EGRNTRR  152

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            EASV+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR KGRFVR+ +
Sbjct  153  EASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVRRET  196



>ref|XP_006425147.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|ESR38387.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
Length=249

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 5/93 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            +SLNL+LNYQ VLDAWSDR  LW  D   FSL + P++  YMGEVPVM  EE  TRREAS
Sbjct  150  SSLNLNLNYQQVLDAWSDRGPLWTDD---FSLSSVPSHGYYMGEVPVM--EEDKTRREAS  204

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
            V+RY+EKRQ+RLFSK+IRYQVRKLNA+KRPRLK
Sbjct  205  VLRYREKRQSRLFSKRIRYQVRKLNADKRPRLK  237



>ref|XP_007016976.1| CCT motif family protein isoform 1 [Theobroma cacao]
 gb|EOY34595.1| CCT motif family protein isoform 1 [Theobroma cacao]
Length=253

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 75/93 (81%), Gaps = 6/93 (6%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             SLNL+LNYQ VLDAWSDR +LWA D   +S+    N + YMGEVPVM  EE   RREAS
Sbjct  147  VSLNLNLNYQDVLDAWSDRGSLWADD---YSISKASNGY-YMGEVPVM--EEERARREAS  200

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
            V+RYKEKRQTRLFSKKIRYQVRKLNA+KRPRLK
Sbjct  201  VLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLK  233



>emb|CDY66177.1| BnaC08g46470D [Brassica napus]
Length=197

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 80/104 (77%), Gaps = 7/104 (7%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDR--RTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            E SL L+LN+Q V++AWSDR  + LW    T  SL   P N  Y GEVPVMD E R+ RR
Sbjct  99   ELSLKLNLNHQEVINAWSDRPQQPLW----TNTSLLRGPANALYSGEVPVMD-EGRNMRR  153

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            EASV+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR KGRFVR+ +
Sbjct  154  EASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVRRET  197



>gb|KHN46121.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Glycine soja]
Length=230

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 74/97 (76%), Gaps = 5/97 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             +LNL+LNYQ VLDAWSDR +LWA D    SL    NN  YMGEVPV+  EE   RREA 
Sbjct  123  VALNLNLNYQEVLDAWSDRGSLWADD---CSLSFATNNAYYMGEVPVL--EEERARREAC  177

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFV  793
            V+RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+K  F+
Sbjct  178  VLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKVTFL  214



>ref|XP_006596439.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X2 [Glycine max]
Length=256

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 74/93 (80%), Gaps = 5/93 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             +LNL+LNYQ VLDAWSDR +LWA D  + S P N  N  YMGEVPV+  EE   RREAS
Sbjct  146  VALNLNLNYQEVLDAWSDRGSLWA-DDCSLSFPTN--NAYYMGEVPVL--EEERARREAS  200

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
            V+RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+K
Sbjct  201  VLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIK  233



>ref|XP_010264549.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Nelumbo nucifera]
Length=239

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 7/103 (7%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASV  685
            SLNL+LNYQ+VLDAWSDR +LWA D T+ S+ N    H+++GEVPVM  EE   RREA V
Sbjct  140  SLNLNLNYQNVLDAWSDRGSLWA-DDTSLSMVN----HNFIGEVPVM--EEERLRREARV  192

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDGD  814
            +RYKEKRQ RLFSKKIRYQVRKLNAEKRPRLKGRFV++    D
Sbjct  193  LRYKEKRQNRLFSKKIRYQVRKLNAEKRPRLKGRFVKRTLPAD  235



>ref|XP_010685899.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 95/150 (63%), Gaps = 24/150 (16%)
 Frame = +2

Query  371  FTSSDHDGGLSSVNEDSGDQKPILSqqqeqdndddeYHQEMKME---ASLNLSLNYQHVL  541
            F  +D DG +    ED G                  +  E  ME    SLNL+LNY+ VL
Sbjct  94   FNINDFDGNVKKEEEDCG--------------SFCGFWDENVMEETKTSLNLNLNYEEVL  139

Query  542  DAWSDRRTLWARDKT-AFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRL  718
            +AWS+R +LWA +   + S+ +N     YMGEVP +  EE  TRRE SV+RYKEKR++RL
Sbjct  140  EAWSNRGSLWAHNHHPSLSMSSN----HYMGEVPNL--EEERTRRETSVLRYKEKRRSRL  193

Query  719  FSKKIRYQVRKLNAEKRPRLKGRFVRKASD  808
            FSKKIRY+VRKLNA+KRPRLKGRFV++ SD
Sbjct  194  FSKKIRYEVRKLNADKRPRLKGRFVKRISD  223



>ref|XP_010557193.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8 [Tarenaya hassleriana]
Length=209

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 78/98 (80%), Gaps = 8/98 (8%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRT-LWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASV  685
            L L+LNYQ V+DAWS+R++ LW    +A      P +  Y GEVPVM+ EER+TRREASV
Sbjct  118  LKLNLNYQEVIDAWSERQSHLWTDASSA------PTHGFYAGEVPVME-EERNTRREASV  170

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            +RYKEKRQ RLFSKKIRYQVRKLNA+ RPRLKGRFV++
Sbjct  171  LRYKEKRQNRLFSKKIRYQVRKLNADNRPRLKGRFVKR  208



>ref|XP_007142159.1| hypothetical protein PHAVU_008G257300g [Phaseolus vulgaris]
 gb|ESW14153.1| hypothetical protein PHAVU_008G257300g [Phaseolus vulgaris]
Length=214

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 74/92 (80%), Gaps = 5/92 (5%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASV  685
            SLNL+LNYQ VLDAWS+R +LWA D+ + SL  N  N  Y GEVPV+  EE   RREASV
Sbjct  124  SLNLNLNYQEVLDAWSNRGSLWA-DECSLSLATN--NSCYNGEVPVL--EEERARREASV  178

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
            +RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+K
Sbjct  179  LRYKEKRQNRLFSKKIRYQVRKLNADKRPRIK  210



>gb|KFK43009.1| hypothetical protein AALP_AA1G067400 [Arabis alpina]
Length=193

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 6/98 (6%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRT-LWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASV  685
            L L+LN+Q V+DAWSDR+  LW    T  S+   P N  Y GEVPVM+ EER+ RREASV
Sbjct  99   LKLNLNHQEVIDAWSDRQQPLW----TDTSVLMAPANALYRGEVPVME-EERNMRREASV  153

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            +RYKEKR++RLF+KKIRYQVRKLNA+KRPR KGRFV++
Sbjct  154  LRYKEKRRSRLFTKKIRYQVRKLNADKRPRFKGRFVKR  191



>ref|XP_002892377.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68636.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=194

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 77/100 (77%), Gaps = 9/100 (9%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSD-RRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASV  685
            L L+LN+Q V+DAWSD R+ LW  + T         N  Y GEVPV++ EER+ RREASV
Sbjct  103  LKLNLNHQEVIDAWSDHRKPLWTDNTTV-------ANSLYKGEVPVIE-EERNMRREASV  154

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            +RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR KGRFV++ +
Sbjct  155  LRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKRET  194



>ref|XP_004490653.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X2 [Cicer arietinum]
Length=198

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 77/99 (78%), Gaps = 5/99 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             +L L+LNYQ VLDAWSDR +LWA   ++ S  N     SYMGEVP+++      RREAS
Sbjct  104  VALKLNLNYQEVLDAWSDRGSLWADGCSSLSTNNYA---SYMGEVPILEE--ERRRREAS  158

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            V+RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+KGRFV++
Sbjct  159  VLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  197



>ref|XP_010457868.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X1 
[Camelina sativa]
Length=189

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 79/103 (77%), Gaps = 9/103 (9%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSD-RRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRRE  676
            E  L L+LN+Q V+DAWSD ++ LW          ++P N  Y GEVPV++ EER+ +RE
Sbjct  95   ELGLKLNLNHQEVIDAWSDHQKPLWTD-------TSSPANSFYRGEVPVIE-EERNMKRE  146

Query  677  ASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            ASV+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR KGRFV++ +
Sbjct  147  ASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKRET  189



>ref|XP_010487064.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X2 
[Camelina sativa]
Length=189

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 79/103 (77%), Gaps = 9/103 (9%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSD-RRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRRE  676
            E  L L+LN+Q V+DAWSD ++ LW          ++P N  Y GEVPV++ EER+ +RE
Sbjct  95   ELGLKLNLNHQEVIDAWSDHQKPLWTD-------TSSPANSFYRGEVPVIE-EERNMKRE  146

Query  677  ASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            ASV+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR KGRFV++ +
Sbjct  147  ASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKRET  189



>ref|NP_563778.1| CCT motif family protein [Arabidopsis thaliana]
 gb|AAM63119.1| unknown [Arabidopsis thaliana]
 dbj|BAD44319.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH30276.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28072.1| CCT motif family protein [Arabidopsis thaliana]
Length=195

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 9/100 (9%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSD-RRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASV  685
            L L+LN+Q V+DAWSD ++ LW    T        +N  Y GEVPV++ E+R+ RREASV
Sbjct  104  LKLNLNHQEVIDAWSDHQKPLWTDTSTL-------DNSVYRGEVPVIE-EKRNMRREASV  155

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            +RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR KGRFV++ +
Sbjct  156  LRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKRET  195



>ref|XP_006379128.1| hypothetical protein POPTR_0009s08080g [Populus trichocarpa]
 gb|ERP56925.1| hypothetical protein POPTR_0009s08080g [Populus trichocarpa]
Length=159

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 71/95 (75%), Gaps = 8/95 (8%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             SLNL+LNYQ VLDAWSDR +L A D   +SL      + Y GEVPVM  EE  TRREAS
Sbjct  70   VSLNLNLNYQEVLDAWSDRGSLLADD---YSLSMESTCY-YKGEVPVM--EEDRTRREAS  123

Query  683  VMRYKEKRQTRLFSKKIRYQ--VRKLNAEKRPRLK  781
            V+RYKEKRQTRLFSKKIRYQ  +RKLNA+K  RLK
Sbjct  124  VLRYKEKRQTRLFSKKIRYQGSIRKLNADKSSRLK  158



>ref|XP_010487055.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X1 
[Camelina sativa]
Length=197

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 74/99 (75%), Gaps = 9/99 (9%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSD-RRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRRE  676
            E  L L+LN+Q V+DAWSD ++ LW          ++P N  Y GEVPV++ EER+ +RE
Sbjct  95   ELGLKLNLNHQEVIDAWSDHQKPLWTD-------TSSPANSFYRGEVPVIE-EERNMKRE  146

Query  677  ASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFV  793
            ASV+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR K  F+
Sbjct  147  ASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKVSFL  185



>ref|XP_006305953.1| hypothetical protein CARUB_v10011200mg [Capsella rubella]
 gb|EOA38851.1| hypothetical protein CARUB_v10011200mg [Capsella rubella]
Length=200

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 9/95 (9%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSD-RRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRRE  676
            E  L L+LN+Q ++DAWSD ++ LW  D +A      P    Y GEVPV++ EER+ RRE
Sbjct  98   ELGLKLNLNHQEIIDAWSDHQKPLWT-DTSA------PAYSFYRGEVPVIE-EERNMRRE  149

Query  677  ASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
            ASV+RYKEKRQ+RLFSKKIRYQVRKLNA+KRPR K
Sbjct  150  ASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFK  184



>ref|XP_004490652.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Cicer arietinum]
Length=290

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 7/94 (7%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNH-SYMGEVPVMDNEERSTRREA  679
             +L L+LNYQ VLDAWSDR +LWA   ++ S     NN+ SYMGEVP+++  E   RREA
Sbjct  104  VALKLNLNYQEVLDAWSDRGSLWADGCSSLS----TNNYASYMGEVPILE--EERRRREA  157

Query  680  SVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
            SV+RYKEKRQ RLFSKKIRYQVRKLNA+KRPR+K
Sbjct  158  SVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIK  191



>ref|NP_001242642.1| uncharacterized protein LOC100803772 [Glycine max]
 gb|ACU18787.1| unknown [Glycine max]
Length=200

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 61/82 (74%), Gaps = 5/82 (6%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             +LNL+LNYQ VLDAWSDR +LWA D    SL    NN  YMGEVPV+  EE   RREA 
Sbjct  123  VALNLNLNYQEVLDAWSDRGSLWADD---CSLSFATNNAYYMGEVPVL--EEERARREAC  177

Query  683  VMRYKEKRQTRLFSKKIRYQVR  748
            V+RYKEKRQ RLFSKKIRYQVR
Sbjct  178  VLRYKEKRQNRLFSKKIRYQVR  199



>gb|KFK25676.1| hypothetical protein AALP_AA8G144900 [Arabis alpina]
Length=329

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 11/110 (10%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---NPNNHSYMGE------VPVMDNE  655
             SL L L+Y+ +++AWSD+ TL+   +   ++P+   +P+  +  GE      VP M+  
Sbjct  217  TSLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASPDGFADAGEAGSLWTVPEMETT  276

Query  656  ERSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            ER  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  277  ERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRIKGRFVKR  326



>ref|XP_004231827.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Solanum lycopersicum]
Length=320

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 26/128 (20%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKT------------AFSLPNNPNNH-----S  622
            K +  L+L L+Y  +L+AWSD+  L+ + ++            AF +P + N       S
Sbjct  192  KRQQQLSLKLDYDEILNAWSDKGPLYLQSQSPQIVPDIHDDFLAFDMPFSINGQLMSSSS  251

Query  623  YMGEVP-VMDNEERST--------RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPR  775
             +  VP V+ NE+R          RREASVMRYKEKRQ RLFSK IRYQVRKLNAEKRPR
Sbjct  252  VVHRVPEVIGNEQREVEDEEMKAGRREASVMRYKEKRQNRLFSKTIRYQVRKLNAEKRPR  311

Query  776  LKGRFVRK  799
            +KGRFV++
Sbjct  312  VKGRFVKR  319



>ref|XP_006399947.1| hypothetical protein EUTSA_v10014044mg [Eutrema salsugineum]
 gb|ESQ41400.1| hypothetical protein EUTSA_v10014044mg [Eutrema salsugineum]
Length=337

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 11/109 (10%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NPNNHSYMG--------EVPVMDNEE  658
            SL L L+Y+ +++AWSD+ TL+   +   ++P+ + +  ++ G         VP M+  E
Sbjct  226  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADAFTGGGEAGSLWAVPEMETTE  285

Query  659  RSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            R  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  286  RLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRIKGRFVKR  334



>gb|AAM63153.1| unknown [Arabidopsis thaliana]
Length=305

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 11/109 (10%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLP---------NNPNNHSYMGEVPVMDNEE  658
            SL L L+Y+ +++AWSD+ TL+   +   ++P         N+      +  VP M+  E
Sbjct  194  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADGFNDGGEAGNLWAVPEMETTE  253

Query  659  RSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            R  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  254  RLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRVKGRFVKR  302



>ref|NP_568300.1| CCT motif family protein [Arabidopsis thaliana]
 gb|AAK92829.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14235.1| unknown protein [Arabidopsis thaliana]
 gb|AED92023.1| CCT motif family protein [Arabidopsis thaliana]
Length=339

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 11/109 (10%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLP---------NNPNNHSYMGEVPVMDNEE  658
            SL L L+Y+ +++AWSD+ TL+   +   ++P         N+      +  VP M+  E
Sbjct  228  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADGFNDGGEAGNLWAVPEMETTE  287

Query  659  RSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            R  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  288  RLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRVKGRFVKR  336



>ref|XP_009121672.1| PREDICTED: uncharacterized protein LOC103846490 [Brassica rapa]
Length=330

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 74/109 (68%), Gaps = 11/109 (10%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLP---------NNPNNHSYMGEVPVMDNEE  658
            SL L L+Y+ +++AWSD+ TL+   +   ++P         N   +   +  VP M+  E
Sbjct  220  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHGSADVFNGGGDSGSLWTVPEMETTE  279

Query  659  RSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            R  R  REAS++RYKEKRQ RLFSK+IRY+VRKLNAEKRPR+KGRFV++
Sbjct  280  RLWRGHREASLLRYKEKRQNRLFSKRIRYEVRKLNAEKRPRVKGRFVKR  328



>emb|CDX69586.1| BnaA10g19350D [Brassica napus]
Length=330

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 74/109 (68%), Gaps = 11/109 (10%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLP---------NNPNNHSYMGEVPVMDNEE  658
            SL L L+Y+ +++AWSD+ TL+   +   ++P         N   +   +  VP M+  E
Sbjct  220  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHGSADVFNGGGDSGSLWTVPEMETTE  279

Query  659  RSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            R  R  REAS++RYKEKRQ RLFSK+IRY+VRKLNAEKRPR+KGRFV++
Sbjct  280  RLWRGHREASLLRYKEKRQNRLFSKRIRYEVRKLNAEKRPRVKGRFVKR  328



>emb|CDX70561.1| BnaC03g06450D [Brassica napus]
Length=151

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 77/108 (71%), Gaps = 9/108 (8%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---NPNNHSYMGE----VPVMDNEER  661
            +SL L L+Y+ +++AW D+ TL+   +   ++P+   + +  +  GE    VP M+  ER
Sbjct  41   SSLALKLDYEQIMEAWLDKGTLYVDGEPPQTVPDLHASADVFTSGGEALWAVPEMETMER  100

Query  662  STR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
              R  REAS++RYKEKRQ+ LFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  101  LWRVHREASLLRYKEKRQSLLFSKRIRYQVRKLNAEKRPRIKGRFVKR  148



>ref|XP_002873661.1| hypothetical protein ARALYDRAFT_488277 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49920.1| hypothetical protein ARALYDRAFT_488277 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 76/109 (70%), Gaps = 11/109 (10%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---NPNNHSYMGE------VPVMDNEE  658
            SL L L+Y+ +++AWSD+ TL+   +    +P+   + +  +  GE      VP M+  E
Sbjct  224  SLALKLDYEQIMEAWSDKGTLYVDGEPPQMVPDLHASTDGFTDCGEAGNLWAVPEMETTE  283

Query  659  RSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            R  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  284  RLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRVKGRFVKR  332



>ref|XP_002961709.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
 gb|EFJ36969.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
Length=448

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 24/129 (19%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNP------------------  610
            +E ++E  + L L+Y+ VL+AWSDR   W       ++P++                   
Sbjct  313  KEEEVEKKITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCM  372

Query  611  --NNHSYMGEVPVMD-NEERST---RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRP  772
                   +G+VPV++  E+R T    REA VMRY+EKR+TRLFSKKIRY+VRKLNAE+RP
Sbjct  373  ESTEVEAVGQVPVVNFGEDRLTPQGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRP  432

Query  773  RLKGRFVRK  799
            RLKGRFV++
Sbjct  433  RLKGRFVKR  441



>ref|XP_002964778.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
 gb|EFJ33616.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
Length=448

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 24/130 (18%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNP------------------  610
            +E ++E  + L L+Y+ VL+AWSDR   W       ++P++                   
Sbjct  313  KEEEVEKKITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCM  372

Query  611  --NNHSYMGEVPVMD-NEERST---RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRP  772
                   +G+VPV++  E+R T    REA VMRY+EKR+TRLFSKKIRY+VRKLNAE+RP
Sbjct  373  ESTEVEAVGQVPVVNFGEDRLTPRGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRP  432

Query  773  RLKGRFVRKA  802
            RLKGRFV++ 
Sbjct  433  RLKGRFVKRT  442



>emb|CDY09849.1| BnaC09g43120D [Brassica napus]
Length=331

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 74/109 (68%), Gaps = 11/109 (10%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---------NPNNHSYMGEVPVMDNEE  658
            SL L L+Y+ +++AWSD+ TL+   +   ++P+            +   +  VP M+  E
Sbjct  221  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADVFTGGGDSGSLWTVPEMETTE  280

Query  659  RSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            R  R  REAS++RYKEKRQ RLFSK+IRY+VRKLNAEKRPR+KGRFV++
Sbjct  281  RLWRGHREASLLRYKEKRQNRLFSKRIRYEVRKLNAEKRPRVKGRFVKR  329



>ref|XP_009125969.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Brassica 
rapa]
Length=156

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%), Gaps = 11/110 (10%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---------NPNNHSYMGEVPVMDNE  655
             SL L L+Y+ +++AW D+ TL+   +   ++P+                +  VP M+  
Sbjct  44   TSLALKLDYEEIMEAWPDKGTLYVDGEPPQTVPDLHASTDVVTGGGEAGSLWTVPEMETT  103

Query  656  ERSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            E   R  REAS++RYKEKRQ+RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  104  ETLWRGHREASLLRYKEKRQSRLFSKRIRYQVRKLNAEKRPRVKGRFVKR  153



>gb|KDO45660.1| hypothetical protein CISIN_1g017778mg [Citrus sinensis]
Length=335

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 76/128 (59%), Gaps = 23/128 (18%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWA----RDKTAFSLPNNPN------NHSYMGEVPV  643
            K   SL L L+YQ VL+AWSD+  L+       +T   L +NPN      N   +  VP 
Sbjct  207  KKRLSLALKLDYQEVLNAWSDKAPLFVDGGESPQTVPDLYDNPNMLFDAGNSGNLFSVPE  266

Query  644  MDNEERSTR-------------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKG  784
            M     S +             REASVMRYKEKRQ RLFSK+IRY+VRKLNAEKRPR+KG
Sbjct  267  MTGNASSFKVDELGKEGWSKEHREASVMRYKEKRQNRLFSKRIRYEVRKLNAEKRPRMKG  326

Query  785  RFVRKASD  808
            RFV++ S+
Sbjct  327  RFVKRNSE  334



>emb|CDX78575.1| BnaA03g04870D [Brassica napus]
Length=301

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 77/108 (71%), Gaps = 9/108 (8%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---NPNNHSYMGE----VPVMDNEER  661
            +SL L L+Y+ +++AW D+ TL+   +   ++P+   + +  +  GE    VP M+  ER
Sbjct  191  SSLALKLDYEQIMEAWLDKGTLYVDGEPPQTVPDLHASADVFTSGGEALWAVPKMETMER  250

Query  662  STR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
              R  REAS++RYKEKRQ+R FSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  251  LWRGHREASLLRYKEKRQSRFFSKRIRYQVRKLNAEKRPRIKGRFVKR  298



>ref|XP_007014423.1| Chloroplast import apparatus 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOY32042.1| Chloroplast import apparatus 2, putative isoform 1 [Theobroma 
cacao]
Length=410

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            A L L LNY  V++AWSDR + +A +      P    N  Y     +    +    REAS
Sbjct  309  AGLQLKLNYDEVVNAWSDRGSPFAEESPG---PEVAGNDVYARLAQIDLFSDGGGVREAS  365

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDGD  814
            V+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+ + G+
Sbjct  366  VLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRRPNSGE  409



>ref|XP_009354303.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X3 
[Pyrus x bretschneideri]
 ref|XP_009341689.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X3 
[Pyrus x bretschneideri]
Length=215

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 119/242 (49%), Gaps = 55/242 (23%)
 Frame = +2

Query  62   SPKKEEQEVPDPD-------IITCSSVVSDNHCHRESNHTVDLHHPNKDYFSSFMDDMEL  220
            S KKEEQ+VPD           T ++ + D + + +++H VD+           MDD E 
Sbjct  9    SLKKEEQQVPDSTHNSGEEFSDTNTTKLDDAYTNGDNDHEVDI-----------MDDWE-  56

Query  221  DDDGSLFAIPADAGDKDDIKNSQAVEAGKPVVDPPAAGHRTGSGAYWDF----EFTSSDH  388
                 +  I  +             E GK   D   +GH       WDF    EF + + 
Sbjct  57   ----QILGIKME-------------EDGKLPSDNMYSGHELN----WDFMHWDEFPNGEE  95

Query  389  DGGLSSVNEDSGDQKPILSqqqeqdnddde------YHQEMKMEASLNLSLNYQHVLDAW  550
            +G       D G  K    ++     +  +      +  + + +  LNL+LNYQ V+DAW
Sbjct  96   EGEEIEQKVDQGIDKCFFEEESYYKKNVVKCESLGFWDDDDEKKVRLNLNLNYQEVMDAW  155

Query  551  SDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKK  730
            SDR TLWA D +  S+ +N N   Y+GEVPVM++E+   RREA V+RYKEKRQ+RLFSKK
Sbjct  156  SDRGTLWADDCSLSSMASNGN---YIGEVPVMEDEK--ARREARVLRYKEKRQSRLFSKK  210

Query  731  IR  736
            IR
Sbjct  211  IR  212



>ref|XP_008230480.1| PREDICTED: uncharacterized protein LOC103329755 [Prunus mume]
Length=330

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 73/117 (62%), Gaps = 16/117 (14%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLP--------NNPNNHSYMG---EVPVMD  649
             +L L L+Y+ +L+AWSD+  L        ++P        N PN     G    VP  +
Sbjct  214  GTLALKLDYEEILNAWSDKGPLCIDGDPPQTVPDQLFQLHDNTPNGEGCDGNLWRVPGGE  273

Query  650  NEERSTR-----REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            +E   T+     REASV+RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV+K S
Sbjct  274  DESLKTKMGKTQREASVLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRMKGRFVKKRS  330



>ref|XP_004507897.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Cicer 
arietinum]
Length=400

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            K +  L L LNY+ V +AWSD+ T +A D      P N  N + + ++ ++ +      R
Sbjct  296  KRKTGLLLKLNYEGVRNAWSDKGTPFADDSPISDAPGNDVN-ARLSQIDLLWDNGVGGVR  354

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  355  EASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  396



>emb|CDX85600.1| BnaA02g02130D [Brassica napus]
Length=318

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 11/110 (10%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NPNNHSYMG--------EVPVMDNE  655
             SL L L+Y+ +++AW D+ TL+   +   ++P+ + + +   G         VP M+  
Sbjct  206  TSLALKLDYEEIMEAWPDKGTLYVDGEPPQTVPDLHASTYVVTGGGEAGSLWTVPEMETT  265

Query  656  ERSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            E   R  REAS++RYKEKRQ+RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  266  ESLWRGHREASLLRYKEKRQSRLFSKRIRYQVRKLNAEKRPRVKGRFVKR  315



>ref|XP_010453557.1| PREDICTED: uncharacterized protein LOC104735456 [Camelina sativa]
Length=345

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 12/110 (11%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---NPNNHSYMGE------VPVMDN-E  655
            SL L L+Y+ +++AWSD+ TL+   +   ++P+   + + ++  GE      VP M+   
Sbjct  233  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADGYTDGGEAGSLWAVPEMETTR  292

Query  656  ERSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            ER  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  293  ERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRIKGRFVKR  342



>emb|CDX91067.1| BnaC02g05300D [Brassica napus]
Length=323

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%), Gaps = 11/110 (10%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---------NPNNHSYMGEVPVMDNE  655
             SL L L+Y+ +++AW D+ TL+   +   ++P+                +  VP M+  
Sbjct  211  TSLALKLDYEQIMEAWPDKGTLYVDGEPPQTVPDLHASADVVTGGGEAGSLWTVPEMETT  270

Query  656  ERSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            E   R  REAS++RYKEKRQ+RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  271  ETLWRGHREASLLRYKEKRQSRLFSKRIRYQVRKLNAEKRPRVKGRFVKR  320



>ref|XP_010492239.1| PREDICTED: uncharacterized protein LOC104769672 [Camelina sativa]
Length=351

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 12/110 (11%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---NPNNHSYMGE------VPVMDNE-  655
            SL L L+Y+ +++AWSD+ TL+   +   ++P+   + + ++  GE      VP M+   
Sbjct  239  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADGYTDGGEAGSLWAVPEMETTT  298

Query  656  ERSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            ER  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  299  ERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRIKGRFVKR  348



>gb|EYU18216.1| hypothetical protein MIMGU_mgv1a007342mg [Erythranthe guttata]
Length=410

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            K  A L L LNY  VL+AW D+ + ++ D  A       +  + + ++ +    E    R
Sbjct  305  KPNAGLLLKLNYDTVLNAWCDKGSPFSGDSPAADCAAGSDVQARLAQIDLF--SENGGIR  362

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVR  796
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR
Sbjct  363  EASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVR  403



>ref|XP_006447220.1| hypothetical protein CICLE_v10015864mg [Citrus clementina]
 ref|XP_006469936.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Citrus sinensis]
 gb|ESR60460.1| hypothetical protein CICLE_v10015864mg [Citrus clementina]
Length=335

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 76/128 (59%), Gaps = 23/128 (18%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWA----RDKTAFSLPNNPN------NHSYMGEVPV  643
            K   SL L L+YQ VL+AWSD+  L+       +T   L ++PN      N   +  VP 
Sbjct  207  KKRLSLALKLDYQEVLNAWSDKAPLFVDGGESPQTVPDLYDDPNMLFDAGNSGNLFSVPE  266

Query  644  MDNEERSTR-------------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKG  784
            M     S +             REASVMRYKEKRQ RLFSK+IRY+VRKLNAEKRPR+KG
Sbjct  267  MTGNASSFKVDELGKEGWSKEHREASVMRYKEKRQNRLFSKRIRYEVRKLNAEKRPRMKG  326

Query  785  RFVRKASD  808
            RFV++ S+
Sbjct  327  RFVKRNSE  334



>ref|XP_002268213.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 isoform X1 
[Vitis vinifera]
Length=392

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 6/102 (6%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            K  +SL L LNY  VL AWSDR + ++R+      P N +  + + ++ +    E    R
Sbjct  288  KSNSSLLLKLNYDDVLSAWSDRGSPFSRET---EFPGN-DTAARLAQIDLFS--ECGGVR  341

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  342  EASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  383



>emb|CAN72725.1| hypothetical protein VITISV_015092 [Vitis vinifera]
Length=392

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 6/102 (6%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            K  +SL L LNY  VL AWSDR + ++R+      P N +  + + ++ +    E    R
Sbjct  288  KSNSSLLLKLNYDDVLSAWSDRGSPFSRET---EFPGN-DTAARLAQIDLFS--ECGGVR  341

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  342  EASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  383



>ref|XP_006286526.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 ref|XP_006286527.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 ref|XP_006286528.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 gb|EOA19424.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 gb|EOA19425.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
 gb|EOA19426.1| hypothetical protein CARUB_v10001375mg [Capsella rubella]
Length=337

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 75/110 (68%), Gaps = 12/110 (11%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGE---------VPVMDNE-  655
            SL L L+Y+ +++AWSD+ TL+   +   ++P+   +    G+         VP M+   
Sbjct  225  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADGFGDGGEAGSIWAVPEMETTT  284

Query  656  ERSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            ER  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  285  ERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRIKGRFVKR  334



>ref|XP_002520096.1| hypothetical protein RCOM_1709850 [Ricinus communis]
 gb|EEF42285.1| hypothetical protein RCOM_1709850 [Ricinus communis]
Length=58

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 2/60 (3%)
 Frame = +2

Query  626  MGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            MGEV VM  EE   RREASV+RYKEKRQTRLFSKKIRYQVRKLNA+KRPRLKGRF++++S
Sbjct  1    MGEVLVM--EEERIRREASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFIKRSS  58



>ref|XP_009131400.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Brassica 
rapa]
Length=301

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 76/108 (70%), Gaps = 9/108 (8%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---NPNNHSYMGE----VPVMDNEER  661
            +SL L L+Y+ +++AW D+ TL+   +   ++P+   + +  +  GE    VP M+  ER
Sbjct  191  SSLALKLDYEQIMEAWLDKGTLYVDGEPPQTVPDLHTSADVFTSGGEALWAVPKMETMER  250

Query  662  STR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
              R  REAS++RYKEKRQ+R FSK+IRYQVRKLNAEKRPR KGRFV++
Sbjct  251  LWRGHREASLLRYKEKRQSRFFSKRIRYQVRKLNAEKRPRNKGRFVKR  298



>ref|XP_001765504.1| predicted protein [Physcomitrella patens]
 gb|EDQ69765.1| predicted protein [Physcomitrella patens]
Length=495

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 9/111 (8%)
 Frame = +2

Query  488  EMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNE---E  658
            E+ +  +  L LNY+ V+ AWSDR   W      F   +  ++ +  G VP M  E   +
Sbjct  371  EVNLGLAPTLRLNYEDVITAWSDRGEPW------FYPHDCTSDATDAGLVPDMAQEGADD  424

Query  659  RSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDG  811
                REASVMR+KEKR++RLFSK+IRY+VRKLNAEKRPR+KGRFV+K S G
Sbjct  425  CQGSREASVMRFKEKRRSRLFSKRIRYEVRKLNAEKRPRMKGRFVKKNSSG  475



>ref|XP_010420071.1| PREDICTED: uncharacterized protein LOC104705709 [Camelina sativa]
Length=345

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 12/110 (11%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---NPNNHSYMGE------VPVMDNE-  655
            SL L L+Y+ +++AWSD+ TL+   +   ++P+   + + ++  GE      VP M+   
Sbjct  233  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADGYTDGGEAGSLWAVPEMETTT  292

Query  656  ERSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            ER  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  293  ERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRIKGRFVKR  342



>emb|CBI40095.3| unnamed protein product [Vitis vinifera]
Length=392

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 6/102 (6%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            K  +SL L LNY  VL AWSDR + ++R+      P N +  + + ++ +    E    R
Sbjct  288  KSNSSLLLKLNYDDVLSAWSDRGSPFSRET---EFPGN-DTAARLAQIDLFS--ECGGVR  341

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  342  EASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  383



>ref|XP_009590839.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=325

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 84/134 (63%), Gaps = 34/134 (25%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN----------NPNNHSYMG------  631
            +  L+L L+Y+ +L+AWSD+ +L+ + ++   +P+          + ++H  MG      
Sbjct  191  QQQLSLKLDYEEILNAWSDKGSLYLQAESPQIVPDIHDDFLNYETSFSSHGLMGGWDSSA  250

Query  632  ---EVP-VMDNEE---RST-----------RREASVMRYKEKRQTRLFSKKIRYQVRKLN  757
                VP VM +E+   R+T           RREASV+RYKEKRQ RLFSKKIRYQVRKLN
Sbjct  251  VLYRVPEVMASEQSASRTTESLQEEELKVGRREASVLRYKEKRQKRLFSKKIRYQVRKLN  310

Query  758  AEKRPRLKGRFVRK  799
            AEKRPR+KGRFV++
Sbjct  311  AEKRPRVKGRFVKR  324



>ref|XP_007216840.1| hypothetical protein PRUPE_ppa022528mg [Prunus persica]
 gb|EMJ18039.1| hypothetical protein PRUPE_ppa022528mg [Prunus persica]
Length=308

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 22/109 (20%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLP--------NNPNNHSYMGEVPVMDNEE  658
             +L L L+Y+ +L+AWSD+  L     +  ++P        N PN    MG+        
Sbjct  214  GTLALKLDYEEILNAWSDKGPLCIDGDSLQTVPDQLFQLHDNTPN----MGK--------  261

Query  659  RSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
              T+REASV+RYKEKRQ RLFSK+IRYQVRK+NAEKRPR+KGRFV+K S
Sbjct  262  --TQREASVLRYKEKRQNRLFSKRIRYQVRKVNAEKRPRMKGRFVKKRS  308



>gb|KDP46366.1| hypothetical protein JCGZ_10206 [Jatropha curcas]
Length=339

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 77/115 (67%), Gaps = 18/115 (16%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY-------MGEVPVMDN-----  652
            + L L+YQ +L+AWSD+  L+ +  +   +P+  + H+        +  VP M++     
Sbjct  222  VGLKLDYQQILNAWSDKGPLYIKGDSPQIVPDVLHAHTASMDGWGNLWRVPEMESIKMKD  281

Query  653  --EERST----RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
              EE+      +REASV+RYKEKRQ+RLF+KKIRY+VRKLNAEKRPRLKGRFV++
Sbjct  282  KGEEKEGWKLGQREASVLRYKEKRQSRLFAKKIRYEVRKLNAEKRPRLKGRFVKR  336



>ref|XP_006338638.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Solanum 
tuberosum]
Length=321

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 81/130 (62%), Gaps = 25/130 (19%)
 Frame = +2

Query  479  YHQEMKMEASLNLSLNYQHVLDAWSDRRTLWAR------------DKTAFSLPNNPNNH-  619
            +HQ  + +  L+L L+Y  +L+AWSD+  L+ +            D  A+ +P + N   
Sbjct  193  HHQ--RRQQQLSLKLDYDEILNAWSDKGPLYLQSESPQIVPDIHDDFLAYDMPFSLNGQL  250

Query  620  -SYMGEVP-VMDNEE--------RSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKR  769
             S    VP V+ NEE        ++ RREASVMRYKEKRQ RLFSK IRYQVRKLNAEKR
Sbjct  251  MSISSVVPEVIGNEEREVEDEEMKAGRREASVMRYKEKRQNRLFSKTIRYQVRKLNAEKR  310

Query  770  PRLKGRFVRK  799
            PR+KGRFV++
Sbjct  311  PRIKGRFVKR  320



>ref|XP_008223874.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Prunus 
mume]
Length=438

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREA  679
            E  L L L+Y++VL+AWSD+ + ++ +     +P N +  + + ++ +  +      REA
Sbjct  328  EPGLMLKLDYENVLNAWSDKASPFSEEMPGSDVPGN-DVSARLAQIDLFSDA--GGLREA  384

Query  680  SVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            SV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  385  SVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  424



>ref|XP_007225066.1| hypothetical protein PRUPE_ppa018578mg [Prunus persica]
 gb|EMJ26265.1| hypothetical protein PRUPE_ppa018578mg [Prunus persica]
Length=440

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREA  679
            E  L L L+Y+ VL+AWSD+ + ++ +     +P N +  + + ++ +  +      REA
Sbjct  330  EPGLMLKLDYEDVLNAWSDKASPFSEEMPGSDVPGN-DVSARLAQIDLFSDA--GGLREA  386

Query  680  SVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            SV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  387  SVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  426



>ref|XP_002276181.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
Length=410

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 20/121 (17%)
 Frame = +2

Query  491  MKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NPNNH--SYMGEVPV------  643
            ++M   ++LSLNY+ V+ AW+ + + W    T  + P  +PN++   YMG  P       
Sbjct  281  VEMRRKISLSLNYEDVITAWASQGSPW----TTGNRPEFDPNDYWPDYMGACPTNVHGPC  336

Query  644  -------MDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
                    +   R   REA V+RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A
Sbjct  337  GDVGGVGGNFGGRDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  396

Query  803  S  805
            S
Sbjct  397  S  397



>ref|XP_003543009.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
1 [Glycine max]
Length=399

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 5/103 (5%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVM-DNEERSTR  670
            K +  L L LNY  V +AWSDR T ++ D     +P N +  + + ++ ++ DN      
Sbjct  293  KPKQGLMLKLNYDDVRNAWSDRGTPFSDDSPLADVPGN-DVTARLSQIDLLWDN---GGV  348

Query  671  REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            REASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  349  REASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  391



>ref|XP_009126853.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Brassica rapa]
Length=394

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ T +  +          + ++ + ++ +  +   +  REASV+RY
Sbjct  293  LKLDYDGVLEAWSDKATPFPEEILGSEATGGADVNARLAQIDLFGD---NGVREASVLRY  349

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            KEKRQTRLFSKKIRYQVRKLNA++RPR+KGRFVR+ S
Sbjct  350  KEKRQTRLFSKKIRYQVRKLNADQRPRVKGRFVRRPS  386



>emb|CAN73757.1| hypothetical protein VITISV_026326 [Vitis vinifera]
Length=475

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 20/121 (17%)
 Frame = +2

Query  491  MKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NPNNH--SYMGEVPV------  643
            ++M   ++LSLNY+ V+ AW+ + + W    T  + P  +PN++   YMG  P       
Sbjct  346  VEMRRKISLSLNYEDVITAWASQGSPW----TTGNRPEFDPNDYWPDYMGACPTNVHGPC  401

Query  644  -------MDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
                    +   R   REA V+RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A
Sbjct  402  GDVGGVGGNFGGRDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  461

Query  803  S  805
            S
Sbjct  462  S  462



>ref|XP_010938521.1| PREDICTED: uncharacterized protein LOC105057575 [Elaeis guineensis]
Length=233

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 71/104 (68%), Gaps = 6/104 (6%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS-YMGEV-----PVMDNEERST  667
            +L+L L+Y+ VL AWSDR +L+        +P+  +  S  + EV      V ++E    
Sbjct  126  ALSLKLDYEEVLTAWSDRGSLYIDGDGPQVVPDLYHTTSPVLVEVGSTGWTVPESELEVG  185

Query  668  RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
             REA VMRYKEKR++RLFSK+IRY+VRKLNAEKRPR KGRFVR+
Sbjct  186  NREARVMRYKEKRRSRLFSKRIRYEVRKLNAEKRPRSKGRFVRR  229



>gb|KDP41094.1| hypothetical protein JCGZ_03224 [Jatropha curcas]
Length=427

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 73/99 (74%), Gaps = 4/99 (4%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            +SL L LNY +VL+AWSDR + ++ + +     N+ +  + + ++ +    E    REAS
Sbjct  321  SSLLLKLNYDNVLNAWSDRGSPFSDEISGAEGGNDVS--ARLAQIDLFS--ESGGIREAS  376

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            V+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  377  VLRYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR  415



>ref|XP_008797174.1| PREDICTED: uncharacterized protein LOC103712429 [Phoenix dactylifera]
Length=232

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 6/104 (6%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS-YMGEVP-----VMDNEERST  667
            +L+L L+Y+ VL AWSDR +L+        +P   +  S  M EV      V +++  + 
Sbjct  125  ALSLKLDYEDVLTAWSDRGSLYIDGDGPQVVPELHHTASPVMVEVGSTGWRVPESDREAG  184

Query  668  RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
             REA VMRYKEKR++RLFSK++RY+VRKLNAE+RPRLKGRFV++
Sbjct  185  NREARVMRYKEKRRSRLFSKRVRYEVRKLNAERRPRLKGRFVKR  228



>emb|CDY47926.1| BnaA02g08300D [Brassica napus]
Length=392

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ T +  +          + ++ + ++ +  +   +  REASV+RY
Sbjct  291  LKLDYDGVLEAWSDKATPFPDEILGSEATGGADVNARLAQIDLFGD---NGVREASVLRY  347

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            KEKRQTRLFSKKIRYQVRKLNA++RPR+KGRFVR+ S
Sbjct  348  KEKRQTRLFSKKIRYQVRKLNADQRPRVKGRFVRRPS  384



>ref|XP_010483220.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Camelina sativa]
Length=456

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + +  D          + ++ + ++ +  +   S  REASV+RY
Sbjct  355  LKLDYDGVLEAWSDKTSPFPDDILGTEAATGIDVNARLAQIDLFGD---SGMREASVLRY  411

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  412  KEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  446



>ref|XP_010273555.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Nelumbo 
nucifera]
Length=403

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L+L LNY  V+ AWSDR + ++ D T  +  +  + H+ + ++ +      +  REASV+
Sbjct  301  LSLKLNYNEVILAWSDRGSPFS-DDTPTTDASESDIHARLAQIDLF---SENGVREASVL  356

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RY+EKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  357  RYREKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  393



>ref|XP_004145240.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Cucumis 
sativus]
 ref|XP_004153365.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Cucumis 
sativus]
 ref|XP_004164410.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
2 [Cucumis sativus]
 gb|KGN65847.1| hypothetical protein Csa_1G533540 [Cucumis sativus]
Length=171

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            ++LNL+LNY+ VL+AWSDR +LWA   ++ S  N+  +  YMGEVP++  EE   RR   
Sbjct  76   SNLNLNLNYEEVLEAWSDRGSLWAAASSSHS--NDSTHTPYMGEVPIIRMEEERRRRVKR  133

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVR  796
                KEKRQ R+F KKIRYQVRKLNA++RPR+KGRFV+
Sbjct  134  Y---KEKRQARIFCKKIRYQVRKLNADRRPRIKGRFVK  168



>emb|CAB87776.1| putative protein [Arabidopsis thaliana]
Length=347

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 11/108 (10%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLP---------NNPNNHSYMGEVPVMDNEE  658
            SL L L+Y+ +++AWSD+ TL+   +   ++P         N+      +  VP M+  E
Sbjct  194  SLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASADGFNDGGEAGNLWAVPEMETTE  253

Query  659  RSTR--REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVR  796
            R  R  REAS++RYKEKRQ RLFSK+IRYQVRKLNAEKRPR+K R  R
Sbjct  254  RLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRVKLRLNR  301



>ref|XP_010451861.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Camelina 
sativa]
Length=466

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + +  D       +  + ++ + ++ +  +   S  REASV+RY
Sbjct  365  LKLDYDGVLEAWSDKTSPFPDDILGTEAASGIDVNARIAQIDLFGD---SGMREASVLRY  421

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  422  KEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  456



>emb|CDY42238.1| BnaC02g11770D [Brassica napus]
Length=386

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ T +  D+   S     + ++ + ++ +  +   +  REASV+RY
Sbjct  286  LKLDYDGVLEAWSDKATPFP-DEILGSEATGADVNARLAQIDLFGD---NGVREASVLRY  341

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            KEKRQTRLFSKKIRYQVRKLNA++RPR+KGRFVR+ S
Sbjct  342  KEKRQTRLFSKKIRYQVRKLNADQRPRVKGRFVRRPS  378



>ref|XP_006850881.1| hypothetical protein AMTR_s00025p00156240 [Amborella trichopoda]
 gb|ERN12462.1| hypothetical protein AMTR_s00025p00156240 [Amborella trichopoda]
Length=436

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 12/114 (11%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFS----LPNNPNNHSYMGEVPVMD------  649
            ++ L L LN++ VL+ WSD+  L+A ++ A +    LP + +  + + +  V        
Sbjct  313  QSRLWLKLNHEDVLNTWSDQAPLYADEQRAEAANAELPTSADALARLTQFDVFPELGNWR  372

Query  650  --NEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
              +EE  + REASVMRYKEKR+TRLFSKKIRY+VRK+NA++RPR+KGRFVR+ +
Sbjct  373  QLSEEGGSMREASVMRYKEKRRTRLFSKKIRYEVRKVNADRRPRMKGRFVRRPA  426



>ref|XP_009801175.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Nicotiana 
sylvestris]
Length=424

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            K +++L L LNY  VL+AWSD+ + ++ D        N +  + + ++ +    E    R
Sbjct  317  KPKSALLLKLNYDTVLNAWSDKESPFSDDMPGSEAAGN-DVQARLAQIDLFS--ENGGMR  373

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVR  796
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFV+
Sbjct  374  EASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVK  414



>ref|XP_009602362.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=394

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 20/112 (18%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWA---RDKTAF------SLPNNPNNHSY------MGEVPVMD  649
            L+L+Y  VL+AW+D+R+ W    R +  F       + N   NH Y       G  P +D
Sbjct  277  LNLDYGGVLNAWADQRSPWTTGERPEVDFNDCWPVCMGNCGKNHLYGDMGTMTGHGPTVD  336

Query  650  NEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                   REA V+RYKEKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ +
Sbjct  337  EG-----REARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTN  383



>ref|XP_010443395.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Camelina 
sativa]
Length=467

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + +  D          + ++ + ++ +  +   S  REASV+RY
Sbjct  366  LKLDYDGVLEAWSDKTSPFPDDILGTEAATGIDVNARLAQIDLFGD---SGMREASVLRY  422

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  423  KEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  457



>ref|XP_002268929.1| PREDICTED: uncharacterized protein LOC100254358 [Vitis vinifera]
Length=310

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (63%), Gaps = 22/120 (18%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN------NPNNHSYMG--EVPVMDNEERS  664
            L+L L+YQ +L+AWS +  L+   ++  ++P+      N     + G  +VP M     S
Sbjct  191  LSLKLDYQEILNAWSGKGPLFIEGESPQTVPDLAHDAANAMGDGWSGVWKVPEMGGSRSS  250

Query  665  TR--------------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
             +              R+ASV+RYKEKRQ+RLFSK+IRY+VRKLNAEKRPR+KGRFV+++
Sbjct  251  MKMEEVGGGEGSKKGQRQASVLRYKEKRQSRLFSKRIRYEVRKLNAEKRPRMKGRFVKRS  310



>ref|XP_006280489.1| hypothetical protein CARUB_v10026429mg [Capsella rubella]
 gb|EOA13387.1| hypothetical protein CARUB_v10026429mg [Capsella rubella]
Length=436

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 65/95 (68%), Gaps = 6/95 (6%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VLDAWSD+ + +  D      P + N       +  +D    S  REASV+RY
Sbjct  338  LKLDYDGVLDAWSDKTSPFPDDILGLE-PADVN-----ARIAQIDLFGDSGMREASVLRY  391

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  392  KEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  426



>ref|XP_004236986.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Solanum lycopersicum]
Length=428

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 72/111 (65%), Gaps = 13/111 (12%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLW---ARDKTAF------SLPNNPNNHSYMGEVPVMDNEER  661
            + L+L+Y+ VL +W D+R  W    R +  F       + N    HSY G++ +M+    
Sbjct  308  IMLNLDYESVLKSWGDKRFPWTTGVRPEVDFNDCWPVCMGNCGKIHSY-GDIAIMNGHGG  366

Query  662  STR---REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                  REA V+RYKEKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ +
Sbjct  367  GVVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTN  417



>ref|XP_002867585.1| hypothetical protein ARALYDRAFT_354188 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43844.1| hypothetical protein ARALYDRAFT_354188 [Arabidopsis lyrata subsp. 
lyrata]
Length=392

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = +2

Query  488  EMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERST  667
            +M+   S  L L+Y  VL+AWS + + ++ D+   S     + H+ +GE+ +      S 
Sbjct  282  KMEQRVSPLLKLDYDGVLEAWSGKESPFS-DEILGSDAAGVDFHARLGEIDLFG---ESG  337

Query  668  RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
             REASV+RYKEKR+ RLFSK+IRYQVRKLNA++RPR+KGRFVR+
Sbjct  338  MREASVLRYKEKRRNRLFSKRIRYQVRKLNADQRPRMKGRFVRR  381



>gb|KFK27272.1| hypothetical protein AALP_AA8G360600 [Arabis alpina]
Length=427

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 70/95 (74%), Gaps = 4/95 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + ++ D+   S     + ++ + ++ +  +   S  REASV+RY
Sbjct  327  LKLDYDGVLEAWSDKASPFS-DEVLGSEATGADVNARLAQIDLFGD---SGMREASVLRY  382

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  383  KEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  417



>emb|CBI17712.3| unnamed protein product [Vitis vinifera]
Length=318

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (63%), Gaps = 22/120 (18%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN------NPNNHSYMG--EVPVMDNEERS  664
            L+L L+YQ +L+AWS +  L+   ++  ++P+      N     + G  +VP M     S
Sbjct  199  LSLKLDYQEILNAWSGKGPLFIEGESPQTVPDLAHDAANAMGDGWSGVWKVPEMGGSRSS  258

Query  665  TR--------------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
             +              R+ASV+RYKEKRQ+RLFSK+IRY+VRKLNAEKRPR+KGRFV+++
Sbjct  259  MKMEEVGGGEGSKKGQRQASVLRYKEKRQSRLFSKRIRYEVRKLNAEKRPRMKGRFVKRS  318



>ref|XP_002864503.1| hypothetical protein ARALYDRAFT_495815 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40762.1| hypothetical protein ARALYDRAFT_495815 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 69/95 (73%), Gaps = 4/95 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + +  D+   S     + ++ + E+ +  +   S  REASV+RY
Sbjct  326  LKLDYDGVLEAWSDKTSPFP-DEILGSEATGIDVNARLAEIDLFGD---SGMREASVLRY  381

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  382  KEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  416



>ref|XP_011094103.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Sesamum 
indicum]
Length=400

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 70/105 (67%), Gaps = 3/105 (3%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKT-AFSLPNNPNNHSYMGEVPVMDNEERSTRREA  679
              L L LNY  VL+AWSD+ + ++ D   A S     +  + + ++ +    E    REA
Sbjct  297  GGLLLKLNYDGVLNAWSDKGSPFSGDAPGAESAAAGTDVQARLAQIDLFS--ENGGVREA  354

Query  680  SVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDGD  814
            SV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR  +  D
Sbjct  355  SVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRTPNSPD  399



>ref|XP_002308112.2| hypothetical protein POPTR_0006s07490g [Populus trichocarpa]
 gb|EEE91635.2| hypothetical protein POPTR_0006s07490g [Populus trichocarpa]
Length=502

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 67/97 (69%), Gaps = 5/97 (5%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L LNY HVL  WSDR + ++ +    +  N+ +       +  +D    +  REASV+
Sbjct  343  LILKLNYDHVLSEWSDRGSPFSDESMGCAEGNDVS-----ARLAQIDLFSENGMREASVL  397

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  398  RYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR  434



>emb|CDP15779.1| unnamed protein product [Coffea canephora]
Length=444

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             SL L LNY +VL AWSD  + ++ D        N +  + + ++ +    E    REAS
Sbjct  340  GSLLLKLNYDNVLTAWSDGPSPFSDDSPVAEASGN-DVQARLAKIDLFS--ETGGVREAS  396

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDGD  814
            V+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR  +  D
Sbjct  397  VLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRTPNSPD  440



>emb|CAN75558.1| hypothetical protein VITISV_028190 [Vitis vinifera]
Length=310

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 74/120 (62%), Gaps = 22/120 (18%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN------NPNNHSYMG--EVPVMDNEERS  664
            L+L L+YQ +L+AWS +  L+   ++  ++P+      N     + G  +VP M     S
Sbjct  191  LSLKLDYQEILNAWSGKGPLFIEGESPQTVPDLAHDAANAMGDGWSGVWKVPEMGGSRSS  250

Query  665  TR--------------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
             +              R+ASV+RYKEKRQ RLFSK+IRY+VRKLNAEKRPR+KGRFV+++
Sbjct  251  MKMEEVGGGEGSKKGQRQASVLRYKEKRQXRLFSKRIRYEVRKLNAEKRPRMKGRFVKRS  310



>ref|XP_009593986.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Nicotiana 
tomentosiformis]
Length=425

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            K +++L L LNY +VL+AWSD+ + ++ D+   S     +  + + ++ +    E    R
Sbjct  314  KPKSTLLLKLNYDNVLNAWSDKESPFS-DEIPGSEAAGNDVQARLAQIDLFS--ENGGIR  370

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVR  796
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFV+
Sbjct  371  EASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVK  411



>ref|XP_010031966.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Eucalyptus 
grandis]
 gb|KCW83853.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83854.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83855.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83856.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
Length=461

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 95/176 (54%), Gaps = 30/176 (17%)
 Frame = +2

Query  341  TGSG--AYWDFEFTSSDH--DGGLSSVNEDSGDQKPILSqqqeqdndddeYHQEMKMEAS  508
            TG+G    WDF+F + DH    G+    ++    + ++S   E+          MK +  
Sbjct  293  TGAGDDVDWDFDFYNDDHVQSLGIEEKEDEENKMRTVVSGDAEE-------QATMKKKRK  345

Query  509  LNLSLNYQHVLDAWSDRRTLWAR-DKTAFSL----PNN---PNNHSYMGEVPVMDNEERS  664
            + L LNY+ V+ AW+ + + W   D+  F L    PN+     +HS    +P    E   
Sbjct  346  MLLRLNYEGVMAAWASQGSPWTTGDRPDFELDEGWPNSNMGTASHSLKYHLPFA--EAMG  403

Query  665  TR---------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
             R         REA V RY+EKR+TR+FSKKIRYQVRKLNAEKRPR+KGRFV++ S
Sbjct  404  LRAHVGAEDGGREARVSRYREKRRTRMFSKKIRYQVRKLNAEKRPRMKGRFVKRMS  459



>ref|NP_567737.1| CIA2-like transcription factor [Arabidopsis thaliana]
 gb|AAK51446.1|AF359388_1 CIL [Arabidopsis thaliana]
 gb|ABO09881.1| At4g25990 [Arabidopsis thaliana]
 gb|AEE85140.1| CIA2-like transcription factor [Arabidopsis thaliana]
Length=394

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 4/95 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWS + + ++ D+   S  +  + H  +GE+ +      S  REASV+RY
Sbjct  293  LKLDYDGVLEAWSGKESPFS-DEILGSDADGVDFHVRLGEIDLFG---ESGMREASVLRY  348

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+ RLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  349  KEKRRNRLFSKKIRYQVRKLNADQRPRMKGRFVRR  383



>ref|XP_010690879.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=428

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 3/103 (3%)
 Frame = +2

Query  491  MKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTR  670
             K    + L LNY  VLDAWSDR + ++ D       +  +  + + ++ +    E    
Sbjct  319  FKSSPGVLLKLNYDEVLDAWSDRGSPYSDDIPGSEF-SGTDALARLAQIDLFG--ESGAL  375

Query  671  REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            REASV RYKEKR+TR FSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  376  REASVQRYKEKRRTRFFSKKIRYQVRKVNADQRPRMKGRFVRR  418



>ref|XP_010320765.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Solanum lycopersicum]
Length=424

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY---MGEVPVMDNEERSTR---RE  676
            L+L+Y+ VL AW+D+R  W    T    P   +N S+   MG    + NE  +     RE
Sbjct  313  LNLDYEGVLKAWADQRCPW----TNGERPELDSNESWPDCMGNYMGIMNENVTIVDRGRE  368

Query  677  ASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            A V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A+
Sbjct  369  ARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  411



>ref|XP_006401232.1| hypothetical protein EUTSA_v10013517mg [Eutrema salsugineum]
 gb|ESQ42685.1| hypothetical protein EUTSA_v10013517mg [Eutrema salsugineum]
Length=452

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 71/95 (75%), Gaps = 4/95 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + ++ D+   S  +  + ++ + ++ +  +   S  REASV+RY
Sbjct  352  LKLDYDGVLEAWSDKASPFS-DEILGSEASRADVNARLAQIDLFGD---SGMREASVLRY  407

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  408  KEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  442



>ref|XP_011010948.1| PREDICTED: uncharacterized protein LOC105115687 [Populus euphratica]
Length=310

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 75/113 (66%), Gaps = 15/113 (13%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGE-------VPVMDNEE---  658
            + L L+YQ +L+AWSD+  L+   ++  ++P+  +  + + +       VP +   +   
Sbjct  195  VGLKLDYQEILNAWSDKGPLYIEGESPQTVPDICDGSNQLMDEWGHVWRVPDLCGSKTKE  254

Query  659  -----RSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
                 +S  REASV+RYKEKRQ RLF+K+IRY+VRKLNAEKRPRLKGRFV+++
Sbjct  255  GKEIWKSGLREASVLRYKEKRQNRLFAKRIRYEVRKLNAEKRPRLKGRFVKRS  307



>ref|XP_001769011.1| predicted protein [Physcomitrella patens]
 gb|EDQ66209.1| predicted protein [Physcomitrella patens]
Length=495

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 74/118 (63%), Gaps = 12/118 (10%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY---MGEVPVMDNE  655
            +E K  A   L LN+  VL AWSDR +LW   K   ++P++ +       +G VP +   
Sbjct  376  EEAKPAAPSLLRLNFDDVLSAWSDR-SLWTDGKRPQTVPDDSSEAVGGLDLGLVPDLSKG  434

Query  656  ERSTR--------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                +        REA V+RY+EKR+TRLFSKKIRY+VRKLNAE+RPR+KGRFV++ +
Sbjct  435  CAQGQPGTGGDRGREARVLRYREKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKRTT  492



>ref|XP_009403041.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Musa 
acuminata subsp. malaccensis]
Length=416

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 77/109 (71%), Gaps = 11/109 (10%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS----YMGEVPV-MDNEE  658
            K++ASL L L+++ V++AWSD  ++++        P++PN+ +     + ++ + +D   
Sbjct  303  KLKASLGLKLSHEEVINAWSDSGSIFSDG------PDSPNSSADALARLADIDLFLDAAG  356

Query  659  RSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                REASV+RYKEKR++RLFSK IRYQVRK NA++RPR+KGRFVR+ S
Sbjct  357  VGGVREASVLRYKEKRRSRLFSKMIRYQVRKTNADRRPRMKGRFVRRPS  405



>ref|XP_004238926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Solanum lycopersicum]
Length=437

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY---MGEVPVMDNEERSTR---RE  676
            L+L+Y+ VL AW+D+R  W    T    P   +N S+   MG    + NE  +     RE
Sbjct  326  LNLDYEGVLKAWADQRCPW----TNGERPELDSNESWPDCMGNYMGIMNENVTIVDRGRE  381

Query  677  ASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            A V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A+
Sbjct  382  ARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  424



>ref|XP_009410222.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=416

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 72/107 (67%), Gaps = 11/107 (10%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS----YMGEVPVM-DNEERS  664
            EA L L LN++ VL AWS R ++++        P+ P++ +     + ++ +  D     
Sbjct  305  EAGLGLKLNHEEVLKAWSGRGSMFSDG------PDTPSSSADALAKLADIDLFPDATGAG  358

Query  665  TRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            T REASV+RY+EKR++RLFSKKIRYQVRK NA++RPR+KGRFVR  S
Sbjct  359  TVREASVLRYREKRRSRLFSKKIRYQVRKANADRRPRMKGRFVRSPS  405



>gb|KHG04097.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=416

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 78/118 (66%), Gaps = 18/118 (15%)
 Frame = +2

Query  488  EMKMEA--SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NPNNHSYMGEVP------  640
            E+K E   S+ L L+Y+ V+ AW+ + + W    T+ + P  NP++  +MG  P      
Sbjct  293  EIKAEKKRSMLLRLDYESVITAWATQGSPW----TSGTRPEFNPDD--FMGSNPNEGIGG  346

Query  641  VMDNEERST---RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            +    +R+     REA V RY+EKR+TRLFSKKIRYQVRKLNAEKRPR+KGRFV++AS
Sbjct  347  ICSQGKRNITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRAS  404



>ref|XP_002324691.2| hypothetical protein POPTR_0018s13890g [Populus trichocarpa]
 gb|EEF03256.2| hypothetical protein POPTR_0018s13890g [Populus trichocarpa]
Length=467

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 5/97 (5%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L LNY +VL+AWSDR + ++ +        +         +  +D    +  REASV+
Sbjct  356  LILKLNYDNVLNAWSDRGSPFSEETMG-----SAEGTDVSARLAQIDLFSENGMREASVL  410

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  411  RYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR  447



>emb|CDY52734.1| BnaC09g53340D [Brassica napus]
Length=398

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L L+Y  VL+AWS++ + ++ D+   S     + ++ + ++ +  +   S  REASV+
Sbjct  296  LMLKLDYDGVLEAWSEKESPFS-DEILGSEAAGADVNARLAQINLFGD---SGIREASVL  351

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  352  RYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  388



>emb|CDY38274.1| BnaA10g11220D [Brassica napus]
Length=397

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 71/97 (73%), Gaps = 4/97 (4%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L L+Y  VL+AWS++ + ++ D+   S     + ++ + ++ +  +   S  REASV+
Sbjct  295  LMLKLDYDGVLEAWSEKESPFS-DEILASEAAGADVNARLAQIDLFGD---SGIREASVL  350

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  351  RYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  387



>ref|XP_006367940.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=428

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 75/111 (68%), Gaps = 13/111 (12%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWA---RDKTAFS------LPNNPNNHSYMGEVPVMDNEER  661
            + L+L+Y+ VL +W+D+R+ W    R +  F+      + N    HSY G++ +++    
Sbjct  308  IMLNLDYESVLKSWADKRSPWTMGERPEVDFNDCWPVCMGNCGKIHSY-GDIGIVNRHGG  366

Query  662  S---TRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                  REA V+RYKEKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ +
Sbjct  367  GGVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTN  417



>ref|XP_001771896.1| predicted protein [Physcomitrella patens]
 gb|EDQ63325.1| predicted protein [Physcomitrella patens]
Length=475

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 12/120 (10%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPN---NHSYMGEVPVMDNE  655
            QE K      L LN+  VL AWSDR +LW   +   ++P++ +     + +G VP ++ +
Sbjct  356  QEKKSAPPPLLRLNFDDVLSAWSDR-SLWTDGRRPQTVPDDSSEAVGGTDVGLVPDINTQ  414

Query  656  ERSTR--------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDG  811
                         RE  VMRYKEKR+TRLFSKKIRY+VRKLNAE+RPR+KGRFV++   G
Sbjct  415  YAQGATLAAGDKGREFRVMRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKQTPGG  474



>ref|XP_004242804.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 isoform X1 
[Solanum lycopersicum]
Length=432

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 70/101 (69%), Gaps = 3/101 (3%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            K ++ L L LN+  VL+AWSD+ + ++ D        N +  + + ++ +    E    R
Sbjct  325  KPKSGLLLKLNFDDVLNAWSDKESPFSDDIQGSDAAGN-DVQARLAQIDLFS--ENGGIR  381

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVR  796
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFV+
Sbjct  382  EASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVK  422



>ref|XP_011017668.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Populus euphratica]
Length=465

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L LNY +VL AWSDR + ++ +        +         +  +D    +  REASV+
Sbjct  354  LILKLNYDNVLSAWSDRGSPFSEETMG-----SAEGTDVSARLAQIDLFSENGMREASVL  408

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  409  RYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR  445



>ref|XP_009349161.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Pyrus 
x bretschneideri]
Length=277

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREA  679
            E  L L L+Y  VL+AWSD+ + ++ +        N +  + + ++ +    +    REA
Sbjct  168  EPGLMLKLDYDDVLNAWSDKASPFSEEILGSDAAGN-DVAARLAQIDLFS--DVGGLREA  224

Query  680  SVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            SV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  225  SVLRYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR  264



>ref|XP_009765495.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=405

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 20/112 (18%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLW---------ARDKTAFSLPNNPNNHSY------MGEVPVMD  649
            L+L+Y  VL+AW+D+R+ W         + D     + N    H+Y       G  P++D
Sbjct  288  LNLDYGGVLNAWADQRSPWTTGERPQVDSNDCWPVCMGNCGQIHAYGDMEIMTGHGPMID  347

Query  650  NEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                   REA V+RYKEKR+TRLFSKKIRY+VRKLNAE RPR+KGRFV++ +
Sbjct  348  EG-----REARVLRYKEKRRTRLFSKKIRYEVRKLNAEMRPRMKGRFVKRTN  394



>ref|XP_002451540.1| hypothetical protein SORBIDRAFT_04g003470 [Sorghum bicolor]
 gb|EES04516.1| hypothetical protein SORBIDRAFT_04g003470 [Sorghum bicolor]
Length=486

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 1/100 (1%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVM-DNEERSTRREASV  685
            L L L+   VL AWSD+ +++A      S  +     + + ++ +  +N      REASV
Sbjct  377  LGLKLDADEVLKAWSDKGSMFAEGSGPESPTSAAEVRAKLADIDLFPENGAGGGIREASV  436

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            +RYKEKR+TRLFSKKIRYQVRK+NA+ RPR+KGRFVR  S
Sbjct  437  LRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPS  476



>ref|XP_010433566.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Camelina 
sativa]
Length=402

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  V++AWS + + ++ D+   S     + H+ +GE+ +      S  REASV+RY
Sbjct  301  LKLDYDGVIEAWSGKESPFS-DEFLGSDAEGIDLHARLGEIDLFG---ESGMREASVLRY  356

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+ RLFSKKIRYQVRKLNA++RPR+KGRFV K
Sbjct  357  KEKRRIRLFSKKIRYQVRKLNADQRPRMKGRFVTK  391



>ref|XP_011020038.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Populus euphratica]
Length=449

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L LNY HV+  WS R + ++ +    +  N+ +  +++ ++ +      +  REASV+
Sbjct  344  LILKLNYDHVMSEWSGRGSPFSDESIGCAEGNDVS--AWLAQIDLFS---ENGMREASVL  398

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  399  RYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR  435



>ref|XP_003549301.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Glycine 
max]
Length=398

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 5/103 (5%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVM-DNEERSTR  670
            K +  L L L+Y  V +AWSD  T +  D     +P N +  + + ++ ++ DN      
Sbjct  291  KPKQGLMLKLDYDGVRNAWSDSGTPFTDDSPLADVPEN-DVTARLSQIDLLWDN---GGV  346

Query  671  REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            REASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  347  REASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  389



>ref|XP_008645243.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 isoform X1 
[Zea mays]
 gb|AFW70158.1| hypothetical protein ZEAMMB73_461303 [Zea mays]
Length=485

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTR----RE  676
            L L L+   VL AWSDR +++A      S  +     + + ++ +    E        RE
Sbjct  373  LGLKLDADEVLKAWSDRGSMFAEGSAPESPTSVAEARAKLSDMDLFPENEAGAGAGGVRE  432

Query  677  ASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            ASV+RYKEKR+TRLFSKKIRYQVRK+NA+ RPR+KGRFVR  S
Sbjct  433  ASVLRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPS  475



>ref|XP_009120241.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 isoform X1 
[Brassica rapa]
Length=418

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L L+Y  VL+AWS++   ++ D+   S     + ++ + ++ +  +   S  REASV+
Sbjct  316  LMLKLDYDGVLEAWSEKELPFS-DEILGSEAAGADVNARLAQIDLFGD---SGIREASVL  371

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  372  RYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  408



>emb|CDP00619.1| unnamed protein product [Coffea canephora]
Length=446

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 10/107 (9%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLW---------ARDKTAFSLPNNPNNHSYMGEVPVMDNEER-S  664
            LSL+Y+ V+ AW+D+R+ W         + D     L      H+  GEV +  +     
Sbjct  327  LSLDYEGVISAWADQRSPWTTGERPELDSNDCWPDCLGTCGTIHNLYGEVGMFGHPAMMD  386

Query  665  TRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
              REA V RY+EKR+TRLF KKIRY+VRKLNAEKRPR+KGRFV++A+
Sbjct  387  GGREARVSRYREKRRTRLFCKKIRYEVRKLNAEKRPRMKGRFVKRAT  433



>gb|AIE41596.1| zinc finger protein CONSTANS-LIKE 5 [Lagerstroemia indica]
Length=379

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 11/106 (10%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWAR-DKTAF--------SLPNNPNNHSYMGEVPVMDNEERST  667
            L L+Y+ V+ +W DR++ W   ++  F        SL +        G + ++  + R  
Sbjct  272  LKLDYEGVMSSWDDRKSPWTTGERPEFNSADCWPDSLVSASGAMQAYGGMAMVSGDARG-  330

Query  668  RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
             REA VMRY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A 
Sbjct  331  -REARVMRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAC  375



>ref|XP_009383142.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Musa acuminata 
subsp. malaccensis]
Length=324

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN--NPNNHSYMGEV----------PVMD  649
            +L L L+Y+ +L  WSDR  L+   +    +P   +P + + + EV          P   
Sbjct  207  ALALKLDYEEILAVWSDRGPLYMDGEGPQVVPQLQHPCDSAMLVEVGCRSWKVPEQPAEG  266

Query  650  NEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
             E     REA VMRYKEKR+ RLF+K+IRY+VRK NAEKRPR+KGRFVR+
Sbjct  267  KERSGMSREARVMRYKEKRRNRLFAKRIRYEVRKFNAEKRPRVKGRFVRR  316



>ref|XP_010111554.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Morus notabilis]
 gb|EXC31212.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Morus notabilis]
Length=440

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L LNY  VL AWSD+ + ++ +     +P N +  + + ++ +    +    REASV+
Sbjct  339  LLLKLNYDGVLSAWSDKGSPFSDEA---DVPGN-DVAARLAQIDLF--SDTGGVREASVL  392

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  393  RYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  429



>ref|XP_007210807.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
 gb|EMJ12006.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
Length=440

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 73/109 (67%), Gaps = 9/109 (8%)
 Frame = +2

Query  482  HQEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NPNNHSYMGEVPVMDNEE  658
            +++M M+  + L L+Y+ ++ AW+++ + W    T  + P  NP++    G +  M    
Sbjct  333  NKQMMMKRKICLRLDYEAIITAWANQGSPW----TTGTRPELNPDD----GWLDCMGGRG  384

Query  659  RSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ S
Sbjct  385  DDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  433



>ref|NP_001169082.1| uncharacterized protein LOC100382924 [Zea mays]
 gb|ACN31603.1| unknown [Zea mays]
Length=485

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVM--DNEERSTRR  673
            +A L L L+   VL AWSD+ +++A      S  +     + + ++ +   +       R
Sbjct  372  KAGLGLKLDADEVLKAWSDKGSMFAEGSGPESPTSATEVRAKLADIDLFPENGAGGGGVR  431

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA+ RPR+KGRFVR  S
Sbjct  432  EASVLRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPS  475



>ref|XP_010448341.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Camelina 
sativa]
Length=389

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWS + + ++ D+   S     + H+ +GE+ +      S  REASV+RY
Sbjct  288  LKLDYDGVLEAWSGKESPFS-DEFLGSDAAGIDLHARLGEIDLFG---ESGMREASVLRY  343

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+ RLFSKKIRYQVRKLNA++RPR+KGRFV +
Sbjct  344  KEKRRIRLFSKKIRYQVRKLNADQRPRMKGRFVTR  378



>ref|XP_010248760.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Nelumbo nucifera]
Length=364

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 18/118 (15%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY------------------  625
            +  L+L L+Y+ +L+AWSDR   +   +   ++P+  +N S                   
Sbjct  246  QGGLSLKLDYEQILNAWSDRSPFYIDGECPQTVPDITDNASLDFGCSGDGRQWRVPDDGS  305

Query  626  MGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
             G   + +   +  +REA V+RY+EKRQ+RLFSKKIRY+VRKLNAE RPRLKGRFV++
Sbjct  306  GGAKEMSEAVSKIKQREARVLRYREKRQSRLFSKKIRYEVRKLNAEIRPRLKGRFVKR  363



>ref|XP_006344138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=447

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY---MGEVPVMDNEERSTR---RE  676
            L+L+Y+ VL AW+D+R+ W    T    P   +N S+   MG    + NE  +     RE
Sbjct  336  LNLDYEGVLTAWADQRSPW----TNGERPELDSNDSWPHCMGNYMGIMNENVTIVDRGRE  391

Query  677  ASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            A V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ +
Sbjct  392  ARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTN  434



>ref|XP_009777706.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=447

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 103/183 (56%), Gaps = 28/183 (15%)
 Frame = +2

Query  296  EAGKPVVDPPAAGHRTG-SGAYWDFEFTSSDHDGGLSSVNEDSGDQKPILSqqqeqdndd  472
            E  + V+D     H    +G  ++F+F   D+D   S +N + GD+   +  +   ++ D
Sbjct  271  EGDEVVMDTTTTNHDIDINGDTFEFKF---DYD---SPMNINGGDEVGEVVMKINGEDGD  324

Query  473  deYHQEMKMEASLNLSLNYQHVLDAWSDRRTLW---------ARDKTAFSLPNNPNNHSY  625
              Y+++ K+     L+L+Y+ VL AW+D+R+ W         + D     + N    H Y
Sbjct  325  GNYNEKKKIL----LNLDYESVLTAWADQRSPWTNGERPELDSNDCWPDCMGNCGTIHPY  380

Query  626  M---GEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVR  796
                G   ++D       REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV+
Sbjct  381  GIMNGHTTIIDRG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  435

Query  797  KAS  805
            +++
Sbjct  436  RSN  438



>ref|XP_008677196.1| PREDICTED: LOC100281423 isoform X1 [Zea mays]
Length=459

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 69/116 (59%), Gaps = 26/116 (22%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN--------------PNNHSYMGEV  637
            +A L L L+   VL AWSD+ +++A + +   LP +              P N +  G V
Sbjct  346  KAGLGLKLDADEVLKAWSDKGSMFA-EGSGPELPTSAAEVRAKLADIDLFPENGAGGGGV  404

Query  638  PVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                       REASV+RYKEKR+TRLFSKKIRYQVRK+NA+ RPR+KGRFVR  S
Sbjct  405  -----------REASVLRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPS  449



>ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
 gb|ERP52165.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
Length=425

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 17/117 (15%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NPNNH--SYMGEVPVMDNEERS  664
            +M+ +++L L+Y+ V+ AW+++   W    T  S P  NP++     MG  P   N    
Sbjct  305  EMKRNVSLRLDYESVIIAWANQGCPW----TTGSRPELNPDDSWTDSMGACPKDVNNPYG  360

Query  665  -----TR-----REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                 TR     REA VMRYKEKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ S
Sbjct  361  GLGSHTRGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  417



>ref|XP_011097346.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Sesamum indicum]
Length=313

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 79/136 (58%), Gaps = 40/136 (29%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMG-------------------  631
            L L L+Y+ +++AWS++  L+   +++  +P+   NH ++                    
Sbjct  180  LWLKLDYEEIMNAWSNKGPLYVEAESSQIVPDM--NHDFLSHEEAFNNIYGVRWGGCNAL  237

Query  632  ---------------EVPVMDNEE-RST---RREASVMRYKEKRQTRLFSKKIRYQVRKL  754
                           E+ V D EE RST   +REASV+RYKEKRQ RLFS+KIRYQVRKL
Sbjct  238  GLWAVPEMVGDVGNSEMRVKDGEEIRSTTLKQREASVLRYKEKRQNRLFSRKIRYQVRKL  297

Query  755  NAEKRPRLKGRFVRKA  802
            NA+KRPRLKGRFV+++
Sbjct  298  NADKRPRLKGRFVKRS  313



>ref|NP_001147813.1| LOC100281423 [Zea mays]
 gb|ACG28777.1| CCT motif family protein [Zea mays]
 gb|ACR36069.1| unknown [Zea mays]
 gb|AFW66529.1| CCT motif protein family [Zea mays]
 gb|AIB05718.1| orphans transcription factor, partial [Zea mays]
Length=485

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 69/116 (59%), Gaps = 26/116 (22%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN--------------PNNHSYMGEV  637
            +A L L L+   VL AWSD+ +++A + +   LP +              P N +  G V
Sbjct  372  KAGLGLKLDADEVLKAWSDKGSMFA-EGSGPELPTSAAEVRAKLADIDLFPENGAGGGGV  430

Query  638  PVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                       REASV+RYKEKR+TRLFSKKIRYQVRK+NA+ RPR+KGRFVR  S
Sbjct  431  -----------REASVLRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPS  475



>ref|XP_006362450.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Solanum tuberosum]
Length=432

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 69/101 (68%), Gaps = 3/101 (3%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRR  673
            K  + L L LN+  VL+AWSD+ + ++ D        N +  + + ++ +    +    R
Sbjct  325  KPNSGLLLKLNFDDVLNAWSDKESPFSDDIQGSDATGN-DVQARLAQIDLFS--DNGGIR  381

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVR  796
            EASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFV+
Sbjct  382  EASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVK  422



>ref|XP_008451201.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Cucumis melo]
Length=441

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            A L L LNY+ V DAWS R + ++ D+   S     + ++ +  + +   E     REAS
Sbjct  331  AGLLLKLNYEAVADAWSSRGSPFS-DEIPSSDTAGSDVNARLANIDLF-TEGGGLLREAS  388

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            V+RYKEKR+TRLFSKKIRYQVRK+NA+ RPR+KGRFVR+
Sbjct  389  VLRYKEKRRTRLFSKKIRYQVRKVNADGRPRMKGRFVRR  427



>ref|XP_007152761.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
 gb|ESW24755.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
Length=406

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 68/111 (61%), Gaps = 19/111 (17%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYM-------GE-VPVMDNEERSTR  670
            L LNY+ V+ AW+ +   W         P N N+  ++       GE V     E RS R
Sbjct  292  LRLNYEDVIAAWASQGCPWTT-----GTPPNFNSDDFLPGFLGSNGEDVLCCYGEMRSLR  346

Query  671  ------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                  REA V+RY+EKR+TRLF+KKIRY+VRKLNAEKRPR+KGRFV++ S
Sbjct  347  GHADGGREARVLRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTS  397



>emb|CDY04230.1| BnaC06g25850D [Brassica napus]
Length=230

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 71/121 (59%), Gaps = 14/121 (12%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWA--------------RDKTAFSLPNNPNNHS  622
            +E + E  L L L+Y++V+ AW   RT W               +  +        ++H+
Sbjct  105  KEEEKEKVLMLRLDYENVISAWGSHRTPWTALEPSEIDLDMLRRQTNSVCESGGEAHHHN  164

Query  623  YMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            +   + +   E     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV+++
Sbjct  165  HFRGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  224

Query  803  S  805
            S
Sbjct  225  S  225



>ref|XP_001759088.1| predicted protein [Physcomitrella patens]
 gb|EDQ76157.1| predicted protein [Physcomitrella patens]
Length=574

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 67/106 (63%), Gaps = 11/106 (10%)
 Frame = +2

Query  491  MKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY--MGEVPVMDNEERS  664
            MK   SL L LNY+ VL AWSDR  LW   K    LP++  +     +G VP + N  ++
Sbjct  371  MKHTPSL-LQLNYEDVLSAWSDR-CLWTDGKCPQKLPDDSYSEIAGDVGLVPDLSNGCQA  428

Query  665  T-------RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
                     REA VMRYKEKR+TRLFSKKIRY+VRKLNAE RPR+K
Sbjct  429  VPGGGGDGGREARVMRYKEKRRTRLFSKKIRYEVRKLNAECRPRMK  474



>ref|XP_006283882.1| hypothetical protein CARUB_v10004999mg [Capsella rubella]
 gb|EOA16780.1| hypothetical protein CARUB_v10004999mg [Capsella rubella]
Length=392

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWS + + ++ D+   S     + ++ +GE+ +      S  REASV+RY
Sbjct  291  LKLDYGGVLEAWSGKESPFS-DEIMGSDAAGIDLYTRLGEIDLFG---ESGMREASVLRY  346

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+ RLFSKKIRYQVRKLNA++RPR+KGRFV +
Sbjct  347  KEKRRNRLFSKKIRYQVRKLNADQRPRMKGRFVTR  381



>ref|NP_568852.2| chloroplast import apparatus 2 protein [Arabidopsis thaliana]
 sp|Q9LU68.1|CIA2_ARATH RecName: Full=Protein CHLOROPLAST IMPORT APPARATUS 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK51445.1|AF359387_1 CIA2 [Arabidopsis thaliana]
 dbj|BAA97368.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAH19527.1| AT5G57180 [Arabidopsis thaliana]
 gb|AED96860.1| chloroplast import apparatus 2 protein [Arabidopsis thaliana]
Length=435

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 69/95 (73%), Gaps = 6/95 (6%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + +  D+   S   + N  + + ++ +  +   S  REASV+RY
Sbjct  337  LKLDYDGVLEAWSDKTSPFP-DEIQGSEAVDVN--ARLAQIDLFGD---SGMREASVLRY  390

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  391  KEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  425



>ref|XP_002887511.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63770.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 70/116 (60%), Gaps = 14/116 (12%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSL--PNNPNNH---------SYMGEVP--  640
            + SL LSL+Y+ V+ AW +  + W     +  L   N   +H         S +G V   
Sbjct  273  KTSLFLSLDYEAVITAWDNHGSPWKTGIKSECLLGGNTCPSHAVGGFDELVSTVGSVTRQ  332

Query  641  -VMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
             V D       REA V+RYKEKR+TRLFSKKIRY+VRKLNAE+RPR+KGRFV++ S
Sbjct  333  QVKDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVKRTS  388



>ref|XP_011016373.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Populus 
euphratica]
Length=426

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 19/121 (16%)
 Frame = +2

Query  482  HQEMKMEASLNLSLNYQHVLDAWSDRRTLW---------ARDKTAFSLPNNPN--NHSYM  628
            ++EMK   SL L  +Y+ V+ AW+++   W         A D    S+  +P   N+ Y 
Sbjct  304  YKEMKRNVSLRL--DYESVIIAWANQGCPWTTGSRPELNADDSWTDSMGTSPKDVNNPYG  361

Query  629  GEVPVMDNEERST--RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            G    + +  R     REA VMRYKEKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ 
Sbjct  362  G----LGSHTRGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  417

Query  803  S  805
            S
Sbjct  418  S  418



>gb|KDO45661.1| hypothetical protein CISIN_1g017778mg [Citrus sinensis]
Length=366

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 68/119 (57%), Gaps = 23/119 (19%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWA----RDKTAFSLPNNPN------NHSYMGEVPV  643
            K   SL L L+YQ VL+AWSD+  L+       +T   L +NPN      N   +  VP 
Sbjct  207  KKRLSLALKLDYQEVLNAWSDKAPLFVDGGESPQTVPDLYDNPNMLFDAGNSGNLFSVPE  266

Query  644  MDNEERSTR-------------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
            M     S +             REASVMRYKEKRQ RLFSK+IRY+VRKLNAEKRPR+K
Sbjct  267  MTGNASSFKVDELGKEGWSKEHREASVMRYKEKRQNRLFSKRIRYEVRKLNAEKRPRMK  325



>ref|XP_007160372.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
 gb|ESW32366.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
Length=369

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 81/143 (57%), Gaps = 17/143 (12%)
 Frame = +2

Query  398  LSSVNEDSGDQKPILSqqqeqdndddeYHQEMKMEASLNLSLNYQHVLDAWSDRRTL-WA  574
            + SV  D+G++K  +         D    +E   +  + L LNY  V+ AWS + +  W 
Sbjct  226  IESVLSDAGEEKACV------VASDGGVGEEEGTKRDIFLRLNYDEVISAWSTQGSSPW-  278

Query  575  RDKTAFSLPNNPNNHSYMGEVPVMDNEERSTR------REASVMRYKEKRQTRLFSKKIR  736
               T  + P   + + +   +  +D E RS R      REA V RY+EKR+TRLF+KKIR
Sbjct  279  ---TTSNPPKFNSGYDFCLGLSGVDGEVRSLRGHLDGGREARVSRYREKRRTRLFAKKIR  335

Query  737  YQVRKLNAEKRPRLKGRFVRKAS  805
            Y+VRKLNAEKRPR+KGRFV++  
Sbjct  336  YEVRKLNAEKRPRMKGRFVKRTC  358



>ref|XP_010539413.1| PREDICTED: LOW QUALITY PROTEIN: protein CHLOROPLAST IMPORT APPARATUS 
2 [Tarenaya hassleriana]
Length=452

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 66/95 (69%), Gaps = 4/95 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  +L+AWSD+   ++ D+         + H+ + ++ +         REASVMRY
Sbjct  351  LKLDYDGILEAWSDKGLPFS-DEILGPDAAGADVHARVAQIDLFG---EGGVREASVMRY  406

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR+
Sbjct  407  KEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR  441



>ref|XP_009359939.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Pyrus 
x bretschneideri]
Length=429

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 67/100 (67%), Gaps = 2/100 (2%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREA  679
            E  L L L+Y  VL+AWSD+ + ++ +          +  + +  + +    +    REA
Sbjct  319  EPGLMLKLDYDDVLNAWSDKASPFSEEMPGSDAAAGNDVSARLAHIDLFS--DVGGLREA  376

Query  680  SVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            SV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  377  SVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  416



>ref|XP_010438814.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Camelina 
sativa]
Length=388

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 66/95 (69%), Gaps = 4/95 (4%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWS + + ++ D+   S     + H+ +GE+ +      S  REASV+RY
Sbjct  287  LKLDYDGVLEAWSGKESPFS-DEFLGSDAAGIDLHARLGEIDLFG---ESGMREASVLRY  342

Query  695  KEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+ RLFSKKIRYQV KLNA++RPR+KGRFV +
Sbjct  343  KEKRRIRLFSKKIRYQVSKLNADQRPRMKGRFVTR  377



>ref|XP_010927568.1| PREDICTED: uncharacterized protein LOC105049568 [Elaeis guineensis]
Length=231

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS-YMGEVP-----VMDNEERST  667
            +L+L L+Y+ VL AWS R + +        +P+  +  S  + EV      V ++E    
Sbjct  124  ALSLKLDYEEVLTAWSGRGSFYIDGDGPQVVPDLHHTTSPVLVEVRSTGWRVPESEREVG  183

Query  668  RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
             REA VMRYKEKR++RLFSK+IRY+VRKL+AEKRPR KGRFV++
Sbjct  184  NREARVMRYKEKRRSRLFSKRIRYEVRKLDAEKRPRSKGRFVKR  227



>ref|XP_002526951.1| hypothetical protein RCOM_0531220 [Ricinus communis]
 gb|EEF35438.1| hypothetical protein RCOM_0531220 [Ricinus communis]
Length=276

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 71/108 (66%), Gaps = 12/108 (11%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN---NPNNHSYMGEVPVMDN----  652
            K+   + L L+YQ +L+AWSD+  L+ + ++  ++P+     N    +  VP + +    
Sbjct  164  KIMGLVGLKLDYQEILNAWSDKGPLYIKGESPQTVPDLLDASNALVNIWTVPELGSSSSI  223

Query  653  -----EERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
                 E +  +REASV+RYKEKRQ+RLFSK+IRY+VRKLNAEKRPRLK
Sbjct  224  KEEKEEWKLGQREASVLRYKEKRQSRLFSKRIRYEVRKLNAEKRPRLK  271



>ref|XP_007154713.1| hypothetical protein PHAVU_003G141200g [Phaseolus vulgaris]
 gb|ESW26707.1| hypothetical protein PHAVU_003G141200g [Phaseolus vulgaris]
Length=391

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 5/103 (5%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVM-DNEERSTR  670
            K +  L L LNY  V  AWSDR   ++ D     LP   +  + + ++ +  DN      
Sbjct  284  KPKQGLMLKLNYDDVRSAWSDRGIPFSDDSPLADLPEA-DVTARLSQIDLWWDN---GGV  339

Query  671  REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            REASV RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  340  REASVQRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  382



>ref|XP_008799492.1| PREDICTED: LOW QUALITY PROTEIN: protein CHLOROPLAST IMPORT APPARATUS 
2-like [Phoenix dactylifera]
Length=411

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 75/108 (69%), Gaps = 11/108 (10%)
 Frame = +2

Query  497  MEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS-YMGEVPVMDNEERSTR-  670
            +++ L L LN++ VL AWS   +++A        P++P++ +  + ++  +D    +   
Sbjct  299  LKSGLGLKLNHEEVLKAWSGHGSVFADG------PDSPHSSAEALAKLADIDLFPEAGGG  352

Query  671  ---REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
               REASV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFV++ S
Sbjct  353  GGVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVKRPS  400



>ref|XP_006656860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=336

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 17/118 (14%)
 Frame = +2

Query  497  MEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY----MGEVPVMDNEERS  664
            +++SL LSLNY+ ++++W    + W   +      N+   H Y    M    V  + E  
Sbjct  212  LQSSLALSLNYEAIIESWGS--SPWTDGERPHVKLNDSWPHDYSGVWMAAAGVFGHGEEQ  269

Query  665  TR-----------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                         REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A+
Sbjct  270  QALTPRLQGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  327



>gb|ACF84125.1| unknown [Zea mays]
Length=226

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 71/117 (61%), Gaps = 12/117 (10%)
 Frame = +2

Query  497  MEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN-PNNHSYM-----------GEVP  640
            ++ SL+L+LNY+ ++ +W         ++    L    P++++ M            ++P
Sbjct  101  LQTSLSLTLNYEAIIQSWGSSPWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDLP  160

Query  641  VMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDG  811
                      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A+ G
Sbjct  161  GTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRATAG  217



>ref|XP_001769217.1| predicted protein [Physcomitrella patens]
 gb|EDQ65929.1| predicted protein [Physcomitrella patens]
Length=646

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 73/110 (66%), Gaps = 10/110 (9%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY--MGEVPVMDNEE  658
            +E+K   SL L LNY+ ++ AWSDR +LW   K   ++P++ N+ S   +G VP   N  
Sbjct  379  EEVKPAPSL-LRLNYEDIMSAWSDR-SLWTDGKRPQTVPDDSNSESTVDLGMVPDFGNGC  436

Query  659  RST------RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRF  790
            ++        R A +MRY+EKR+TRLFSKKIRY+VRKLNAE+RPR+K + 
Sbjct  437  QTVPGGSDGGRGARIMRYREKRRTRLFSKKIRYEVRKLNAERRPRMKSQL  486



>ref|XP_008811451.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 isoform X2 
[Phoenix dactylifera]
Length=434

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 72/107 (67%), Gaps = 11/107 (10%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS-YMGEVPVMD----NEERS  664
            ++ L L LN + VL AW+DR +++A        P++P++ +  + ++  MD         
Sbjct  304  KSGLGLKLNSEEVLKAWADRGSVFADG------PDSPHSSAEALAKLGDMDLFPGVGCGG  357

Query  665  TRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
              REASV+R+KEK+ TRLFSKKIRYQVRK+NAE+RPR+KGRFV  +S
Sbjct  358  GGREASVLRFKEKQGTRLFSKKIRYQVRKVNAEQRPRMKGRFVGSSS  404



>ref|XP_010524282.1| PREDICTED: uncharacterized protein LOC104802388 [Tarenaya hassleriana]
Length=364

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 11/107 (10%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGE------VPVMDNEERST  667
            SL L L+Y+ + +AWSD+ +L+   +   ++P+    H+  G       VP M+  ER+ 
Sbjct  248  SLALKLDYEQIKEAWSDKGSLYVDGEPPQTVPDL---HAQEGAGMSVWAVPEMEETERAR  304

Query  668  RREA--SVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            R     S++RYKEKRQ+RLF+K+IRY+VRKLNAEKRPRLKGRFV++A
Sbjct  305  RGRREASLLRYKEKRQSRLFAKRIRYEVRKLNAEKRPRLKGRFVKRA  351



>emb|CDO98435.1| unnamed protein product [Coffea canephora]
Length=431

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 71/114 (62%), Gaps = 21/114 (18%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWAR-DKTAFSLPN--------------NPNNHSYMGEVPV  643
            ++L LNY+ V+ AW+ + + WA   K  F+L +              +PN  +  G V  
Sbjct  312  MHLKLNYEEVITAWASQGSPWADGTKPEFNLGDCWPDFMGMSLNELHHPNG-AGGGRVSS  370

Query  644  MDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
             D E     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ S
Sbjct  371  HDEE-----REARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  419



>ref|XP_008388630.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Malus domestica]
Length=436

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREA  679
            E  L L L+Y  VL+AWS++ + ++ +        N +  + + ++ +  +      REA
Sbjct  327  EPGLMLKLDYDDVLNAWSNKASPFSEEMPGSDAAGN-DVSARLAQIDLFSDA--GGLREA  383

Query  680  SVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            SV+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  384  SVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  423



>ref|XP_010929359.1| PREDICTED: LOW QUALITY PROTEIN: protein CHLOROPLAST IMPORT APPARATUS 
2 [Elaeis guineensis]
Length=425

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 71/104 (68%), Gaps = 11/104 (11%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS-YMGEVPVMD----NEERSTRR  673
            L L LN++ VL AWS   +++A        P++P++ +  + ++  MD           R
Sbjct  305  LGLKLNHEEVLRAWSGHGSVFADS------PDSPHSSAEALAKLADMDLFLEGSCGGGVR  358

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            EAS++RYKEKR+TRLFSKKIRYQVRKLNA++RPR+KGRFVR +S
Sbjct  359  EASMLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRSSS  402



>gb|ACL53155.1| unknown [Zea mays]
Length=157

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 71/117 (61%), Gaps = 12/117 (10%)
 Frame = +2

Query  497  MEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN-PNNHSYMG-----------EVP  640
            ++ SL+L+LNY+ ++ +W         ++    L    P++++ M            ++P
Sbjct  32   LQTSLSLTLNYEAIIQSWGSSPWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDLP  91

Query  641  VMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDG  811
                      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A+ G
Sbjct  92   GTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRATAG  148



>ref|XP_011098790.1| PREDICTED: uncharacterized protein LOC105177366 isoform X2 [Sesamum 
indicum]
Length=306

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 76/126 (60%), Gaps = 31/126 (25%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWAR-DKTAFSLPNNP----NNH------------------  619
            L+L L+Y+ +L+AWSD+  L+ R  +++  +P+      N+H                  
Sbjct  184  LSLKLDYEEILNAWSDKGPLYIRVAESSQIVPDITHDILNSHEIVSNNVDGMMMLQRGRQ  243

Query  620  -SYMGEVPVMDNEE----RSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKG  784
             S +G VP MD          +REASVMRYKEKR   LFSKKIRYQVRK+NAEKRPRLKG
Sbjct  244  ESSVGVVPEMDENGMMAGNGNQREASVMRYKEKR---LFSKKIRYQVRKINAEKRPRLKG  300

Query  785  RFVRKA  802
            RFV+++
Sbjct  301  RFVKRS  306



>gb|KDP20116.1| hypothetical protein JCGZ_05885 [Jatropha curcas]
Length=431

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 80/135 (59%), Gaps = 17/135 (13%)
 Frame = +2

Query  434  PILSqqqeqdndddeYHQEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NP  610
            P ++    +    D++ +EMK + SL   LNY+ V+ AW+   + W    T  + P  NP
Sbjct  296  PAVTNTTVKVVSSDQHKKEMKRDVSL--RLNYEAVITAWASHGSPW----TTGTRPELNP  349

Query  611  NNH--SYMGEVPV--------MDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNA  760
            ++     +G  P           N   +  REA V+RYKEKR+TRLFSKKIRY+VRKLNA
Sbjct  350  DDCWPDCLGTCPKDGHHHPYRGHNGGGNGGREARVLRYKEKRRTRLFSKKIRYEVRKLNA  409

Query  761  EKRPRLKGRFVRKAS  805
            EKRPRL+GRFV++ S
Sbjct  410  EKRPRLQGRFVKRTS  424



>ref|XP_010927244.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X2 [Elaeis guineensis]
Length=416

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 74/109 (68%), Gaps = 12/109 (11%)
 Frame = +2

Query  497  MEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS-YMGEVPVMD-----NEE  658
            +++ L L LN++ VL AWS   +++A        P++P++ +  + ++  +D        
Sbjct  303  LKSGLGLKLNHEEVLQAWSGHGSVFAEG------PDSPHSSAEALAKLADIDLFPEAGSG  356

Query  659  RSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                REASV+RYKEKR++RLFSKKIRYQVRK+NA++RPR+KGRFV++ S
Sbjct  357  AGGMREASVLRYKEKRRSRLFSKKIRYQVRKVNADQRPRMKGRFVKRPS  405



>emb|CDY42769.1| BnaA03g47700D [Brassica napus]
Length=233

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             S  L L+Y  VL+AWSD+ + ++ D+   S     + H+ + E+ +      S  REAS
Sbjct  128  VSTFLKLDYDRVLEAWSDKESPFS-DEILGSHATGIDIHTMLAEIDLFGE---SGMREAS  183

Query  683  VMRYKEKRQTRLFS--KKIRYQVRKLNAEKRPRLKGRFVRK  799
            V+RYKEKR  RLFS  K+IRYQVRKL+A++RPR+KGRFVR+
Sbjct  184  VLRYKEKRMNRLFSNSKQIRYQVRKLSADQRPRMKGRFVRR  224



>gb|AFW87599.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (58%), Gaps = 16/121 (13%)
 Frame = +2

Query  497  MEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSL----PNNPNNHSYMGE----------  634
            ++ SL+L+LNY+ ++ +W         ++    L    P++  N   +G           
Sbjct  327  LQTSLSLTLNYEAIIQSWGSSPWTGGAERPHVKLDDSWPHDCTNMWVVGRGMVGHGGEDL  386

Query  635  --VPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASD  808
               P +        REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A+ 
Sbjct  387  LGTPRLGQGMDDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRATA  446

Query  809  G  811
            G
Sbjct  447  G  447



>ref|NP_001149457.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
 gb|ACG35514.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (58%), Gaps = 16/121 (13%)
 Frame = +2

Query  497  MEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSL----PNNPNNHSYMGE----------  634
            ++ SL+L+LNY+ ++ +W         ++    L    P++  N   +G           
Sbjct  327  LQTSLSLTLNYEAIIQSWGSSPWTGGAERPHVKLDDSWPHDCTNMWVVGRGMVGHGGEDL  386

Query  635  --VPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASD  808
               P +        REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A+ 
Sbjct  387  LGTPRLGQGMDDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRATA  446

Query  809  G  811
            G
Sbjct  447  G  447



>ref|XP_009420122.1| PREDICTED: uncharacterized protein LOC103999941 [Musa acuminata 
subsp. malaccensis]
Length=310

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 72/125 (58%), Gaps = 28/125 (22%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY----MGEVPVMDN-------  652
            +L L L+Y+ +L AWSDR  L+   +    +P   ++H+      G  PV+         
Sbjct  175  ALALKLDYEEILAAWSDRGPLYMDGEGPQVVPQL-HHHAADPYDAGAFPVLVEVGCCSSN  233

Query  653  -----EERST-----------RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKG  784
                 E+R+             REA VMRYKEKR+ RLF+K+IRY+VRKLNAEKRPRLKG
Sbjct  234  PMKVPEQRACDGDRTAEGSGLSREARVMRYKEKRRNRLFAKRIRYEVRKLNAEKRPRLKG  293

Query  785  RFVRK  799
            RFVR+
Sbjct  294  RFVRR  298



>ref|XP_004296491.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=430

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 66/98 (67%), Gaps = 6/98 (6%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMD-NEERSTRREASV  685
            L L L+Y  VL+AWSD+ + +  +     L    + +     +  +D   +    REASV
Sbjct  325  LMLKLDYDDVLNAWSDKASPFPEE-----LQGGADGNDVSARLAQIDLFTDAGGLREASV  379

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            +RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  380  LRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  417



>emb|CDY07383.1| BnaA07g24620D [Brassica napus]
Length=230

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (12%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWAR------DKTAFSLPNN--------PNNHS  622
            +E K E  L L L+Y+ V+  W  + T W        D        N         ++H+
Sbjct  105  KEEKKEKVLMLRLDYETVISTWGSQGTPWTALKPSEIDLDMLCCQTNSMCESGGEAHHHN  164

Query  623  YMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            +   + +   E     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV+++
Sbjct  165  HFPGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  224

Query  803  S  805
            S
Sbjct  225  S  225



>ref|XP_009137564.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Brassica rapa]
Length=383

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
             S  L L+Y  VL+AWSD+ + ++ D+   S     + H+ + E+ +      S  REAS
Sbjct  278  VSTFLKLDYDRVLEAWSDKESPFS-DEILGSHATGIDIHTMLAEIDLFG---ESGMREAS  333

Query  683  VMRYKEKRQTRLFS--KKIRYQVRKLNAEKRPRLKGRFVRK  799
            V+RYKEKR  RLFS  K+IRYQVRKL+A++RPR+KGRFVR+
Sbjct  334  VLRYKEKRMNRLFSNSKQIRYQVRKLSADQRPRMKGRFVRR  374



>ref|XP_011076793.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Sesamum indicum]
Length=439

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 69/108 (64%), Gaps = 13/108 (12%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDK-----TAFSLPNNPNN----HSYMGEVPVMDNEERST  667
            L L+Y+ VL AW D+++ W   +     +A   P+        H Y GE+ +M     + 
Sbjct  321  LRLDYEGVLSAWDDQKSPWTTGERPDLDSAGCWPDCMGTCGTVHVY-GEMGMMIGHAVAV  379

Query  668  R---REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
                REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A
Sbjct  380  GDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  427



>ref|XP_009410221.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=418

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 72/109 (66%), Gaps = 13/109 (12%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHS----YMGEVPVM-DNEERS  664
            EA L L LN++ VL AWS R ++++        P+ P++ +     + ++ +  D     
Sbjct  305  EAGLGLKLNHEEVLKAWSGRGSMFSDG------PDTPSSSADALAKLADIDLFPDATGAG  358

Query  665  TRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK--GRFVRKAS  805
            T REASV+RY+EKR++RLFSKKIRYQVRK NA++RPR+K  GRFVR  S
Sbjct  359  TVREASVLRYREKRRSRLFSKKIRYQVRKANADRRPRMKASGRFVRSPS  407



>ref|XP_006440964.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
 gb|ESR54204.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
Length=403

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 67/121 (55%), Gaps = 21/121 (17%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY----------------  625
            K+  ++ L LNY  V+ AW+ +   W    TA S P    NH +                
Sbjct  275  KLMRNVCLKLNYDAVITAWASQGCPW----TAGSRPEINLNHCWPHCTGLCCKDVHHHTC  330

Query  626  -MGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
              G V    +      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ 
Sbjct  331  GGGAVLRGCHLGAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  390

Query  803  S  805
            S
Sbjct  391  S  391



>gb|KGN61175.1| hypothetical protein Csa_2G061540 [Cucumis sativus]
Length=438

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L LNY+ V DAWS R + ++ D+   S     + ++ +  + +   E     REASV+
Sbjct  330  LLLKLNYEAVADAWSSRGSPFS-DEIPSSDTAGSDVNARVANIDLF-TEGGGLLREASVL  387

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRK+NA+ RPR+KGRFVR+
Sbjct  388  RYKEKRRTRLFSKKIRYQVRKVNADGRPRMKGRFVRR  424



>ref|XP_006413244.1| hypothetical protein EUTSA_v10025322mg [Eutrema salsugineum]
 gb|ESQ54697.1| hypothetical protein EUTSA_v10025322mg [Eutrema salsugineum]
Length=416

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 6/97 (6%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + ++ D+   S     + H+ + E+ +      S  REASV+RY
Sbjct  313  LKLDYDRVLEAWSDKESPFS-DEMLSSDSAGIDLHARLAEIDLFG---ESGMREASVLRY  368

Query  695  KEKRQTRLFS--KKIRYQVRKLNAEKRPRLKGRFVRK  799
            KEKR+ RLFS  +KIRYQVRKLNA++RPR+KGRFV+K
Sbjct  369  KEKRRNRLFSNSQKIRYQVRKLNADQRPRMKGRFVKK  405



>emb|CDX89377.1| BnaA01g15160D [Brassica napus]
Length=382

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 68/98 (69%), Gaps = 6/98 (6%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + ++ D+   S     + H+ + E+ +      S  REA V+RY
Sbjct  279  LKLDYDRVLEAWSDKESPFS-DEILGSEAAGSDVHASLAEIDLFGE---SGMREAIVLRY  334

Query  695  KEKRQTRLFS--KKIRYQVRKLNAEKRPRLKGRFVRKA  802
            KEKR+ RLFS  K+IRYQVRKLNA++RPR+KGRFVR++
Sbjct  335  KEKRRNRLFSNSKRIRYQVRKLNADQRPRMKGRFVRRS  372



>ref|XP_009627333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=446

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 7/104 (7%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDK-----TAFSLPNNPNNHSYMGEVPVMDNEERST--RR  673
            L+L+Y+ VL AW+D+R+ W   +     +    P+   N   +    +M+         R
Sbjct  334  LNLDYESVLTAWADQRSPWTNGERPELDSNDCWPDCMGNCGTIHPYGIMNGHTTMIDRGR  393

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            EA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++++
Sbjct  394  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSN  437



>ref|XP_008799931.1| PREDICTED: uncharacterized protein LOC103714457 [Phoenix dactylifera]
Length=268

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 65/105 (62%), Gaps = 10/105 (10%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYM--------GEVPVMDNEE--RS  664
            L L+Y+ VL AWSDR +L+   +    +P      S +          VP  D  E    
Sbjct  161  LKLDYEEVLTAWSDRGSLYIDGEGPQIVPELHRTASPVFVEVGCTGWRVPESDRMEGKEV  220

Query  665  TRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
              REA VMRYKEKR++R FSK+IRY+VRKLNAEKRPRLKGRFVR+
Sbjct  221  GNREARVMRYKEKRRSRHFSKQIRYEVRKLNAEKRPRLKGRFVRR  265



>gb|ABF00989.1| putative stress resistance-related protein [Oryza sativa Japonica 
Group]
Length=482

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +2

Query  491  MKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVM--DNEERS  664
            M  +  L L L+   VL AWS + +++A      S  +     + + ++ +   +     
Sbjct  366  MAPKTGLGLKLDADDVLKAWSGKGSMFADGGAPESPKSAAEVRAKLADIDLFPENGNGAG  425

Query  665  TRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
              REASVMRYKEKR+TRLFSKKIRYQVRK+NA+ RPR+KGRFVR  S
Sbjct  426  GIREASVMRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPS  472



>ref|XP_007036519.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY21020.1| Transcription factor, putative [Theobroma cacao]
Length=431

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 73/118 (62%), Gaps = 18/118 (15%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NPNN----------HSYMGEVP  640
            +M+ ++ L LNY+ V+ AW+ + + W    TA S P  NP++          H   G   
Sbjct  308  EMKRNMLLRLNYESVITAWARQGSPW----TAGSRPEFNPDDFMGSNLKEGHHLSGGIGG  363

Query  641  VMDNEERST---RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            +   + R      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ S
Sbjct  364  IYSLQGRGNTDGEREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  421



>ref|NP_001048022.1| Os02g0731700 [Oryza sativa Japonica Group]
 dbj|BAD15938.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16131.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF09936.1| Os02g0731700 [Oryza sativa Japonica Group]
 gb|EEE57750.1| hypothetical protein OsJ_08268 [Oryza sativa Japonica Group]
Length=323

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 70/119 (59%), Gaps = 25/119 (21%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN--PNNHSY-----------------M  628
            SL+L LNY+ ++++W +  + W   +      ++  PN+H Y                 M
Sbjct  202  SLDLRLNYEAIIESWGN--SPWTDGRPPHGQLDDFWPNDHHYSGLWAAGGGGHGAEVGMM  259

Query  629  GEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
               P MD       REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ S
Sbjct  260  TVRPRMDG----PGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPS  314



>ref|XP_010428333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=403

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 71/122 (58%), Gaps = 20/122 (16%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARD-KTAFSL------PNNPNNHSYMGEVPVMDNEE  658
            +ASL L L+Y+ V+ AW +  + W    K  F+L       NN      MG    + +  
Sbjct  276  KASLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDGCLLGGNNTCPSHVMGGFEELASAV  335

Query  659  RST-------------RREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RS               REA V+RY+EKR+TRLF+KKIRY+VRKLNAE+RPR+KGRFV++
Sbjct  336  RSVTRQQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVKR  395

Query  800  AS  805
             S
Sbjct  396  TS  397



>ref|XP_002533412.1| transcription factor, putative [Ricinus communis]
 gb|EEF28970.1| transcription factor, putative [Ricinus communis]
Length=430

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 75/121 (62%), Gaps = 19/121 (16%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY--MGEVPVMDN--  652
            +E K  ASL L LNY+ V++AW+ + + W    T+ S P   ++  +    ++ + D   
Sbjct  304  KETKSTASL-LRLNYEDVINAWASQGSPW----TSGSRPELNSDDCWPDCMDICLKDGHH  358

Query  653  ----------EERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
                         +  REA V+RYKEKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ 
Sbjct  359  HPYGGMGGHTRGGNGAREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  418

Query  803  S  805
            S
Sbjct  419  S  419



>ref|XP_010236261.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Brachypodium 
distachyon]
Length=440

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 63/100 (63%), Gaps = 1/100 (1%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVM-DNEERSTRREASV  685
            L L L+   VL  WS + +++A      S  +     + + ++ +  +N      REASV
Sbjct  331  LGLKLDADDVLKEWSGKGSMFAEGGGPESTESAAEVRAKLADIDLFPENGAAGGIREASV  390

Query  686  MRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            MRYKEKR+ RLFSKKIRYQVRK+NA+ RPR+KGRFVR  S
Sbjct  391  MRYKEKRRNRLFSKKIRYQVRKVNADCRPRMKGRFVRSPS  430



>ref|XP_003560836.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Brachypodium 
distachyon]
Length=436

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 71/113 (63%), Gaps = 16/113 (14%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY------MGEVPVMDNEE--R  661
            SL+L+LNY+ ++D W   ++ WA  K      +    H Y      MG V V    E  R
Sbjct  315  SLSLNLNYEAIIDKWE--KSPWADGKRPDVKLDGCWPHDYSMSVWMMGGVLVGHGTEELR  372

Query  662  STR------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            + R      R+A V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A
Sbjct  373  TPRTKMDGGRDARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  425



>ref|XP_009371730.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8 [Pyrus x bretschneideri]
Length=363

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 71/119 (60%), Gaps = 21/119 (18%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWA---------------RDKTAFSLPNNPNNHSYMG---  631
            SL L L+Y+ +L+AWSD+  L+                +D   F L +N +     G   
Sbjct  244  SLALKLDYEEILNAWSDKGPLYIDGGDSPQTVPDSMHQQDHQLFQLDHNSSTPDGSGGKL  303

Query  632  -EVPVMDN--EERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
              VP  D   + +  +R ASV+RYKEKR  RL+SK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  304  WRVPEEDGSLKMKMEQRLASVLRYKEKRHNRLYSKRIRYQVRKLNAEKRPRMKGRFVKR  362



>ref|XP_007014424.1| Chloroplast import apparatus 2, putative isoform 2 [Theobroma 
cacao]
 gb|EOY32043.1| Chloroplast import apparatus 2, putative isoform 2 [Theobroma 
cacao]
Length=400

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 3/93 (3%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            A L L LNY  V++AWSDR + +A +      P    N  Y     +    +    REAS
Sbjct  309  AGLQLKLNYDEVVNAWSDRGSPFAEESPG---PEVAGNDVYARLAQIDLFSDGGGVREAS  365

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK  781
            V+RYKEKR+TRLFSKKIRYQVRK+NA++RPR+K
Sbjct  366  VLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMK  398



>ref|XP_003637430.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
Length=166

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 68/120 (57%), Gaps = 20/120 (17%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWAR-DKTAFSLPNN---------PNNHSYMGEV--  637
            K +  ++L L+Y  V+ AW  ++  W   DK       N            H   GE   
Sbjct  41   KGKRKISLQLDYDAVIIAWDSQKCPWTNGDKPILDADENWPDCMGTFGTEVHYAYGEFGG  100

Query  638  ----PVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                PVM +      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++AS
Sbjct  101  YGCHPVMVD----GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS  156



>gb|EEC73943.1| hypothetical protein OsI_08813 [Oryza sativa Indica Group]
Length=324

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 70/120 (58%), Gaps = 26/120 (22%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN--PNNHSY------------------  625
            SL+L LNY+ ++++W +  + W   +      ++  PN+H Y                  
Sbjct  202  SLDLRLNYEAIIESWGN--SPWTDGRPPHGQLDDFWPNDHHYSVRVVGAGGGGHGAEVGM  259

Query  626  MGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            M   P MD       REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ S
Sbjct  260  MTVRPRMDG----PGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPS  315



>ref|XP_006453246.1| hypothetical protein CICLE_v10008308mg [Citrus clementina]
 ref|XP_006474272.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR66486.1| hypothetical protein CICLE_v10008308mg [Citrus clementina]
Length=442

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L L Y  VL+AWS + + +  +    SL  +   +     +  +D       REASV+
Sbjct  330  LLLKLQYDDVLNAWSGKGSPFLDE----SLAPDGQGNDVSARLAQIDLFSDGGLREASVL  385

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  386  RYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  422



>gb|AEF12200.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN16579.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=371

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 68/106 (64%), Gaps = 11/106 (10%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTL-WARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTR-----  670
            + L LNY  V+ AWS + +  W    T  + P   +++ +   +  +D E RS R     
Sbjct  259  IFLRLNYDEVITAWSSQGSSPW----TTSNPPKFNSDYDFSLGLSGVDGEGRSLRGHLDG  314

Query  671  -REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
             REA V RY+EKR+TRLF+KKIRY+VRKLNAEKRPR+KGRFV++  
Sbjct  315  GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTC  360



>ref|XP_006829901.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
 gb|ERM97317.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
Length=390

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 69/113 (61%), Gaps = 10/113 (9%)
 Frame = +2

Query  491  MKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGE-VPVMDNEERST  667
            + +E S++L L+Y+ V+ AW   R+ W   +     P++     + G  VP M       
Sbjct  272  IVLEKSISLRLDYEAVISAWG--RSPWTTGQRPEFNPDDCWPDPFTGNCVPEMSTYSEVG  329

Query  668  R-------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                    REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ S
Sbjct  330  NATASDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  382



>ref|XP_004499509.1| PREDICTED: uncharacterized protein LOC101500857 isoform X2 [Cicer 
arietinum]
Length=320

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 81/127 (64%), Gaps = 28/127 (22%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLW--ARDKTAFSLPN------NPNNHSYMG---------  631
             SL+L L++  +L+AWSD+  L+  A D+   ++P+       P N+++ G         
Sbjct  193  GSLSLKLDHDGILNAWSDKGPLYVDAGDEAPQTVPDLFNASSFPPNNAWDGCGCDVVGNT  252

Query  632  -EVP-------VMDNEE---RSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRL  778
             +VP       +   EE   +  +REAS++RYKEKRQ+RLF+K+IRY+VRKLNAEKRPR+
Sbjct  253  WKVPEGCGANDIKVKEEMGWKLGQREASLLRYKEKRQSRLFAKRIRYEVRKLNAEKRPRM  312

Query  779  KGRFVRK  799
            KGRFV++
Sbjct  313  KGRFVKR  319



>ref|XP_009340847.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=387

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 21/120 (18%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWA---------------RDKTAFSLPNNPNNHSYMG---  631
            SL L L+Y+ +L+AWSD+  L+                +D   F L  N +  +  G   
Sbjct  268  SLALKLDYEEILNAWSDKGPLYIDGGDSPQTVPDLLHQQDHQLFHLHENSSTPNGSGGNL  327

Query  632  -EVPVMDN--EERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
              VP  D   + +  +RE S++RYKEKR+ RL+SK+IRYQVRKLNAEKRPR+KGRFV+++
Sbjct  328  WRVPEEDGSLKMKMEQRETSMLRYKEKRRNRLYSKRIRYQVRKLNAEKRPRMKGRFVKRS  387



>ref|XP_010263709.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Nelumbo nucifera]
Length=451

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 23/125 (18%)
 Frame = +2

Query  488  EMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPV--------  643
            +M  + SL L LNY+ V+ AW+ + + W   +     P++      MG  P+        
Sbjct  321  KMSSKISLRLRLNYEGVICAWASKGSPWTTGERPQFNPDDDCWPDCMGTYPMEVYHHHPY  380

Query  644  -----------MDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRF  790
                       M N      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRF
Sbjct  381  GEMGGVGGHVTMGN----GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  436

Query  791  VRKAS  805
            V++ S
Sbjct  437  VKRTS  441



>gb|KHN05568.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=242

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 28/119 (24%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN-NPNN-------------HSYMGEV---  637
            ++L L+Y+ ++ AW+ +++ W    T    PN +P+              H   GE+   
Sbjct  121  VSLQLDYEAIIIAWASQKSPW----TTADKPNLDPDECWKQCMGSCETAYHHPCGEMGGF  176

Query  638  ---PVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
               PV+ +      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++AS
Sbjct  177  GIHPVIID----GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS  231



>gb|AAG52391.1|AC011915_5 putative B-box zinc finger protein; 52092-50677 [Arabidopsis 
thaliana]
Length=405

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 73/123 (59%), Gaps = 14/123 (11%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLW-AR-----DKTAFSLPNN--------PNNHS  622
            +E K E +L L L+Y+ V+  W  +   W AR     D      P +         ++H+
Sbjct  280  KEEKKEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHN  339

Query  623  YMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            +   + +   +     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV+++
Sbjct  340  HFRGLGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  399

Query  803  SDG  811
            S G
Sbjct  400  SIG  402



>ref|XP_011071256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Sesamum 
indicum]
Length=458

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 72/122 (59%), Gaps = 16/122 (13%)
 Frame = +2

Query  485  QEMKM--EASLNLSLNYQHVLDAWSDRRTLWARDKTA----------FSLPNNPNNHSYM  628
            QE KM   +   L L+Y+ VL AW D+++ W   +              L  +   H Y 
Sbjct  323  QECKMGDSSKTFLRLDYEGVLSAWDDKKSPWTTGERPNLDSCDCWPDHCLGTSGAMHVY-  381

Query  629  GEVPVMDNEERSTR---REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            GE+  M     +     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++
Sbjct  382  GEMGRMSGHAAAMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  441

Query  800  AS  805
            ++
Sbjct  442  SN  443



>ref|NP_564932.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
 sp|Q8LG76.2|COL6_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 6 [Arabidopsis 
thaliana]
 gb|AAK96816.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAM10103.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AEE34802.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
Length=406

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 73/123 (59%), Gaps = 14/123 (11%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLW-AR-----DKTAFSLPNN--------PNNHS  622
            +E K E +L L L+Y+ V+  W  +   W AR     D      P +         ++H+
Sbjct  281  KEEKKEKALMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHN  340

Query  623  YMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            +   + +   +     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV+++
Sbjct  341  HFRGLGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  400

Query  803  SDG  811
            S G
Sbjct  401  SIG  403



>ref|XP_006646882.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Oryza 
brachyantha]
Length=480

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 65/113 (58%), Gaps = 26/113 (23%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN--------------PNNHSYMGEVPVM  646
            L L L+   VL AWS + +++A D  A   P +              P N S  G +   
Sbjct  370  LGLKLDTDDVLKAWSGKGSMFA-DGGAPESPKSAAEVRAKLADIDLFPENGSGAGGI---  425

Query  647  DNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                    REASVMRYKEKR+TRLFSKKIRYQVRK+NA+ RPR+KGRFVR  S
Sbjct  426  --------REASVMRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPS  470



>ref|XP_003530677.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=371

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 68/106 (64%), Gaps = 11/106 (10%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTL-WARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTR-----  670
            + L LNY  V+ AWS + +  W    T  + P   +++ +   +  +D E RS R     
Sbjct  259  IFLRLNYDEVITAWSSQGSSPW----TTSNPPKFNSDYDFSLGLSGVDGEGRSLRGHLDG  314

Query  671  -REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
             REA V RY+EKR+TRLF+KKIRY+VRKLNAEKRPR+KGRFV++  
Sbjct  315  GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTC  360



>ref|XP_006485786.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO57445.1| hypothetical protein CISIN_1g015643mg [Citrus sinensis]
Length=403

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 68/121 (56%), Gaps = 21/121 (17%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSY----------------  625
            K+  +++L LNY  V+ AW+ +   W    TA S P    NH +                
Sbjct  275  KLMRNVSLKLNYDAVITAWASQGCPW----TAGSRPEINLNHCWPYCTGLCCKGVHHHTC  330

Query  626  -MGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
              G V    +      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ 
Sbjct  331  GGGAVLRGCHLGAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  390

Query  803  S  805
            S
Sbjct  391  S  391



>ref|XP_009105041.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Brassica rapa]
 ref|XP_009105042.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Brassica rapa]
Length=402

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (12%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWAR------DKTAFSLPNN--------PNNHS  622
            +E K E  L L L+Y+ V+  W  + T W        D        N         ++H+
Sbjct  277  KEEKKEKVLMLRLDYETVISTWGSQGTPWTALKPSEIDLDMLCCQTNSMCESGGEAHHHN  336

Query  623  YMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            +   + +   E     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV+++
Sbjct  337  HFPGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  396

Query  803  S  805
            S
Sbjct  397  S  397



>ref|XP_006649016.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=331

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 14/118 (12%)
 Frame = +2

Query  497  MEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN-PNNHSYMGE-------------  634
             + SL+L LNY+ ++++W        R      L +  PN+H Y G              
Sbjct  206  FQKSLDLRLNYEEIIESWGSSPWTDGRRPHGHQLDDFWPNDHHYQGLWAAGGGGHGAEAG  265

Query  635  VPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASD  808
              VM        REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++ ++
Sbjct  266  TTVMRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPAE  323



>ref|XP_010029065.1| PREDICTED: uncharacterized protein LOC104419187 [Eucalyptus grandis]
 gb|KCW55906.1| hypothetical protein EUGRSUZ_I01705 [Eucalyptus grandis]
Length=362

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 76/129 (59%), Gaps = 34/129 (26%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLW-----ARDKTAFSLPNNPNNHSYMGEVPVMDN-------  652
            L+L L+YQ +LDAWSD+ +L+     A  +T  ++P+     S  G + V +N       
Sbjct  232  LSLKLDYQEILDAWSDKGSLFVYGGNANHETPQTVPDLMRVDS--GPMDVWENVWRVPEK  289

Query  653  --------------------EERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRP  772
                                 ++  +REASV+RYKEKR +RLFSK+IRY+VRKLNA+KRP
Sbjct  290  AAESEAAINRDAIAEDGGEFSDKIRQREASVLRYKEKRHSRLFSKRIRYEVRKLNAQKRP  349

Query  773  RLKGRFVRK  799
            R+KGRFVR+
Sbjct  350  RIKGRFVRR  358



>ref|XP_009370323.1| PREDICTED: uncharacterized protein LOC103959692 [Pyrus x bretschneideri]
Length=363

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 71/119 (60%), Gaps = 21/119 (18%)
 Frame = +2

Query  506  SLNLSLNYQHVLDAWSDRRTLWA---------------RDKTAFSLPNNPNNHSYMG---  631
            SL L L+Y+ +L+AWSD+  L+                +D   F L +N +     G   
Sbjct  244  SLALKLDYEEILNAWSDKGPLYIDGGDSPQTVPDSMHQQDHQLFQLDHNSSTPDGSGGKL  303

Query  632  -EVPVMDN--EERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
              VP  D   + +  +R ASV+RYKEKR  RL+SK+IRYQVRKLNAEKRPR+KGRFV++
Sbjct  304  WRVPEEDGSLKMKMEQRLASVLRYKEKRHNRLYSKRIRYQVRKLNAEKRPRMKGRFVKR  362



>ref|XP_008363941.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Malus 
domestica]
Length=436

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 66/100 (66%), Gaps = 3/100 (3%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREA  679
            E  L L L+Y  VL+AW D+ + ++ +        N +  + +  + +  +      REA
Sbjct  327  EPGLKLKLDYDDVLNAWXDKASPFSEEMPGSDAAGN-DVAARLAXIDLFSD--VGGLREA  383

Query  680  SVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            SV+RYKEKR+TRLF KKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  384  SVLRYKEKRRTRLFXKKIRYQVRKVNADQRPRMKGRFVRR  423



>gb|ADK63396.1| B-box type zinc finger protein [Brassica rapa]
Length=265

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 17/121 (14%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKT------AFSLPNN--------PNNHS  622
            +E K E    L L+Y+ V+  W  + T W   +T          P +         ++H+
Sbjct  143  KEEKNEKVHMLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHN  202

Query  623  YMGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKA  802
            Y+  + +   E     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV+++
Sbjct  203  YVRGLGLHMGE---AGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  259

Query  803  S  805
            S
Sbjct  260  S  260



>ref|XP_007142909.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
 gb|ESW14903.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
Length=409

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 74/122 (61%), Gaps = 34/122 (28%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNN------HSYM-----------GEV  637
            ++L L+Y+ V+ AW+ +++ W       + P+ PN       H  M           GEV
Sbjct  288  ISLQLDYESVITAWASQKSPW-------TTPHKPNLDPDECWHHCMESCGTGMDDPYGEV  340

Query  638  ------PVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
                  P++++      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++
Sbjct  341  GGFGIHPMIND----GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  396

Query  800  AS  805
            AS
Sbjct  397  AS  398



>ref|XP_010046933.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Eucalyptus 
grandis]
 gb|KCW78650.1| hypothetical protein EUGRSUZ_C00112 [Eucalyptus grandis]
Length=397

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L LNY  V+DAWS + + +  D          +  + + ++ +    E    REASV 
Sbjct  295  LLLKLNYDEVVDAWSGKGSPFPDDSDG----AGNDVSARLAQIDLF--LESGGLREASVQ  348

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TRLFSKKIRYQVRK+NA++RPR+KGRFVR+
Sbjct  349  RYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR  385



>ref|NP_001140584.1| uncharacterized protein LOC100272654 [Zea mays]
 gb|ACN28503.1| unknown [Zea mays]
 gb|AFW76935.1| hypothetical protein ZEAMMB73_075677 [Zea mays]
 gb|AIB05431.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=452

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 71/117 (61%), Gaps = 12/117 (10%)
 Frame = +2

Query  497  MEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN-PNNHSYM-----------GEVP  640
            ++ SL+L+LNY+ ++ +W         ++    L    P++++ M            ++P
Sbjct  327  LQTSLSLTLNYEAIIQSWGSSPWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDLP  386

Query  641  VMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDG  811
                      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++A+ G
Sbjct  387  GTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRATAG  443



>ref|XP_010690870.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=435

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 67/110 (61%), Gaps = 10/110 (9%)
 Frame = +2

Query  491  MKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTR  670
             K    + L LNY  VLDAWSDR + ++ D       +  +  + + ++ +    E    
Sbjct  319  FKSSPGVLLKLNYDEVLDAWSDRGSPYSDDIPGSEF-SGTDALARLAQIDLFG--ESGAL  375

Query  671  REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLK-------GRFVRK  799
            REASV RYKEKR+TR FSKKIRYQVRK+NA++RPR+K       GRFVR+
Sbjct  376  REASVQRYKEKRRTRFFSKKIRYQVRKVNADQRPRMKVCNYDNPGRFVRR  425



>ref|XP_009139739.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Brassica rapa]
Length=382

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 6/98 (6%)
 Frame = +2

Query  515  LSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVMRY  694
            L L+Y  VL+AWSD+ + ++ D+   S     + H+ + E+ +      S  REA V+RY
Sbjct  279  LKLDYDRVLEAWSDKESPFS-DEILGSEAAGSDIHARLAEIDLFGE---SGMREAIVLRY  334

Query  695  KEKRQTRLFS--KKIRYQVRKLNAEKRPRLKGRFVRKA  802
            KEKR+ RLFS  K+IRYQVRKLNA++RPR+KGRFVR +
Sbjct  335  KEKRRNRLFSNSKRIRYQVRKLNADQRPRMKGRFVRNS  372



>ref|XP_004305701.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Fragaria 
vesca subsp. vesca]
Length=488

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREASVM  688
            L L LNY  VL AWSD+ + +  +    ++ N+ +    + ++ +  +   S  REASV+
Sbjct  383  LMLKLNYDDVLSAWSDKASPFPEELQDGAVGNDVSTR--LAQIDLFTDT--SGLREASVL  438

Query  689  RYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            RYKEKR+TR FSKKI YQVRK+N ++RPR+KGRFVR+
Sbjct  439  RYKEKRRTRFFSKKIMYQVRKVNVDRRPRMKGRFVRR  475



>emb|CDP16632.1| unnamed protein product [Coffea canephora]
Length=395

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 73/148 (49%), Gaps = 52/148 (35%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWAR-------------DKTAFSLPNNPNNHSYMGE-----  634
            L+L LNYQ +L+AWSD+  L+               D   F LP   +N S  G+     
Sbjct  248  LSLKLNYQEILNAWSDKAPLYVHAAQDSPQTVPDIHDHDRF-LPPQLSNGSSDGQGSCGG  306

Query  635  ----VPVM-----------------------------DNEERSTRREASVMRYKEKRQTR  715
                VP M                               E +  +REASV RYKEKRQ R
Sbjct  307  CVWRVPEMMMTKKTNEQGLASVRVKAEEQQEQVEVVGGKELKVGQREASVRRYKEKRQNR  366

Query  716  LFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
            LFSK+IRYQVRKLNAEKRPRLKGRFV++
Sbjct  367  LFSKQIRYQVRKLNAEKRPRLKGRFVKR  394



>ref|NP_177528.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
 sp|Q9C9A9.1|COL7_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 7 [Arabidopsis 
thaliana]
 gb|AAG52532.1|AC016662_26 hypothetical protein; 93964-92656 [Arabidopsis thaliana]
 gb|AAU84677.1| At1g73870 [Arabidopsis thaliana]
 gb|AAV43785.1| At1g73870 [Arabidopsis thaliana]
 gb|AEE35518.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
Length=392

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 68/116 (59%), Gaps = 14/116 (12%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWARD-KTAFSLPNNPNN-HSYMGEVPVMDNEERSTR-  670
            + SL L L+Y  V+ AW +  + W    K    L  N    H   G   +M ++   TR 
Sbjct  274  KTSLFLRLDYGAVISAWDNHGSPWKTGIKPECMLGGNTCLPHVVGGYEKLMSSDGSVTRQ  333

Query  671  -----------REASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
                       REA V+RYKEKR+TRLFSKKIRY+VRKLNAE+RPR+KGRFV++ S
Sbjct  334  QGRDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVKRTS  389



>ref|XP_002888669.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64928.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 70/117 (60%), Gaps = 13/117 (11%)
 Frame = +2

Query  500  EASLNLSLNYQHVLDAWSDRRTLWA-RDKTAFSL------------PNNPNNHSYMGEVP  640
            E +L L L+Y+ V+  W+ +   W  R+ +   L                ++H++   + 
Sbjct  293  EKALMLRLDYESVISTWNGQGIPWTDREPSEIDLDMVCCPTHSLGESGEAHHHNHFRGLG  352

Query  641  VMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDG  811
            +   E     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV+++S G
Sbjct  353  LHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSIG  409



>gb|KHG01643.1| chloroplast import apparatus 2 -like protein [Gossypium arboreum]
Length=433

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 73/112 (65%), Gaps = 10/112 (9%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTR-----R  673
            L L LNY++V++AWSD  + ++ +      P + + ++ + +V ++   E         R
Sbjct  327  LKLKLNYENVVNAWSDGASPFSEEP-----PADDDVYARLAQVELLSEGEAEAEAEGGGR  381

Query  674  EASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDGD**KER  829
            +ASV+RYK+KR TRL S KIRYQVRK+NA++RPR+KGRFVR+ S     +ER
Sbjct  382  KASVLRYKQKRHTRLLSTKIRYQVRKVNADRRPRIKGRFVRRPSSSTVSEER  433



>ref|XP_004235805.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
lycopersicum]
Length=408

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = +2

Query  509  LNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNN--PNNHS------YMGEVPVMDNEERS  664
            L LSLN++ V+ AW ++ + W         P++  P+  S      Y G V   D     
Sbjct  292  LFLSLNHEAVISAWPNQSSPWTNGIRPHFNPDDYWPDFFSETSVGNYGGHVRCGDG----  347

Query  665  TRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
              REA V RY+EKRQ RLFSKKIRY+VRKLNAEKRPRLKGRF++++S
Sbjct  348  -GREARVSRYREKRQNRLFSKKIRYEVRKLNAEKRPRLKGRFIKRSS  393



>ref|XP_010415472.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Camelina 
sativa]
Length=427

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 70/122 (57%), Gaps = 15/122 (12%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLW-ARDKTAFSLPNNPNNHSYMGE---------  634
            +E K E +L L L+Y+ VL  W  +   W A++ +   L         MGE         
Sbjct  301  KEEKKEKALMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVCCPTDSMGETGADQAHHY  360

Query  635  -----VPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRK  799
                 + +   E     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++
Sbjct  361  NHFRGLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  420

Query  800  AS  805
            +S
Sbjct  421  SS  422



>gb|EYU38741.1| hypothetical protein MIMGU_mgv1a008071mg [Erythranthe guttata]
Length=385

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +2

Query  503  ASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPNNPNNHSYMGEVPVMDNEERSTRREAS  682
            A L L LNY  VL+AWSD+ + ++ +          +  + + ++ +  ++  S  R A 
Sbjct  280  AGLLLKLNYDSVLNAWSDKGSPFSGESPGEKSAGK-DVQARLAQIELFPDDVAS--RGAI  336

Query  683  VMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKASDGD  814
            V+RYKEKR+TRLFSKKIRYQVRK+ A++RPR+KGRFVR  +  D
Sbjct  337  VLRYKEKRRTRLFSKKIRYQVRKVKADQRPRMKGRFVRTPNSPD  380



>ref|XP_007044348.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
 gb|EOY00180.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
Length=440

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 12/116 (10%)
 Frame = +2

Query  494  KMEASLNLSLNYQHVLDAWSDRRTLWARDKT-----------AFSLPNNPNNHSYMGEVP  640
            K +  + LSLNY+ V+ AW+ + + W                         +H+Y   + 
Sbjct  313  KKKRKILLSLNYESVITAWASQGSPWTSGGRPDFDPDECWPDCMGTGGTEVHHTYSDLIG  372

Query  641  VMDNEERS-TRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
            +  ++      REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV++AS
Sbjct  373  MGAHQALGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS  428



>ref|XP_006391130.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
 gb|ESQ28416.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
Length=399

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 71/120 (59%), Gaps = 17/120 (14%)
 Frame = +2

Query  485  QEMKMEASLNLSLNYQHVLDAWSDRRTLWARDKTAFSLPN--------NPNN-----HSY  625
            +E K E    L L+YQ V+  W  + T W    TA   P         +PN+     H++
Sbjct  279  KEEKKENVPMLRLDYQAVISTWGGQGTPW----TALEPPEIDLDMLCCSPNSTAHQHHNH  334

Query  626  MGEVPVMDNEERSTRREASVMRYKEKRQTRLFSKKIRYQVRKLNAEKRPRLKGRFVRKAS  805
               + +   +     REA V RY+EKR+TRLFSKKIRY+VRKLNAEKRPR+KGRFV+++S
Sbjct  335  FHGLGLRMGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSS  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2278597794392