BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18480_g2_i1 len=1897 path=[1:0-190 @192@!:191-1799 1801:1800-1800
1802:1801-1896]

Length=1897
                                                                      Score     E

ref|XP_009604191.1|  PREDICTED: putative indole-3-acetic acid-ami...    880   0.0      
ref|XP_008386644.1|  PREDICTED: putative indole-3-acetic acid-ami...    872   0.0      
ref|XP_008235040.1|  PREDICTED: putative indole-3-acetic acid-ami...    867   0.0      
ref|XP_007199764.1|  hypothetical protein PRUPE_ppa003141mg             867   0.0      
ref|XP_002263353.1|  PREDICTED: putative indole-3-acetic acid-ami...    866   0.0      Vitis vinifera
ref|XP_009775768.1|  PREDICTED: putative indole-3-acetic acid-ami...    864   0.0      
ref|XP_008368983.1|  PREDICTED: putative indole-3-acetic acid-ami...    862   0.0      
emb|CDP03514.1|  unnamed protein product                                859   0.0      
ref|XP_009342127.1|  PREDICTED: putative indole-3-acetic acid-ami...    857   0.0      
ref|XP_010090808.1|  hypothetical protein L484_009086                   854   0.0      
ref|XP_004290773.1|  PREDICTED: putative indole-3-acetic acid-ami...    853   0.0      
ref|XP_002531876.1|  Indole-3-acetic acid-amido synthetase GH3.17...    852   0.0      Ricinus communis
ref|XP_002302704.1|  auxin-responsive GH3 family protein                852   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007143845.1|  hypothetical protein PHAVU_007G106600g             850   0.0      
ref|XP_011009307.1|  PREDICTED: putative indole-3-acetic acid-ami...    850   0.0      
ref|XP_004496050.1|  PREDICTED: putative indole-3-acetic acid-ami...    844   0.0      
gb|KEH43223.1|  indole-3-acetic acid-amido synthetase                   842   0.0      
ref|XP_007050866.1|  Indole-3-acetic acid-amido synthetase GH3.9,...    840   0.0      
ref|XP_003536201.1|  PREDICTED: putative indole-3-acetic acid-ami...    835   0.0      
gb|EYU46693.1|  hypothetical protein MIMGU_mgv1a003107mg                827   0.0      
ref|XP_006444284.1|  hypothetical protein CICLE_v10019393mg             825   0.0      
ref|XP_003518956.1|  PREDICTED: putative indole-3-acetic acid-ami...    825   0.0      
ref|XP_009604193.1|  PREDICTED: putative indole-3-acetic acid-ami...    822   0.0      
ref|XP_011079705.1|  PREDICTED: putative indole-3-acetic acid-ami...    820   0.0      
ref|XP_010545027.1|  PREDICTED: putative indole-3-acetic acid-ami...    819   0.0      
ref|XP_010269496.1|  PREDICTED: putative indole-3-acetic acid-ami...    806   0.0      
ref|XP_010269495.1|  PREDICTED: putative indole-3-acetic acid-ami...    802   0.0      
ref|XP_010684416.1|  PREDICTED: putative indole-3-acetic acid-ami...    795   0.0      
ref|XP_008789923.1|  PREDICTED: probable indole-3-acetic acid-ami...    794   0.0      
ref|XP_010038195.1|  PREDICTED: putative indole-3-acetic acid-ami...    795   0.0      
ref|XP_009604192.1|  PREDICTED: putative indole-3-acetic acid-ami...    792   0.0      
emb|CDY53016.1|  BnaC04g00140D                                          785   0.0      
ref|XP_002882130.1|  auxin-responsive GH3 family protein                781   0.0      
ref|XP_009775769.1|  PREDICTED: putative indole-3-acetic acid-ami...    778   0.0      
emb|CDX80131.1|  BnaA05g00250D                                          778   0.0      
ref|XP_006293888.1|  hypothetical protein CARUB_v10022875mg             777   0.0      
ref|XP_006397970.1|  hypothetical protein EUTSA_v10001368mg             776   0.0      
ref|XP_009142505.1|  PREDICTED: putative indole-3-acetic acid-ami...    776   0.0      
ref|XP_010938422.1|  PREDICTED: probable indole-3-acetic acid-ami...    773   0.0      
emb|CBI36825.3|  unnamed protein product                                757   0.0      
ref|NP_182296.1|  putative indole-3-acetic acid-amido synthetase ...    758   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507858.1|  PREDICTED: putative indole-3-acetic acid-ami...    757   0.0      
gb|KDO87302.1|  hypothetical protein CISIN_1g044130mg                   741   0.0      
gb|ACJ68117.1|  putative indole-3-acetic acid-amido synthetase          735   0.0      Brassica napus [oilseed rape]
gb|EMT24142.1|  hypothetical protein F775_11820                         717   0.0      
ref|XP_003559815.1|  PREDICTED: probable indole-3-acetic acid-ami...    716   0.0      
ref|XP_004958633.1|  PREDICTED: probable indole-3-acetic acid-ami...    714   0.0      
gb|EMS61902.1|  hypothetical protein TRIUR3_17511                       713   0.0      
ref|XP_006840504.1|  hypothetical protein AMTR_s00045p00199760          709   0.0      
sp|P0C0M3.1|GH311_ORYSJ  RecName: Full=Probable indole-3-acetic a...    709   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006588600.1|  PREDICTED: putative indole-3-acetic acid-ami...    701   0.0      
gb|EEC82663.1|  hypothetical protein OsI_27288                          706   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006658099.1|  PREDICTED: probable indole-3-acetic acid-ami...    703   0.0      
ref|XP_006658096.1|  PREDICTED: probable indole-3-acetic acid-ami...    704   0.0      
gb|KEH43222.1|  indole-3-acetic acid-amido synthetase                   696   0.0      
ref|XP_008653454.1|  PREDICTED: probable indole-3-acetic acid-ami...    698   0.0      
ref|XP_008653453.1|  PREDICTED: probable indole-3-acetic acid-ami...    700   0.0      
ref|XP_004152165.1|  PREDICTED: indole-3-acetic acid-amido synthe...    699   0.0      
ref|XP_008454158.1|  PREDICTED: indole-3-acetic acid-amido synthe...    697   0.0      
ref|XP_010066475.1|  PREDICTED: indole-3-acetic acid-amido synthe...    694   0.0      
ref|XP_006844646.1|  hypothetical protein AMTR_s00016p00234260          685   0.0      
ref|XP_002268278.2|  PREDICTED: indole-3-acetic acid-amido synthe...    683   0.0      Vitis vinifera
ref|XP_002890761.1|  GH3.17                                             679   0.0      
ref|XP_002512687.1|  Indole-3-acetic acid-amido synthetase GH3.17...    677   0.0      Ricinus communis
ref|XP_009102930.1|  PREDICTED: indole-3-acetic acid-amido synthe...    678   0.0      
tpg|DAA64076.1|  TPA: hypothetical protein ZEAMMB73_443383              674   0.0      
ref|XP_006303207.1|  hypothetical protein CARUB_v10011293mg             676   0.0      
gb|KFK44683.1|  hypothetical protein AALP_AA1G290100                    676   0.0      
ref|NP_174134.1|  indole-3-acetic acid-amido synthetase GH3.17          676   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222270.1|  PREDICTED: indole-3-acetic acid-amido synthe...    673   0.0      
ref|XP_010460587.1|  PREDICTED: indole-3-acetic acid-amido synthe...    673   0.0      
ref|XP_010478176.1|  PREDICTED: indole-3-acetic acid-amido synthe...    672   0.0      
ref|XP_006286048.1|  hypothetical protein CARUB_v10007580mg             672   0.0      
ref|XP_010445414.1|  PREDICTED: indole-3-acetic acid-amido synthe...    671   0.0      
ref|XP_010436584.1|  PREDICTED: indole-3-acetic acid-amido synthe...    671   0.0      
emb|CDY15692.1|  BnaA07g08630D                                          671   0.0      
ref|XP_007043752.1|  Auxin-responsive GH3 family protein                671   0.0      
ref|XP_010499312.1|  PREDICTED: indole-3-acetic acid-amido synthe...    669   0.0      
ref|XP_010538163.1|  PREDICTED: indole-3-acetic acid-amido synthe...    669   0.0      
ref|XP_002299361.1|  auxin-responsive GH3 family protein                669   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006415692.1|  hypothetical protein EUTSA_v10007112mg             668   0.0      
emb|CDY63330.1|  BnaCnng41900D                                          667   0.0      
ref|XP_007222041.1|  hypothetical protein PRUPE_ppa003065mg             667   0.0      
ref|XP_010929717.1|  PREDICTED: indole-3-acetic acid-amido synthe...    665   0.0      
ref|XP_009353499.1|  PREDICTED: indole-3-acetic acid-amido synthe...    665   0.0      
gb|KDO46538.1|  hypothetical protein CISIN_1g007149mg                   665   0.0      
ref|XP_010234157.1|  PREDICTED: probable indole-3-acetic acid-ami...    659   0.0      
ref|XP_006494790.1|  PREDICTED: indole-3-acetic acid-amido synthe...    665   0.0      
ref|XP_008797151.1|  PREDICTED: indole-3-acetic acid-amido synthe...    664   0.0      
ref|XP_002303740.2|  auxin-responsive GH3 family protein                663   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011036210.1|  PREDICTED: indole-3-acetic acid-amido synthe...    663   0.0      
ref|XP_009380137.1|  PREDICTED: indole-3-acetic acid-amido synthe...    662   0.0      
ref|XP_009113698.1|  PREDICTED: indole-3-acetic acid-amido synthe...    662   0.0      
ref|XP_010249302.1|  PREDICTED: indole-3-acetic acid-amido synthe...    662   0.0      
ref|XP_011020911.1|  PREDICTED: indole-3-acetic acid-amido synthe...    662   0.0      
ref|NP_200262.1|  indole-3-acetic acid-amido synthetase GH3.6           661   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008390224.1|  PREDICTED: indole-3-acetic acid-amido synthe...    660   0.0      
ref|XP_010540435.1|  PREDICTED: indole-3-acetic acid-amido synthe...    660   0.0      
gb|AFG33002.1|  GH3 family protein                                      659   0.0      
gb|AAL47444.1|  AT5g54510/F24B18_13                                     659   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008355612.1|  PREDICTED: indole-3-acetic acid-amido synthe...    659   0.0      
ref|XP_009122951.1|  PREDICTED: indole-3-acetic acid-amido synthe...    657   0.0      
emb|CAN78161.1|  hypothetical protein VITISV_040921                     659   0.0      Vitis vinifera
ref|XP_006280192.1|  hypothetical protein CARUB_v10026098mg             656   0.0      
ref|XP_009359857.1|  PREDICTED: indole-3-acetic acid-amido synthe...    655   0.0      
gb|KFK27060.1|  hypothetical protein AALP_AA8G329100                    655   0.0      
emb|CDY22728.1|  BnaA08g05580D                                          654   0.0      
ref|XP_002866046.1|  hypothetical protein ARALYDRAFT_918581             654   0.0      
ref|XP_010539260.1|  PREDICTED: indole-3-acetic acid-amido synthe...    654   0.0      
ref|XP_010112000.1|  hypothetical protein L484_004686                   652   0.0      
ref|XP_009132438.1|  PREDICTED: indole-3-acetic acid-amido synthe...    650   0.0      
ref|XP_010267862.1|  PREDICTED: indole-3-acetic acid-amido synthe...    650   0.0      
emb|CDY62097.1|  BnaCnng39150D                                          650   0.0      
emb|CDY43824.1|  BnaC03g14570D                                          650   0.0      
ref|XP_006432395.1|  hypothetical protein CICLE_v10000544mg             651   0.0      
emb|CDY67943.1|  BnaAnng25610D                                          649   0.0      
ref|XP_010250483.1|  PREDICTED: indole-3-acetic acid-amido synthe...    649   0.0      
ref|XP_009127083.1|  PREDICTED: indole-3-acetic acid-amido synthe...    648   0.0      
ref|XP_010540432.1|  PREDICTED: indole-3-acetic acid-amido synthe...    648   0.0      
ref|XP_007021139.1|  Auxin-responsive GH3 family protein                647   0.0      
ref|XP_002533739.1|  Indole-3-acetic acid-amido synthetase GH3.6,...    647   0.0      Ricinus communis
ref|XP_006413097.1|  hypothetical protein EUTSA_v10024696mg             647   0.0      
emb|CDX92823.1|  BnaC07g40810D                                          646   0.0      
ref|XP_008674951.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...    646   0.0      
ref|XP_009137648.1|  PREDICTED: indole-3-acetic acid-amido synthe...    646   0.0      
ref|XP_010443025.1|  PREDICTED: indole-3-acetic acid-amido synthe...    643   0.0      
ref|NP_194456.1|  indole-3-acetic acid-amido synthetase GH3.5           646   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003564364.1|  PREDICTED: probable indole-3-acetic acid-ami...    646   0.0      
ref|XP_006283319.1|  hypothetical protein CARUB_v10004357mg             647   0.0      
ref|XP_006401565.1|  hypothetical protein EUTSA_v10012997mg             646   0.0      
ref|XP_003566071.1|  PREDICTED: probable indole-3-acetic acid-ami...    646   0.0      
emb|CDY43037.1|  BnaA03g11840D                                          645   0.0      
emb|CDY46653.1|  BnaA03g48550D                                          645   0.0      
ref|XP_008797411.1|  PREDICTED: probable indole-3-acetic acid-ami...    644   0.0      
ref|XP_010438643.1|  PREDICTED: indole-3-acetic acid-amido synthe...    644   0.0      
gb|EAY81150.1|  hypothetical protein OsI_36332                          645   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010448162.1|  PREDICTED: indole-3-acetic acid-amido synthe...    644   0.0      
emb|CDY29291.1|  BnaC01g19430D                                          642   0.0      
ref|XP_010448236.1|  PREDICTED: indole-3-acetic acid-amido synthe...    642   0.0      
ref|XP_010520883.1|  PREDICTED: indole-3-acetic acid-amido synthe...    642   0.0      
ref|XP_009143243.1|  PREDICTED: indole-3-acetic acid-amido synthe...    642   0.0      
ref|XP_010240996.1|  PREDICTED: indole-3-acetic acid-amido synthe...    642   0.0      
gb|KHG29342.1|  Indole-3-acetic acid-amido synthetase GH3.6 -like...    642   0.0      
ref|XP_009763610.1|  PREDICTED: indole-3-acetic acid-amido synthe...    641   0.0      
ref|XP_008789772.1|  PREDICTED: probable indole-3-acetic acid-ami...    641   0.0      
ref|XP_003576014.2|  PREDICTED: probable indole-3-acetic acid-ami...    642   0.0      
ref|XP_009408668.1|  PREDICTED: probable indole-3-acetic acid-ami...    640   0.0      
ref|XP_002869571.1|  GH3.5/WES1                                         640   0.0      
gb|KDP39002.1|  hypothetical protein JCGZ_00759                         640   0.0      
ref|XP_010062931.1|  PREDICTED: indole-3-acetic acid-amido synthe...    639   0.0      
ref|XP_004970208.1|  PREDICTED: probable indole-3-acetic acid-ami...    639   0.0      
emb|CDX89263.1|  BnaA01g16300D                                          639   0.0      
ref|XP_010924006.1|  PREDICTED: probable indole-3-acetic acid-ami...    638   0.0      
gb|KDO47749.1|  hypothetical protein CISIN_1g046696mg                   638   0.0      
ref|XP_006447440.1|  hypothetical protein CICLE_v10017968mg             638   0.0      
ref|XP_002456458.1|  hypothetical protein SORBIDRAFT_03g036680          638   0.0      Sorghum bicolor [broomcorn]
gb|KHG06705.1|  Indole-3-acetic acid-amido synthetase GH3.6 -like...    637   0.0      
ref|XP_004961601.1|  PREDICTED: probable indole-3-acetic acid-ami...    638   0.0      
ref|XP_006475255.1|  PREDICTED: indole-3-acetic acid-amido synthe...    637   0.0      
ref|XP_007214798.1|  hypothetical protein PRUPE_ppa002986mg             637   0.0      
ref|XP_007043391.1|  Auxin-responsive GH3 family protein                637   0.0      
emb|CDM84494.1|  unnamed protein product                                635   0.0      
gb|KHG01600.1|  Uncharacterized protein F383_23170                      634   0.0      
ref|XP_006452114.1|  hypothetical protein CICLE_v10007746mg             635   0.0      
ref|XP_009615928.1|  PREDICTED: indole-3-acetic acid-amido synthe...    635   0.0      
ref|XP_009621450.1|  PREDICTED: indole-3-acetic acid-amido synthe...    634   0.0      
gb|KHG17209.1|  Indole-3-acetic acid-amido synthetase GH3.6 -like...    634   0.0      
gb|AGH61310.1|  indole-3-acetic acid amido synthetase                   634   0.0      
ref|XP_011009953.1|  PREDICTED: indole-3-acetic acid-amido synthe...    634   0.0      
ref|XP_009377289.1|  PREDICTED: indole-3-acetic acid-amido synthe...    634   0.0      
ref|XP_011097950.1|  PREDICTED: indole-3-acetic acid-amido synthe...    634   0.0      
ref|XP_009779551.1|  PREDICTED: indole-3-acetic acid-amido synthe...    633   0.0      
ref|XP_010928643.1|  PREDICTED: probable indole-3-acetic acid-ami...    633   0.0      
ref|XP_009137649.1|  PREDICTED: indole-3-acetic acid-amido synthe...    633   0.0      
ref|XP_008226758.1|  PREDICTED: indole-3-acetic acid-amido synthe...    633   0.0      
ref|XP_011095287.1|  PREDICTED: indole-3-acetic acid-amido synthe...    633   0.0      
ref|XP_002449599.1|  hypothetical protein SORBIDRAFT_05g019810          635   0.0      Sorghum bicolor [broomcorn]
ref|XP_004244168.1|  PREDICTED: indole-3-acetic acid-amido synthe...    632   0.0      
gb|EYU19184.1|  hypothetical protein MIMGU_mgv1a003042mg                632   0.0      
ref|XP_002975803.1|  hypothetical protein SELMODRAFT_103740             632   0.0      
ref|XP_004980566.1|  PREDICTED: indole-3-acetic acid-amido synthe...    634   0.0      
emb|CAN83696.1|  hypothetical protein VITISV_013365                     632   0.0      Vitis vinifera
ref|XP_003540050.1|  PREDICTED: indole-3-acetic acid-amido synthe...    631   0.0      
ref|XP_002276241.2|  PREDICTED: indole-3-acetic acid-amido synthe...    631   0.0      Vitis vinifera
ref|NP_001044467.1|  Os01g0785400                                       631   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010548443.1|  PREDICTED: indole-3-acetic acid-amido synthe...    630   0.0      
ref|XP_006370580.1|  DWARF IN LIGHT 1 family protein                    630   0.0      
ref|XP_006360114.1|  PREDICTED: indole-3-acetic acid-amido synthe...    630   0.0      
ref|XP_002973755.1|  hypothetical protein SELMODRAFT_99818              630   0.0      
ref|XP_004958635.1|  PREDICTED: probable indole-3-acetic acid-ami...    625   0.0      
ref|XP_008365943.1|  PREDICTED: indole-3-acetic acid-amido synthe...    630   0.0      
ref|XP_002283229.2|  PREDICTED: indole-3-acetic acid-amido synthe...    632   0.0      Vitis vinifera
emb|CDP05830.1|  unnamed protein product                                630   0.0      
ref|XP_010694299.1|  PREDICTED: indole-3-acetic acid-amido synthe...    630   0.0      
ref|XP_004149936.1|  PREDICTED: indole-3-acetic acid-amido synthe...    630   0.0      
ref|XP_008452341.1|  PREDICTED: indole-3-acetic acid-amido synthe...    630   0.0      
ref|XP_003526154.1|  PREDICTED: indole-3-acetic acid-amido synthe...    630   0.0      
ref|NP_001055967.1|  Os05g0500900                                       630   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002316954.1|  DWARF IN LIGHT 1 family protein                    629   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004510013.1|  PREDICTED: indole-3-acetic acid-amido synthe...    628   0.0      
ref|XP_009346484.1|  PREDICTED: indole-3-acetic acid-amido synthe...    627   0.0      
ref|XP_011020987.1|  PREDICTED: indole-3-acetic acid-amido synthe...    627   0.0      
tpg|DAA42049.1|  TPA: hypothetical protein ZEAMMB73_501171              628   0.0      
ref|XP_004294315.1|  PREDICTED: indole-3-acetic acid-amido synthe...    627   0.0      
ref|XP_011030915.1|  PREDICTED: indole-3-acetic acid-amido synthe...    626   0.0      
ref|XP_009355553.1|  PREDICTED: indole-3-acetic acid-amido synthe...    626   0.0      
ref|XP_008670756.1|  PREDICTED: probable indole-3-acetic acid-ami...    628   0.0      
ref|XP_008359299.1|  PREDICTED: indole-3-acetic acid-amido synthe...    626   0.0      
gb|KEH19704.1|  indole-3-acetic acid-amido synthetase                   625   0.0      
ref|XP_010092269.1|  hypothetical protein L484_021129                   625   0.0      
ref|XP_006644816.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...    625   0.0      
ref|XP_006360545.1|  PREDICTED: indole-3-acetic acid-amido synthe...    624   0.0      
ref|XP_010518490.1|  PREDICTED: putative indole-3-acetic acid-ami...    626   0.0      
ref|XP_002319398.1|  hypothetical protein POPTR_0013s14740g             624   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006851205.1|  hypothetical protein AMTR_s00043p00208540          623   0.0      
ref|XP_008359298.1|  PREDICTED: indole-3-acetic acid-amido synthe...    623   0.0      
ref|XP_004251485.1|  PREDICTED: indole-3-acetic acid-amido synthe...    622   0.0      
ref|XP_007133123.1|  hypothetical protein PHAVU_011G153400g             620   0.0      
emb|CDP11866.1|  unnamed protein product                                619   0.0      
ref|NP_195455.1|  indole-3-acetic acid-amido synthetase GH3.2           619   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK30362.1|  hypothetical protein AALP_AA7G251400                    619   0.0      
emb|CAJ14972.1|  auxin-induced GH3 protein                              619   0.0      Pinus pinaster [cluster pine]
ref|XP_003543279.1|  PREDICTED: indole-3-acetic acid-amido synthe...    619   0.0      
ref|XP_006363511.1|  PREDICTED: indole-3-acetic acid-amido synthe...    618   0.0      
ref|XP_002868993.1|  hypothetical protein ARALYDRAFT_490882             617   0.0      
gb|AFW82417.1|  hypothetical protein ZEAMMB73_006681                    618   0.0      
ref|XP_009123833.1|  PREDICTED: indole-3-acetic acid-amido synthe...    615   0.0      
ref|XP_006411897.1|  hypothetical protein EUTSA_v10024716mg             615   0.0      
emb|CDX69296.1|  BnaC01g01570D                                          614   0.0      
ref|XP_002271252.1|  PREDICTED: probable indole-3-acetic acid-ami...    614   0.0      Vitis vinifera
emb|CDY69969.1|  BnaCnng66170D                                          610   0.0      
pdb|4B2G|A  Chain A, Crystal Structure Of An Indole-3-acetic Acid...    614   0.0      
ref|XP_006283369.1|  hypothetical protein CARUB_v10004412mg             614   0.0      
ref|XP_009402880.1|  PREDICTED: probable indole-3-acetic acid-ami...    614   0.0      
ref|NP_001146696.1|  uncharacterized protein LOC100280297               615   0.0      Zea mays [maize]
ref|XP_002441339.1|  hypothetical protein SORBIDRAFT_09g024710          615   0.0      Sorghum bicolor [broomcorn]
gb|KHN25755.1|  Indole-3-acetic acid-amido synthetase GH3.6             614   0.0      
ref|NP_001060163.1|  Os07g0592600                                       613   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009117296.1|  PREDICTED: indole-3-acetic acid-amido synthe...    612   0.0      
ref|XP_010485124.1|  PREDICTED: indole-3-acetic acid-amido synthe...    612   0.0      
emb|CDY46090.1|  BnaA09g42140D                                          612   0.0      
gb|KHN29920.1|  Putative indole-3-acetic acid-amido synthetase GH3.1    610   0.0      
ref|XP_003518806.1|  PREDICTED: probable indole-3-acetic acid-ami...    611   0.0      
gb|EPS63059.1|  hypothetical protein M569_11729                         610   0.0      
ref|XP_010446666.1|  PREDICTED: indole-3-acetic acid-amido synthe...    610   0.0      
ref|XP_010432064.1|  PREDICTED: indole-3-acetic acid-amido synthe...    610   0.0      
ref|XP_003596546.1|  Indole-3-acetic acid-amido synthetase GH3.6        610   0.0      
ref|XP_007149669.1|  hypothetical protein PHAVU_005G089200g             610   0.0      
gb|KHN27995.1|  Indole-3-acetic acid-amido synthetase GH3.6             609   0.0      
ref|XP_009367779.1|  PREDICTED: probable indole-3-acetic acid-ami...    608   0.0      
ref|XP_010271511.1|  PREDICTED: probable indole-3-acetic acid-ami...    608   0.0      
ref|XP_007199763.1|  hypothetical protein PRUPE_ppa003134mg             608   0.0      
ref|XP_004289743.1|  PREDICTED: probable indole-3-acetic acid-ami...    608   0.0      
ref|XP_006404785.1|  hypothetical protein EUTSA_v10000101mg             608   0.0      
ref|XP_010417072.1|  PREDICTED: indole-3-acetic acid-amido synthe...    608   0.0      
gb|KDP32021.1|  hypothetical protein JCGZ_12482                         607   0.0      
ref|XP_003541929.2|  PREDICTED: indole-3-acetic acid-amido synthe...    608   0.0      
ref|XP_008236406.1|  PREDICTED: probable indole-3-acetic acid-ami...    607   0.0      
gb|EYU33579.1|  hypothetical protein MIMGU_mgv1a002987mg                608   0.0      
ref|XP_010277152.1|  PREDICTED: probable indole-3-acetic acid-ami...    607   0.0      
ref|XP_007156752.1|  hypothetical protein PHAVU_002G014400g             607   0.0      
tpg|DAA57327.1|  TPA: hypothetical protein ZEAMMB73_719431              608   0.0      
ref|NP_001146837.1|  indole-3-acetic acid amido synthetase              607   0.0      Zea mays [maize]
gb|KHN06043.1|  Indole-3-acetic acid-amido synthetase GH3.6             606   0.0      
gb|KHN36576.1|  Indole-3-acetic acid-amido synthetase GH3.5             604   0.0      
ref|XP_007149929.1|  hypothetical protein PHAVU_005G111000g             608   0.0      
ref|XP_004490325.1|  PREDICTED: probable indole-3-acetic acid-ami...    606   0.0      
ref|XP_010472316.1|  PREDICTED: indole-3-acetic acid-amido synthe...    606   0.0      
gb|AAD32141.1|AF123503_1  Nt-gh3 deduced protein                        606   0.0      Nicotiana tabacum [American tobacco]
gb|ACI46148.1|  indole-3-acetic acid amido synthetase                   607   0.0      Zea mays [maize]
ref|NP_001151752.1|  indole-3-acetic acid-amido synthetase GH3.8        606   0.0      Zea mays [maize]
ref|XP_009395628.1|  PREDICTED: probable indole-3-acetic acid-ami...    606   0.0      
ref|XP_009772040.1|  PREDICTED: probable indole-3-acetic acid-ami...    605   0.0      
ref|XP_009339499.1|  PREDICTED: probable indole-3-acetic acid-ami...    605   0.0      
ref|XP_004243428.1|  PREDICTED: indole-3-acetic acid-amido synthe...    606   0.0      
tpg|DAA41299.1|  TPA: indole-3-acetic acid amido synthetase             606   0.0      
ref|XP_008365651.1|  PREDICTED: probable indole-3-acetic acid-ami...    605   0.0      
ref|XP_007208307.1|  hypothetical protein PRUPE_ppa003126mg             605   0.0      
ref|XP_002524947.1|  Indole-3-acetic acid-amido synthetase GH3.3,...    605   0.0      Ricinus communis
ref|XP_010429260.1|  PREDICTED: indole-3-acetic acid-amido synthe...    605   0.0      
ref|XP_007157602.1|  hypothetical protein PHAVU_002G083100g             605   0.0      
gb|ACN27604.1|  unknown                                                 605   0.0      
ref|XP_004149186.1|  PREDICTED: indole-3-acetic acid-amido synthe...    605   0.0      
gb|EYU37610.1|  hypothetical protein MIMGU_mgv1a003251mg                604   0.0      
ref|XP_004970078.1|  PREDICTED: probable indole-3-acetic acid-ami...    605   0.0      
gb|KDP44447.1|  hypothetical protein JCGZ_16280                         604   0.0      
ref|XP_006293849.1|  hypothetical protein CARUB_v10022833mg             605   0.0      
ref|XP_010547971.1|  PREDICTED: probable indole-3-acetic acid-ami...    603   0.0      
ref|XP_010095194.1|  hypothetical protein L484_008731                   604   0.0      
ref|XP_004958192.1|  PREDICTED: probable indole-3-acetic acid-ami...    603   0.0      
ref|XP_007042570.1|  Auxin-responsive GH3 family protein                603   0.0      
ref|XP_009397263.1|  PREDICTED: probable indole-3-acetic acid-ami...    602   0.0      
ref|XP_010691643.1|  PREDICTED: probable indole-3-acetic acid-ami...    602   0.0      
ref|XP_002880486.1|  GH3.3                                              602   0.0      
gb|KFK32769.1|  hypothetical protein AALP_AA6G286300                    601   0.0      
ref|XP_010679563.1|  PREDICTED: probable indole-3-acetic acid-ami...    601   0.0      
ref|NP_179898.1|  indole-3-acetic acid-amido synthetase GH3.3           601   0.0      
ref|XP_010437234.1|  PREDICTED: indole-3-acetic acid-amido synthe...    602   0.0      
ref|XP_008238544.1|  PREDICTED: probable indole-3-acetic acid-ami...    601   0.0      
ref|XP_010939642.1|  PREDICTED: probable indole-3-acetic acid-ami...    601   0.0      
ref|XP_010070615.1|  PREDICTED: probable indole-3-acetic acid-ami...    601   0.0      
ref|XP_009394764.1|  PREDICTED: probable indole-3-acetic acid-ami...    602   0.0      
ref|XP_003539320.1|  PREDICTED: probable indole-3-acetic acid-ami...    600   0.0      
ref|XP_004140723.1|  PREDICTED: probable indole-3-acetic acid-ami...    600   0.0      
ref|XP_009617606.1|  PREDICTED: probable indole-3-acetic acid-ami...    600   0.0      
gb|KCW59512.1|  hypothetical protein EUGRSUZ_H02264                     600   0.0      
ref|XP_008454612.1|  PREDICTED: indole-3-acetic acid-amido synthe...    600   0.0      
ref|XP_002463118.1|  hypothetical protein SORBIDRAFT_02g038170          601   0.0      
ref|XP_004157348.1|  PREDICTED: LOW QUALITY PROTEIN: probable ind...    600   0.0      
ref|XP_011088186.1|  PREDICTED: probable indole-3-acetic acid-ami...    600   0.0      
gb|KHN41185.1|  Indole-3-acetic acid-amido synthetase GH3.6             601   0.0      
ref|XP_007047426.1|  Auxin-responsive GH3 family protein                600   0.0      
ref|XP_006346338.1|  PREDICTED: probable indole-3-acetic acid-ami...    600   0.0      
ref|XP_003527474.1|  PREDICTED: indole-3-acetic acid-amido synthe...    600   0.0      
ref|XP_006573649.1|  PREDICTED: probable indole-3-acetic acid-ami...    598   0.0      
gb|AAS02074.1|  auxin and ethylene responsive GH3-like protein          599   0.0      
ref|XP_010099059.1|  hypothetical protein L484_011493                   599   0.0      
ref|XP_011092528.1|  PREDICTED: probable indole-3-acetic acid-ami...    599   0.0      
ref|XP_009372462.1|  PREDICTED: probable indole-3-acetic acid-ami...    599   0.0      
ref|XP_008338396.1|  PREDICTED: probable indole-3-acetic acid-ami...    599   0.0      
ref|XP_009350660.1|  PREDICTED: probable indole-3-acetic acid-ami...    598   0.0      
ref|XP_009782242.1|  PREDICTED: probable indole-3-acetic acid-ami...    598   0.0      
ref|XP_003540863.1|  PREDICTED: indole-3-acetic acid-amido synthe...    600   0.0      
ref|XP_003539512.2|  PREDICTED: indole-3-acetic acid-amido synthe...    600   0.0      
gb|ACF88044.1|  unknown                                                 596   0.0      
ref|XP_003569888.1|  PREDICTED: probable indole-3-acetic acid-ami...    598   0.0      
ref|XP_009394335.1|  PREDICTED: probable indole-3-acetic acid-ami...    599   0.0      
ref|XP_010028390.1|  PREDICTED: probable indole-3-acetic acid-ami...    598   0.0      
ref|XP_004487633.1|  PREDICTED: indole-3-acetic acid-amido synthe...    598   0.0      
gb|KHN36267.1|  Putative indole-3-acetic acid-amido synthetase GH3.1    597   0.0      
ref|NP_001169263.1|  hypothetical protein                               597   0.0      
ref|XP_009598101.1|  PREDICTED: probable indole-3-acetic acid-ami...    597   0.0      
ref|XP_008465614.1|  PREDICTED: probable indole-3-acetic acid-ami...    597   0.0      
ref|XP_009411073.1|  PREDICTED: probable indole-3-acetic acid-ami...    597   0.0      
ref|XP_008779774.1|  PREDICTED: probable indole-3-acetic acid-ami...    597   0.0      
ref|XP_003611653.1|  Indole-3-acetic acid-amido synthetase GH3.3        596   0.0      
gb|KDP23247.1|  hypothetical protein JCGZ_23080                         592   0.0      
ref|XP_004231891.1|  PREDICTED: probable indole-3-acetic acid-ami...    596   0.0      
ref|XP_011097389.1|  PREDICTED: probable indole-3-acetic acid-ami...    595   0.0      
ref|XP_002300248.2|  auxin-responsive GH3 family protein                595   0.0      
ref|XP_008373075.1|  PREDICTED: probable indole-3-acetic acid-ami...    595   0.0      
gb|KHN22868.1|  Indole-3-acetic acid-amido synthetase GH3.6             593   0.0      
ref|XP_002456397.1|  hypothetical protein SORBIDRAFT_03g035500          596   0.0      
gb|AFC36444.1|  GH3-1                                                   595   0.0      
ref|XP_009622718.1|  PREDICTED: probable indole-3-acetic acid-ami...    595   0.0      
ref|XP_004141893.1|  PREDICTED: probable indole-3-acetic acid-ami...    595   0.0      
ref|XP_007132598.1|  hypothetical protein PHAVU_011G108500g             595   0.0      
gb|EYU34549.1|  hypothetical protein MIMGU_mgv1a023361mg                595   0.0      
ref|XP_004230721.1|  PREDICTED: probable indole-3-acetic acid-ami...    595   0.0      
ref|XP_004163839.1|  PREDICTED: probable indole-3-acetic acid-ami...    595   0.0      
ref|XP_006339838.1|  PREDICTED: probable indole-3-acetic acid-ami...    595   0.0      
gb|AEL22119.1|  GH31                                                    595   0.0      
ref|XP_011030377.1|  PREDICTED: probable indole-3-acetic acid-ami...    594   0.0      
ref|XP_008440335.1|  PREDICTED: probable indole-3-acetic acid-ami...    594   0.0      
ref|XP_006646355.1|  PREDICTED: probable indole-3-acetic acid-ami...    594   0.0      
ref|XP_006466527.1|  PREDICTED: probable indole-3-acetic acid-ami...    593   0.0      
ref|XP_006486962.1|  PREDICTED: probable indole-3-acetic acid-ami...    593   0.0      
emb|CDX76870.1|  BnaC08g34560D                                          592   0.0      
ref|XP_006380674.1|  hypothetical protein POPTR_0007s10350g             592   0.0      
ref|XP_006422877.1|  hypothetical protein CICLE_v10028058mg             592   0.0      
ref|XP_006299420.1|  hypothetical protein CARUB_v10015580mg             592   0.0      
gb|ADK27716.1|  GH3                                                     592   0.0      
ref|XP_011012296.1|  PREDICTED: probable indole-3-acetic acid-ami...    592   0.0      
gb|ADN93114.1|  indole-3-acetic acid-amido synthetase                   592   0.0      
ref|XP_006426015.1|  hypothetical protein CICLE_v10025211mg             591   0.0      
ref|NP_001044345.1|  Os01g0764800                                       592   0.0      
gb|KDO79042.1|  hypothetical protein CISIN_1g007558mg                   591   0.0      
gb|KDO47942.1|  hypothetical protein CISIN_1g007532mg                   591   0.0      
ref|XP_009399301.1|  PREDICTED: probable indole-3-acetic acid-ami...    590   0.0      
ref|XP_006657906.1|  PREDICTED: probable indole-3-acetic acid-ami...    591   0.0      
gb|KEH17188.1|  indole-3-acetic acid-amido synthetase                   590   0.0      
ref|XP_002467673.1|  hypothetical protein SORBIDRAFT_01g032020          591   0.0      
ref|XP_011001484.1|  PREDICTED: probable indole-3-acetic acid-ami...    590   0.0      
ref|XP_006829263.1|  hypothetical protein AMTR_s00001p00272720          590   0.0      
gb|KHG22898.1|  Uncharacterized protein F383_10696                      590   0.0      
gb|AFC36443.1|  GH3-1                                                   590   0.0      
ref|XP_009123229.1|  PREDICTED: probable indole-3-acetic acid-ami...    589   0.0      
ref|XP_010087275.1|  hypothetical protein L484_009408                   589   0.0      
ref|XP_004141994.1|  PREDICTED: probable indole-3-acetic acid-ami...    588   0.0      
emb|CDY52419.1|  BnaCnng22400D                                          588   0.0      
ref|XP_008440334.1|  PREDICTED: probable indole-3-acetic acid-ami...    588   0.0      
ref|XP_010327157.1|  PREDICTED: indole-3-acetic acid-amido synthe...    589   0.0      
ref|XP_004983963.1|  PREDICTED: probable indole-3-acetic acid-ami...    588   0.0      
emb|CAN70815.1|  hypothetical protein VITISV_042944                     588   0.0      
ref|XP_002313887.2|  hypothetical protein POPTR_0009s09590g             591   0.0      
ref|XP_002283886.1|  PREDICTED: probable indole-3-acetic acid-ami...    587   0.0      
ref|XP_010517936.1|  PREDICTED: probable indole-3-acetic acid-ami...    586   0.0      
ref|XP_010028148.1|  PREDICTED: probable indole-3-acetic acid-ami...    586   0.0      
emb|CDY54470.1|  BnaA09g52740D                                          586   0.0      
ref|XP_002885948.1|  GH3.1                                              585   0.0      
ref|XP_010936557.1|  PREDICTED: probable indole-3-acetic acid-ami...    586   0.0      
ref|XP_004287982.1|  PREDICTED: probable indole-3-acetic acid-ami...    586   0.0      
ref|XP_009760129.1|  PREDICTED: probable indole-3-acetic acid-ami...    585   0.0      
gb|KFK39993.1|  hypothetical protein AALP_AA3G316200                    585   0.0      
ref|NP_179101.1|  putative indole-3-acetic acid-amido synthetase ...    585   0.0      
ref|XP_006409612.1|  hypothetical protein EUTSA_v10023027mg             585   0.0      
gb|KHG08695.1|  Uncharacterized protein F383_11873                      585   0.0      
ref|XP_010467277.1|  PREDICTED: probable indole-3-acetic acid-ami...    585   0.0      
gb|ADK27717.1|  GH3                                                     584   0.0      
ref|XP_010488935.1|  PREDICTED: probable indole-3-acetic acid-ami...    583   0.0      
gb|EPS59124.1|  nt-gh3 deduced protein                                  583   0.0      
ref|XP_002527466.1|  Indole-3-acetic acid-amido synthetase GH3.3,...    583   0.0      
ref|XP_010556087.1|  PREDICTED: 4-substituted benzoates-glutamate...    582   0.0      
ref|XP_011099346.1|  PREDICTED: probable indole-3-acetic acid-ami...    582   0.0      
tpg|DAA45873.1|  TPA: hypothetical protein ZEAMMB73_156027              582   0.0      
gb|KEH29592.1|  indole-3-acetic acid-amido synthetase                   582   0.0      
ref|XP_009388916.1|  PREDICTED: probable indole-3-acetic acid-ami...    581   0.0      
ref|XP_007155870.1|  hypothetical protein PHAVU_003G238700g             581   0.0      
ref|XP_003562778.1|  PREDICTED: probable indole-3-acetic acid-ami...    581   0.0      
emb|CDM84342.1|  unnamed protein product                                580   0.0      
dbj|BAJ99350.1|  predicted protein                                      582   0.0      
ref|XP_009775770.1|  PREDICTED: putative indole-3-acetic acid-ami...    576   0.0      
ref|XP_002886679.1|  GH3.4                                              579   0.0      
ref|XP_009631635.1|  PREDICTED: indole-3-acetic acid-amido synthe...    580   0.0      
ref|XP_009790940.1|  PREDICTED: indole-3-acetic acid-amido synthe...    579   0.0      
ref|XP_009604194.1|  PREDICTED: putative indole-3-acetic acid-ami...    575   0.0      
dbj|BAJ95141.1|  predicted protein                                      577   0.0      
dbj|BAG68923.1|  IAA-amido synthetase                                   575   0.0      
ref|XP_010556088.1|  PREDICTED: 4-substituted benzoates-glutamate...    573   0.0      
gb|AEM36357.1|  At1g59500                                               573   0.0      
gb|EMT18426.1|  hypothetical protein F775_07058                         573   0.0      
ref|NP_176159.1|  indole-3-acetic acid-amido synthetase GH3.4           572   0.0      
ref|NP_173729.1|  auxin-responsive GH3 family protein                   570   0.0      
ref|XP_006367190.1|  PREDICTED: probable indole-3-acetic acid-ami...    570   0.0      
ref|XP_006362911.1|  PREDICTED: indole-3-acetic acid-amido synthe...    568   0.0      
ref|NP_849718.1|  indole-3-acetic acid-amido synthetase GH3.17          563   0.0      
ref|XP_006362920.1|  PREDICTED: indole-3-acetic acid-amido synthe...    567   0.0      
ref|XP_009790943.1|  PREDICTED: indole-3-acetic acid-amido synthe...    568   0.0      
gb|KHN27054.1|  Indole-3-acetic acid-amido synthetase GH3.3             565   0.0      
ref|XP_003550026.1|  PREDICTED: probable indole-3-acetic acid-ami...    565   0.0      
ref|XP_009586735.1|  PREDICTED: indole-3-acetic acid-amido synthe...    565   0.0      
ref|XP_004233446.1|  PREDICTED: probable indole-3-acetic acid-ami...    565   0.0      
emb|CAA42636.1|  auxin-responsive GH3 product                           564   0.0      
ref|XP_003524670.1|  PREDICTED: probable indole-3-acetic acid-ami...    564   0.0      
sp|Q9SZT9.3|GH32_ARATH  RecName: Full=Indole-3-acetic acid-amido ...    560   0.0      
gb|EAZ18570.1|  hypothetical protein OsJ_34099                          565   0.0      
ref|XP_002871561.1|  hypothetical protein ARALYDRAFT_488150             561   0.0      
pdb|4EWV|A  Chain A, Crystal Structure Of Gh3.12 In Complex With ...    560   0.0      
gb|AAL25575.1|  AT4g37390/F6G17_40                                      559   0.0      
ref|XP_009110116.1|  PREDICTED: 4-substituted benzoates-glutamate...    560   0.0      
ref|NP_196836.1|  4-substituted benzoates-glutamate ligase GH3.12       560   0.0      
gb|ACL52529.1|  unknown                                                 558   0.0      
ref|XP_010453394.1|  PREDICTED: 4-substituted benzoates-glutamate...    558   0.0      
ref|XP_009125902.1|  PREDICTED: 4-substituted benzoates-glutamate...    558   0.0      
ref|XP_006287373.1|  hypothetical protein CARUB_v10000575mg             558   0.0      
ref|XP_010492080.1|  PREDICTED: 4-substituted benzoates-glutamate...    558   0.0      
ref|XP_006306116.1|  hypothetical protein CARUB_v10011560mg             557   0.0      
emb|CDX91132.1|  BnaC02g04650D                                          556   0.0      
emb|CDY09045.1|  BnaC08g09990D                                          553   0.0      
emb|CDX70497.1|  BnaC03g05810D                                          557   0.0      
ref|XP_010419906.1|  PREDICTED: 4-substituted benzoates-glutamate...    556   0.0      
ref|XP_006399823.1|  hypothetical protein EUTSA_v10013094mg             555   0.0      
emb|CDX85657.1|  BnaA02g01560D                                          555   0.0      
dbj|BAJ33847.1|  unnamed protein product                                545   0.0      
ref|XP_009121771.1|  PREDICTED: 4-substituted benzoates-glutamate...    550   0.0      
emb|CBI20465.3|  unnamed protein product                                550   0.0      
ref|XP_009131331.1|  PREDICTED: 4-substituted benzoates-glutamate...    550   0.0      
emb|CDX78516.1|  BnaA03g04280D                                          550   0.0      
ref|XP_010556086.1|  PREDICTED: 4-substituted benzoates-glutamate...    550   0.0      
emb|CDX69648.1|  BnaA10g19970D                                          548   0.0      
ref|XP_006362917.1|  PREDICTED: indole-3-acetic acid-amido synthe...    550   0.0      
ref|NP_196841.2|  auxin-responsive GH3 family protein                   548   0.0      
ref|XP_003636674.1|  Indole-3-acetic acid-amido synthetase GH3.6        545   0.0      
ref|XP_002871564.1|  auxin-responsive GH3 family protein                547   0.0      
ref|XP_010556077.1|  PREDICTED: indole-3-acetic acid-amido synthe...    545   0.0      
gb|KFK25570.1|  hypothetical protein AALP_AA8G132100                    545   0.0      
emb|CDY09786.1|  BnaC09g43750D                                          544   0.0      
ref|NP_196840.1|  auxin-responsive GH3 family protein                   545   0.0      
ref|NP_001190301.1|  auxin-responsive GH3 family protein                545   0.0      
pdb|4EQ4|A  Chain A, Crystal Structure Of Seleno-Methionine Deriv...    540   0.0      
ref|XP_007021517.1|  Indole-3-acetic acid-amido synthetase GH3.17       540   0.0      
ref|XP_008361439.1|  PREDICTED: uncharacterized protein LOC103425146    562   0.0      
ref|XP_010492088.1|  PREDICTED: indole-3-acetic acid-amido synthe...    540   0.0      
gb|KFK25569.1|  hypothetical protein AALP_AA8G132000                    540   0.0      
ref|XP_010433389.1|  PREDICTED: indole-3-acetic acid-amido synthe...    532   1e-180   
ref|XP_010453405.1|  PREDICTED: indole-3-acetic acid-amido synthe...    538   2e-180   
ref|XP_010555002.1|  PREDICTED: 4-substituted benzoates-glutamate...    535   9e-180   
ref|XP_010453404.1|  PREDICTED: indole-3-acetic acid-amido synthe...    536   3e-179   
ref|XP_006287319.1|  hypothetical protein CARUB_v10000528mg             534   3e-179   
ref|XP_003611652.1|  Indole-3-acetic acid-amido synthetase GH3.3        541   3e-179   
ref|XP_010936558.1|  PREDICTED: probable indole-3-acetic acid-ami...    530   3e-179   
ref|XP_010419911.1|  PREDICTED: indole-3-acetic acid-amido synthe...    533   5e-179   
ref|XP_009611719.1|  PREDICTED: indole-3-acetic acid-amido synthe...    534   6e-179   
ref|XP_009131333.1|  PREDICTED: indole-3-acetic acid-amido synthe...    533   8e-179   
ref|XP_010467278.1|  PREDICTED: probable indole-3-acetic acid-ami...    528   9e-179   
ref|XP_009125904.1|  PREDICTED: indole-3-acetic acid-amido synthe...    532   9e-179   
ref|XP_007021520.1|  Indole-3-acetic acid-amido synthetase GH3.17       532   1e-178   
ref|XP_006399828.1|  hypothetical protein EUTSA_v10013038mg             531   2e-178   
ref|XP_006399829.1|  hypothetical protein EUTSA_v10013044mg             530   6e-178   
emb|CDX78518.1|  BnaA03g04300D                                          531   7e-178   
gb|KFK35356.1|  hypothetical protein AALP_AA5G274100                    530   8e-178   
emb|CDY67949.1|  BnaAnng25660D                                          531   1e-177   
ref|XP_006351399.1|  PREDICTED: indole-3-acetic acid-amido synthe...    529   2e-177   
ref|NP_196842.2|  auxin-responsive GH3 family protein                   530   2e-177   
emb|CDX91130.1|  BnaC02g04670D                                          529   3e-177   
ref|XP_010492084.1|  PREDICTED: indole-3-acetic acid-amido synthe...    529   3e-177   
ref|XP_009121768.1|  PREDICTED: indole-3-acetic acid-amido synthe...    528   5e-177   
ref|XP_006290085.1|  hypothetical protein CARUB_v10003724mg             528   7e-177   
emb|CAB87144.1|  auxin reponsive-like protein                           526   9e-177   
ref|XP_010497199.1|  PREDICTED: indole-3-acetic acid-amido synthe...    523   2e-176   



>ref|XP_009604191.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X1 [Nicotiana tomentosiformis]
Length=602

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/550 (76%), Positives = 478/550 (87%), Gaps = 14/550 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VS FK  +P + YE+I+PYILRIANG+  + I+  PITEMLCSSGTSGGEPKLMPSIAED
Sbjct  57    VSKFKSLIPTVTYEEIQPYILRIANGEDSNLISAHPITEMLCSSGTSGGEPKLMPSIAED  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QYIPG+DEGKAM+LYFVKAEMSTPCG+PARTVLTSYYKSKHFKC
Sbjct  117   LDRRTFLYNLIMPIMNQYIPGLDEGKAMFLYFVKAEMSTPCGIPARTVLTSYYKSKHFKC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             RS DPYND TSPDQ+ILC D+NQSMYCQLLAGLVYR QVLR+GAVFASA LRAISFLQ N
Sbjct  177   RSKDPYNDFTSPDQAILCYDSNQSMYCQLLAGLVYRHQVLRIGAVFASALLRAISFLQRN  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKIL--LAPDPEL-ADEIEEICRAASWKGIVYRL  1094
             W ++C DIRTGQL+ MI D  CRS++S IL  L  D ++  DEIEEIC  +SWKGI+ +L
Sbjct  237   WQNMCHDIRTGQLNAMITDVSCRSSLSNILSTLNLDSDIDTDEIEEICGRSSWKGIICQL  296

Query  1093  WPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFT  914
             WPKAKYIEAV+TGSMSQY+PAL YYS+GKLPLICTMYASSECYFGVNLKPL+ P +V+FT
Sbjct  297   WPKAKYIEAVVTGSMSQYIPALEYYSEGKLPLICTMYASSECYFGVNLKPLNPPDEVSFT  356

Query  913   LLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             LLPNM YFEFIPLG NGTFL +L++E        +PQSKLVDLVHVRLG YYELV+TTFS
Sbjct  357   LLPNMAYFEFIPLGANGTFLIDLDEEEF------VPQSKLVDLVHVRLGYYYELVITTFS  410

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYRIGDVLQV GFHNKAPQF+F CRRNVVLSID+DKTN++DLHRSIT AKKLLEPHQ
Sbjct  411   GLYRYRIGDVLQVTGFHNKAPQFRFICRRNVVLSIDNDKTNEQDLHRSITLAKKLLEPHQ  470

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGA-----AAIDAQVLQDCCIAIEEQLDYVYRR  389
             ALLVEYTSYAD SS+PGHYV+YWEI+H+ +       ++AQVL++CCIAIEEQLDY+YRR
Sbjct  471   ALLVEYTSYADASSLPGHYVLYWEIVHSHSIIDKDVNVEAQVLEECCIAIEEQLDYIYRR  530

Query  388   CRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRA  209
             CR++DK +GPLEIR+VKPGTF+ LM   I++G SINQYKTPRCI SN SA ++L S V+A
Sbjct  531   CRTNDKSVGPLEIRLVKPGTFEALMDLLISQGGSINQYKTPRCIMSNESAFELLNSTVKA  590

Query  208   RYFSPRDPAW  179
              YFSPR+P+W
Sbjct  591   SYFSPREPSW  600



>ref|XP_008386644.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Malus domestica]
Length=596

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/549 (75%), Positives = 477/549 (87%), Gaps = 12/549 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VS FK+CVPVI Y+ I+PYI RIANG+  S ITG PITEMLCSSGTSG EPK+MPSIAED
Sbjct  55    VSAFKQCVPVITYKAIQPYIQRIANGEDSSLITGHPITEMLCSSGTSGREPKMMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QY+PG+DEGKAM+LYFVKAEMSTPCGLPARTVLTSYYKS HFKC
Sbjct  115   LDRRTFLYNLIMPIMNQYVPGLDEGKAMFLYFVKAEMSTPCGLPARTVLTSYYKSSHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DP+N+ TSPDQ+I C+D+NQSMYCQLL+GLV+R QVLRLGAVFASAFLRAISFL+ N
Sbjct  175   RGPDPFNNCTSPDQTIFCNDSNQSMYCQLLSGLVHRHQVLRLGAVFASAFLRAISFLERN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W + C DIRTGQL  +I D ECRS+M+ ++  P+P LADEI EIC   SWKGIV  LWPK
Sbjct  235   WINFCNDIRTGQLDPLITDPECRSSMAPLISVPNPSLADEINEICSLPSWKGIVCHLWPK  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+PAL YYSDGKLPL+CTMYASSECYFGVNLKPLSDPADV+FTLLP
Sbjct  295   AKYIEAVVTGSMAQYIPALEYYSDGKLPLVCTMYASSECYFGVNLKPLSDPADVSFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEFIPLGENGT L N+++      +E +   KLVDLV VRLGCYYELVVTTF+GL 
Sbjct  355   NMGYFEFIPLGENGTRLMNIDE------DEEVRSDKLVDLVQVRLGCYYELVVTTFAGLN  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQV GFHNKAPQF+F CRRNVVLSID+DKTN+EDLH+S++ AKKLLEP  ALL
Sbjct  409   RYRIGDVLQVTGFHNKAPQFRFICRRNVVLSIDTDKTNEEDLHKSVSVAKKLLEPFNALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGA-----AAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTSYADTS +PGHYV+YWEI++ G+     A +D +V+Q+CCIA+EE+LDY+YRRCR+
Sbjct  469   VEYTSYADTSCLPGHYVLYWEIIYHGSMVDSTAPLDDKVMQECCIAVEEELDYIYRRCRT  528

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             +DK +GPLEIRVV+PGTFD LM  FI++G SINQYKTPRCIKSN  ALK+L+SNV+A +F
Sbjct  529   YDKSVGPLEIRVVEPGTFDALMDYFISQGGSINQYKTPRCIKSN-KALKLLDSNVKACFF  587

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  588   SPRDPKWIP  596



>ref|XP_008235040.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Prunus mume]
Length=599

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/552 (74%), Positives = 476/552 (86%), Gaps = 15/552 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VS FK+CVPVI Y+ I+PYI RIANG+  S ITG PITEMLCSSGTSG +PK+MPSIAED
Sbjct  55    VSAFKQCVPVITYKAIQPYIQRIANGEDSSLITGHPITEMLCSSGTSGRKPKMMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QY+PG+DEGKAM+LYFVKAEMSTPCGLPARTVLTSYYKS HFKC
Sbjct  115   LDRRTFLYNLIMPIMNQYVPGLDEGKAMFLYFVKAEMSTPCGLPARTVLTSYYKSSHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DP+N+ TSPDQ+ILC+D+NQSMYCQLL+GLV+R  VLRLGAVFASAFLRAISFL+ N
Sbjct  175   RGLDPFNNGTSPDQTILCNDSNQSMYCQLLSGLVHRHHVLRLGAVFASAFLRAISFLERN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W + C DIRTGQL   I D ECR +M+ +L  P+  LADEI++IC   SWKGI+ +LWPK
Sbjct  235   WVNFCNDIRTGQLDPFITDPECRLSMAPLLSLPNASLADEIKDICSQTSWKGILCQLWPK  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+PAL YYSDGKLPL+CTMYASSECYFGVNL+PL DPADVAFTLLP
Sbjct  295   AKYIEAVVTGSMAQYIPALEYYSDGKLPLVCTMYASSECYFGVNLEPLCDPADVAFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEFIPLGENGT L ++++      +E +   KLVDLV VRLGCYYELVVTTF+GLY
Sbjct  355   NMGYFEFIPLGENGTRLMDIDE------DEEVRNDKLVDLVQVRLGCYYELVVTTFAGLY  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQV GFHN+APQF+F CRRNVVLSID+DKTN+EDLH+SI+ AKKLLEP  ALL
Sbjct  409   RYRIGDVLQVTGFHNEAPQFRFICRRNVVLSIDNDKTNEEDLHKSISVAKKLLEPFNALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDA--------QVLQDCCIAIEEQLDYVYRR  389
             VEYTSYADTS +PGHYV+YWEI+H G++ +D         +VLQ+CCIA+EE+LDY+YRR
Sbjct  469   VEYTSYADTSHLPGHYVLYWEIIHHGSSVVDLDSSTLDVDKVLQECCIAVEEELDYIYRR  528

Query  388   CRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRA  209
             CR+HDK +GPLEIRVV+PGTF+ LM  FI++G SINQYKTPRCIKSN  ALK+L+SNV+A
Sbjct  529   CRAHDKSVGPLEIRVVEPGTFEELMDYFISQGGSINQYKTPRCIKSN-KALKLLDSNVKA  587

Query  208   RYFSPRDPAWKP  173
              +FSPRDP W P
Sbjct  588   CFFSPRDPKWIP  599



>ref|XP_007199764.1| hypothetical protein PRUPE_ppa003141mg [Prunus persica]
 gb|EMJ00963.1| hypothetical protein PRUPE_ppa003141mg [Prunus persica]
Length=599

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/552 (74%), Positives = 476/552 (86%), Gaps = 15/552 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VS FK+CVPVI Y+ I+PYI RIANG+  S ITG PITEMLCSSGTSG +PK+MPSIAED
Sbjct  55    VSAFKQCVPVITYKAIQPYIQRIANGEDSSLITGHPITEMLCSSGTSGRKPKMMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QY+PG+DEGKAM+LYFVKAEMSTPCGLPARTVLTSYYKS HFK 
Sbjct  115   LDRRTFLYNLIMPIMNQYVPGLDEGKAMFLYFVKAEMSTPCGLPARTVLTSYYKSSHFKY  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DP+N+ TSPDQ+I C+D+NQSMYCQLL+GLV+R QVLRLGAVFASAFLRAISFL+ N
Sbjct  175   RGLDPFNNGTSPDQTIFCNDSNQSMYCQLLSGLVHRHQVLRLGAVFASAFLRAISFLERN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W + C DIRTGQL   I DSECR +M+ +L  P+P LADEI+EIC   SWKGI+ +LWPK
Sbjct  235   WVNFCNDIRTGQLDPSITDSECRLSMAPLLSLPNPSLADEIKEICSQTSWKGILCQLWPK  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+PAL YYSDGKLPL+CTMYASSECYFGVNL+PL DPADVAFTLLP
Sbjct  295   AKYIEAVVTGSMAQYIPALEYYSDGKLPLVCTMYASSECYFGVNLEPLCDPADVAFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEFIPLGENGT L ++++      +E +   KLVDLV VRLGCYYELVVTTF+GLY
Sbjct  355   NMGYFEFIPLGENGTRLMDIDE------DEEVRNDKLVDLVQVRLGCYYELVVTTFAGLY  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQV GFHN+APQF+F CRRNVVLSID+DKTN+EDLH+SI+ AKKLLEP  ALL
Sbjct  409   RYRIGDVLQVTGFHNEAPQFRFICRRNVVLSIDNDKTNEEDLHKSISVAKKLLEPFNALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDA--------QVLQDCCIAIEEQLDYVYRR  389
             VEYTSYADTS +PGHYV+YWEI+H G++ +D         +VLQ+CCIA+EE+LDY+YRR
Sbjct  469   VEYTSYADTSHLPGHYVLYWEIIHHGSSVVDLDSSTLDVDKVLQECCIAVEEELDYIYRR  528

Query  388   CRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRA  209
             CR+HDK +GPLEIRVV+PGTF+ LM  FI++G SINQYKTPRCIKS   ALK+L+SNV+A
Sbjct  529   CRAHDKSVGPLEIRVVEPGTFEELMDYFISQGGSINQYKTPRCIKSK-KALKLLDSNVKA  587

Query  208   RYFSPRDPAWKP  173
              +FSPRDP W P
Sbjct  588   CFFSPRDPKWIP  599



>ref|XP_002263353.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Vitis vinifera]
Length=596

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/549 (75%), Positives = 477/549 (87%), Gaps = 12/549 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FK+ VPVI Y+DI PYI RIANG+  S I+G PITEMLCSSGTSGGEPK+MPSIAED
Sbjct  55    VLEFKQSVPVITYKDIHPYIQRIANGEDSSLISGHPITEMLCSSGTSGGEPKMMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             L+RRTFLYNLIMPIM+QYIPG+DEGKAM+LYFVKAEMSTPCGLPAR VLTSYYKSK+F+C
Sbjct  115   LNRRTFLYNLIMPIMNQYIPGLDEGKAMFLYFVKAEMSTPCGLPARAVLTSYYKSKNFRC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D +ND TSPDQ+ILC+D+NQSMYCQLLAGLV+R QVLRLGAVFASA LRAISFL+ +
Sbjct  175   RVRDAFNDFTSPDQAILCTDSNQSMYCQLLAGLVHRHQVLRLGAVFASALLRAISFLERH  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIRTG L   I D ECRS+MS IL +P+P LADEIEEIC   SWKG++ +LWP+
Sbjct  235   WVHLCNDIRTGHLDSSITDPECRSSMSTILSSPNPHLADEIEEICSHPSWKGMLSQLWPR  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAVITGSM+QY+P+L YYS GKLPL+CTMYASSECYFGVN+KPL DPADVAFTLLP
Sbjct  295   AKYIEAVITGSMAQYIPSLEYYSGGKLPLVCTMYASSECYFGVNMKPLCDPADVAFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLGENGT L ++++      E+ +P+ KLVDLVHVRLGCYYELVVTTF+GL 
Sbjct  355   NMCYFEFIPLGENGTLLMDMDE------EKGVPKEKLVDLVHVRLGCYYELVVTTFAGLN  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQV GFHN+APQF+F CRRNVVLSID+DKTN+EDLHRSIT AKKLLEP+ ALL
Sbjct  409   RYRIGDVLQVTGFHNRAPQFRFICRRNVVLSIDNDKTNEEDLHRSITMAKKLLEPYNALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMH-----AGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTSYADTSS+PGHYV+YWEI H     + +  +D++VL++CCIA+EE+LDY+YRRCR+
Sbjct  469   VEYTSYADTSSLPGHYVLYWEITHCISTDSPSTPLDSKVLEECCIAVEEELDYIYRRCRT  528

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HDK +GPLEIR+V+PGTF+ LM  FI++G SINQYKTPRCIKS S+ALK+L SNV A +F
Sbjct  529   HDKSVGPLEIRLVQPGTFEDLMDLFISQGGSINQYKTPRCIKS-SNALKLLNSNVEASFF  587

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  588   SPRDPRWIP  596



>ref|XP_009775768.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X1 [Nicotiana sylvestris]
Length=605

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/551 (77%), Positives = 481/551 (87%), Gaps = 14/551 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VS FK  VP + YEDI+PYILRIANG+    I+  PITEMLCSSGTSGGEPKLMPSIA+D
Sbjct  57    VSKFKSLVPAVTYEDIQPYILRIANGEDPILISANPITEMLCSSGTSGGEPKLMPSIAQD  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QYIPG+DEGKAM+LYFVKAEMSTPCG+PARTVLTSYY+SKHFKC
Sbjct  117   LDRRTFLYNLIMPIMNQYIPGLDEGKAMFLYFVKAEMSTPCGIPARTVLTSYYESKHFKC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             RS DPYND TSPDQ+ILC D+NQSMYCQLLAGLVYR QVLR+GAVFASA LRAISFLQ N
Sbjct  177   RSKDPYNDFTSPDQAILCYDSNQSMYCQLLAGLVYRHQVLRIGAVFASALLRAISFLQRN  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKIL--LAPDPEL-ADEIEEICRAASWKGIVYRL  1094
             W ++C DIRTGQL+ MI D  CRSA+S IL  L  D ++ ADEIEEIC  +SWKGI+ +L
Sbjct  237   WQNMCHDIRTGQLNAMITDVSCRSALSNILSTLNLDSDIVADEIEEICGRSSWKGIICQL  296

Query  1093  WPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFT  914
             WPKAKYIEAV+TGSMSQY+PAL YYS+GKLPLICTMYASSECYFGVNLKPLS P +V+FT
Sbjct  297   WPKAKYIEAVVTGSMSQYIPALEYYSEGKLPLICTMYASSECYFGVNLKPLSPPDEVSFT  356

Query  913   LLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             LLPNM YFEFIPLG NGTFL +L++E        +PQSKLVDLVHVRLG YYELVVTTFS
Sbjct  357   LLPNMAYFEFIPLGANGTFLMDLDEEQF------VPQSKLVDLVHVRLGYYYELVVTTFS  410

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYRIGDVLQV GFHNKAPQF+F CRRNVVLSID+DKTN++DLHRSIT AKKLLEPHQ
Sbjct  411   GLYRYRIGDVLQVTGFHNKAPQFRFICRRNVVLSIDNDKTNEKDLHRSITLAKKLLEPHQ  470

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGAAA-----IDAQVLQDCCIAIEEQLDYVYRR  389
             ALLVEYTSYAD SSVPGHYV+YWEI+H+ +       ++AQV+++CCIAIEE+LDY+YRR
Sbjct  471   ALLVEYTSYADASSVPGHYVLYWEIVHSHSIVNKDVNVEAQVVEECCIAIEEELDYIYRR  530

Query  388   CRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRA  209
             CR++DK IGPLEIR+VKPGTF+ LM   I++G SINQYKTPRCI SN SAL++L SNV+A
Sbjct  531   CRTNDKSIGPLEIRLVKPGTFEALMDLLISQGGSINQYKTPRCIISNDSALQLLNSNVKA  590

Query  208   RYFSPRDPAWK  176
              YFSPR+P+WK
Sbjct  591   SYFSPREPSWK  601



>ref|XP_008368983.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Malus domestica]
Length=596

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/549 (74%), Positives = 476/549 (87%), Gaps = 12/549 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VSDFK CVPVI Y+ I+PYI RI NG+  S ITG PITE+LCSSGTSG EPK+MPSIAED
Sbjct  55    VSDFKLCVPVINYKAIQPYIKRITNGEDSSLITGHPITEILCSSGTSGREPKMMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QY+PG+DEGKAM+LYFVKAEMSTPCGLPARTVLTSYYKS HFKC
Sbjct  115   LDRRTFLYNLIMPIMNQYVPGLDEGKAMFLYFVKAEMSTPCGLPARTVLTSYYKSSHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             RS DP+N+ TSPDQ+I C+D+NQSMYCQLL+G+V+R QVLRLGAVFASAFLRAISFL+ N
Sbjct  175   RSPDPFNNCTSPDQTIFCNDSNQSMYCQLLSGIVHRHQVLRLGAVFASAFLRAISFLERN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W + C DIRTGQL  +I D ECRS+M+ ++  P+P LADEI EIC   SWKGI+ +LWPK
Sbjct  235   WINFCNDIRTGQLDPLITDPECRSSMAPLISVPNPSLADEINEICSLPSWKGILCQLWPK  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+PAL YYSDGKLPL+CTMYASSECYFGVNLKPLSDPADV+FTLLP
Sbjct  295   AKYIEAVVTGSMAQYIPALEYYSDGKLPLVCTMYASSECYFGVNLKPLSDPADVSFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEFIPL ENGT L N++       +E +   KLVDLV V LGCYYELVVTTF+GLY
Sbjct  355   NMGYFEFIPLRENGTRLMNIDD------DEEVRNDKLVDLVQVSLGCYYELVVTTFAGLY  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             R+R+GDVLQV GFHNKAPQF+F CRRNVVLSID+DKTN+EDLH+S++ AKKLL+P  ALL
Sbjct  409   RHRVGDVLQVTGFHNKAPQFRFICRRNVVLSIDTDKTNEEDLHKSVSVAKKLLKPFNALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGA-----AAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTSYADTS +PGHYV+YWEI++ G+     A +D +V+Q+CCIA+EE+LDY+YRRCR+
Sbjct  469   VEYTSYADTSRLPGHYVMYWEIIYHGSMVDSTAPLDDKVMQECCIAVEEELDYIYRRCRA  528

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             +DK +GPLEIRVV+PG+FD LM  FI++G SINQYKTPRCIKSN  ALK+L+SNV+A +F
Sbjct  529   YDKSVGPLEIRVVEPGSFDALMDYFISQGGSINQYKTPRCIKSN-KALKLLDSNVKACFF  587

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  588   SPRDPKWIP  596



>emb|CDP03514.1| unnamed protein product [Coffea canephora]
Length=605

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/551 (76%), Positives = 477/551 (87%), Gaps = 10/551 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V  FKRCVPV  Y+D+RPYI RIANGD+ + IT QP+TEMLCSSGTS GEPKLMPSI ED
Sbjct  58    VPHFKRCVPVTTYKDVRPYIQRIANGDNSNLITSQPVTEMLCSSGTSAGEPKLMPSIEED  117

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPI++QY+ G+DEGKAM+LYFVKAEMSTPCGLPARTVLTS+YKS+HFK 
Sbjct  118   LDRRTFLYNLIMPIINQYVGGLDEGKAMFLYFVKAEMSTPCGLPARTVLTSFYKSQHFKN  177

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             RS DPYND TSPDQ+ILC D+NQSMYCQLLAGLV+R QVLRLGAVFASAFLRAISFL+ N
Sbjct  178   RSHDPYNDFTSPDQTILCYDSNQSMYCQLLAGLVFRHQVLRLGAVFASAFLRAISFLERN  237

Query  1264  WPSLCLDIRTGQLS-GMIADSECRSAM-SKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
             W  LC DIRTG+L   MI D++C+SAM S++LL P P +ADEIE IC + SWKGIV RLW
Sbjct  238   WRKLCQDIRTGKLDHAMITDAQCQSAMYSRVLLRPQPLVADEIESICSSKSWKGIVRRLW  297

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             PKAKYIEAVITGSMSQY+P+L YYSDGKLPL+CTMYASSECYFGVNLKP   PADV+FTL
Sbjct  298   PKAKYIEAVITGSMSQYIPSLEYYSDGKLPLVCTMYASSECYFGVNLKPFCKPADVSFTL  357

Query  910   LPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             LPNMG+FEFIPLGE+ T+  +L++  EEEEEE +P +KLVDLVHVR+GCYYELVVTTF+G
Sbjct  358   LPNMGHFEFIPLGESATWSIDLDE--EEEEEEEVPPNKLVDLVHVRVGCYYELVVTTFAG  415

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYRIGDVLQV GFHN+APQF+F CRRNVVLS+D+DKTN+EDLH+SITAAKKLLEP+ A
Sbjct  416   LYRYRIGDVLQVTGFHNQAPQFRFICRRNVVLSVDNDKTNEEDLHKSITAAKKLLEPYNA  475

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAG-----AAAIDAQVLQDCCIAIEEQLDYVYRRC  386
             LLVEYTS AD S+VPGHYVIYWEI +       A AID  VLQ+CC A+EE+LDY YRRC
Sbjct  476   LLVEYTSCADASTVPGHYVIYWEIAYNNGLVDEAFAIDPTVLQECCAAVEERLDYTYRRC  535

Query  385   RSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRAR  206
             R+ DK +GPLEIR+V+ GTF+ LM  FIN+G+SINQYKTPRCIKS  +ALK+L SNV+A 
Sbjct  536   RTLDKSVGPLEIRIVEAGTFESLMDFFINQGASINQYKTPRCIKSK-AALKLLNSNVKAS  594

Query  205   YFSPRDPAWKP  173
             YFS RDP W P
Sbjct  595   YFSSRDPCWNP  605



>ref|XP_009342127.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Pyrus x bretschneideri]
 ref|XP_009342129.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Pyrus x bretschneideri]
Length=596

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/549 (74%), Positives = 475/549 (87%), Gaps = 12/549 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VSDFK+CVPVI Y+ I+PYI RI NG+  S ITG PITE+LCSSGTSG EPK+MPSIAED
Sbjct  55    VSDFKQCVPVITYKAIQPYIKRITNGEDSSLITGHPITEILCSSGTSGREPKMMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QY+PG+DEGKAM LYFVKAE STPCGLPARTVL SYYKS HFKC
Sbjct  115   LDRRTFLYNLIMPIMNQYVPGLDEGKAMLLYFVKAETSTPCGLPARTVLNSYYKSSHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             RS DP+N+ TSPDQ+ILC+D+NQSMYCQLL+G+V+R QVLRLGAVFASAFLRA+SFL+ N
Sbjct  175   RSPDPFNNCTSPDQTILCNDSNQSMYCQLLSGIVHRHQVLRLGAVFASAFLRALSFLERN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W + C DIRTGQL  +I D ECRS+M+ ++  P+P LADEI EIC   SWKGI+ +LWPK
Sbjct  235   WINFCNDIRTGQLDPLITDPECRSSMAPLISVPNPSLADEINEICSLPSWKGILCQLWPK  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+PAL YYSDGKLPL+C MYASSECYFGVNLKPLSDPADV+FTLLP
Sbjct  295   AKYIEAVVTGSMAQYIPALEYYSDGKLPLVCPMYASSECYFGVNLKPLSDPADVSFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEFIPLGENGT L N++       +E +   KLVDLV + LGCYYELVVTTF+GLY
Sbjct  355   NMGYFEFIPLGENGTRLMNIDD------DEEVRNDKLVDLVQLSLGCYYELVVTTFAGLY  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             R+R+GDVLQV GFHNKAPQF+F CRRNVVLSID+DKTN+EDLH+S++ AKKLLEP  ALL
Sbjct  409   RHRVGDVLQVTGFHNKAPQFRFICRRNVVLSIDTDKTNEEDLHKSVSVAKKLLEPFNALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGA-----AAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTS+ADTS +PGHYV+YWEI++ G+     A +D +V+Q+CCIA+EE+LDY+YRRCR+
Sbjct  469   VEYTSHADTSRLPGHYVMYWEIIYHGSMVDSTAPLDDKVMQECCIAVEEELDYIYRRCRT  528

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             +DK +GPLEIRVV+PG+FD LM  FI++G SINQYKTPRCIKSN  ALK+L+SNV+A +F
Sbjct  529   YDKSVGPLEIRVVEPGSFDGLMDYFISQGGSINQYKTPRCIKSN-KALKLLDSNVKACFF  587

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  588   SPRDPKWIP  596



>ref|XP_010090808.1| hypothetical protein L484_009086 [Morus notabilis]
 gb|EXB40841.1| hypothetical protein L484_009086 [Morus notabilis]
Length=602

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/554 (74%), Positives = 474/554 (86%), Gaps = 17/554 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S FK+ VPVI Y+DI+PYI RI NG+  S ITG PITEMLCSSGTS GEPK+MPSIAED
Sbjct  56    ISQFKKRVPVITYKDIQPYIERICNGEESSLITGHPITEMLCSSGTSAGEPKMMPSIAED  115

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPI++QY+PG+DEGKAM+LYFVKAEMSTPCGLPAR VLTSYYKSKHFKC
Sbjct  116   LDRRTFLYNLIMPIINQYVPGLDEGKAMFLYFVKAEMSTPCGLPARAVLTSYYKSKHFKC  175

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R+ D +N  TSPDQ+ILC D+NQSMYCQLLAGLV+R QVLRLGAVFASA LRAISFL+ N
Sbjct  176   RAQDAFNSYTSPDQAILCYDSNQSMYCQLLAGLVHRHQVLRLGAVFASALLRAISFLERN  235

Query  1264  WPSLCLDIRTGQLS-GMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWP  1088
             W SLC DIRTGQL   +I D ECR AMS ++  PDP LADEIEEIC  +SWKGI+ RLWP
Sbjct  236   WASLCNDIRTGQLDPSIITDHECRLAMSSVVSFPDPCLADEIEEICCRSSWKGILCRLWP  295

Query  1087  KAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLL  908
             +AKYIEAVITGSM+QY+PAL YYS+GKLPL+CTMYASSECYFGVNLKPL DPADVAFTLL
Sbjct  296   RAKYIEAVITGSMAQYIPALEYYSEGKLPLVCTMYASSECYFGVNLKPLCDPADVAFTLL  355

Query  907   PNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGL  728
             PNM YFEFIPLGENGT L ++ +      EE +P  KLVDLVHVR GCYYELVVTTF+GL
Sbjct  356   PNMCYFEFIPLGENGTLLMDIAE------EEEVPVDKLVDLVHVRRGCYYELVVTTFAGL  409

Query  727   YRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQAL  548
              RYRIGDVLQV  FHNKAPQF+F CRRNV+LSID+DKTN+EDLH+S++AAKKLLEPH AL
Sbjct  410   NRYRIGDVLQVMSFHNKAPQFRFICRRNVLLSIDNDKTNEEDLHKSVSAAKKLLEPHNAL  469

Query  547   LVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQ---------VLQDCCIAIEEQLDYVY  395
             LVEYTSYADTS VPGHYV+YWE++H G  +  +Q         VL++CCIA+EE+LDY+Y
Sbjct  470   LVEYTSYADTSRVPGHYVLYWELLHHGPPSPFSQLLWLNDASHVLEECCIAVEEELDYIY  529

Query  394   RRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNV  215
             RRCR++DK +GPLEIRVVKPGTF++LM   I++G SINQYKTPRCIKS+ + LK+L+SNV
Sbjct  530   RRCRTNDKSVGPLEIRVVKPGTFEVLMDLCISQGGSINQYKTPRCIKSD-TVLKLLDSNV  588

Query  214   RARYFSPRDPAWKP  173
             +A +FSPRDP W P
Sbjct  589   KACFFSPRDPKWIP  602



>ref|XP_004290773.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9-like 
[Fragaria vesca subsp. vesca]
Length=613

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/562 (73%), Positives = 477/562 (85%), Gaps = 22/562 (4%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V+DFK+CVPVI Y++I+PYI RIANG+  S ITG PITEMLCSSGTSG EPK+MP+IAED
Sbjct  55    VADFKKCVPVITYKEIQPYIQRIANGEDSSLITGHPITEMLCSSGTSGREPKMMPTIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLIMPI++QY+P +D+GKAM+LYFVKAEMSTPCGLPARTVLTSYYKS HFKC
Sbjct  115   LDRRTFIYNLIMPIINQYVPDLDKGKAMFLYFVKAEMSTPCGLPARTVLTSYYKSNHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DP+N+ TSPDQ++ C+D+NQSMYCQLL+GL++R QVLRLGAVFASAFLRAISFL+ N
Sbjct  175   RGEDPFNNCTSPDQTVFCNDSNQSMYCQLLSGLLHRHQVLRLGAVFASAFLRAISFLERN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W + C DIRTG+L  +I D +CR +M+KIL +PDP+LADEI  IC   SWKGI+ +LWPK
Sbjct  235   WVNFCNDIRTGKLDPLITDPDCRKSMAKILSSPDPDLADEISSICSLQSWKGILCQLWPK  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+PAL YYSDGKLPL+ TMYASSECYFGVNLKP  DPADVAFTL+P
Sbjct  295   AKYIEAVVTGSMAQYIPALEYYSDGKLPLVGTMYASSECYFGVNLKPFCDPADVAFTLMP  354

Query  904   NMGYFEFIPL--GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             NMGYFEFIPL  GENGT   +   + EE+E+E +   KLVDLVHV+LG YYELVVTTF+G
Sbjct  355   NMGYFEFIPLGRGENGT---SRVMDIEEDEDEDVLSDKLVDLVHVKLGGYYELVVTTFAG  411

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYRIGDVLQV GFHN+APQF+F CRRNVVLSID+DKTN+EDLHRSIT AKKLLEP  A
Sbjct  412   LYRYRIGDVLQVTGFHNQAPQFRFICRRNVVLSIDTDKTNEEDLHRSITVAKKLLEPFNA  471

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAGAA----------------AIDAQVLQDCCIAI  419
             LLVEYTSYADTS VPGHYV+YWEI+H   +                 +D +VLQ+CCIA+
Sbjct  472   LLVEYTSYADTSRVPGHYVMYWEIVHHHGSLSPSPTVDSLINNVVTPLDDKVLQECCIAV  531

Query  418   EEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSA  239
             EE+LDY+YRRCRSHDK +GPLEIRVV+PGTF+ LM  FIN+G SINQYKTPRCIKS   A
Sbjct  532   EEELDYIYRRCRSHDKSVGPLEIRVVEPGTFEALMDYFINQGGSINQYKTPRCIKSK-KA  590

Query  238   LKILESNVRARYFSPRDPAWKP  173
             LK+L+SNV+ARYFSPRDP W P
Sbjct  591   LKLLDSNVKARYFSPRDPHWSP  612



>ref|XP_002531876.1| Indole-3-acetic acid-amido synthetase GH3.17, putative [Ricinus 
communis]
 gb|EEF30513.1| Indole-3-acetic acid-amido synthetase GH3.17, putative [Ricinus 
communis]
Length=597

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/550 (73%), Positives = 468/550 (85%), Gaps = 13/550 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FK CVPV  Y+D+ PYI RIANG+  S ITG+PITEMLCSSGTS GEPKLMPSI ED
Sbjct  55    VKEFKYCVPVTTYKDMYPYIQRIANGEDSSLITGRPITEMLCSSGTSAGEPKLMPSINED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNL+MPIM+QYI G+DEGKAMYLYFVK EMSTPCGLPARTVLTSYYKSKHFKC
Sbjct  115   LDRRTFIYNLVMPIMNQYISGLDEGKAMYLYFVKEEMSTPCGLPARTVLTSYYKSKHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R+ D +ND TSPDQ+ILC D++QSMYCQLL+GLVYR QVLR+GAVFASA LRAISFL+ N
Sbjct  175   RARDSFNDFTSPDQAILCKDSDQSMYCQLLSGLVYRHQVLRIGAVFASALLRAISFLERN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIR G+L  MI D ECRS MS IL +P+P LADEIEEIC   SWKGI+  LWP+
Sbjct  235   WVHLCNDIRNGELDPMITDPECRSCMSMILSSPNPSLADEIEEICSRPSWKGILCLLWPR  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYIEAV+TGSM+QYVP+L+YYS+ KLPL+CTMYASSECYFGVNLKPLSDPA+V+FTL+P
Sbjct  295   TKYIEAVVTGSMAQYVPSLKYYSERKLPLVCTMYASSECYFGVNLKPLSDPAEVSFTLMP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLGENGT L ++++      EE +P  KLVDLVHVR GCYYELVVTTF+GLY
Sbjct  355   NMCYFEFIPLGENGTLLMDVDE------EEKVPIHKLVDLVHVRRGCYYELVVTTFAGLY  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQV GFHN+APQF+F CRRNVVLSID+DKTN+EDLH+SI+ AKKLLEP+ A+L
Sbjct  409   RYRIGDVLQVTGFHNQAPQFRFICRRNVVLSIDNDKTNEEDLHKSISTAKKLLEPYNAIL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAA------IDAQVLQDCCIAIEEQLDYVYRRCR  383
             VEYTSYA+T  VPGHYV+YWEI+H  +        +DA+V Q+CCIA+EE+LDY+YRRCR
Sbjct  469   VEYTSYAETLVVPGHYVLYWEILHHSSVVNHNQTPLDAEVFQECCIAVEEELDYIYRRCR  528

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
             +HDK IGPLEIRVV+PGTF+ LM  FI +G SINQYKTPRCIKSN +AL +L S+V+A +
Sbjct  529   THDKSIGPLEIRVVEPGTFEALMDLFIGQGGSINQYKTPRCIKSN-AALMLLNSHVKASF  587

Query  202   FSPRDPAWKP  173
             FS RDP W P
Sbjct  588   FSARDPVWIP  597



>ref|XP_002302704.1| auxin-responsive GH3 family protein [Populus trichocarpa]
 gb|EEE81977.1| auxin-responsive GH3 family protein [Populus trichocarpa]
Length=596

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/549 (74%), Positives = 471/549 (86%), Gaps = 12/549 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FK  VPVI Y+D+ PYI RIA G+  S +TG P+TEMLCSSGTS GEPKLMPSIAED
Sbjct  55    VDEFKFHVPVITYKDVCPYIQRIATGEDSSLVTGHPVTEMLCSSGTSAGEPKLMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLIMPIM+QYI G+DEGKAM+LYF+KAEMSTPCGLPARTVLTSYYKSKHFKC
Sbjct  115   LDRRTFVYNLIMPIMNQYIFGLDEGKAMFLYFIKAEMSTPCGLPARTVLTSYYKSKHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R+ D +ND TSPDQ+ILC D+NQSMYCQLL+GLV+R QVLRLGAVFASAFLRAISFL+ N
Sbjct  175   RTRDAFNDFTSPDQAILCKDSNQSMYCQLLSGLVHRHQVLRLGAVFASAFLRAISFLERN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIR+G L   I D ECRS MS +L +P+P LADEIE+IC   SWKGI+  LWP+
Sbjct  235   WGRLCNDIRSGDLDPTITDPECRSCMSMLLTSPNPSLADEIEDICSNTSWKGILCHLWPR  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+P+L YYS+GKLPL+CTMYASSECYFGVNLKPL DPADVAFTLLP
Sbjct  295   AKYIEAVVTGSMAQYIPSLEYYSEGKLPLVCTMYASSECYFGVNLKPLCDPADVAFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFI LGENGT+L N ++      E  +P  KLV+LV+VRLG YYELVVTTF+GLY
Sbjct  355   NMCYFEFIHLGENGTWLVNKDE------EGEVPNDKLVNLVNVRLGSYYELVVTTFAGLY  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVL+V GFHNKAPQF+F CRRNVVLSID+DKTN+EDLH+SITAAKKLLEP+ ALL
Sbjct  409   RYRIGDVLRVTGFHNKAPQFQFICRRNVVLSIDNDKTNEEDLHKSITAAKKLLEPYDALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAG-----AAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTSYADTSSVPGHYV+YWEI+H       +A +D ++LQ+CCI++EE+LDYVYRRCR+
Sbjct  469   VEYTSYADTSSVPGHYVLYWEILHDASFPDSSAQLDVKLLQECCISVEEELDYVYRRCRA  528

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HDK +GPLEIRVV+ GTF+ LM  FI +G+SINQYKTPR IKSN +ALK+L S+V+A  F
Sbjct  529   HDKSVGPLEIRVVESGTFEALMDFFIGQGASINQYKTPRSIKSN-AALKLLNSHVKASAF  587

Query  199   SPRDPAWKP  173
             SPRDPAW P
Sbjct  588   SPRDPAWIP  596



>ref|XP_007143845.1| hypothetical protein PHAVU_007G106600g [Phaseolus vulgaris]
 gb|ESW15839.1| hypothetical protein PHAVU_007G106600g [Phaseolus vulgaris]
Length=605

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/553 (72%), Positives = 461/553 (83%), Gaps = 17/553 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +++FKR VPV  YE I PYI RIANG+  S ITG  ITEMLCSSGTSGGEPK+MPSIAED
Sbjct  58    IAEFKRSVPVTTYERIFPYIQRIANGEDSSLITGHSITEMLCSSGTSGGEPKIMPSIAED  117

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             L+RRTF+YNL MPIM+QY+P +DEGKAMYL+FVKAEMSTPCGLPARTVLTSYYKSKHFKC
Sbjct  118   LERRTFVYNLTMPIMNQYVPDLDEGKAMYLFFVKAEMSTPCGLPARTVLTSYYKSKHFKC  177

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R++DP+ND TSPDQ+ILC+D+NQSMYCQLLAGL++RRQVLRLGAVFASAFLRAISFL+ N
Sbjct  178   RTYDPWNDYTSPDQTILCNDSNQSMYCQLLAGLIHRRQVLRLGAVFASAFLRAISFLEQN  237

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DI  GQLS  I D  CRS MS +L  PDP LADEI  IC    WKGI+ +LWP 
Sbjct  238   WRQLCEDICNGQLSSSITDPSCRSCMSSVLSTPDPRLADEITRICSQKCWKGILCQLWPN  297

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QYVPAL++YSDG+LPL+CT+YASSECYFGVNLKPL DPADVAFTLLP
Sbjct  298   AKYIEAVVTGSMAQYVPALKHYSDGRLPLVCTLYASSECYFGVNLKPLCDPADVAFTLLP  357

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEF+PLG NG  L + ++         +P  KLVDLVHV+LGC+YE VVTTF+GLY
Sbjct  358   NMGYFEFLPLGHNGKLLMDFDE-------GDVPNDKLVDLVHVKLGCFYEPVVTTFAGLY  410

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GFHN APQ +F CRRNVV+S+D++KTN+EDLHRS++ +KKLLEP+  LL
Sbjct  411   RYRVGDVLQVVGFHNNAPQVRFICRRNVVISVDTEKTNEEDLHRSVSMSKKLLEPYDGLL  470

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAG---------AAAIDAQVLQDCCIAIEEQLDYVYR  392
             VEYTSY DT SVPGHYV+YWEI+H G         A  +D  VL++CCIA+EEQLDYVYR
Sbjct  471   VEYTSYPDTCSVPGHYVLYWEILHCGIKAEAENGNAVVLDGSVLEECCIAVEEQLDYVYR  530

Query  391   RCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVR  212
             RCRSHDK +GPLEIRVV+PGTFD LM  FI++G+S+NQYKTPRCIKS   ALK+L S V 
Sbjct  531   RCRSHDKSVGPLEIRVVEPGTFDALMDLFISQGASMNQYKTPRCIKSK-KALKLLNSKVT  589

Query  211   ARYFSPRDPAWKP  173
             A +FSPRDP W P
Sbjct  590   ASFFSPRDPNWVP  602



>ref|XP_011009307.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Populus euphratica]
Length=596

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/549 (74%), Positives = 470/549 (86%), Gaps = 12/549 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FK  VPVI Y+D+ PYI RIA G+  S +TG P+TEMLCSSGTS GEPKLMPSIAED
Sbjct  55    VEEFKFHVPVITYKDVFPYIQRIATGEDSSLVTGHPVTEMLCSSGTSAGEPKLMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLIMPIM+QYI G+DEGKAM+LYF+KAEMSTPCGLPARTVLTSYYKSKHFKC
Sbjct  115   LDRRTFVYNLIMPIMNQYISGLDEGKAMFLYFIKAEMSTPCGLPARTVLTSYYKSKHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R+ D +ND TSPDQ+ILC D+NQSMYCQLL+GLV+R QVLRLGAVFASAFLRAISFL+ N
Sbjct  175   RTRDAFNDFTSPDQAILCRDSNQSMYCQLLSGLVHRHQVLRLGAVFASAFLRAISFLERN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIR+G L   I D ECRS MS +L +P+P LADEIE+IC   SWKGI+  LWP+
Sbjct  235   WGRLCNDIRSGDLDPTITDPECRSCMSMLLTSPNPSLADEIEDICSNTSWKGILCHLWPR  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+P+L YYS+GKLPL+CTMYASSECYFGVNLKPL DPADVAFTLLP
Sbjct  295   AKYIEAVVTGSMAQYIPSLEYYSEGKLPLVCTMYASSECYFGVNLKPLCDPADVAFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFI LGENGT+L N ++      E  +P  KLV+LV+VRLG YYELVVTTF+GLY
Sbjct  355   NMCYFEFIHLGENGTWLVNKDE------EGEVPNDKLVNLVNVRLGSYYELVVTTFAGLY  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVL+V GFHNKAPQF+F CRRNVVLSID+DKTN+EDLH+SITAAKKLLEP+ ALL
Sbjct  409   RYRIGDVLRVTGFHNKAPQFQFICRRNVVLSIDNDKTNEEDLHKSITAAKKLLEPYGALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAG-----AAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTSYADTSSVPGHYV+YWEI+H       +A +D ++LQ+CCI++EE+LDYVYRRCR+
Sbjct  469   VEYTSYADTSSVPGHYVLYWEILHDASFPDSSAQLDVKLLQECCISVEEELDYVYRRCRA  528

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HDK +GPLEIRVV+ GTF+ LM  FI +G+SINQYKTPR IKSN +ALK+L  +V+A  F
Sbjct  529   HDKSVGPLEIRVVESGTFEALMDFFIGQGASINQYKTPRSIKSN-AALKLLNFHVKASAF  587

Query  199   SPRDPAWKP  173
             SPRDPAW P
Sbjct  588   SPRDPAWIP  596



>ref|XP_004496050.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9-like 
[Cicer arietinum]
Length=597

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/544 (74%), Positives = 461/544 (85%), Gaps = 9/544 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             + +FK+ VPVI+YE I PYI RIANG+  S ITG PITEMLCSSGTS GEPKLMPSIAED
Sbjct  58    LQEFKKRVPVISYEGIFPYIQRIANGEDSSLITGHPITEMLCSSGTSAGEPKLMPSIAED  117

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLIMPIM+QY+P +DEGKAMYLYFVKAE  TPCGLPAR+VLTSYYKSKHFKC
Sbjct  118   LDRRTFVYNLIMPIMNQYVPDLDEGKAMYLYFVKAEKCTPCGLPARSVLTSYYKSKHFKC  177

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R+ DP+ND TSPDQ+ILC+D NQSM+CQLLAGLV+RR VLRLGAVFASA LRAISFL+ N
Sbjct  178   RTHDPWNDFTSPDQTILCNDINQSMHCQLLAGLVHRRHVLRLGAVFASALLRAISFLERN  237

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W +LC DIR G LS  I D  C S MS +L +PDP LADEI +IC   SWKGI+ +LWPK
Sbjct  238   WRNLCDDIRNGHLSSFITDPSCCSCMSTVLSSPDPRLADEISKICSQKSWKGILCKLWPK  297

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QYVPAL +Y +GKLPL+CTMYASSECYFGVNLKPL DP DVAFTLLP
Sbjct  298   AKYIEAVVTGSMAQYVPALEHYCEGKLPLVCTMYASSECYFGVNLKPLCDPNDVAFTLLP  357

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEFIPLG NGT L + ++       E +P  KLVDLV+V+LGC+YELV+TTF+GL 
Sbjct  358   NMGYFEFIPLGHNGTLLMDFDE------NEQVPNDKLVDLVNVKLGCFYELVITTFAGLN  411

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVL+V GF+NKAPQFKF CRRNVV+SIDS+KTN+EDLHRS+T AKKLLEP+ ALL
Sbjct  412   RYRIGDVLEVVGFYNKAPQFKFICRRNVVISIDSEKTNEEDLHRSVTIAKKLLEPYDALL  471

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAA--AIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
             VEYTSYADTSSVPGHYV+YWEI+H G+    +D  VLQ CCIA+E++LDYVYRRCR++DK
Sbjct  472   VEYTSYADTSSVPGHYVLYWEILHYGSKRDPLDPNVLQQCCIAVEDELDYVYRRCRTNDK  531

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              +G LEIRVV+ GTFD LM  FIN+G+SINQYKTPRCIKSN  AL +L S V A +FSPR
Sbjct  532   SVGALEIRVVEAGTFDALMDLFINKGASINQYKTPRCIKSN-KALNLLNSKVTASFFSPR  590

Query  190   DPAW  179
             DP W
Sbjct  591   DPKW  594



>gb|KEH43223.1| indole-3-acetic acid-amido synthetase [Medicago truncatula]
Length=597

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/546 (74%), Positives = 468/546 (86%), Gaps = 9/546 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             + +FKRCVPVI+YE I PYI RIANG+  S ITGQPITEMLCSSGTS GEPKLMPSIAED
Sbjct  58    LKEFKRCVPVISYEGIFPYIQRIANGEVSSLITGQPITEMLCSSGTSAGEPKLMPSIAED  117

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLIMPIM+QY+P +DEGK MYLYFVKAE STPCGLPAR+VLTSYYKSKHFKC
Sbjct  118   LDRRTFVYNLIMPIMNQYVPDLDEGKVMYLYFVKAEKSTPCGLPARSVLTSYYKSKHFKC  177

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R+ DP+ND TSPDQ+ILC+D NQSM+CQLLAGL++RRQVLRLGAVFASAFLRAISFL+ N
Sbjct  178   RTHDPWNDFTSPDQTILCNDINQSMHCQLLAGLIHRRQVLRLGAVFASAFLRAISFLERN  237

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIR GQL+  I D  CRS+MS +L +PDP LADEI +IC    WKGI+ +LWPK
Sbjct  238   WRKLCDDIRNGQLNSFITDPSCRSSMSTLLSSPDPCLADEISKICSQKCWKGILCKLWPK  297

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QYVPAL +Y +GKL L+CTMYASSECYFGVNLKPLSDP DVAFTLLP
Sbjct  298   AKYIEAVVTGSMAQYVPALEHYCEGKLHLVCTMYASSECYFGVNLKPLSDPDDVAFTLLP  357

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEFIPLG NGT L + ++       E +P  KLVDLV+V++GC+YELV+TTF+GLY
Sbjct  358   NMGYFEFIPLGHNGTLLMDFDE------NEQVPNDKLVDLVNVKIGCFYELVITTFAGLY  411

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV  FHNKAPQF+F CRRNVV+SIDS+KTN+EDLHRS+T +KKLLEP+ ALL
Sbjct  412   RYRVGDVLQVVAFHNKAPQFRFICRRNVVISIDSEKTNEEDLHRSVTMSKKLLEPYDALL  471

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAA--IDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
             VEYTSYADT SVPGHYV+YWEI+H G     +D  VLQ+CCIA+EE+LDYVYRRCR++DK
Sbjct  472   VEYTSYADTCSVPGHYVLYWEILHYGTKGDPLDPNVLQECCIAVEEELDYVYRRCRTNDK  531

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              +GPLEIRVV+PGTF+ LM  FI +G+SINQYKTPRCIKS   ALK+L+S V A +FSPR
Sbjct  532   SVGPLEIRVVEPGTFEALMDLFITKGASINQYKTPRCIKS-KKALKLLKSKVSASFFSPR  590

Query  190   DPAWKP  173
             DP W P
Sbjct  591   DPKWGP  596



>ref|XP_007050866.1| Indole-3-acetic acid-amido synthetase GH3.9, putative [Theobroma 
cacao]
 gb|EOX95023.1| Indole-3-acetic acid-amido synthetase GH3.9, putative [Theobroma 
cacao]
Length=595

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/545 (74%), Positives = 467/545 (86%), Gaps = 8/545 (1%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VS+FKRCVPVI Y++I PYI RIANG+  S ITGQPITEMLCSSGTS GEPKLMPSIAED
Sbjct  55    VSEFKRCVPVITYKNIYPYIQRIANGEGSSLITGQPITEMLCSSGTSAGEPKLMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QYI G+DEGKAMYLYFVKAEMSTPCGLP RTVLTSYYKSKHFKC
Sbjct  115   LDRRTFLYNLIMPIMNQYICGLDEGKAMYLYFVKAEMSTPCGLPFRTVLTSYYKSKHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R+ DP+ND TSPDQ+ILC+D++QSMYCQLLAGLV+R QV+RLGAVFASA LRAISFL+  
Sbjct  175   RTRDPFNDFTSPDQAILCNDSSQSMYCQLLAGLVHRHQVMRLGAVFASALLRAISFLERK  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIRTGQL   I D  CRS+M+ IL +P+P LADEIE IC   SWKGI+  LWP+
Sbjct  235   WVQLCNDIRTGQLDLAIVDPACRSSMTTILTSPNPHLADEIEGICSCPSWKGILCHLWPR  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+PAL +YS GKLPL+CTMYASSECYFG+NLKPL DPA+VAFTLLP
Sbjct  295   AKYIEAVVTGSMAQYIPALEFYSAGKLPLVCTMYASSECYFGINLKPLCDPAEVAFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEF+PLGENGT   ++ +      EE +P  +LVDLV+V++G YYELVVTTFSGL 
Sbjct  355   NMGYFEFLPLGENGTLSLDVGE------EEEVPNDRLVDLVNVKVGFYYELVVTTFSGLC  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVL V GFHN+APQF+F CRRNVVLS+D+DKTN+ DLHRS+T AK+LLEP+ ALL
Sbjct  409   RYRIGDVLHVTGFHNQAPQFRFICRRNVVLSVDNDKTNEVDLHRSVTIAKRLLEPYNALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEI-MHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             VEYTSYADTSSVPGHYV++WEI M   + +IDA+VL++CCI +EE+LD+VYR+CRS +K 
Sbjct  469   VEYTSYADTSSVPGHYVLFWEIQMVDSSTSIDAKVLEECCITVEEELDFVYRQCRSREKT  528

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             +GPLEIRVV PGTF+ LM  FI++G SINQYKTPRCIKS+ +ALK+L S+V A   SPRD
Sbjct  529   VGPLEIRVVTPGTFEALMDFFISQGGSINQYKTPRCIKSH-TALKLLNSHVLASLCSPRD  587

Query  187   PAWKP  173
             P W P
Sbjct  588   PKWIP  592



>ref|XP_003536201.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X1 [Glycine max]
 gb|KHN03733.1| Putative indole-3-acetic acid-amido synthetase GH3.9 [Glycine 
soja]
Length=608

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/557 (72%), Positives = 465/557 (83%), Gaps = 16/557 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V++FKRCVPVI YE I PYI RIANG+  + IT  PITEMLCSSGTS GEPK+MPSI ED
Sbjct  58    VAEFKRCVPVITYERIFPYIQRIANGEDSTLITSHPITEMLCSSGTSAGEPKMMPSIVED  117

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             L+RRTF+YNLI PI++QY+  +DEGKAMYLYFVKAEM TPCGLPARTVLTSYYKSKHFKC
Sbjct  118   LERRTFVYNLITPIINQYVSDLDEGKAMYLYFVKAEMCTPCGLPARTVLTSYYKSKHFKC  177

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R+ DP+ND TSPDQ+ILC+D+NQSM+CQLL+GLV+RR VLRLGAVFASA LRAISFL+ N
Sbjct  178   RTHDPWNDYTSPDQTILCNDSNQSMHCQLLSGLVHRRHVLRLGAVFASALLRAISFLERN  237

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIRTGQLS  I D  CRS MS +L +PDP LADEI  IC   SWKGI+ +LWPK
Sbjct  238   WRHLCEDIRTGQLSSFITDPSCRSCMSTLLSSPDPRLADEITRICSQKSWKGILCQLWPK  297

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QYVPAL++YSDGKLPL+CTMYASSECYFGVNLKPL DP DVAFTLLP
Sbjct  298   AKFIEAVVTGSMAQYVPALKHYSDGKLPLVCTMYASSECYFGVNLKPLCDPGDVAFTLLP  357

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEF+PLG NGT L + ++       E +P  KLVDLVHV+LGC+YE VVTTF+GLY
Sbjct  358   NMGYFEFLPLGHNGTLLMDFDE------GEQVPNDKLVDLVHVKLGCFYEPVVTTFAGLY  411

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N APQ +F CRRNVV+S+D++KTN+EDLHR +T AKKLLEP+ ALL
Sbjct  412   RYRVGDVLQVVGFYNNAPQVRFICRRNVVISVDTEKTNEEDLHRGVTMAKKLLEPYDALL  471

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAA---------IDAQVLQDCCIAIEEQLDYVYR  392
             VEYTSY DTSS+PGHYV+YWEI+H G            +DA VL++CCIA+EEQLDYVYR
Sbjct  472   VEYTSYPDTSSIPGHYVLYWEILHCGIKTTESSQQLQLLDANVLEECCIAVEEQLDYVYR  531

Query  391   RCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVR  212
             RCRS+DK +GPLEIRVV+PGTFD LM  FI++G+SINQYKTPRCIKS  +  K+L+S V 
Sbjct  532   RCRSYDKSVGPLEIRVVEPGTFDALMDLFISQGASINQYKTPRCIKSKKAL-KLLKSKVT  590

Query  211   ARYFSPRDPAWKP*LVS  161
             A +FSPRDP W P + S
Sbjct  591   ASFFSPRDPKWSPKMCS  607



>gb|EYU46693.1| hypothetical protein MIMGU_mgv1a003107mg [Erythranthe guttata]
Length=608

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/551 (74%), Positives = 465/551 (84%), Gaps = 12/551 (2%)
 Frame = -1

Query  1807  LVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAE  1628
             LVS FK  VPVI Y+DIRPYI+RIANG+  S IT +PITEMLCSSGTS GEPKLMPSIAE
Sbjct  60    LVSQFKNRVPVITYKDIRPYIIRIANGEDSSLITSRPITEMLCSSGTSAGEPKLMPSIAE  119

Query  1627  DLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFK  1448
             DLDRRTFLYNLIMPIM+Q++ G+ EGKAMYLYF+KAEMSTPCGLPARTVLTSYYKS HFK
Sbjct  120   DLDRRTFLYNLIMPIMNQHVAGLSEGKAMYLYFIKAEMSTPCGLPARTVLTSYYKSTHFK  179

Query  1447  CRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQH  1268
              R  DP+ND TSPD +ILCSD++QSMYCQLLAGL++RR+VLRLGAVFASA LRAISFL+ 
Sbjct  180   HRPHDPFNDFTSPDAAILCSDSDQSMYCQLLAGLIHRRRVLRLGAVFASALLRAISFLER  239

Query  1267  NWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAA----SWKGIVY  1100
             +W  LC DIR G+L   I D  CRSAMS ++  PDP+LA +IEEIC       SWKGI+ 
Sbjct  240   HWRDLCRDIRAGKLDDRITDPACRSAMSDLIGRPDPDLAGQIEEICGVGKTTPSWKGILC  299

Query  1099  RLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVA  920
             RLWP  KYIEAV+TGSMSQYVPALRYYSDGKLPL+CTMYASSECYFGVN+KPLSDP++V+
Sbjct  300   RLWPNVKYIEAVVTGSMSQYVPALRYYSDGKLPLVCTMYASSECYFGVNMKPLSDPSEVS  359

Query  919   FTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTT  740
             FTLLPNMG+FEFI LGENG+ L +  +   ++EEE++P + LVDLVHV+LGCYYELVVTT
Sbjct  360   FTLLPNMGFFEFILLGENGSLLMDFEE---DDEEEALPPTVLVDLVHVKLGCYYELVVTT  416

Query  739   FSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAA-KKLLE  563
             FSGL RYRIGDVLQV GFHN APQF+F CRRNVVLSID+DKTN+EDLHRSITAA K LLE
Sbjct  417   FSGLNRYRIGDVLQVTGFHNAAPQFRFICRRNVVLSIDNDKTNEEDLHRSITAATKSLLE  476

Query  562   PHQALLVEYTSYADTSSVPGHYVIYWEIMHAGAAA--IDAQVLQDCCIAIEEQLDYVYRR  389
             P  ALLVEYTSYADTS++PGHYVIYWEI +  A    I  +V+ +CCIA+EE LDYVYRR
Sbjct  477   PRHALLVEYTSYADTSTIPGHYVIYWEIKNTNATQPPISGEVVSECCIAVEEGLDYVYRR  536

Query  388   CRSHDKCIGPLEIRVVKPGTFDLLMGNFINE-GSSINQYKTPRCIKSNSSALKILESNVR  212
             CR++DK +GPLEIRVVK GTF+ LM  FI + G+SINQYKTPRC+KS  + LK+L +NV 
Sbjct  537   CRTNDKSVGPLEIRVVKSGTFEKLMDLFIAQGGASINQYKTPRCVKSK-AGLKLLNANVS  595

Query  211   ARYFSPRDPAW  179
               YFSPRDPAW
Sbjct  596   ECYFSPRDPAW  606



>ref|XP_006444284.1| hypothetical protein CICLE_v10019393mg [Citrus clementina]
 ref|XP_006479914.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9-like 
[Citrus sinensis]
 gb|ESR57524.1| hypothetical protein CICLE_v10019393mg [Citrus clementina]
Length=599

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/549 (74%), Positives = 467/549 (85%), Gaps = 10/549 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIA-NGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAE  1628
             VSDFKRCVPV  Y++I PYI RIA +G+  S I+G PITEMLCSSGTS GEPKLMPSIAE
Sbjct  56    VSDFKRCVPVSTYKNIYPYIQRIAISGEDSSLISGHPITEMLCSSGTSAGEPKLMPSIAE  115

Query  1627  DLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFK  1448
             DLDRRTFLYNLIMPIM+QYI G+DEGKAMY YFVKAEMSTP GLP RTVLTSYYKSKHFK
Sbjct  116   DLDRRTFLYNLIMPIMNQYICGLDEGKAMYFYFVKAEMSTPSGLPTRTVLTSYYKSKHFK  175

Query  1447  CRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQH  1268
             CR+ DPYND TSPD +ILC+D+NQSMYCQLLAGL++R QVLRLGAVFASA LRAISFL+ 
Sbjct  176   CRTRDPYNDFTSPDPAILCNDSNQSMYCQLLAGLIHRHQVLRLGAVFASALLRAISFLER  235

Query  1267  NWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWP  1088
             NW  LC DIR+G+L   I D  CRS+   +L +P+P LADEIEEIC   SWKGI+ +LWP
Sbjct  236   NWFQLCNDIRSGRLDLTITDPGCRSSTLSLLTSPNPTLADEIEEICSRPSWKGILCQLWP  295

Query  1087  KAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLL  908
             +AKYIEAV+TGSM+QY+P+L YYS GKLPL+ TMYASSECYFGVNLKPLS+PADV+FTLL
Sbjct  296   RAKYIEAVVTGSMAQYIPSLEYYSAGKLPLVGTMYASSECYFGVNLKPLSNPADVSFTLL  355

Query  907   PNMGYFEFIPL-GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             PNM YFEF+PL GENGT LS      E  EEE +P  KLVDL HVR+G YYELVVTTF+G
Sbjct  356   PNMCYFEFLPLGGENGTLLS-----MEFNEEEEVPNDKLVDLGHVRVGHYYELVVTTFAG  410

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             L RYRIGDVLQV GF+N+APQF+F CRRNVVLSID+DKTN+EDLH+S+T AK LLEP+ A
Sbjct  411   LNRYRIGDVLQVTGFYNRAPQFRFICRRNVVLSIDNDKTNEEDLHKSVTIAKNLLEPYSA  470

Query  550   LLVEYTSYADTSSVPGHYVIYWE--IMHAGAAAIDAQ-VLQDCCIAIEEQLDYVYRRCRS  380
             LLVEYTSYADTS+VPGHYV+YWE  I+ + A  +D Q VL++CCIA+EEQLDYVYRRCRS
Sbjct  471   LLVEYTSYADTSTVPGHYVLYWEIQIVDSPALPLDHQKVLEECCIAVEEQLDYVYRRCRS  530

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HDK +GPLEIRVV+PGTF+ LM   +++G SINQYKTPRCIKSN++AL +L+S+V+  +F
Sbjct  531   HDKSVGPLEIRVVEPGTFETLMDLLVSQGGSINQYKTPRCIKSNNAALMLLDSHVKDSFF  590

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  591   SPRDPKWIP  599



>ref|XP_003518956.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9-like 
[Glycine max]
 gb|KHN46578.1| Putative indole-3-acetic acid-amido synthetase GH3.9 [Glycine 
soja]
Length=606

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/555 (71%), Positives = 460/555 (83%), Gaps = 14/555 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +++FKRCVPV  YE I PYI RIANG+  S IT  PITEMLCSSGTS GEPK+MPSIAED
Sbjct  58    IAEFKRCVPVTTYERIFPYIQRIANGEDSSLITSHPITEMLCSSGTSSGEPKMMPSIAED  117

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             L+RRTF+YNLI PI++QY+P +DEGKAMYLYFVKAEM TPCGLPARTVLTSYYKSKHFKC
Sbjct  118   LERRTFVYNLITPIINQYVPDLDEGKAMYLYFVKAEMCTPCGLPARTVLTSYYKSKHFKC  177

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R+ DP+ND TSPDQSILC+D+NQSM+CQLLAGLV+RR VLRLGAVFASA LRAISFL+ N
Sbjct  178   RTHDPWNDYTSPDQSILCNDSNQSMHCQLLAGLVHRRHVLRLGAVFASALLRAISFLERN  237

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DI +GQLS  I D  CRS MS  L +P+P LADEI  IC   SWKGI+ +LWPK
Sbjct  238   WRHLCEDICSGQLSSFITDPSCRSRMSTFLSSPNPRLADEITRICSQKSWKGILCQLWPK  297

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QYVPAL++YS+GKLPL+CTMYASSECYFGVNLKPL DP+DVAFTLLP
Sbjct  298   AKFIEAVVTGSMAQYVPALKHYSEGKLPLVCTMYASSECYFGVNLKPLCDPSDVAFTLLP  357

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEF+PL  NGT L + ++       E +P  KLVDLVHV+LGC+YE VVTTF+GLY
Sbjct  358   NMGYFEFLPLRHNGTLLMDFDE------GEQVPNDKLVDLVHVKLGCFYEPVVTTFAGLY  411

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N APQ +F CRRNVV+S+D++KTN+EDLHR +T AKKLLEP+ +LL
Sbjct  412   RYRVGDVLQVVGFYNNAPQVRFICRRNVVISVDTEKTNEEDLHRGVTMAKKLLEPYDSLL  471

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAA-------IDAQVLQDCCIAIEEQLDYVYRRC  386
             VEYTSY DTSSVPGHYV+YWEI+H G          +DA VL++CCIA+EEQLDYVYRRC
Sbjct  472   VEYTSYPDTSSVPGHYVLYWEILHCGIKTESSPQLQLDANVLEECCIAVEEQLDYVYRRC  531

Query  385   RSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRAR  206
             RS+DK +GPLEIRVV+PGTFD LM  FI +G+SINQYKTPRCIKS  +   +  S V A 
Sbjct  532   RSYDKSVGPLEIRVVEPGTFDALMDLFICQGASINQYKTPRCIKSKKALKLLK-SKVTAS  590

Query  205   YFSPRDPAWKP*LVS  161
             +FSPRDP W P + S
Sbjct  591   FFSPRDPKWAPKMCS  605



>ref|XP_009604193.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X3 [Nicotiana tomentosiformis]
Length=520

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/509 (77%), Positives = 446/509 (88%), Gaps = 14/509 (3%)
 Frame = -1

Query  1681  CSSGTSGGEPKLMPSIAEDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPC  1502
             C +GTSGGEPKLMPSIAEDLDRRTFLYNLIMPIM+QYIPG+DEGKAM+LYFVKAEMSTPC
Sbjct  16    CFAGTSGGEPKLMPSIAEDLDRRTFLYNLIMPIMNQYIPGLDEGKAMFLYFVKAEMSTPC  75

Query  1501  GLPARTVLTSYYKSKHFKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLR  1322
             G+PARTVLTSYYKSKHFKCRS DPYND TSPDQ+ILC D+NQSMYCQLLAGLVYR QVLR
Sbjct  76    GIPARTVLTSYYKSKHFKCRSKDPYNDFTSPDQAILCYDSNQSMYCQLLAGLVYRHQVLR  135

Query  1321  LGAVFASAFLRAISFLQHNWPSLCLDIRTGQLSGMIADSECRSAMSKIL--LAPDPEL-A  1151
             +GAVFASA LRAISFLQ NW ++C DIRTGQL+ MI D  CRS++S IL  L  D ++  
Sbjct  136   IGAVFASALLRAISFLQRNWQNMCHDIRTGQLNAMITDVSCRSSLSNILSTLNLDSDIDT  195

Query  1150  DEIEEICRAASWKGIVYRLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSE  971
             DEIEEIC  +SWKGI+ +LWPKAKYIEAV+TGSMSQY+PAL YYS+GKLPLICTMYASSE
Sbjct  196   DEIEEICGRSSWKGIICQLWPKAKYIEAVVTGSMSQYIPALEYYSEGKLPLICTMYASSE  255

Query  970   CYFGVNLKPLSDPADVAFTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLV  791
             CYFGVNLKPL+ P +V+FTLLPNM YFEFIPLG NGTFL +L++E        +PQSKLV
Sbjct  256   CYFGVNLKPLNPPDEVSFTLLPNMAYFEFIPLGANGTFLIDLDEEEF------VPQSKLV  309

Query  790   DLVHVRLGCYYELVVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTN  611
             DLVHVRLG YYELV+TTFSGLYRYRIGDVLQV GFHNKAPQF+F CRRNVVLSID+DKTN
Sbjct  310   DLVHVRLGYYYELVITTFSGLYRYRIGDVLQVTGFHNKAPQFRFICRRNVVLSIDNDKTN  369

Query  610   DEDLHRSITAAKKLLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGA-----AAIDAQ  446
             ++DLHRSIT AKKLLEPHQALLVEYTSYAD SS+PGHYV+YWEI+H+ +       ++AQ
Sbjct  370   EQDLHRSITLAKKLLEPHQALLVEYTSYADASSLPGHYVLYWEIVHSHSIIDKDVNVEAQ  429

Query  445   VLQDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTP  266
             VL++CCIAIEEQLDY+YRRCR++DK +GPLEIR+VKPGTF+ LM   I++G SINQYKTP
Sbjct  430   VLEECCIAIEEQLDYIYRRCRTNDKSVGPLEIRLVKPGTFEALMDLLISQGGSINQYKTP  489

Query  265   RCIKSNSSALKILESNVRARYFSPRDPAW  179
             RCI SN SA ++L S V+A YFSPR+P+W
Sbjct  490   RCIMSNESAFELLNSTVKASYFSPREPSW  518



>ref|XP_011079705.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Sesamum indicum]
Length=606

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/550 (73%), Positives = 470/550 (85%), Gaps = 10/550 (2%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D VS FK+ VPVI Y+DIRPYILRIA+G+  + IT  PITE++CSSGTS GEPKLMPSIA
Sbjct  59    DAVSQFKKRVPVITYKDIRPYILRIASGEDSNLITAHPITEIICSSGTSAGEPKLMPSIA  118

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             EDLDRRTFLYNLIMPIM+Q++PG+DEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKS HF
Sbjct  119   EDLDRRTFLYNLIMPIMNQHVPGLDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSAHF  178

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
             K R  DP+ND TSPD +ILC D++QSMYCQLLAGL++R++VLRLGAVFASA LR+ISFL+
Sbjct  179   KHRPHDPFNDFTSPDAAILCYDSDQSMYCQLLAGLIHRQRVLRLGAVFASALLRSISFLE  238

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEIC-RAASWKGIVYRL  1094
              +W   C DIR+G+L+  I DS CRSAM  ++   DP+LA+EIE+IC +  SWKGI+ RL
Sbjct  239   RHWRDFCQDIRSGELNEGITDSGCRSAMLDLIGPLDPDLAEEIEDICSQTTSWKGIICRL  298

Query  1093  WPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFT  914
             WP AKYIEAV+TGSMSQYVPAL+YYSD KLPL+CTMYASSECYFGVN+ PL +P++V+FT
Sbjct  299   WPNAKYIEAVVTGSMSQYVPALKYYSDDKLPLVCTMYASSECYFGVNVNPLCEPSEVSFT  358

Query  913   LLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             LLPNMGYFEFIPLGENG+   +  +   E+EEE +PQSKLVDLVHV++GCYYELVVTTFS
Sbjct  359   LLPNMGYFEFIPLGENGSLFMDFEE---EDEEEEVPQSKLVDLVHVKVGCYYELVVTTFS  415

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAA-KKLLEPH  557
             GL RYRIGDVLQV GFHN APQF+F CRRNVVLSID+DKTN+EDLHRSITAA K+LLEP 
Sbjct  416   GLNRYRIGDVLQVTGFHNHAPQFRFICRRNVVLSIDNDKTNEEDLHRSITAAVKRLLEPR  475

Query  556   QALLVEYTSYADTSSVPGHYVIYWEI---MHAGAAAIDAQVLQDCCIAIEEQLDYVYRRC  386
              ALLVEYTSYADTSSVPGHYVIYWEI   +H     + A+ +++CCIA+EE LDYVYRRC
Sbjct  476   HALLVEYTSYADTSSVPGHYVIYWEINNTIHPQEPPVSAEAVEECCIAVEEGLDYVYRRC  535

Query  385   RSHDKCIGPLEIRVVKPGTFDLLMGNFINE-GSSINQYKTPRCIKSNSSALKILESNVRA  209
             R++DK +GPLEIRVVK GTF+ LM  FI + G+SINQYKTPRC+KS  +ALK+L +NV +
Sbjct  536   RTNDKSVGPLEIRVVKAGTFEKLMDLFIAQGGASINQYKTPRCVKSK-AALKLLNANVSS  594

Query  208   RYFSPRDPAW  179
              YFSPR PAW
Sbjct  595   CYFSPRYPAW  604



>ref|XP_010545027.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Tarenaya hassleriana]
Length=597

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/549 (70%), Positives = 460/549 (84%), Gaps = 11/549 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S+FKR VPVI Y+DI PYI RIANG+  S +TG PITE+LCSSGTS GEPKLMPSIAED
Sbjct  55    ISEFKRSVPVIKYKDIYPYIQRIANGEDSSLVTGHPITEILCSSGTSAGEPKLMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLY+LIMPI++QYIPG+D+GKAMYLYFVKAE STP GLP R VLTSYYKSKHFKC
Sbjct  115   LDRRTFLYSLIMPIVNQYIPGLDKGKAMYLYFVKAETSTPGGLPVRAVLTSYYKSKHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP  ++LC D+NQSMYCQLL+GLV+R QV+RLGAVFASAFLRAIS+L+  
Sbjct  175   RPYDPFNDLTSPIPAVLCEDSNQSMYCQLLSGLVHRHQVMRLGAVFASAFLRAISYLERR  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIR G+L  MI D  CRS+MS +L +P+P LADEIEEICR +SWKGI+Y LWP+
Sbjct  235   WLQLCRDIREGELDPMITDPGCRSSMSTLLESPNPGLADEIEEICRRSSWKGILYHLWPR  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QY+PAL++YS GKLPL+C MYASSE YFGVNLKPLS+PADVAFTLLP
Sbjct  295   AKFIEAVVTGSMAQYIPALQFYSGGKLPLVCPMYASSESYFGVNLKPLSNPADVAFTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLGENG+   + N       +E +   K+VDLV V+LGCYYELVVTTF+GL 
Sbjct  355   NMCYFEFIPLGENGSLSFDDND------DEEVSSDKVVDLVDVKLGCYYELVVTTFAGLC  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQVAGF+N APQF+F CRRNVVLS+D+DKTN+EDLHRSIT AKK LE H ALL
Sbjct  409   RYRMGDVLQVAGFYNTAPQFRFICRRNVVLSVDNDKTNEEDLHRSITLAKKFLESHNALL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIMH-----AGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTSY DTSSVPGHYV++WEI H      G  A++ +V+++CCI++EE+LDY+YR+CRS
Sbjct  469   VEYTSYVDTSSVPGHYVLFWEIQHHSGTPNGKTAMEGEVIEECCISVEEELDYIYRQCRS  528

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
              D+ +GPLEIRVV+ G+F+ LM   I++G SINQYKTPRC+KSNS ALK+L   V   +F
Sbjct  529   KDRSVGPLEIRVVEGGSFEALMDLIISQGGSINQYKTPRCVKSNSGALKLLNGRVIGSFF  588

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  589   SPRDPIWVP  597



>ref|XP_010269496.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X2 [Nelumbo nucifera]
Length=603

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/553 (70%), Positives = 457/553 (83%), Gaps = 13/553 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V+ FKR VPV+ Y DI+PYI RIANG+  S I+GQ ITEML SSGTS GE KLMPSIAED
Sbjct  55    VTTFKRLVPVVTYADIQPYIQRIANGEDSSLISGQTITEMLRSSGTSAGEQKLMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QY+PG+D+GKAMYLYFVK+E  TP G+P R VLTSYYKSKHFKC
Sbjct  115   LDRRTFLYNLIMPIMNQYVPGLDKGKAMYLYFVKSETPTPSGIPTRPVLTSYYKSKHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DP+ND TSPDQ+ILC+D  QSMYCQLLAGLV+R QVLRLGAVFASAFLRAISFL+ N
Sbjct  175   RPPDPFNDYTSPDQAILCTDNRQSMYCQLLAGLVHRHQVLRLGAVFASAFLRAISFLERN  234

Query  1264  WPSLCLDIRTGQL-SGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWP  1088
             W  LC DIRTG L S  I D  CR+AMS +L +P+P LADEIE ICR  SWKGI+ +LWP
Sbjct  235   WVHLCNDIRTGSLDSTTIVDPGCRTAMSDVLRSPNPLLADEIEAICRCKSWKGILCQLWP  294

Query  1087  KAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLL  908
             +AKYIEAV+TG+M+QY+PAL +YS GKLPL+CTMYASSECYFGVNL PL DPA+V++TLL
Sbjct  295   RAKYIEAVVTGTMAQYIPALNFYSGGKLPLVCTMYASSECYFGVNLNPLCDPAEVSYTLL  354

Query  907   PNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGL  728
             PNMGYFEFIPLG+NG  L  ++   EEE    +P  KLVDL HVR GCYYELVVTTF+GL
Sbjct  355   PNMGYFEFIPLGDNGRLLLMMDAGNEEEV---VPVDKLVDLAHVRPGCYYELVVTTFAGL  411

Query  727   YRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQAL  548
             YRYRIGDVLQV GF+N+APQF+F CRRNVVLSID+DKTN+EDLH+S++ AKKLLEP+ AL
Sbjct  412   YRYRIGDVLQVTGFYNRAPQFRFICRRNVVLSIDTDKTNEEDLHKSVSMAKKLLEPYNAL  471

Query  547   LVEYTSYADTSSVPGHYVIYWEIMHAGAAA--------IDAQVLQDCCIAIEEQLDYVYR  392
             LVEYTSYADTS++PGHYV+YWE++H   ++         DA +L +CC  +EE LDYVYR
Sbjct  472   LVEYTSYADTSTIPGHYVLYWEVLHLQHSSTTNGVVSLFDAHLLPECCSTVEESLDYVYR  531

Query  391   RCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVR  212
             RCR++DK +GPLEIR+V  GTFD LM   I++G SINQYKTPRCIKS ++ L++L S V+
Sbjct  532   RCRAYDKSVGPLEIRLVGAGTFDALMDLCISQGGSINQYKTPRCIKS-AAGLELLNSRVK  590

Query  211   ARYFSPRDPAWKP  173
             A +FSPRDP W P
Sbjct  591   ACFFSPRDPTWIP  603



>ref|XP_010269495.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X1 [Nelumbo nucifera]
Length=604

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/554 (70%), Positives = 457/554 (82%), Gaps = 14/554 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V+ FKR VPV+ Y DI+PYI RIANG+  S I+GQ ITEML SSGTS GE KLMPSIAED
Sbjct  55    VTTFKRLVPVVTYADIQPYIQRIANGEDSSLISGQTITEMLRSSGTSAGEQKLMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLIMPIM+QY+PG+D+GKAMYLYFVK+E  TP G+P R VLTSYYKSKHFKC
Sbjct  115   LDRRTFLYNLIMPIMNQYVPGLDKGKAMYLYFVKSETPTPSGIPTRPVLTSYYKSKHFKC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DP+ND TSPDQ+ILC+D  QSMYCQLLAGLV+R QVLRLGAVFASAFLRAISFL+ N
Sbjct  175   RPPDPFNDYTSPDQAILCTDNRQSMYCQLLAGLVHRHQVLRLGAVFASAFLRAISFLERN  234

Query  1264  WPSLCLDIRTGQL-SGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWP  1088
             W  LC DIRTG L S  I D  CR+AMS +L +P+P LADEIE ICR  SWKGI+ +LWP
Sbjct  235   WVHLCNDIRTGSLDSTTIVDPGCRTAMSDVLRSPNPLLADEIEAICRCKSWKGILCQLWP  294

Query  1087  KAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLL  908
             +AKYIEAV+TG+M+QY+PAL +YS GKLPL+CTMYASSECYFGVNL PL DPA+V++TLL
Sbjct  295   RAKYIEAVVTGTMAQYIPALNFYSGGKLPLVCTMYASSECYFGVNLNPLCDPAEVSYTLL  354

Query  907   PNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS-G  731
             PNMGYFEFIPLG+NG  L  ++   EEE    +P  KLVDL HVR GCYYELVVTTF+ G
Sbjct  355   PNMGYFEFIPLGDNGRLLLMMDAGNEEEV---VPVDKLVDLAHVRPGCYYELVVTTFAVG  411

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYRIGDVLQV GF+N+APQF+F CRRNVVLSID+DKTN+EDLH+S++ AKKLLEP+ A
Sbjct  412   LYRYRIGDVLQVTGFYNRAPQFRFICRRNVVLSIDTDKTNEEDLHKSVSMAKKLLEPYNA  471

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAGAAA--------IDAQVLQDCCIAIEEQLDYVY  395
             LLVEYTSYADTS++PGHYV+YWE++H   ++         DA +L +CC  +EE LDYVY
Sbjct  472   LLVEYTSYADTSTIPGHYVLYWEVLHLQHSSTTNGVVSLFDAHLLPECCSTVEESLDYVY  531

Query  394   RRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNV  215
             RRCR++DK +GPLEIR+V  GTFD LM   I++G SINQYKTPRCIKS ++ L++L S V
Sbjct  532   RRCRAYDKSVGPLEIRLVGAGTFDALMDLCISQGGSINQYKTPRCIKS-AAGLELLNSRV  590

Query  214   RARYFSPRDPAWKP  173
             +A +FSPRDP W P
Sbjct  591   KACFFSPRDPTWIP  604



>ref|XP_010684416.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=592

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/550 (69%), Positives = 455/550 (83%), Gaps = 18/550 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VS FK  VPVI Y   +PYI RI NG+  S ++G  I EMLCSSGTS GEPKLMPSIAED
Sbjct  55    VSTFKHHVPVIDYSGAQPYIKRIGNGEESSLLSGHTIVEMLCSSGTSNGEPKLMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLIMPI+++YIPG+DEGKAMYLYFVKAEMSTPCGLPAR VLTSYYKSKHFK 
Sbjct  115   LDRRTFVYNLIMPIVNKYIPGLDEGKAMYLYFVKAEMSTPCGLPARAVLTSYYKSKHFKG  174

Query  1444  RSFD-PYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQH  1268
             R+ + P+ D TSPDQ+ILC D+NQSMYCQLLAGLV R QVLRLGAVFASAFLR+I++L+ 
Sbjct  175   RARNVPFLDYTSPDQAILCDDSNQSMYCQLLAGLVLRDQVLRLGAVFASAFLRSITYLEK  234

Query  1267  NWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWP  1088
             NW  LC DIR G+L   I D EC+ AMS +L +P P LADEIE+IC  +SWKGI+ RLWP
Sbjct  235   NWVKLCNDIRKGKLDASITDPECQLAMSSLLTSPKPSLADEIEKICGGSSWKGILCRLWP  294

Query  1087  KAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLL  908
             KAK+IEAV+TGSM+QY+P+L YYSD KLPL C MYA++E YFGVNLKPLSDP+DV+FTLL
Sbjct  295   KAKFIEAVVTGSMAQYIPSLEYYSDKKLPLFCPMYAATESYFGVNLKPLSDPSDVSFTLL  354

Query  907   PNMGYFEFIPLGENG-TFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             PNM YFEFIPLGEN  +F    N          IP + L+DL  V+LGCYYE+VVTTF+G
Sbjct  355   PNMCYFEFIPLGENSWSFDEETN----------IPSNNLIDLSEVKLGCYYEIVVTTFAG  404

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             L RYRIGDVLQV GF+NKAPQFKF CRRNV LS+D++KT++E+L++SITAAKKLLEPH+ 
Sbjct  405   LCRYRIGDVLQVTGFYNKAPQFKFICRRNVALSLDNEKTSEENLYKSITAAKKLLEPHKV  464

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHA----GAAAIDAQVLQDCCIAIEEQLDYVYRRCR  383
             +L+EYTS ADTSSVPGHYV+YWEI+H       +++D +VL++CCIA+EE+LDY YRRCR
Sbjct  465   ILLEYTSVADTSSVPGHYVLYWEIVHVKPKLAHSSLD-EVLKECCIAVEEELDYTYRRCR  523

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
             SHDK IGPLEI++VKPGTF+ LM  +I++G SINQYKTPRCI+S  +ALK+LE+NV+ R+
Sbjct  524   SHDKAIGPLEIKLVKPGTFEALMDFYISQGGSINQYKTPRCIQSE-TALKLLEANVKERF  582

Query  202   FSPRDPAWKP  173
              SPRDP W P
Sbjct  583   LSPRDPIWTP  592



>ref|XP_008789923.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
[Phoenix dactylifera]
Length=592

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/549 (69%), Positives = 455/549 (83%), Gaps = 16/549 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V+++KR VPVI Y++I+PYI RIANG+  S I+G PITEML SSGTSGGEP+LMPSIAED
Sbjct  55    VAEYKRRVPVITYDEIQPYIQRIANGEDSSIISGCPITEMLISSGTSGGEPRLMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             +DRRT+LYNLIMPIM+Q+IPG+D+GKAMYL FVKAE+ TPCG+PAR VLTSYYKS+HF+ 
Sbjct  115   IDRRTYLYNLIMPIMNQHIPGLDKGKAMYLLFVKAEIPTPCGMPARPVLTSYYKSRHFRQ  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D +ND TSPD +ILC D++QSMYCQLLAGLV+R  VLRLGAVFASAFLR+ISFL+ +
Sbjct  175   RPRDAFNDYTSPDAAILCPDSHQSMYCQLLAGLVHRHHVLRLGAVFASAFLRSISFLECH  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             WP L  DIR+G+L+  I D ECRSAMS +L +P+P LADEIE IC + SWKGI+ RLWPK
Sbjct  235   WPDLANDIRSGRLNSAITDQECRSAMSALLASPNPTLADEIEAICSSGSWKGIICRLWPK  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKY+EAV+TGSM+QY+P L +YSD K+PL+C MYASSECYFGVNL+PL DP +V++TL+P
Sbjct  295   AKYLEAVLTGSMAQYIPMLEFYSDAKIPLVCVMYASSECYFGVNLRPLCDPMEVSYTLVP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEFIPL E+G  L  L +         +   K+V LV V++GCYYELVVTTF+GLY
Sbjct  355   NMGYFEFIPL-EDGLGLDQLKE---------VENDKVVGLVDVKIGCYYELVVTTFAGLY  404

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQV+GFHN APQFKF CRRNVVLS+D+DKTN+EDLH+SIT +KKLLE +  LL
Sbjct  405   RYRIGDVLQVSGFHNNAPQFKFICRRNVVLSVDNDKTNEEDLHKSITTSKKLLEANNYLL  464

Query  544   VEYTSYADTSSVPGHYVIYWEIM-----HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTSYA+TS++PGHYV++WEI       +    +D  +LQDCCIAIEE LDYVYRRCRS
Sbjct  465   VEYTSYAETSTIPGHYVLFWEIKCTSDDTSQTMTLDDHLLQDCCIAIEESLDYVYRRCRS  524

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HDK +GPLEIR+V+ GTF+ LM  FI++GSSINQYKTPRCI+S S ALK L S VR+ YF
Sbjct  525   HDKSVGPLEIRLVEAGTFEALMDIFISQGSSINQYKTPRCIES-SVALKFLNSKVRSCYF  583

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  584   SPRDPTWNP  592



>ref|XP_010038195.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Eucalyptus grandis]
 gb|KCW50014.1| hypothetical protein EUGRSUZ_K03463 [Eucalyptus grandis]
Length=606

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/556 (70%), Positives = 458/556 (82%), Gaps = 21/556 (4%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             +FK+ VPVI Y+ I+PYI RIA+G+  S ITG+PITEMLCSSGTS GEPK+MPSI ED+D
Sbjct  58    EFKKLVPVITYKAIQPYIERIAHGEDSSLITGKPITEMLCSSGTSAGEPKMMPSIEEDID  117

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             RRTFLYNLIMPIM QY+ G+DEGKAMYLYFVKAE STPCGLPAR+VLTSYYKSK FK R+
Sbjct  118   RRTFLYNLIMPIMSQYLTGLDEGKAMYLYFVKAERSTPCGLPARSVLTSYYKSKRFKFRA  177

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
              D YND TSP  +ILC D  QSMYCQLL+GLV+R QVLRLGAVFASAFLRA+SFL+ NW 
Sbjct  178   PDAYNDCTSPYAAILCDDGEQSMYCQLLSGLVHRHQVLRLGAVFASAFLRAVSFLERNWG  237

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              +C DI  G L   I D ECRS+MS ILL P+P LA EI+E+C + SWKGI+ RLWP+AK
Sbjct  238   RMCDDIAVGCLDPFITDPECRSSMSSILLPPNPTLAAEIQELCSSPSWKGILCRLWPRAK  297

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIEAV+TGSM+QY+PAL YYS+GKLP +CTMYASSECYFGVNL+PL DP DVAFTLLPNM
Sbjct  298   YIEAVVTGSMAQYIPALEYYSEGKLPPVCTMYASSECYFGVNLRPLCDPHDVAFTLLPNM  357

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             GYFEFIPLG NGT +  +++      +E +   +LVDLV+VR+GCYYELVVTTF+GLYRY
Sbjct  358   GYFEFIPLGGNGTLVMEIDE------DEEVSGRRLVDLVNVRVGCYYELVVTTFAGLYRY  411

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             RIGDVLQV GFHN+APQF+F CRRNVVLSID+DKTN+EDLH+SITA KKLLEP  A LVE
Sbjct  412   RIGDVLQVTGFHNRAPQFRFICRRNVVLSIDNDKTNEEDLHKSITAGKKLLEPLDAFLVE  471

Query  538   YTSYADTSSVPGHYVIYWEIMH--------------AGAAAIDAQVLQDCCIAIEEQLDY  401
             YTS  DTSSVPGHYV+YWEI H              A   A+D +VL++CCI +EE+LDY
Sbjct  472   YTSRVDTSSVPGHYVLYWEIKHHPRSPPSALSNNSGANKLALDGRVLEECCIVVEEELDY  531

Query  400   VYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILES  221
             VYRRCR++D+ +GPLEIRVV PGTF+LLM  FI++G SINQYKTPRCIKS S+AL++L+ 
Sbjct  532   VYRRCRTNDRSVGPLEIRVVNPGTFELLMDFFISQGGSINQYKTPRCIKS-SAALELLDG  590

Query  220   NVRARYFSPRDPAWKP  173
             NV A +FSPRDP W+P
Sbjct  591   NVEASFFSPRDPTWRP  606



>ref|XP_009604192.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X2 [Nicotiana tomentosiformis]
Length=568

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/550 (70%), Positives = 444/550 (81%), Gaps = 48/550 (9%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VS FK  +P + YE+I+PYILRIANG+  + I+  PITEMLC                  
Sbjct  57    VSKFKSLIPTVTYEEIQPYILRIANGEDSNLISAHPITEMLC------------------  98

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
                             +YIPG+DEGKAM+LYFVKAEMSTPCG+PARTVLTSYYKSKHFKC
Sbjct  99    ----------------RYIPGLDEGKAMFLYFVKAEMSTPCGIPARTVLTSYYKSKHFKC  142

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             RS DPYND TSPDQ+ILC D+NQSMYCQLLAGLVYR QVLR+GAVFASA LRAISFLQ N
Sbjct  143   RSKDPYNDFTSPDQAILCYDSNQSMYCQLLAGLVYRHQVLRIGAVFASALLRAISFLQRN  202

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKIL--LAPDPEL-ADEIEEICRAASWKGIVYRL  1094
             W ++C DIRTGQL+ MI D  CRS++S IL  L  D ++  DEIEEIC  +SWKGI+ +L
Sbjct  203   WQNMCHDIRTGQLNAMITDVSCRSSLSNILSTLNLDSDIDTDEIEEICGRSSWKGIICQL  262

Query  1093  WPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFT  914
             WPKAKYIEAV+TGSMSQY+PAL YYS+GKLPLICTMYASSECYFGVNLKPL+ P +V+FT
Sbjct  263   WPKAKYIEAVVTGSMSQYIPALEYYSEGKLPLICTMYASSECYFGVNLKPLNPPDEVSFT  322

Query  913   LLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             LLPNM YFEFIPLG NGTFL +L++E        +PQSKLVDLVHVRLG YYELV+TTFS
Sbjct  323   LLPNMAYFEFIPLGANGTFLIDLDEEEF------VPQSKLVDLVHVRLGYYYELVITTFS  376

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYRIGDVLQV GFHNKAPQF+F CRRNVVLSID+DKTN++DLHRSIT AKKLLEPHQ
Sbjct  377   GLYRYRIGDVLQVTGFHNKAPQFRFICRRNVVLSIDNDKTNEQDLHRSITLAKKLLEPHQ  436

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGA-----AAIDAQVLQDCCIAIEEQLDYVYRR  389
             ALLVEYTSYAD SS+PGHYV+YWEI+H+ +       ++AQVL++CCIAIEEQLDY+YRR
Sbjct  437   ALLVEYTSYADASSLPGHYVLYWEIVHSHSIIDKDVNVEAQVLEECCIAIEEQLDYIYRR  496

Query  388   CRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRA  209
             CR++DK +GPLEIR+VKPGTF+ LM   I++G SINQYKTPRCI SN SA ++L S V+A
Sbjct  497   CRTNDKSVGPLEIRLVKPGTFEALMDLLISQGGSINQYKTPRCIMSNESAFELLNSTVKA  556

Query  208   RYFSPRDPAW  179
              YFSPR+P+W
Sbjct  557   SYFSPREPSW  566



>emb|CDY53016.1| BnaC04g00140D [Brassica napus]
Length=594

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/545 (68%), Positives = 451/545 (83%), Gaps = 8/545 (1%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FKR VPVI Y+D+ PYI RIANG+  S ITG PITE+LCSSGTSGGEPKLMP+I+ED
Sbjct  57    VMEFKRSVPVITYKDVCPYIQRIANGEDSSLITGHPITEILCSSGTSGGEPKLMPTISED  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLI PI ++Y+ G+D+GK MYL FVKAE STPCGLP RTVLTSYYKSKHF+C
Sbjct  117   LDRRTFVYNLINPIANKYLEGLDKGKTMYLNFVKAETSTPCGLPIRTVLTSYYKSKHFQC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP Q+ILC D+NQSMYCQLLA L++R +V+RLGAVFASAFLRAIS+L+  
Sbjct  177   RPYDPFNDLTSPIQTILCEDSNQSMYCQLLAALIHRHKVMRLGAVFASAFLRAISYLERK  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIRTG LS MI D  C++AM+ +L +P+P+LADE+EEIC   SWKGI+ +LWP+
Sbjct  237   WSQLCQDIRTGHLSPMITDPGCQTAMTSLLASPNPDLADEVEEICGRPSWKGILCQLWPQ  296

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QY+PAL ++S GK+PL+C MYASSE YFGVN+KPLS P+DV FTLLP
Sbjct  297   AKFIEAVVTGSMAQYIPALEFFSQGKIPLVCPMYASSETYFGVNVKPLSKPSDVVFTLLP  356

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFI LG+NGT   ++  E        +P  K+VDLV V+LG YYELVVTTF+GLY
Sbjct  357   NMCYFEFISLGKNGTLSFDVEDEEV------VPCDKVVDLVDVKLGRYYELVVTTFAGLY  410

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQVAGF+NKAPQF+F CRRNVVLSID DKTN+EDLHRSIT AKK LE ++A L
Sbjct  411   RYRIGDVLQVAGFYNKAPQFRFICRRNVVLSIDLDKTNEEDLHRSITLAKKKLE-NKAFL  469

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVL-QDCCIAIEEQLDYVYRRCRSHDKC  368
              EYTSYADTSSVPGHYV++WEI        + ++L ++CCIA+EE+LDY+YR+CR  D+ 
Sbjct  470   AEYTSYADTSSVPGHYVLFWEIQWLEPDDEEEKLLMEECCIAVEEELDYIYRQCRKRDRS  529

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             +GPLEIRVVKPGTF+ LM   I++G S+NQYKTPRC+KSNS+ LK+L+ +V   +FSPRD
Sbjct  530   VGPLEIRVVKPGTFEKLMDMIISQGGSLNQYKTPRCVKSNSAMLKLLDGHVTGSFFSPRD  589

Query  187   PAWKP  173
             P W P
Sbjct  590   PTWSP  594



>ref|XP_002882130.1| auxin-responsive GH3 family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58389.1| auxin-responsive GH3 family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=589

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/542 (68%), Positives = 450/542 (83%), Gaps = 11/542 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FKR VP+I Y+DI PYI RIANG+  S ITG PITE+LCSSGTS GEPKLMP+I+ED
Sbjct  57    VVEFKRSVPIITYKDIYPYIQRIANGEDSSLITGHPITEILCSSGTSAGEPKLMPTISED  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLI+PI+++YIPG+D+GKAMYL FVKAE STPCGLP R VLTSYYKSKHF+C
Sbjct  117   LDRRTFLYNLIIPIVNKYIPGLDKGKAMYLNFVKAETSTPCGLPIRAVLTSYYKSKHFQC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP Q+ILC D+NQSMYCQLLAGL++R +V+RLGAVFASAFLRAIS+L+  
Sbjct  177   RPYDPFNDLTSPIQTILCEDSNQSMYCQLLAGLIHRHKVMRLGAVFASAFLRAISYLEKK  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIRTG+L+ MI D  C+ AMS +L +PDPELA EIEEIC  +SWKGI+  LWP+
Sbjct  237   WSQLCEDIRTGRLNPMITDPGCQIAMSCLLTSPDPELASEIEEICSRSSWKGILCHLWPR  296

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QY+PAL ++  GK+PL+C MYASSE YFGVN++PLS P+DV FTLLP
Sbjct  297   AKFIEAVVTGSMAQYIPALEFFGQGKIPLVCPMYASSETYFGVNVEPLSKPSDVVFTLLP  356

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLG+NG    +L+       +E +P  K+VDLV+V+LG YYELVVTTF+GLY
Sbjct  357   NMCYFEFIPLGKNGALSFDLDD------DEQVPCDKVVDLVNVKLGRYYELVVTTFAGLY  410

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQVAGF+N+APQF+F CRRNVVLSID DKTN+EDLHRSIT AKK L  + A L
Sbjct  411   RYRIGDVLQVAGFYNEAPQFRFICRRNVVLSIDLDKTNEEDLHRSITLAKKKLGSN-AFL  469

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
              EYTSYADTSSVPGHYV++WEI       ++ ++++ CC+A+EE+LDY+YR+CR+ ++ I
Sbjct  470   AEYTSYADTSSVPGHYVLFWEIQ----GHLEPKLMEGCCVAVEEELDYIYRQCRTKERSI  525

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             G LEIRVVKPGTF+ LM   I++G S NQYKTPRC+KSNS+  K+L  +V A +FSPRDP
Sbjct  526   GALEIRVVKPGTFEKLMDLIISQGGSFNQYKTPRCVKSNSATFKLLNGHVTASFFSPRDP  585

Query  184   AW  179
              W
Sbjct  586   TW  587



>ref|XP_009775769.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X2 [Nicotiana sylvestris]
Length=571

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/551 (71%), Positives = 447/551 (81%), Gaps = 48/551 (9%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             VS FK  VP + YEDI+PYILRIANG+    I+  PITEMLC                  
Sbjct  57    VSKFKSLVPAVTYEDIQPYILRIANGEDPILISANPITEMLC------------------  98

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
                             +YIPG+DEGKAM+LYFVKAEMSTPCG+PARTVLTSYY+SKHFKC
Sbjct  99    ----------------RYIPGLDEGKAMFLYFVKAEMSTPCGIPARTVLTSYYESKHFKC  142

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             RS DPYND TSPDQ+ILC D+NQSMYCQLLAGLVYR QVLR+GAVFASA LRAISFLQ N
Sbjct  143   RSKDPYNDFTSPDQAILCYDSNQSMYCQLLAGLVYRHQVLRIGAVFASALLRAISFLQRN  202

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKIL--LAPDPEL-ADEIEEICRAASWKGIVYRL  1094
             W ++C DIRTGQL+ MI D  CRSA+S IL  L  D ++ ADEIEEIC  +SWKGI+ +L
Sbjct  203   WQNMCHDIRTGQLNAMITDVSCRSALSNILSTLNLDSDIVADEIEEICGRSSWKGIICQL  262

Query  1093  WPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFT  914
             WPKAKYIEAV+TGSMSQY+PAL YYS+GKLPLICTMYASSECYFGVNLKPLS P +V+FT
Sbjct  263   WPKAKYIEAVVTGSMSQYIPALEYYSEGKLPLICTMYASSECYFGVNLKPLSPPDEVSFT  322

Query  913   LLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             LLPNM YFEFIPLG NGTFL +L++E        +PQSKLVDLVHVRLG YYELVVTTFS
Sbjct  323   LLPNMAYFEFIPLGANGTFLMDLDEEQF------VPQSKLVDLVHVRLGYYYELVVTTFS  376

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYRIGDVLQV GFHNKAPQF+F CRRNVVLSID+DKTN++DLHRSIT AKKLLEPHQ
Sbjct  377   GLYRYRIGDVLQVTGFHNKAPQFRFICRRNVVLSIDNDKTNEKDLHRSITLAKKLLEPHQ  436

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGAAA-----IDAQVLQDCCIAIEEQLDYVYRR  389
             ALLVEYTSYAD SSVPGHYV+YWEI+H+ +       ++AQV+++CCIAIEE+LDY+YRR
Sbjct  437   ALLVEYTSYADASSVPGHYVLYWEIVHSHSIVNKDVNVEAQVVEECCIAIEEELDYIYRR  496

Query  388   CRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRA  209
             CR++DK IGPLEIR+VKPGTF+ LM   I++G SINQYKTPRCI SN SAL++L SNV+A
Sbjct  497   CRTNDKSIGPLEIRLVKPGTFEALMDLLISQGGSINQYKTPRCIISNDSALQLLNSNVKA  556

Query  208   RYFSPRDPAWK  176
              YFSPR+P+WK
Sbjct  557   SYFSPREPSWK  567



>emb|CDX80131.1| BnaA05g00250D [Brassica napus]
Length=594

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/543 (68%), Positives = 448/543 (83%), Gaps = 8/543 (1%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FKR VP+I Y+D+ PYI RIANG+  S ITG  ITE+LCSSGTSGGEPKLMP+I+ED
Sbjct  57    VLEFKRSVPIITYKDVCPYIQRIANGEDSSLITGHLITEILCSSGTSGGEPKLMPTISED  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLI PI ++Y+ G+D+GK MYL FVKAE STPCGLP RTVLTSYYKSKHF+C
Sbjct  117   LDRRTFVYNLINPIANKYLEGLDKGKTMYLNFVKAETSTPCGLPIRTVLTSYYKSKHFQC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP Q+ILC D+NQSMYCQLLA L++R +V+RLGAVFASAFLRAIS+L+  
Sbjct  177   RPYDPFNDLTSPIQTILCEDSNQSMYCQLLAALIHRHKVMRLGAVFASAFLRAISYLERK  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIRTG LS MI D  C++AMS +L +P+P+LADEIEEIC   SWKGI+ +LWP+
Sbjct  237   WSQLCQDIRTGHLSPMITDPGCQTAMSSLLASPNPDLADEIEEICGRPSWKGILCQLWPQ  296

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QY+PAL ++S GK+PL+C MYASSE YFGVN+ PLS P+DV FTLLP
Sbjct  297   AKFIEAVVTGSMAQYIPALEFFSQGKIPLVCPMYASSETYFGVNVMPLSKPSDVVFTLLP  356

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLG+NGT   ++  E        +P  K+VDLV V+LG YYELVVTTF+GLY
Sbjct  357   NMCYFEFIPLGKNGTLSFDVEDEEV------VPCDKVVDLVDVKLGRYYELVVTTFAGLY  410

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQVAGF+NKAPQFKF CRRNVVLSID DKTN+EDLHRSIT AKK LE ++A L
Sbjct  411   RYRIGDVLQVAGFYNKAPQFKFICRRNVVLSIDLDKTNEEDLHRSITLAKKKLE-NKAFL  469

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVL-QDCCIAIEEQLDYVYRRCRSHDKC  368
              EYTSYADTSSVPGHYV++WEI        + ++L ++CCIA+EE+LDY+YR+CR  D+ 
Sbjct  470   AEYTSYADTSSVPGHYVLFWEIQWLEPDDEEEKLLMEECCIAVEEELDYIYRQCRKRDRS  529

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             +GPLEIRVVK GTF+ LM   I++G S+NQYKTPRC+KSNS+ LK+L+ +V   +FSPRD
Sbjct  530   VGPLEIRVVKAGTFEKLMDMIISQGGSLNQYKTPRCVKSNSAMLKLLDGHVTGSFFSPRD  589

Query  187   PAW  179
             P W
Sbjct  590   PTW  592



>ref|XP_006293888.1| hypothetical protein CARUB_v10022875mg [Capsella rubella]
 gb|EOA26786.1| hypothetical protein CARUB_v10022875mg [Capsella rubella]
Length=589

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/544 (67%), Positives = 450/544 (83%), Gaps = 11/544 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             + +FKR VP+I Y+DI PYI RIANG+  S ITG PITE+LCSSGTS GEPKLMP+I+ED
Sbjct  57    ILEFKRSVPIITYKDIYPYIQRIANGEDSSLITGHPITEILCSSGTSAGEPKLMPTISED  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLI+PIM++YIPG+D+GKAMYL FVKAE STPCGLP R VLTSYYKSKHF+C
Sbjct  117   LDRRTFLYNLIIPIMNKYIPGLDKGKAMYLNFVKAETSTPCGLPIRAVLTSYYKSKHFQC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP Q+ILC D+NQSMYCQLLA L+ R +V+RLGAVFASAFLRAIS+L+  
Sbjct  177   RPYDPFNDLTSPIQTILCEDSNQSMYCQLLAALIQRHKVMRLGAVFASAFLRAISYLEQK  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIR G+L+ MI D  C+ AMS +L +P+PELA EIEEICR +SWKGI+ +LWPK
Sbjct  237   WSELCEDIRRGRLNPMITDPGCQVAMSCLLSSPNPELASEIEEICRRSSWKGILCQLWPK  296

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QY+PAL  +S GK+PL+C MYASSE YFGVN++PLS P+DV FTLLP
Sbjct  297   AKFIEAVVTGSMAQYIPALELFSQGKIPLVCPMYASSETYFGVNVEPLSRPSDVVFTLLP  356

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLG+NGT   +L+        E +P  ++VDLV+V+LG YYELVVTTF+GLY
Sbjct  357   NMCYFEFIPLGKNGTLSFDLDD------GEQVPCDEVVDLVNVKLGRYYELVVTTFAGLY  410

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQVAGF+N+APQF+F CRRNVVLSID DKTN+EDLHRSIT AK+ L  + A L
Sbjct  411   RYRIGDVLQVAGFYNRAPQFRFICRRNVVLSIDLDKTNEEDLHRSITLAKRKLGSN-AFL  469

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
              EYTSYADTSS+PGHYV++WEI       ++ ++ Q+CC+A+EE+LDY+YR+CR+ ++ I
Sbjct  470   AEYTSYADTSSLPGHYVLFWEIQ----GKLEPKLAQECCVAVEEELDYIYRQCRTKERSI  525

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             G LEIRVVKPGTF+ LM   I++G S+NQYKTPRC+K NS+  K+L  +V A +FSPRDP
Sbjct  526   GALEIRVVKPGTFEKLMDLIISQGGSLNQYKTPRCVKYNSATFKLLNGHVTASFFSPRDP  585

Query  184   AWKP  173
              W P
Sbjct  586   TWVP  589



>ref|XP_006397970.1| hypothetical protein EUTSA_v10001368mg [Eutrema salsugineum]
 gb|ESQ39423.1| hypothetical protein EUTSA_v10001368mg [Eutrema salsugineum]
Length=592

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/542 (68%), Positives = 452/542 (83%), Gaps = 8/542 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             +FKR VP+I Y+D+ PYI RIANG+  S ITG PITE+LCSSGTSGGEPKLMP+I+EDLD
Sbjct  59    EFKRSVPIIKYKDVCPYIQRIANGEDSSLITGHPITEILCSSGTSGGEPKLMPTISEDLD  118

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             RRTFLYNLIMPI+++Y+ G+D+GKAMYL FVKAE STPCGLP R VLTSYYKSKHF+CR+
Sbjct  119   RRTFLYNLIMPIVNKYVTGLDKGKAMYLNFVKAETSTPCGLPIRAVLTSYYKSKHFQCRA  178

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             +DP+ND+TSP Q+ILC D+NQSMYCQLLA L++R +V+RLGAVFASAFLR IS+L+  W 
Sbjct  179   YDPFNDLTSPIQTILCEDSNQSMYCQLLAALIHRHKVMRLGAVFASAFLRGISYLEQKWS  238

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC DIRTG LS MI D  C+ AMS +L +P+P LA+EIEEIC  +SWKGI+ +LWPKAK
Sbjct  239   QLCEDIRTGHLSPMITDPGCQMAMSCLLTSPNPGLANEIEEICGRSSWKGIICQLWPKAK  298

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             +IEAV+TGSM+QY+PAL ++S GK+PL+C MYASSE YFGVN+KPLS PADV FTLLPNM
Sbjct  299   FIEAVVTGSMAQYIPALEFFSQGKIPLVCPMYASSETYFGVNVKPLSKPADVVFTLLPNM  358

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
              YFEFIPLG+NGT         + ++++ +P  K+VDLV+V+LG YYELVVTTF+GL RY
Sbjct  359   CYFEFIPLGKNGTL------SLDLDDDDQVPCDKVVDLVNVKLGRYYELVVTTFAGLNRY  412

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             RIGDVLQVAGF+NKAPQF+F CRRNVVLSID DKTN+EDLHRSIT AKK L  ++A L E
Sbjct  413   RIGDVLQVAGFYNKAPQFRFICRRNVVLSIDLDKTNEEDLHRSITLAKKNLH-NKAFLAE  471

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTSYADTSSVPGHYV++WEI          +++++CCIA+EE+LDY+YR+CR+ ++ IGP
Sbjct  472   YTSYADTSSVPGHYVLFWEI-QGLEPDHQQKLMEECCIAVEEELDYIYRQCRTKERSIGP  530

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIRVV+PGTF+ LM   I++G S NQYKTPRC+KS+S+ L++L ++V A +FSPR P W
Sbjct  531   LEIRVVEPGTFEKLMDLIISQGGSFNQYKTPRCVKSDSATLELLNAHVTASFFSPRYPTW  590

Query  178   KP  173
              P
Sbjct  591   SP  592



>ref|XP_009142505.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Brassica rapa]
Length=594

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/543 (68%), Positives = 447/543 (82%), Gaps = 8/543 (1%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FKR VP+I Y+D+ PYI RIANG+  S ITG  ITE+LCSSGTSGGEPKLMP+I+ED
Sbjct  57    VLEFKRSVPIITYKDVCPYIQRIANGEDSSLITGHLITEILCSSGTSGGEPKLMPTISED  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLI PI ++Y+ G+D+GK MYL FVKAE STPCGLP RTVLTSYYKSKHF+C
Sbjct  117   LDRRTFVYNLINPIANKYLEGLDKGKTMYLNFVKAETSTPCGLPIRTVLTSYYKSKHFQC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP Q+ILC D+NQSMYCQLLA L++R +V+RLGAVFASAFLRAIS+L+  
Sbjct  177   RPYDPFNDLTSPIQTILCEDSNQSMYCQLLAALIHRHKVMRLGAVFASAFLRAISYLERK  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC +IRTG LS MI D  C+ AMS +L +P+P+LADEIEEIC   SWKGI+ +LWP+
Sbjct  237   WSQLCQNIRTGHLSPMITDPGCQMAMSSLLASPNPDLADEIEEICGRPSWKGILCQLWPQ  296

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QY+PAL ++S GK+PL+C MYASSE YFGVN+KPLS P DV FTLLP
Sbjct  297   AKFIEAVVTGSMAQYIPALEFFSQGKIPLVCPMYASSETYFGVNVKPLSKPCDVVFTLLP  356

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLG+NGT   ++  E        +P  K+VDLV V+LG YYELVVTTF+GLY
Sbjct  357   NMCYFEFIPLGKNGTLSFDVEDEEV------VPCDKVVDLVDVKLGRYYELVVTTFAGLY  410

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQVAGF+NKAPQFKF CRRNVVLSID DKTN+EDLHRSIT AKK LE ++A L
Sbjct  411   RYRIGDVLQVAGFYNKAPQFKFICRRNVVLSIDLDKTNEEDLHRSITLAKKKLE-NKAFL  469

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVL-QDCCIAIEEQLDYVYRRCRSHDKC  368
              EYTSYADTSSVPGHYV++WEI        + ++L ++CCIA+EE+LDY+YR+CR  D+ 
Sbjct  470   AEYTSYADTSSVPGHYVLFWEIQWLEPDDEEEKLLMEECCIAVEEELDYIYRQCRKRDRS  529

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             +GPLEIRVVK GTF+ LM   I++G S+NQYKTPRC+KSNS+ LK+L+ +V   +FSPRD
Sbjct  530   VGPLEIRVVKAGTFEKLMDMIISQGGSLNQYKTPRCVKSNSAMLKLLDGHVTGSFFSPRD  589

Query  187   PAW  179
             P W
Sbjct  590   PTW  592



>ref|XP_010938422.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
[Elaeis guineensis]
Length=596

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/549 (67%), Positives = 446/549 (81%), Gaps = 12/549 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V+++K  VPVI Y++I+PYI RIANG+  S I+G PITEML SSGTSGGEP+LMPSIAED
Sbjct  55    VAEYKCRVPVITYDEIQPYIQRIANGEDSSIISGYPITEMLTSSGTSGGEPRLMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             +DRRT+LYNLIMPIM+QYIPG+D+GKAMYL FVKAE  T CG+PAR VLTSYYK +HF+ 
Sbjct  115   IDRRTYLYNLIMPIMNQYIPGLDKGKAMYLLFVKAETPTACGMPARPVLTSYYKGQHFRH  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DP+ND TSPD +ILC  ++QSMYCQLLAGL++R  VLRLGAVFASAFLR+ISFL+ N
Sbjct  175   RPRDPFNDYTSPDAAILCPGSHQSMYCQLLAGLIHRHHVLRLGAVFASAFLRSISFLECN  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  L  DIR+G+L+  I D ECRSAMS +L +P+P LADEIE IC   SWKGI+ +LWPK
Sbjct  235   WIDLANDIRSGRLNSTITDEECRSAMSALLASPNPMLADEIESICSNGSWKGIICKLWPK  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AKYIEAV+TGSM+QY+P L YYSD K+PL+C MYASSECYFGVNL+PL DP +V++TLLP
Sbjct  295   AKYIEAVLTGSMAQYIPMLEYYSDAKIPLVCVMYASSECYFGVNLRPLCDPMEVSYTLLP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NMGYFEFIPL +       L++       + +   K+V LV V++GCYYELVVTTF+GLY
Sbjct  355   NMGYFEFIPLEDGLGLGLGLDQ------VKEVENDKVVGLVDVKIGCYYELVVTTFAGLY  408

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQV+GFHN APQF+F CRRNVVLS+D DKTN+EDLH+SIT +KKLLE +  LL
Sbjct  409   RYRIGDVLQVSGFHNNAPQFRFICRRNVVLSVDLDKTNEEDLHKSITTSKKLLEANNLLL  468

Query  544   VEYTSYADTSSVPGHYVIYWEIM-----HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTS+ DTS++PGHYV++WEI       +    +D  +LQDCCIAIEE LDY+YRRCRS
Sbjct  469   VEYTSHTDTSTIPGHYVLFWEIKCTSDDTSQIIPLDDHLLQDCCIAIEESLDYIYRRCRS  528

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             +DK +GPLEIR+V+ GTF+ LM  FI++GSSINQYKTPRCI+S S ALK L S VR+ +F
Sbjct  529   NDKSVGPLEIRLVEAGTFEALMDIFISQGSSINQYKTPRCIES-SVALKFLNSKVRSCFF  587

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  588   SPRDPTWNP  596



>emb|CBI36825.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/549 (68%), Positives = 431/549 (79%), Gaps = 60/549 (11%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FK+ VPVI Y+DI PYI RIANG+  S I+G PITEMLCSSGTSGGEPK+MPSIAED
Sbjct  55    VLEFKQSVPVITYKDIHPYIQRIANGEDSSLISGHPITEMLCSSGTSGGEPKMMPSIAED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             L+RRTFLYNLIMPIM+QYIPG+DEGKAM+LYFVKAEMSTPCGLPAR VLTSYYKSK+F+C
Sbjct  115   LNRRTFLYNLIMPIMNQYIPGLDEGKAMFLYFVKAEMSTPCGLPARAVLTSYYKSKNFRC  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D +ND TSPDQ+ILC+D+NQSMYCQLLAGLV+R QVLRLGAVFASA LRAISFL+ +
Sbjct  175   RVRDAFNDFTSPDQAILCTDSNQSMYCQLLAGLVHRHQVLRLGAVFASALLRAISFLERH  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIRTG L   I D ECRS+MS IL +P+P LADEIEEIC   SWKG++      
Sbjct  235   WVHLCNDIRTGHLDSSITDPECRSSMSTILSSPNPHLADEIEEICSHPSWKGML------  288

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
                                                       +N+KPL DPADVAFTLLP
Sbjct  289   ------------------------------------------INMKPLCDPADVAFTLLP  306

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLGENGT L ++++E        +P+ KLVDLVHVRLGCYYELVVTTF+GL 
Sbjct  307   NMCYFEFIPLGENGTLLMDMDEEK------GVPKEKLVDLVHVRLGCYYELVVTTFAGLN  360

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQV GFHN+APQF+F CRRNVVLSID+DKTN+EDLHRSIT AKKLLEP+ ALL
Sbjct  361   RYRIGDVLQVTGFHNRAPQFRFICRRNVVLSIDNDKTNEEDLHRSITMAKKLLEPYNALL  420

Query  544   VEYTSYADTSSVPGHYVIYWEIMH-----AGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             VEYTSYADTSS+PGHYV+YWEI H     + +  +D++VL++CCIA+EE+LDY+YRRCR+
Sbjct  421   VEYTSYADTSSLPGHYVLYWEITHCISTDSPSTPLDSKVLEECCIAVEEELDYIYRRCRT  480

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HDK +GPLEIR+V+PGTF+ LM  FI++G SINQYKTPRCIKS S+ALK+L SNV A +F
Sbjct  481   HDKSVGPLEIRLVQPGTFEDLMDLFISQGGSINQYKTPRCIKS-SNALKLLNSNVEASFF  539

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  540   SPRDPRWIP  548



>ref|NP_182296.1| putative indole-3-acetic acid-amido synthetase GH3.9 [Arabidopsis 
thaliana]
 sp|O82243.1|GH39_ARATH RecName: Full=Putative indole-3-acetic acid-amido synthetase 
GH3.9; AltName: Full=Auxin-responsive GH3-like protein 9; Short=AtGH3-9 
[Arabidopsis thaliana]
 gb|AAC63630.1| putative auxin-responsive protein [Arabidopsis thaliana]
 gb|AAL06947.1| At2g47750/F17A22.14 [Arabidopsis thaliana]
 gb|AAN18195.1| At2g47750/F17A22.14 [Arabidopsis thaliana]
 gb|AEC10882.1| putative indole-3-acetic acid-amido synthetase GH3.9 [Arabidopsis 
thaliana]
Length=585

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/544 (68%), Positives = 451/544 (83%), Gaps = 11/544 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FKR VP+I Y+DI PYI RIANG+  S ITG  ITE+LCSSGTS GEPKLMP+I ED
Sbjct  53    VLEFKRAVPIIIYKDIYPYIQRIANGEDSSLITGHSITEILCSSGTSAGEPKLMPTIPED  112

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLI+PI+++YI G+D+GKAMYL FVKAE STPCGLP R VLTSYYKSKHF+C
Sbjct  113   LDRRTFLYNLIIPIVNKYITGLDKGKAMYLNFVKAETSTPCGLPIRAVLTSYYKSKHFQC  172

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP Q+ILC D+NQSMYCQLLAGL++R +V+RLGAVFASAFLRAIS+L+  
Sbjct  173   RPYDPFNDLTSPIQTILCEDSNQSMYCQLLAGLIHRHKVMRLGAVFASAFLRAISYLEKK  232

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIRTG L+ MI D  C+ AMS +L++P+PELA EIEEIC  +SWKGI+ +LWPK
Sbjct  233   WSQLCEDIRTGSLNPMITDPGCQMAMSCLLMSPNPELASEIEEICGRSSWKGILCQLWPK  292

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QY+PAL ++S GK+PL+C MYASSE YFGVN++PLS P+DV FTLLP
Sbjct  293   AKFIEAVVTGSMAQYIPALEFFSQGKIPLVCPMYASSETYFGVNVEPLSKPSDVVFTLLP  352

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLG+NGT   +L+       +E +P  K+VDLV+V+LG YYELVVTTF+GLY
Sbjct  353   NMCYFEFIPLGKNGTLSFDLDD------DEQVPCDKVVDLVNVKLGRYYELVVTTFAGLY  406

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQVAGF+N APQF+F CRRNVVLSID DKTN+EDLHRSIT AKK L  + A L
Sbjct  407   RYRIGDVLQVAGFYNGAPQFRFICRRNVVLSIDLDKTNEEDLHRSITLAKKKLGSN-AFL  465

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
              EYTSYADTSSVPGHYV++WEI       ++ +++++CC+A+EE+LDY+YR+CR+ ++ I
Sbjct  466   AEYTSYADTSSVPGHYVLFWEIQ----GHLEPKLMEECCVAVEEELDYIYRQCRTKERSI  521

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             G LEIRVVKPGTF+ LM   I++G S NQYKTPRC+KSNS+  K+L  +V A +FSPRDP
Sbjct  522   GALEIRVVKPGTFEKLMDLIISQGGSFNQYKTPRCVKSNSATFKLLNGHVMASFFSPRDP  581

Query  184   AWKP  173
              W P
Sbjct  582   TWVP  585



>ref|XP_010507858.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Camelina sativa]
Length=589

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/544 (67%), Positives = 452/544 (83%), Gaps = 11/544 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FKR VP+I Y+DI PYI RIANG+  S ITG  ITE+LCSSGTSGGEPKLMP+I+ED
Sbjct  57    VLEFKRSVPIITYKDIYPYIHRIANGEDSSLITGHRITEILCSSGTSGGEPKLMPTISED  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLI+PI+++YIPG+D+GKAMYL FVKAE STPCG+P R+VLTSYYKSKHF+C
Sbjct  117   LDRRTFLYNLIIPIVNKYIPGLDKGKAMYLNFVKAETSTPCGIPIRSVLTSYYKSKHFQC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP Q+ILC D NQSMYCQLLA L+ R +V+RLGAVFASAFLRAIS+L+  
Sbjct  177   RPYDPFNDLTSPIQTILCEDGNQSMYCQLLAALIQRHKVMRLGAVFASAFLRAISYLEQK  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIR+G+L+ MI D  C++AMS +L +P+PELA EIEEICR +SWKGI+ +LWPK
Sbjct  237   WSELCEDIRSGRLNPMITDPGCQTAMSSLLTSPNPELASEIEEICRGSSWKGILCQLWPK  296

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSMSQY+PAL  +S GK+PL+C MYASSE YFGVN++PLS P+DV FTLLP
Sbjct  297   AKFIEAVVTGSMSQYIPALELFSQGKIPLVCPMYASSETYFGVNVEPLSKPSDVVFTLLP  356

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLG+NGT   +L+       +E +P  K+VDLV V+LG YYELVVTTF+GLY
Sbjct  357   NMCYFEFIPLGKNGTLSFDLDD------DEQVPCDKVVDLVSVKLGRYYELVVTTFAGLY  410

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQVAGF+N+APQF+F CRRNVVLSID DKTN+EDLHRSIT AKK L   +ALL
Sbjct  411   RYRIGDVLQVAGFYNRAPQFRFICRRNVVLSIDLDKTNEEDLHRSITLAKKKLG-SKALL  469

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
             +EYTSY DTSS+PGHYV++WEI       ++ +++++CC+A+EE+LDY+YR+CR+ ++ I
Sbjct  470   LEYTSYVDTSSLPGHYVLFWEIQ----GKLEPKLVEECCVAVEEELDYIYRQCRTKERSI  525

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             G LEIRVVKPGTF+ LM   I++G S NQYKTPRC+K NS+  K+L  +V A +FS RDP
Sbjct  526   GALEIRVVKPGTFEKLMDMIISQGGSFNQYKTPRCVKYNSATFKLLNGHVTASFFSTRDP  585

Query  184   AWKP  173
              W P
Sbjct  586   TWVP  589



>gb|KDO87302.1| hypothetical protein CISIN_1g044130mg [Citrus sinensis]
Length=565

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/549 (67%), Positives = 432/549 (79%), Gaps = 44/549 (8%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIA-NGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAE  1628
             VSDFKRCVPV  Y++I PYI RIA +G+  S I+G PITEMLC                 
Sbjct  56    VSDFKRCVPVSTYKNIYPYIQRIAISGEDSSLISGHPITEMLC-----------------  98

Query  1627  DLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFK  1448
                              +YI G+DEGKAMY YFVKAEMSTP GLP RTVLTSYYKSKHFK
Sbjct  99    -----------------RYICGLDEGKAMYFYFVKAEMSTPSGLPTRTVLTSYYKSKHFK  141

Query  1447  CRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQH  1268
             CR+ DPYND TSPD +ILC+D+NQSMYCQLLAGL++R QVLRLGAVFASA LRAISFL+ 
Sbjct  142   CRTRDPYNDFTSPDPAILCNDSNQSMYCQLLAGLIHRHQVLRLGAVFASALLRAISFLER  201

Query  1267  NWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWP  1088
             NW  LC DIR+G+L   I D  CRS+   +L +P+P LADEIEEIC   SWKGI+ +LWP
Sbjct  202   NWFQLCNDIRSGRLDLTITDPGCRSSTLSLLTSPNPTLADEIEEICSRPSWKGILCQLWP  261

Query  1087  KAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLL  908
             +AKYIEAV+TGSM+QY+P+L YYS GKLPL+ TMYASSECYFGVNLKPLS+PADV+FTLL
Sbjct  262   RAKYIEAVVTGSMAQYIPSLEYYSAGKLPLVGTMYASSECYFGVNLKPLSNPADVSFTLL  321

Query  907   PNMGYFEFIPL-GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             PNM YFEF+PL GENGT LS      E  EEE +P  KLVDL HVR+G YYELVVTTF+G
Sbjct  322   PNMCYFEFLPLGGENGTLLS-----MEFNEEEEVPNDKLVDLGHVRVGHYYELVVTTFAG  376

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             L RYRIGDVLQV GF+N+APQF+F CRRNVVLSID+DKTN+EDLH+S+T AK LLEP+ A
Sbjct  377   LNRYRIGDVLQVTGFYNRAPQFRFICRRNVVLSIDNDKTNEEDLHKSVTIAKNLLEPYSA  436

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAGAAAI---DAQVLQDCCIAIEEQLDYVYRRCRS  380
             LLVEYTSYADTS+VPGHYV+YWEI    + A+     +VL++CCIA+EEQLDYVYRRCRS
Sbjct  437   LLVEYTSYADTSTVPGHYVLYWEIQIVDSPALPLDHQKVLEECCIAVEEQLDYVYRRCRS  496

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HDK +GPLEIRVV+PGTF+ LM   +++G SINQYKTPRCIKSN++AL +L+S+V+  +F
Sbjct  497   HDKSVGPLEIRVVEPGTFETLMDLLVSQGGSINQYKTPRCIKSNNAALMLLDSHVKDSFF  556

Query  199   SPRDPAWKP  173
             SPRDP W P
Sbjct  557   SPRDPKWIP  565



>gb|ACJ68117.1| putative indole-3-acetic acid-amido synthetase [Brassica napus]
Length=594

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/545 (65%), Positives = 433/545 (79%), Gaps = 8/545 (1%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FKR VP+I Y+D+ PYI RIANG+  S ITG  ITE+LCSSGTSGGEPKLMP+I+ED
Sbjct  57    VLEFKRSVPIITYKDVCPYIQRIANGEDSSLITGHLITEILCSSGTSGGEPKLMPTISED  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTF+YNLI PI ++Y+ G+D+GK MYL FVKAE STPCGLP RTVLTSYYKSKHF+C
Sbjct  117   LDRRTFVYNLINPIANKYLEGLDKGKTMYLNFVKAETSTPCGLPIRTVLTSYYKSKHFQC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP Q+ILC D+NQSMYCQLLA L++R +V    +    +      +L   
Sbjct  177   RPYDPFNDLTSPIQTILCEDSNQSMYCQLLAALIHRHKVHASRSCLRFSLSPCNLYLGRK  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIRTG LS MI D  C++AM+ +L +P+P+LADE+EEIC   SWKGI+ +LWP+
Sbjct  237   WSQLCQDIRTGHLSPMITDPGCQTAMTSLLASPNPDLADEVEEICGRPSWKGILCQLWPQ  296

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSM+QY+PAL ++S GK+PL+C MYASSE YFGVN+KPLS P+DV FTLLP
Sbjct  297   AKFIEAVVTGSMAQYIPALEFFSQGKIPLVCPMYASSETYFGVNVKPLSKPSDVVFTLLP  356

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLG+NGT   ++  E        +P  K+VDLV V+LG YYELVVTTF+GLY
Sbjct  357   NMCYFEFIPLGKNGTLSFDVEDEEV------VPCDKVVDLVDVKLGRYYELVVTTFAGLY  410

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVLQVAGF+NKAPQFKF CRRNVVLSID DKTN+ED HRSIT AKK LE ++A L
Sbjct  411   RYRIGDVLQVAGFYNKAPQFKFICRRNVVLSIDLDKTNEEDSHRSITLAKKKLE-NKAFL  469

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVL-QDCCIAIEEQLDYVYRRCRSHDKC  368
              E TSYADTSSVPGHYV++WEI        + ++L ++CCIA+EE+LDY+YR+CR  D+ 
Sbjct  470   AECTSYADTSSVPGHYVLFWEIQWLEPDDEEEKLLMEECCIAVEEELDYIYRQCRKRDRS  529

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             +GPLEIRVVKPGTF+ LM   I++G S+NQYKTPRC+KSNS+ LK+L+ +V   + SPRD
Sbjct  530   VGPLEIRVVKPGTFEKLMDMIISQGGSLNQYKTPRCVKSNSAMLKLLDGHVTGSFSSPRD  589

Query  187   PAWKP  173
             P W P
Sbjct  590   PTWSP  594



>gb|EMT24142.1| hypothetical protein F775_11820 [Aegilops tauschii]
Length=590

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/543 (63%), Positives = 423/543 (78%), Gaps = 12/543 (2%)
 Frame = -1

Query  1801  SDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDL  1622
             S FKR VPV+ Y+ ++PYI RI+ G+  S I+G  I E+L SSGTS GEP+LMP+I+EDL
Sbjct  56    STFKRNVPVVTYDVVQPYIARISTGEDSSIISGDRIVELLRSSGTSRGEPRLMPAISEDL  115

Query  1621  DRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCR  1442
             DRRT+LY+L+MPIM++Y+ G+ EGKAMYL FVKAE  T  G+P R+VLTSYYKS HF  R
Sbjct  116   DRRTYLYSLLMPIMNKYVSGLGEGKAMYLLFVKAETLTNSGIPVRSVLTSYYKSPHFLHR  175

Query  1441  SFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNW  1262
               D YN+ TSPD+ ILC D+ QSMYCQLL GLV R+ VLRLGAVFASAFLR+ISFL+ +W
Sbjct  176   KHDLYNNYTSPDEVILCPDSQQSMYCQLLCGLVERQHVLRLGAVFASAFLRSISFLEQHW  235

Query  1261  PSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKA  1082
               L  DIR G+L+  + ++ECR AM   L  P+PELADE+EEIC    WKGI+ RLWP  
Sbjct  236   CDLVNDIRIGKLNSNVTNTECRLAMEGFLALPNPELADELEEICGHGPWKGILGRLWPNV  295

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KYIEAV+TG+M+QY+P L +YS G++PL+CTMYASSE YFGVNL+PL  P DV++T+LPN
Sbjct  296   KYIEAVLTGTMAQYIPMLEFYSGGRIPLVCTMYASSESYFGVNLRPLCKPTDVSYTILPN  355

Query  901   MGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYR  722
             M YFEFIPL E+G  +++  +         +   KLV LV V++GCYYELVVTTFSGLYR
Sbjct  356   MAYFEFIPL-EDGLRVTDDEEV--------VGNDKLVSLVDVKVGCYYELVVTTFSGLYR  406

Query  721   YRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLV  542
             YR+GDVLQV GF+N+ PQFKF CRRNV+LSID+DKTN+EDLH S+T AKK+LE    +L+
Sbjct  407   YRVGDVLQVTGFYNRVPQFKFICRRNVILSIDTDKTNEEDLHNSVTRAKKILEDRNHILL  466

Query  541   EYTSYADTSSVPGHYVIYWEIMHA--GAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             EYTSY DTS+VPGHYV++WEI     G   +D Q+L+ CCI++EE LDY+YRRCR+HDK 
Sbjct  467   EYTSYPDTSTVPGHYVLFWEIKSTCEGVKPLDPQLLESCCISVEESLDYIYRRCRAHDKS  526

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             +GPLEIRVV+ G FD LM   +++GSSINQYKTPRCI+S   ALK+L S V A +FSPRD
Sbjct  527   VGPLEIRVVEAGAFDALMDLLVSQGSSINQYKTPRCIES-GLALKLLNSKVTASFFSPRD  585

Query  187   PAW  179
             P W
Sbjct  586   PEW  588



>ref|XP_003559815.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X1 [Brachypodium distachyon]
Length=590

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/544 (63%), Positives = 425/544 (78%), Gaps = 12/544 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S F R VPV+ Y+ ++PYI RI+ G+  S I G  I E+L SSGTS GEP+LMP+I+ED
Sbjct  55    ISTFNRNVPVVTYDVVQPYIARISTGEDSSIICGDRIVELLRSSGTSRGEPRLMPAISED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRT+LY+L+MPIM++Y+ G+ EGKAMYL FVKAE  T  G+P R+VLTSYYKS HF  
Sbjct  115   LDRRTYLYSLLMPIMNKYVSGLGEGKAMYLLFVKAETLTDSGIPVRSVLTSYYKSPHFLH  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D YN+ TSPD+ ILC D+ QSMYCQLL GL+ R  VLRLGAVFASAFLR+ISFL+ +
Sbjct  175   RKHDLYNNYTSPDEVILCPDSQQSMYCQLLCGLIERHHVLRLGAVFASAFLRSISFLEQH  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  L  DIR G+L+  + ++ CR AM   L  P+PELADE+EEIC    WKGI+ RLWP 
Sbjct  235   WRDLVNDIRIGKLNSNVTNNACRLAMVGFLALPNPELADELEEICSCGPWKGILGRLWPN  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYIEAV+TG+M+QY+P L +YS G++PL+CTMYASSE YFGVNL+PL +P DV++T+LP
Sbjct  295   VKYIEAVLTGTMAQYIPMLEFYSGGRIPLVCTMYASSESYFGVNLRPLCNPTDVSYTILP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPL E+G  +++        +E+ +   KLV LV V++GCYYELVVTTFSGLY
Sbjct  355   NMAYFEFIPL-EDGLRVTD--------DEDVVENDKLVSLVDVKVGCYYELVVTTFSGLY  405

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N APQFKF CRRNV+LSIDSDKTN+EDLH S+T AKK+LE    +L
Sbjct  406   RYRVGDVLQVTGFYNCAPQFKFICRRNVILSIDSDKTNEEDLHNSVTRAKKILEDRNYIL  465

Query  544   VEYTSYADTSSVPGHYVIYWEIMHA--GAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
             +EYTSYADTS+VPGHYV++WEI     G A +DAQ+L+ CC A+EE LDY+YRRCR+HDK
Sbjct  466   LEYTSYADTSTVPGHYVLFWEIKSTCEGGAPLDAQLLESCCTAVEESLDYIYRRCRAHDK  525

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              +GPLEIR+V+ G FD LM   +++GSSINQYKTPRCI+S   ALK+L S V A +FSPR
Sbjct  526   SVGPLEIRLVEAGAFDALMDLLVSQGSSINQYKTPRCIES-GLALKVLNSKVIASFFSPR  584

Query  190   DPAW  179
             DP W
Sbjct  585   DPQW  588



>ref|XP_004958633.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11-like 
isoform X1 [Setaria italica]
 ref|XP_004958634.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11-like 
isoform X2 [Setaria italica]
Length=593

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/547 (63%), Positives = 420/547 (77%), Gaps = 15/547 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S FK  VPV+ Y+ +R YI RIA G+  S + G+ I E+L SSGTS GEP+LMPSI+ED
Sbjct  55    ISAFKSQVPVVTYDVVRSYIARIAGGEESSILCGEKIVELLRSSGTSRGEPRLMPSISED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             L RRT+LY+LIMPIM++YI G+ EGKAMYL FVKAE  T  G+P R+VLTSYYKS HF  
Sbjct  115   LYRRTYLYSLIMPIMNKYIRGLGEGKAMYLLFVKAETLTNAGIPIRSVLTSYYKSPHFLQ  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +D YN  TSPD+ ILC D  QSMYCQLL GLV R+ VLRLGAVFASAFLR+ISFL+ +
Sbjct  175   RKYDLYNKYTSPDEVILCPDNKQSMYCQLLCGLVERQHVLRLGAVFASAFLRSISFLEQH  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  L  DIR GQLS  I +S C+ AM   L  P+PELADEIE IC + SWKGI+ RLWP 
Sbjct  235   WCDLVNDIRIGQLSSNITNSTCQLAMQSFLALPNPELADEIEAICSSGSWKGILGRLWPN  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYIEAV+TG+M+QY+P L +YSDG++PL+CTMYASSE YFGVNL+PL  P DV++T+LP
Sbjct  295   VKYIEAVLTGTMAQYIPMLEFYSDGRIPLVCTMYASSESYFGVNLRPLCSPKDVSYTILP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPL E+G  L+         + E +   KLV +V V++GCYYELVVTTFSGLY
Sbjct  355   NMAYFEFIPL-EDGLKLTE--------DYEVVENDKLVSMVDVKIGCYYELVVTTFSGLY  405

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N+APQFKF CRRNV+LS+D+DKTN+EDLH S+T AKK+LE    LL
Sbjct  406   RYRVGDVLQVTGFYNRAPQFKFICRRNVILSVDTDKTNEEDLHNSVTRAKKILESRNYLL  465

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAA-----IDAQVLQDCCIAIEEQLDYVYRRCRS  380
             +EYTS  DTS++PGHYV++WEI      A     IDAQ L+ CCIA+EE LDYVYRRCR+
Sbjct  466   LEYTSCTDTSTIPGHYVLFWEIKSTYEDATPCVPIDAQFLESCCIAVEEALDYVYRRCRA  525

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HDK +GPLEIR+V+ G FD LM   +++GSSINQYKTPRCI+S   ALK+L S V   +F
Sbjct  526   HDKSVGPLEIRLVEAGAFDALMDLLVSQGSSINQYKTPRCIESG-PALKLLNSRVTGSFF  584

Query  199   SPRDPAW  179
             SPRDP W
Sbjct  585   SPRDPEW  591



>gb|EMS61902.1| hypothetical protein TRIUR3_17511 [Triticum urartu]
Length=624

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/543 (62%), Positives = 423/543 (78%), Gaps = 12/543 (2%)
 Frame = -1

Query  1801  SDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDL  1622
             S FKR VPV+ Y+ ++PYI RI+ G+  S I+G  I E+L SSGTS GEP+LMP+I+EDL
Sbjct  90    STFKRNVPVVTYDVVQPYITRISTGEDSSIISGDRIVELLRSSGTSRGEPRLMPAISEDL  149

Query  1621  DRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCR  1442
             DRRT+LY+L+MPIM++Y+ G+ EGKAMYL FVKAE  T  G+P R+VLTSYYKS HF  R
Sbjct  150   DRRTYLYSLLMPIMNKYVSGLGEGKAMYLLFVKAETLTNSGIPVRSVLTSYYKSPHFLHR  209

Query  1441  SFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNW  1262
               D YN+ TSPD+ ILC D+ QSMYCQLL GLV R+ VLRLGAVFASAFLR+ISFL+ +W
Sbjct  210   KHDLYNNYTSPDEVILCPDSQQSMYCQLLCGLVERQHVLRLGAVFASAFLRSISFLELHW  269

Query  1261  PSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKA  1082
               L  DIR G+L+  + +++CR AM   L  P+PELADE+EEIC    WKGI+ RLWP  
Sbjct  270   CDLVTDIRNGKLNPNVTNTKCRLAMECFLALPNPELADELEEICGCGPWKGILGRLWPNV  329

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KYIEAV+TG+M+QY+P L +YS G++PL+CTMYASSE YFGVNL+PL  P DV++T+LPN
Sbjct  330   KYIEAVLTGTMAQYIPMLEFYSGGRIPLVCTMYASSESYFGVNLRPLCKPTDVSYTILPN  389

Query  901   MGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYR  722
             M YFEFIPL E+G  +++  +         +   KLV LV V++GCYYELVVTTFSGLYR
Sbjct  390   MAYFEFIPL-EDGLRVTDDEEV--------VGNDKLVSLVDVKVGCYYELVVTTFSGLYR  440

Query  721   YRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLV  542
             YR+GDVLQV GF+N APQFKF CRRNV+LSID+DKTN+EDLH S+T AKK+LE    +L+
Sbjct  441   YRVGDVLQVTGFYNHAPQFKFICRRNVILSIDTDKTNEEDLHNSVTRAKKILEDRNHILL  500

Query  541   EYTSYADTSSVPGHYVIYWEIMHA--GAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             EYTSY DTS+VPGHYV++WEI     G   +D Q+L+ CC+++EE LDY+YRRCR+HDK 
Sbjct  501   EYTSYPDTSTVPGHYVLFWEIKSTCEGVQPLDPQLLESCCVSVEESLDYIYRRCRAHDKS  560

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             +GPLEIRVV+ G FD LM   +++GSSINQYKTPRCI+S   ALK+L S V A +FSPRD
Sbjct  561   VGPLEIRVVEAGAFDALMDLLVSQGSSINQYKTPRCIES-GLALKLLNSKVTASFFSPRD  619

Query  187   PAW  179
             P W
Sbjct  620   PEW  622



>ref|XP_006840504.1| hypothetical protein AMTR_s00045p00199760 [Amborella trichopoda]
 gb|ERN02179.1| hypothetical protein AMTR_s00045p00199760 [Amborella trichopoda]
Length=582

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/542 (62%), Positives = 422/542 (78%), Gaps = 20/542 (4%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             +FKR VPV++Y+DI+P I RIANG+H+S I+G PITE+L SSGTSGGE KLMPSIAED+D
Sbjct  57    EFKRRVPVVSYDDIKPLIQRIANGEHYSLISGDPITELLTSSGTSGGESKLMPSIAEDID  116

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             RRT+LYNL+MPIM++++ G+D GKAMYLYFVKAE STP GLPAR VLTSYYKS+HF+ R 
Sbjct  117   RRTYLYNLLMPIMNKHVSGLDMGKAMYLYFVKAETSTPSGLPARPVLTSYYKSEHFRHRP  176

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             FDPYN++TSPD++ILC + +QSMYCQLL GL++R++VLRLGAVFASAFLRAI+FL+ NW 
Sbjct  177   FDPYNNLTSPDKTILCQEISQSMYCQLLCGLIFRQKVLRLGAVFASAFLRAINFLEQNWQ  236

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              +C+DI TG L  +I D  C  AMS++ L PDP+L+ EI  +C    W GI+  LWPKAK
Sbjct  237   RMCVDIETGNLDPLITDPGCLEAMSRV-LRPDPQLSTEISRLCERECWGGILCELWPKAK  295

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIE ++TGSMSQY+PAL YYS G+LPL+ TMYASSE YFGVNL+PL +PA VA+TLLPNM
Sbjct  296   YIEVIVTGSMSQYIPALNYYSGGRLPLVSTMYASSESYFGVNLEPLCEPASVAYTLLPNM  355

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
              YFEF P+ +    +S                 + V LV V +G +YEL+VT F+GLYRY
Sbjct  356   AYFEFAPIAKGEGTVSE----------------EPVSLVDVEVGRFYELIVTNFAGLYRY  399

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             RIGDV+QV GFHN+APQF+F CRR+V+LSID+DKT +EDLHR++ +AKKLLEP +  LVE
Sbjct  400   RIGDVVQVTGFHNQAPQFRFICRRDVILSIDTDKTTEEDLHRAVASAKKLLEPSRLFLVE  459

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQ--VLQDCCIAIEEQLDYVYRRCRSHDKCI  365
             YTSYADTSS+PGHYV++WEI  A +  +     V++ CC  +E+ L  VYRRCRS DK +
Sbjct  460   YTSYADTSSIPGHYVLFWEIGPATSVRLSPHNSVMEACCANMEQSLGDVYRRCRSTDKSV  519

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIR+V PGTFD LM   ++ G S+NQYKTPR I+S   AL++L S V + + SPRDP
Sbjct  520   GPLEIRLVCPGTFDALMDLSVSNGGSVNQYKTPRGIRSG-LALELLNSRVTSNFLSPRDP  578

Query  184   AW  179
              W
Sbjct  579   MW  580



>sp|P0C0M3.1|GH311_ORYSJ RecName: Full=Probable indole-3-acetic acid-amido synthetase 
GH3.11; AltName: Full=Auxin-responsive GH3-like protein 11; 
Short=OsGH3-11 [Oryza sativa Japonica Group]
 gb|EEE67793.1| hypothetical protein OsJ_25530 [Oryza sativa Japonica Group]
Length=591

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/543 (64%), Positives = 416/543 (77%), Gaps = 13/543 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S FKR VPV+ Y+ + PYILRIA G+  S + G+ I E+L SSGTS GEP+LMPSI +D
Sbjct  55    ISAFKRHVPVVTYDKVHPYILRIATGEESSILCGEYILELLRSSGTSRGEPRLMPSILKD  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRT+LY+LIMPIM++YI G+ EGKAMYL FVKAE  T  G+P R+VLTSYYKS HF  
Sbjct  115   LDRRTYLYSLIMPIMNKYISGLGEGKAMYLLFVKAETLTDSGIPVRSVLTSYYKSPHFLH  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D YN+ TSPD+ ILC D+ QSMYCQLL GLV R+ VLR+GAVFASAFLR+ISFL+ +
Sbjct  175   RKHDLYNNYTSPDEVILCPDSQQSMYCQLLCGLVERQHVLRIGAVFASAFLRSISFLEQH  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  L  DIR GQL+  I    CR AM   L  P+PELAD++E IC   SWKGI+ RLWP 
Sbjct  235   WRDLVNDIRIGQLNSSITSPACRLAMLNFLALPNPELADQVEAICSCGSWKGILGRLWPN  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYIEAV+TG+M+QY+P L +Y  G +P +CTMYASSE YFGVNL PL  PADV++T+LP
Sbjct  295   VKYIEAVLTGTMAQYIPMLEFYGGGAIPFVCTMYASSESYFGVNLSPLCSPADVSYTILP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPL E+G  L++  +         I   KLV LV V++GCYYELVVTTFSGLY
Sbjct  355   NMAYFEFIPL-EDGLRLTDHEEV--------IENDKLVSLVDVKVGCYYELVVTTFSGLY  405

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N+APQFKF CRRNV+LSIDSDKTN+EDLH S+T AKK+LE    LL
Sbjct  406   RYRVGDVLQVTGFYNRAPQFKFICRRNVILSIDSDKTNEEDLHNSVTTAKKILENQNYLL  465

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAG---AAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSY D S+VPGHYV++WEI        A +DAQ+L+ CC A+EE LDYVYRRCR+HD
Sbjct  466   LEYTSYTDISTVPGHYVLFWEIKSTHDERPAPLDAQLLESCCAAVEESLDYVYRRCRAHD  525

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
             + IGPLEIR+V+ G FD LM   ++ GSSINQYKTPRCI+S S ALK+L S V A +FSP
Sbjct  526   RSIGPLEIRLVEAGAFDALMDLLVSHGSSINQYKTPRCIES-SLALKLLNSKVIACFFSP  584

Query  193   RDP  185
             +DP
Sbjct  585   QDP  587



>ref|XP_006588600.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
isoform X2 [Glycine max]
Length=464

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/470 (72%), Positives = 392/470 (83%), Gaps = 16/470 (3%)
 Frame = -1

Query  1543  MYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSFDPYNDMTSPDQSILCSDTNQSMYC  1364
             MYLYFVKAEM TPCGLPARTVLTSYYKSKHFKCR+ DP+ND TSPDQ+ILC+D+NQSM+C
Sbjct  1     MYLYFVKAEMCTPCGLPARTVLTSYYKSKHFKCRTHDPWNDYTSPDQTILCNDSNQSMHC  60

Query  1363  QLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPSLCLDIRTGQLSGMIADSECRSAMS  1184
             QLL+GLV+RR VLRLGAVFASA LRAISFL+ NW  LC DIRTGQLS  I D  CRS MS
Sbjct  61    QLLSGLVHRRHVLRLGAVFASALLRAISFLERNWRHLCEDIRTGQLSSFITDPSCRSCMS  120

Query  1183  KILLAPDPELADEIEEICRAASWKGIVYRLWPKAKYIEAVITGSMSQYVPALRYYSDGKL  1004
              +L +PDP LADEI  IC   SWKGI+ +LWPKAK+IEAV+TGSM+QYVPAL++YSDGKL
Sbjct  121   TLLSSPDPRLADEITRICSQKSWKGILCQLWPKAKFIEAVVTGSMAQYVPALKHYSDGKL  180

Query  1003  PLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMGYFEFIPLGENGTFLSNLNKegeee  824
             PL+CTMYASSECYFGVNLKPL DP DVAFTLLPNMGYFEF+PLG NGT L + ++     
Sbjct  181   PLVCTMYASSECYFGVNLKPLCDPGDVAFTLLPNMGYFEFLPLGHNGTLLMDFDE-----  235

Query  823   eeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRN  644
               E +P  KLVDLVHV+LGC+YE VVTTF+GLYRYR+GDVLQV GF+N APQ +F CRRN
Sbjct  236   -GEQVPNDKLVDLVHVKLGCFYEPVVTTFAGLYRYRVGDVLQVVGFYNNAPQVRFICRRN  294

Query  643   VVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGA  464
             VV+S+D++KTN+EDLHR +T AKKLLEP+ ALLVEYTSY DTSS+PGHYV+YWEI+H G 
Sbjct  295   VVISVDTEKTNEEDLHRGVTMAKKLLEPYDALLVEYTSYPDTSSIPGHYVLYWEILHCGI  354

Query  463   AA---------IDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMG  311
                        +DA VL++CCIA+EEQLDYVYRRCRS+DK +GPLEIRVV+PGTFD LM 
Sbjct  355   KTTESSQQLQLLDANVLEECCIAVEEQLDYVYRRCRSYDKSVGPLEIRVVEPGTFDALMD  414

Query  310   NFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWKP*LVS  161
              FI++G+SINQYKTPRCIKS  +  K+L+S V A +FSPRDP W P + S
Sbjct  415   LFISQGASINQYKTPRCIKSKKAL-KLLKSKVTASFFSPRDPKWSPKMCS  463



>gb|EEC82663.1| hypothetical protein OsI_27288 [Oryza sativa Indica Group]
Length=591

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/543 (63%), Positives = 415/543 (76%), Gaps = 13/543 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S FKR VPV+ Y+ + PYILRIA G+  S + G+ I E+L SSGTS GEP+LMPSI +D
Sbjct  55    ISAFKRHVPVVTYDKVHPYILRIATGEESSILCGEYILELLRSSGTSRGEPRLMPSILKD  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRT+LY+LIMPIM++YI G+ EGKAMYL FVKAE  T  G+P R+VLTSYYKS HF  
Sbjct  115   LDRRTYLYSLIMPIMNKYISGLGEGKAMYLLFVKAETLTDSGIPVRSVLTSYYKSPHFLH  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D YN+ TSPD+ ILC D+ QSMYCQLL GLV R+ VLR+GAVFASAFLR+ISFL+ +
Sbjct  175   RKHDLYNNYTSPDEVILCPDSQQSMYCQLLCGLVERQHVLRIGAVFASAFLRSISFLEQH  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  L  DIR GQL+  I    CR AM   L  P+PELAD++E IC   SWKGI+ RLWP 
Sbjct  235   WRDLVNDIRIGQLNSSITSPACRLAMLNFLALPNPELADQVEAICSCGSWKGILGRLWPN  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYIEAV+TG+M+QY+P L +Y  G +P +CTMYASSE YFGVNL PL  PADV++T+LP
Sbjct  295   VKYIEAVLTGTMAQYIPMLEFYGGGAIPFVCTMYASSESYFGVNLSPLCSPADVSYTILP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM Y EFIPL E+G  L++  +         I   KLV LV V++GCYYELVVTTFSGLY
Sbjct  355   NMAYSEFIPL-EDGLRLTDHEEV--------IENDKLVSLVDVKVGCYYELVVTTFSGLY  405

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N+APQFKF CRRNV+LSIDSDKTN+EDLH S+T AKK+LE    LL
Sbjct  406   RYRVGDVLQVTGFYNRAPQFKFICRRNVILSIDSDKTNEEDLHNSVTTAKKILENQNYLL  465

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAG---AAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSY D S+VPGHYV++WEI        A +DAQ+L+ CC A+EE LDYVYRRCR+HD
Sbjct  466   LEYTSYTDISTVPGHYVLFWEIKSTHDERPAPLDAQLLESCCAAVEESLDYVYRRCRAHD  525

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
             + IGPLEIR+V+ G FD LM   ++ GSSINQYKTPRCI+S S ALK+L S V A +FSP
Sbjct  526   RSIGPLEIRLVEAGAFDALMDLLVSHGSSINQYKTPRCIES-SLALKLLNSKVIACFFSP  584

Query  193   RDP  185
             +DP
Sbjct  585   QDP  587



>ref|XP_006658099.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11-like 
isoform X4 [Oryza brachyantha]
Length=543

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/543 (63%), Positives = 417/543 (77%), Gaps = 13/543 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S FKR VPV+ Y+ ++ YILRIA G+  S + G+ I E+L SSGTS GEP+LMPSI +D
Sbjct  7     ISAFKRLVPVVTYDKVQQYILRIATGEDSSILCGEQIVELLRSSGTSQGEPRLMPSILKD  66

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRT+LY+LIMPIM +YI G+D+GKAMYL F KAE  T  G+P R+VLTSYYKS HF  
Sbjct  67    LDRRTYLYSLIMPIMSKYISGLDKGKAMYLLFAKAETLTNSGMPVRSVLTSYYKSPHFLH  126

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D YN+ TSPD+ ILC D+ QSMYCQLL GLV R+ VLR+GAVFASAFLR+ISFL+H+
Sbjct  127   RKHDLYNNYTSPDEVILCPDSQQSMYCQLLCGLVERQHVLRIGAVFASAFLRSISFLEHH  186

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  L  DIR GQL+  I    CR AM   L +P+PELAD++E IC   SWKGI+ RLWP 
Sbjct  187   WCDLVNDIRIGQLNPSITSPACRLAMLDFLASPNPELADQVEAICSCGSWKGILGRLWPN  246

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYIEAV+TG+M+QY+P L +Y  G +PL+CTMYASSE YFGVNL+PL  PADV++T+LP
Sbjct  247   VKYIEAVLTGTMAQYIPMLEFYGGGGIPLVCTMYASSESYFGVNLRPLCSPADVSYTILP  306

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPL E+G  L++  +         +   +LV LV V++GCYYELVVTTFSGLY
Sbjct  307   NMAYFEFIPL-EDGLRLTDHEEM--------VENDRLVGLVDVKVGCYYELVVTTFSGLY  357

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N+APQFKF CRRNV+LSID+DKTN+EDLH SITAAKK+LE    LL
Sbjct  358   RYRVGDVLQVTGFYNQAPQFKFICRRNVILSIDTDKTNEEDLHNSITAAKKILENRNYLL  417

Query  544   VEYTSYADTSSVPGHYVIYWEIMHA---GAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSY DTS+VPGHYV++WEI          +D Q+L+ CC AIEE LDYVYRRCR+H+
Sbjct  418   LEYTSYTDTSTVPGHYVLFWEIKSTHDESPTPLDCQLLESCCAAIEESLDYVYRRCRAHE  477

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
             K IGPLEIR+V+ G FD LM   ++ GSSINQYKT RCI+S   ALK+L S V A +FSP
Sbjct  478   KSIGPLEIRLVEAGAFDALMDLLVSHGSSINQYKTLRCIESG-LALKLLNSKVIACFFSP  536

Query  193   RDP  185
             RDP
Sbjct  537   RDP  539



>ref|XP_006658096.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006658097.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11-like 
isoform X2 [Oryza brachyantha]
 ref|XP_006658098.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11-like 
isoform X3 [Oryza brachyantha]
Length=591

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/543 (63%), Positives = 417/543 (77%), Gaps = 13/543 (2%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S FKR VPV+ Y+ ++ YILRIA G+  S + G+ I E+L SSGTS GEP+LMPSI +D
Sbjct  55    ISAFKRLVPVVTYDKVQQYILRIATGEDSSILCGEQIVELLRSSGTSQGEPRLMPSILKD  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRT+LY+LIMPIM +YI G+D+GKAMYL F KAE  T  G+P R+VLTSYYKS HF  
Sbjct  115   LDRRTYLYSLIMPIMSKYISGLDKGKAMYLLFAKAETLTNSGMPVRSVLTSYYKSPHFLH  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D YN+ TSPD+ ILC D+ QSMYCQLL GLV R+ VLR+GAVFASAFLR+ISFL+H+
Sbjct  175   RKHDLYNNYTSPDEVILCPDSQQSMYCQLLCGLVERQHVLRIGAVFASAFLRSISFLEHH  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  L  DIR GQL+  I    CR AM   L +P+PELAD++E IC   SWKGI+ RLWP 
Sbjct  235   WCDLVNDIRIGQLNPSITSPACRLAMLDFLASPNPELADQVEAICSCGSWKGILGRLWPN  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYIEAV+TG+M+QY+P L +Y  G +PL+CTMYASSE YFGVNL+PL  PADV++T+LP
Sbjct  295   VKYIEAVLTGTMAQYIPMLEFYGGGGIPLVCTMYASSESYFGVNLRPLCSPADVSYTILP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPL E+G  L++  +         +   +LV LV V++GCYYELVVTTFSGLY
Sbjct  355   NMAYFEFIPL-EDGLRLTDHEEM--------VENDRLVGLVDVKVGCYYELVVTTFSGLY  405

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N+APQFKF CRRNV+LSID+DKTN+EDLH SITAAKK+LE    LL
Sbjct  406   RYRVGDVLQVTGFYNQAPQFKFICRRNVILSIDTDKTNEEDLHNSITAAKKILENRNYLL  465

Query  544   VEYTSYADTSSVPGHYVIYWEIMHA---GAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSY DTS+VPGHYV++WEI          +D Q+L+ CC AIEE LDYVYRRCR+H+
Sbjct  466   LEYTSYTDTSTVPGHYVLFWEIKSTHDESPTPLDCQLLESCCAAIEESLDYVYRRCRAHE  525

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
             K IGPLEIR+V+ G FD LM   ++ GSSINQYKT RCI+S   ALK+L S V A +FSP
Sbjct  526   KSIGPLEIRLVEAGAFDALMDLLVSHGSSINQYKTLRCIESG-LALKLLNSKVIACFFSP  584

Query  193   RDP  185
             RDP
Sbjct  585   RDP  587



>gb|KEH43222.1| indole-3-acetic acid-amido synthetase [Medicago truncatula]
Length=453

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/459 (73%), Positives = 391/459 (85%), Gaps = 9/459 (2%)
 Frame = -1

Query  1543  MYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSFDPYNDMTSPDQSILCSDTNQSMYC  1364
             MYLYFVKAE STPCGLPAR+VLTSYYKSKHFKCR+ DP+ND TSPDQ+ILC+D NQSM+C
Sbjct  1     MYLYFVKAEKSTPCGLPARSVLTSYYKSKHFKCRTHDPWNDFTSPDQTILCNDINQSMHC  60

Query  1363  QLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPSLCLDIRTGQLSGMIADSECRSAMS  1184
             QLLAGL++RRQVLRLGAVFASAFLRAISFL+ NW  LC DIR GQL+  I D  CRS+MS
Sbjct  61    QLLAGLIHRRQVLRLGAVFASAFLRAISFLERNWRKLCDDIRNGQLNSFITDPSCRSSMS  120

Query  1183  KILLAPDPELADEIEEICRAASWKGIVYRLWPKAKYIEAVITGSMSQYVPALRYYSDGKL  1004
              +L +PDP LADEI +IC    WKGI+ +LWPKAKYIEAV+TGSM+QYVPAL +Y +GKL
Sbjct  121   TLLSSPDPCLADEISKICSQKCWKGILCKLWPKAKYIEAVVTGSMAQYVPALEHYCEGKL  180

Query  1003  PLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMGYFEFIPLGENGTFLSNLNKegeee  824
              L+CTMYASSECYFGVNLKPLSDP DVAFTLLPNMGYFEFIPLG NGT L + ++     
Sbjct  181   HLVCTMYASSECYFGVNLKPLSDPDDVAFTLLPNMGYFEFIPLGHNGTLLMDFDE-----  235

Query  823   eeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRN  644
               E +P  KLVDLV+V++GC+YELV+TTF+GLYRYR+GDVLQV  FHNKAPQF+F CRRN
Sbjct  236   -NEQVPNDKLVDLVNVKIGCFYELVITTFAGLYRYRVGDVLQVVAFHNKAPQFRFICRRN  294

Query  643   VVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGA  464
             VV+SIDS+KTN+EDLHRS+T +KKLLEP+ ALLVEYTSYADT SVPGHYV+YWEI+H G 
Sbjct  295   VVISIDSEKTNEEDLHRSVTMSKKLLEPYDALLVEYTSYADTCSVPGHYVLYWEILHYGT  354

Query  463   AA--IDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGS  290
                 +D  VLQ+CCIA+EE+LDYVYRRCR++DK +GPLEIRVV+PGTF+ LM  FI +G+
Sbjct  355   KGDPLDPNVLQECCIAVEEELDYVYRRCRTNDKSVGPLEIRVVEPGTFEALMDLFITKGA  414

Query  289   SINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWKP  173
             SINQYKTPRCIKS   ALK+L+S V A +FSPRDP W P
Sbjct  415   SINQYKTPRCIKS-KKALKLLKSKVSASFFSPRDPKWGP  452



>ref|XP_008653454.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X2 [Zea mays]
 ref|XP_008653455.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X2 [Zea mays]
 ref|XP_008653456.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X2 [Zea mays]
 ref|XP_008653457.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X2 [Zea mays]
 ref|XP_008653458.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X2 [Zea mays]
 ref|XP_008653459.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X2 [Zea mays]
 ref|XP_008653460.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X2 [Zea mays]
 tpg|DAA64074.1| TPA: hypothetical protein ZEAMMB73_443383 [Zea mays]
 tpg|DAA64075.1| TPA: hypothetical protein ZEAMMB73_443383 [Zea mays]
Length=547

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/545 (60%), Positives = 421/545 (77%), Gaps = 14/545 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S FK  VPV+ Y+ ++PYI RIA G+  S + G+ I E+L SSGTS GEP+LMPSI+ED
Sbjct  7     ISAFKSQVPVVTYDVVQPYIARIAAGERSSILCGEQIVELLRSSGTSQGEPRLMPSISED  66

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             + RR +LY+LIMPIM +YI G+ EGKAMYL FVKAE  T  G+P R+VLTSYYKS  F  
Sbjct  67    IYRRMYLYSLIMPIMSKYIRGLGEGKAMYLLFVKAETLTNAGIPVRSVLTSYYKSPQFLQ  126

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D YN  TSPD+ ILC D+ QSMYCQLL GLV R+ V+RLGAVFASAFLR+ISFL+ +
Sbjct  127   RKHDLYNSYTSPDEVILCPDSQQSMYCQLLCGLVERQNVVRLGAVFASAFLRSISFLEKH  186

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  L  DIRTG+++  I ++ CR A    L  P+PELADE+E IC + SWKG++ RLWP 
Sbjct  187   WHDLVTDIRTGRINPSITNAACRVATESFLAQPNPELADEVEAICSSESWKGVLGRLWPN  246

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYIEAV+TG+M+QYVP L +YSDG++PL+CTMYASSE YFGVNL+PL  P DV++T+LP
Sbjct  247   VKYIEAVLTGTMAQYVPMLEFYSDGRIPLVCTMYASSESYFGVNLRPLCSPKDVSYTILP  306

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEF+PL ++G  L+   +        ++ + KLV LV V++GCYYELVVTTF+GLY
Sbjct  307   NMAYFEFVPL-DDGLRLAEDGE--------AVEKEKLVGLVDVKVGCYYELVVTTFAGLY  357

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N+APQFKF CRRNV+LS+D+DKTN+EDLH S++ AKK+LE    +L
Sbjct  358   RYRVGDVLQVTGFYNRAPQFKFICRRNVILSVDADKTNEEDLHGSVSRAKKILEDRGHIL  417

Query  544   VEYTSYADTSSVPGHYVIYWEIMH-----AGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             +EYTS+ DTS+VPGHYV++WE+       +G A +DAQVL+ CC+A+EE LD VYRRCR+
Sbjct  418   LEYTSFTDTSTVPGHYVLFWEVKATPTSGSGGARLDAQVLESCCVAVEESLDCVYRRCRA  477

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HD+ +GPLEIR+V+ G FD LM   +++G SINQYKTPRCI+   +AL++L+S   A +F
Sbjct  478   HDRSVGPLEIRLVEAGAFDALMDLLVSQGGSINQYKTPRCIEPGGAALELLDSKATASFF  537

Query  199   SPRDP  185
             SPRDP
Sbjct  538   SPRDP  542



>ref|XP_008653453.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X1 [Zea mays]
Length=595

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/545 (60%), Positives = 421/545 (77%), Gaps = 14/545 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             +S FK  VPV+ Y+ ++PYI RIA G+  S + G+ I E+L SSGTS GEP+LMPSI+ED
Sbjct  55    ISAFKSQVPVVTYDVVQPYIARIAAGERSSILCGEQIVELLRSSGTSQGEPRLMPSISED  114

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             + RR +LY+LIMPIM +YI G+ EGKAMYL FVKAE  T  G+P R+VLTSYYKS  F  
Sbjct  115   IYRRMYLYSLIMPIMSKYIRGLGEGKAMYLLFVKAETLTNAGIPVRSVLTSYYKSPQFLQ  174

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  D YN  TSPD+ ILC D+ QSMYCQLL GLV R+ V+RLGAVFASAFLR+ISFL+ +
Sbjct  175   RKHDLYNSYTSPDEVILCPDSQQSMYCQLLCGLVERQNVVRLGAVFASAFLRSISFLEKH  234

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  L  DIRTG+++  I ++ CR A    L  P+PELADE+E IC + SWKG++ RLWP 
Sbjct  235   WHDLVTDIRTGRINPSITNAACRVATESFLAQPNPELADEVEAICSSESWKGVLGRLWPN  294

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYIEAV+TG+M+QYVP L +YSDG++PL+CTMYASSE YFGVNL+PL  P DV++T+LP
Sbjct  295   VKYIEAVLTGTMAQYVPMLEFYSDGRIPLVCTMYASSESYFGVNLRPLCSPKDVSYTILP  354

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEF+PL ++G  L+   +        ++ + KLV LV V++GCYYELVVTTF+GLY
Sbjct  355   NMAYFEFVPL-DDGLRLAEDGE--------AVEKEKLVGLVDVKVGCYYELVVTTFAGLY  405

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GDVLQV GF+N+APQFKF CRRNV+LS+D+DKTN+EDLH S++ AKK+LE    +L
Sbjct  406   RYRVGDVLQVTGFYNRAPQFKFICRRNVILSVDADKTNEEDLHGSVSRAKKILEDRGHIL  465

Query  544   VEYTSYADTSSVPGHYVIYWEIMH-----AGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             +EYTS+ DTS+VPGHYV++WE+       +G A +DAQVL+ CC+A+EE LD VYRRCR+
Sbjct  466   LEYTSFTDTSTVPGHYVLFWEVKATPTSGSGGARLDAQVLESCCVAVEESLDCVYRRCRA  525

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
             HD+ +GPLEIR+V+ G FD LM   +++G SINQYKTPRCI+   +AL++L+S   A +F
Sbjct  526   HDRSVGPLEIRLVEAGAFDALMDLLVSQGGSINQYKTPRCIEPGGAALELLDSKATASFF  585

Query  199   SPRDP  185
             SPRDP
Sbjct  586   SPRDP  590



>ref|XP_004152165.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Cucumis sativus]
 gb|KGN52954.1| hypothetical protein Csa_4G007100 [Cucumis sativus]
Length=611

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/548 (61%), Positives = 420/548 (77%), Gaps = 12/548 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YEDI+PYI RIANG+    I+ QPITE+L SSGTSGG+PK+MPS AEDLDR
Sbjct  62    FKHSVPVVNYEDIKPYIERIANGEPSHIISSQPITELLTSSGTSGGQPKMMPSTAEDLDR  121

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YNL++P++++Y+ G++EGK MYL F+K EMSTP GL AR VLTSYYKSK+F+ R F
Sbjct  122   KTFFYNLLVPVLNKYVDGLEEGKGMYLLFIKPEMSTPSGLMARPVLTSYYKSKNFRNRPF  181

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPD++ILCSD+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+  W  
Sbjct  182   NKYNVYTSPDETILCSDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDYWKE  241

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  +IR G+LS  I+D  CR+++S +L   +P LAD I+ +C   SW+GI+ +LWPK KY
Sbjct  242   LSDNIRKGELSQWISDPNCRASVSSVLTKSNPVLADLIDGLCGEKSWEGIIKKLWPKTKY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TGSM+QY+P L +YS G LPLI TMYASSECYFG+N  PLS P+DV++TLLPNM 
Sbjct  302   IEVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECYFGINFNPLSKPSDVSYTLLPNMA  360

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             +FEF+P+ +N   LS+ N       +E     K VDLV V+LG YYELVVTTF+GLYRYR
Sbjct  361   FFEFLPVEKNDGELSHCNGTTNTSVQEEF---KTVDLVDVKLGQYYELVVTTFTGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHNKAPQFKF  RRNVVLSID+DKTN++DL  +IT AK L+EP   LL EY
Sbjct  418   VGDILKVTGFHNKAPQFKFMHRRNVVLSIDTDKTNEDDLLNAITKAKLLVEPLGVLLTEY  477

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAA-------IDAQVLQDCCIAIEEQLDYVYRRCRSH  377
             TSYADT S+PGHYV++WE+     +        ++  ++++CC +IEE LD VYRRCRS 
Sbjct  478   TSYADTESIPGHYVLFWEMKKRSGSNYENFEELVEVDLMEECCSSIEESLDSVYRRCRSK  537

Query  376   DKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFS  197
             DK IGPLEIRVVK G FD LM   +++GSS+NQYKTPRCIKS   A+KIL+S V ARYFS
Sbjct  538   DKSIGPLEIRVVKQGAFDALMDFCVSQGSSVNQYKTPRCIKS-EEAIKILDSRVVARYFS  596

Query  196   PRDPAWKP  173
              + P W+P
Sbjct  597   KKTPFWEP  604



>ref|XP_008454158.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Cucumis melo]
Length=612

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/548 (61%), Positives = 420/548 (77%), Gaps = 12/548 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YEDI+PYI RIANG+    I+ QPITE+L SSGTSGG+PK+MPS AEDLDR
Sbjct  63    FKHSVPVVNYEDIKPYIERIANGEPSHIISSQPITELLTSSGTSGGQPKMMPSTAEDLDR  122

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YNL++P++++Y+ G++EGK MYL F+K EMSTP GL AR VLTSYYKSK+F+ R F
Sbjct  123   KTFFYNLLVPVLNKYVDGLEEGKGMYLLFIKPEMSTPSGLMARPVLTSYYKSKNFRNRPF  182

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPD++ILCSD+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+  W  
Sbjct  183   NKYNVYTSPDETILCSDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDYWKE  242

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  +IR G+LS  I+D  CR+++S IL   +P LAD I+ +C   SW+GI+ +LWPK KY
Sbjct  243   LSDNIRKGELSQWISDPNCRASVSLILTKSNPVLADLIDGLCGEKSWEGIIKKLWPKTKY  302

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TGSM+QY+P L +YS G LPLI TMYASSECYFG+N  PLS P+DV++TLLPNM 
Sbjct  303   IEVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECYFGINFNPLSKPSDVSYTLLPNMA  361

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             +FEF+P+ +N   L++ N       ++     K VDLV V+LG YYELVVTTF+GLYRYR
Sbjct  362   FFEFLPVEKNDGELTHCNGTTNTSVQDEF---KTVDLVDVKLGQYYELVVTTFTGLYRYR  418

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHNKAPQFKF  RRNVVLSID+DKTN++DL  +IT AK L+EP   LL EY
Sbjct  419   VGDILKVTGFHNKAPQFKFIHRRNVVLSIDTDKTNEDDLLNAITKAKLLVEPLGVLLTEY  478

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAA-------IDAQVLQDCCIAIEEQLDYVYRRCRSH  377
             TSYADT S+PGHYV++WE+     +        ++  ++++CC +IEE LD VYRRCRS 
Sbjct  479   TSYADTESIPGHYVLFWEMKRRSGSNYENFEELVEVDLMEECCSSIEESLDSVYRRCRSK  538

Query  376   DKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFS  197
             DK IGPLEIRVVK G FD LM   +++GSS+NQYKTPRCIKS   A+KIL+S V ARYFS
Sbjct  539   DKSIGPLEIRVVKHGAFDALMDFCVSQGSSVNQYKTPRCIKS-EEAIKILDSRVVARYFS  597

Query  196   PRDPAWKP  173
              + P W+P
Sbjct  598   KKTPFWEP  605



>ref|XP_010066475.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Eucalyptus grandis]
 gb|KCW64361.1| hypothetical protein EUGRSUZ_G01985 [Eucalyptus grandis]
Length=606

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/548 (59%), Positives = 423/548 (77%), Gaps = 11/548 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VPV+ YED++PYI RIANG+    I+ QPITE+L SSGTSGG+PK+MPS AEDLDR
Sbjct  54    FKKKVPVVNYEDVKPYIERIANGERSDIISSQPITELLTSSGTSGGQPKMMPSTAEDLDR  113

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YNL++P+M++Y+ G+D+GK MYL F+K E+STP GL AR VLTSYYKS +F+ R +
Sbjct  114   KTFFYNLLVPVMNKYVDGLDQGKGMYLLFIKPEISTPSGLKARPVLTSYYKSNNFRNRPY  173

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPD++ILCSD+ QSMYCQLL GLV R +V R+GAVFASAFLRAI FL+  W  
Sbjct  174   NRYNVYTSPDETILCSDSKQSMYCQLLCGLVQRDEVRRVGAVFASAFLRAIKFLEDYWKE  233

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC +IRTGQ+S  I D  CRS++S IL  PDP+LA+ IE+ C   SW+GI+ R+WP+ KY
Sbjct  234   LCSNIRTGQISDWITDPGCRSSVSSILRKPDPDLANSIEKECGGESWEGIIKRIWPRTKY  293

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TGSM+QY+P L +YS G LPLI TMYASSEC+FG+N KPLS P+DV++TLLPNM 
Sbjct  294   IEVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECFFGINFKPLSKPSDVSYTLLPNMA  352

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ ++ +  +   +        S+ ++  VDLV V+LG YYEL+VTTF+GLYRYR
Sbjct  353   YFEFLPVEKSHSETTEEAQCNGNSGSHSVKET--VDLVDVKLGQYYELIVTTFTGLYRYR  410

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L V GFHN APQF+F  R+NVVLSID+DKT++EDL +++T AKKLLEP   LL EY
Sbjct  411   VGDILMVTGFHNNAPQFRFVQRQNVVLSIDTDKTSEEDLLKAVTEAKKLLEPLGFLLTEY  470

Query  535   TSYADTSSVPGHYVIYWEIMHAGA-------AAIDAQVLQDCCIAIEEQLDYVYRRCRSH  377
             TSY DTSS+PG YV++WE+   G          ++ +++++CC  +EE LDYVYRRCR+ 
Sbjct  471   TSYPDTSSLPGRYVLFWELKAKGNNIVINELKGLNGEIMEECCSRVEESLDYVYRRCRAK  530

Query  376   DKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFS  197
             DK IG LEIRVV+ GTFD LM   +++GSS+NQYKTPRCIKS+  ALKIL+S V  R+FS
Sbjct  531   DKSIGALEIRVVRHGTFDALMDYCLSQGSSVNQYKTPRCIKSD-DALKILDSRVTRRFFS  589

Query  196   PRDPAWKP  173
              + P W+P
Sbjct  590   KKVPFWEP  597



>ref|XP_006844646.1| hypothetical protein AMTR_s00016p00234260 [Amborella trichopoda]
 gb|ERN06321.1| hypothetical protein AMTR_s00016p00234260 [Amborella trichopoda]
Length=606

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/547 (60%), Positives = 422/547 (77%), Gaps = 10/547 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VPV+ YED++PYI RIANG+    I+GQPI+E+L SSGTSGG PK+MPS  EDLDR
Sbjct  58    FKKKVPVVNYEDVKPYIERIANGEPSQIISGQPISELLTSSGTSGGHPKMMPSTIEDLDR  117

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TFLYNL++P+M+QY+ G+D+GK MYL FVK E++T  GL AR VLTSYYKSK+F+ R+F
Sbjct  118   KTFLYNLLVPVMNQYVDGLDQGKGMYLLFVKQEITTASGLTARPVLTSYYKSKNFRNRAF  177

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPD++ILC+D+ QSM+CQL+ GLV R QVLR+GAVFASAFLRAI FL+ +W  
Sbjct  178   NGYNVYTSPDETILCTDSKQSMFCQLICGLVQRDQVLRVGAVFASAFLRAIKFLEDHWEE  237

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  +IRTG +S  + DS CR A  KIL  P PELAD IE +C + SW+GI+ +LWPK KY
Sbjct  238   LSSNIRTGIISEWVTDSSCREATMKILEKPKPELADLIESVCSSKSWEGIIKKLWPKTKY  297

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TGSM+QY+  L +YS G LPL+ TMYASSECYFG+NLKPLS P+DV++ L+PNM 
Sbjct  298   VDVIVTGSMAQYISTLDFYS-GSLPLVSTMYASSECYFGLNLKPLSKPSDVSYILIPNMA  356

Query  895   YFEFIPLG---ENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             YFEFIP+    E      +++  G  ++    P+   VDLV V++G +YELVVTTF+GLY
Sbjct  357   YFEFIPVNKGLEEERIDRDVHCNGNTDKICMEPEP--VDLVDVKVGDHYELVVTTFTGLY  414

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RY +GD+L V GFHN+APQFKF  RRNVVLSID+DKTN+EDL R+IT AK L+EP   L+
Sbjct  415   RYSVGDILLVTGFHNQAPQFKFVHRRNVVLSIDTDKTNEEDLLRAITKAKLLVEPLGCLV  474

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
              EYTSYADTSS+PGHYV++WE+   G      +++ V++DCC  +EE+LD VYRRCRS D
Sbjct  475   TEYTSYADTSSIPGHYVLFWELQTRGKNPLTELESSVMEDCCSNVEEELDSVYRRCRSKD  534

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
             K IGPLEIRVVK GTFD LM   +++GSS+NQYKTPRCIKS   AL+IL+S V   +FS 
Sbjct  535   KSIGPLEIRVVKQGTFDALMDFCVSQGSSVNQYKTPRCIKSE-EALQILKSRVLWSFFSK  593

Query  193   RDPAWKP  173
             + P+W P
Sbjct  594   KMPSWVP  600



>ref|XP_002268278.2| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Vitis vinifera]
Length=611

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/547 (60%), Positives = 420/547 (77%), Gaps = 9/547 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VP++ YEDI+P+I RIANG+    I+ QPITE+L SSGTSGG+PKLMPS AEDLDR
Sbjct  62    FKKKVPIVNYEDIKPHIERIANGEPSRIISAQPITELLTSSGTSGGQPKLMPSTAEDLDR  121

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YNL++P+M++Y+ G+D+GK MYL F+K E+STP GL AR VLTSYYKS +F+ R F
Sbjct  122   KTFFYNLLIPVMNKYVDGLDQGKGMYLLFIKPEISTPSGLMARPVLTSYYKSSNFRNRPF  181

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             +P+N  TSPD++ILC D+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+ +W  
Sbjct  182   NPFNVYTSPDETILCLDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDHWRE  241

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC +IRTG +S  I D  CR+A+S  L  P P+LAD IE  C   SW+GI+ RLWP+ KY
Sbjct  242   LCSNIRTGCVSDWITDPSCRNAVSSFLSKPQPDLADFIEFECNGESWEGIIKRLWPRTKY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TGSM+QY+P L +YS G LPL+ TMYASSECY+G+NLKPLS P+DV++TLLPNM 
Sbjct  302   IEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYASSECYYGINLKPLSKPSDVSYTLLPNMA  360

Query  895   YFEFIPLGENG---TFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             YFEF+P+ +N    T     N    ++E E + + ++V LV V++G YYELVVTTF+GLY
Sbjct  361   YFEFLPVQKNNGEVTQQVQCNGGCIKKEGERV-EIEVVGLVDVKVGHYYELVVTTFTGLY  419

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR GD+L V GF+N APQF+F  RRNVVLSID+DKTN+EDL +++T AK LLEP+  LL
Sbjct  420   RYRTGDILMVTGFYNNAPQFRFVQRRNVVLSIDTDKTNEEDLLKAVTQAKLLLEPYGFLL  479

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAI---DAQVLQDCCIAIEEQLDYVYRRCRSHD  374
              EYTSYADTSS+PGHYV++WE+   G   +   D  +++ CC  +EE LD VYRRCR  D
Sbjct  480   TEYTSYADTSSIPGHYVLFWELKTRGNNDLSEPDHTIMEQCCSTVEESLDSVYRRCRRRD  539

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
               IGPLEIR+VKPGTFD LM   +++GSS+NQYKTPRCIKS   A+KIL+S V  + FS 
Sbjct  540   NSIGPLEIRIVKPGTFDALMDFCVSQGSSVNQYKTPRCIKS-KEAIKILDSRVVGKVFSK  598

Query  193   RDPAWKP  173
             + P W+P
Sbjct  599   KVPFWEP  605



>ref|XP_002890761.1| GH3.17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67020.1| GH3.17 [Arabidopsis lyrata subsp. lyrata]
Length=609

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/550 (59%), Positives = 425/550 (77%), Gaps = 14/550 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RIA+G+ +  ++ QPITE+L SSGTS G+PKLMPS AE+LDR
Sbjct  60    FKNKVPVVNYDDIKPFIQRIADGESYDIVSAQPITELLTSSGTSAGKPKLMPSTAEELDR  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++PIM++Y+ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPIMNKYVNGLDEGKGMYLLFIKPEIKTPSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I +S CR ++  IL  P+ ELADEIE  C   SW+GI+ R+WPKAKY
Sbjct  240   LCADIRTGTVTSWITNSSCRDSVLSILNGPNQELADEIESECAEKSWEGILRRIWPKAKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL DPADV++TLLPNM 
Sbjct  300   VEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYASSECYFGINLNPLCDPADVSYTLLPNMA  358

Query  895   YFEFIPLGENG----TFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGL  728
             YFEF+P+ +       F S+ N    +++++++ +  +VDLV+V++G YYE+V+TTF+GL
Sbjct  359   YFEFLPVDDKSHEEIHFASHSN---TDDDDDALKEDLIVDLVNVKVGQYYEIVITTFTGL  415

Query  727   YRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQ  554
             YRYR+GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T AK   L  P  
Sbjct  416   YRYRVGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLNHLQHPSS  475

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIM--HAG-AAAIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL+EYTSYADTSS+PGHYV++WE+   H+     +D + + DCC  +E+ LDYVYRRCR
Sbjct  476   LLLMEYTSYADTSSIPGHYVLFWELKPRHSNDPPKLDDKTMDDCCSEVEDCLDYVYRRCR  535

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
             + DK IGPLEIRVV  GTFD LM   +++GSS+NQYKTPRC+KS   AL+IL+S V  R+
Sbjct  536   NRDKSIGPLEIRVVSLGTFDSLMDFCVSQGSSLNQYKTPRCVKS-GGALEILDSRVIGRF  594

Query  202   FSPRDPAWKP  173
             FS R P W+P
Sbjct  595   FSKRVPQWEP  604



>ref|XP_002512687.1| Indole-3-acetic acid-amido synthetase GH3.17, putative [Ricinus 
communis]
 gb|EEF50139.1| Indole-3-acetic acid-amido synthetase GH3.17, putative [Ricinus 
communis]
Length=590

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/545 (60%), Positives = 412/545 (76%), Gaps = 18/545 (3%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             DFK  VPV+ YEDIRP I  IANG   S I+ QPITE+L SSGTSGG+PK+MPS AE+LD
Sbjct  57    DFKEKVPVVNYEDIRPCIECIANGGSSSIISAQPITELLTSSGTSGGQPKMMPSTAEELD  116

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL++P+M++YI G+D+GK MYL F+K E+STP GL AR VLTSYYKS +F+ R 
Sbjct  117   RKTFFYNLLVPVMNKYIDGLDQGKGMYLLFIKPEISTPSGLMARPVLTSYYKSSNFRNRP  176

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ YN  TSPD++ILC D+ QSMYCQLL GLV R +VLR+GA+FASAFLRAI FL+  W 
Sbjct  177   FNRYNVYTSPDETILCPDSKQSMYCQLLCGLVQRDEVLRVGAIFASAFLRAIKFLEDYWQ  236

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +IRTG +S  I D  CR+A+S IL  P+ ELAD IE  C   SW+GI+ +LWP+ K
Sbjct  237   ELCSNIRTGCISDWIDDPSCRNAVSSILKKPNSELADLIERKCSNKSWEGIIKKLWPRTK  296

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             +IE ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+N KPLS P+DV++TLLPNM
Sbjct  297   FIEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYASSECYFGINFKPLSAPSDVSYTLLPNM  355

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
              YFEF+P+ E G       K             + VDLV V++G YYELVVTTF+GLYRY
Sbjct  356   AYFEFLPV-ERGYGAKQKKKM------------ETVDLVDVKVGHYYELVVTTFTGLYRY  402

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GD+L V GF+N APQF+F  RRNVVLSID+DKTN+EDL +++T AK+LLEP   L+ E
Sbjct  403   RVGDILMVTGFYNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTQAKRLLEPLGFLMTE  462

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAA---IDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             YTS+ADTSS+PGHYV++WE+   G      +D  +++ CC+ +EE LD VYRRCR  DK 
Sbjct  463   YTSFADTSSIPGHYVLFWELKTRGENVPEELDPIIMEQCCLTVEESLDSVYRRCRKKDKS  522

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             IG LEIRVVK GTFD LM   +++GSS+NQYKTPRCIKS  +ALKIL+S V  ++FS R 
Sbjct  523   IGALEIRVVKHGTFDALMDFCLSQGSSVNQYKTPRCIKS-EAALKILDSRVIGKFFSKRA  581

Query  187   PAWKP  173
             P W+P
Sbjct  582   PFWEP  586



>ref|XP_009102930.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17 [Brassica 
rapa]
Length=608

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/546 (59%), Positives = 420/546 (77%), Gaps = 7/546 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS A++LDR
Sbjct  60    FKNKVPVVNYDDIKPFIQRIADGESSDIVSVQPITELLTSSGTSAGKPKLMPSTAKELDR  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++P+M++Y+ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPVMNKYVNGLDEGKGMYLLFIKPEIKTPSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+ ELADEIE  C   SW+GI+ RLWPKAKY
Sbjct  240   LCADIRTGTITSWITDSACRDSVLSILDGPNQELADEIESECAEKSWEGILRRLWPKAKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G L L+ TMYASSECYFG+NL PL DP+DV++TLLPNM 
Sbjct  300   VEVIVTGSMAQYIPTLEFYS-GGLTLVSTMYASSECYFGINLNPLCDPSDVSYTLLPNMA  358

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ +      +   +   E+++SI +  +VDLV+V +G YYE+V+TTF+GLYRYR
Sbjct  359   YFEFLPVDDKSHEEIHFASQSNAEDDDSIKEDLIVDLVNVEVGRYYEIVITTFTGLYRYR  418

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQALLV  542
             +GD+L+V GF+NKAPQF+F  RRNVVLSID+DKT++EDL  ++T AK   L +P   LL 
Sbjct  419   VGDILKVTGFYNKAPQFRFVERRNVVLSIDTDKTSEEDLLNAVTQAKLNHLQQPSSLLLT  478

Query  541   EYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
             EYTSYADTSS+PGHYV++WE+    +     +D + ++ CC  +E++LDYVYRRCR+ DK
Sbjct  479   EYTSYADTSSIPGHYVLFWELKPRYNNDPPKLDDKTMEKCCSEVEDRLDYVYRRCRNKDK  538

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              IGPLEIRVV  GTFDLLM   +++GSS+NQYKTPRC+KS   AL+IL+S V  R+FS R
Sbjct  539   SIGPLEIRVVSLGTFDLLMDFCVSQGSSVNQYKTPRCVKS-GGALEILDSRVIGRFFSQR  597

Query  190   DPAWKP  173
              P W+P
Sbjct  598   VPQWEP  603



>tpg|DAA64076.1| TPA: hypothetical protein ZEAMMB73_443383 [Zea mays]
Length=541

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/523 (61%), Positives = 405/523 (77%), Gaps = 14/523 (3%)
 Frame = -1

Query  1738  IANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDRRTFLYNLIMPIMDQYIPGM  1559
             IA G+  S + G+ I E+L SSGTS GEP+LMPSI+ED+ RR +LY+LIMPIM +YI G+
Sbjct  23    IAAGERSSILCGEQIVELLRSSGTSQGEPRLMPSISEDIYRRMYLYSLIMPIMSKYIRGL  82

Query  1558  DEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSFDPYNDMTSPDQSILCSDTN  1379
              EGKAMYL FVKAE  T  G+P R+VLTSYYKS  F  R  D YN  TSPD+ ILC D+ 
Sbjct  83    GEGKAMYLLFVKAETLTNAGIPVRSVLTSYYKSPQFLQRKHDLYNSYTSPDEVILCPDSQ  142

Query  1378  QSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPSLCLDIRTGQLSGMIADSEC  1199
             QSMYCQLL GLV R+ V+RLGAVFASAFLR+ISFL+ +W  L  DIRTG+++  I ++ C
Sbjct  143   QSMYCQLLCGLVERQNVVRLGAVFASAFLRSISFLEKHWHDLVTDIRTGRINPSITNAAC  202

Query  1198  RSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKYIEAVITGSMSQYVPALRYY  1019
             R A    L  P+PELADE+E IC + SWKG++ RLWP  KYIEAV+TG+M+QYVP L +Y
Sbjct  203   RVATESFLAQPNPELADEVEAICSSESWKGVLGRLWPNVKYIEAVLTGTMAQYVPMLEFY  262

Query  1018  SDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMGYFEFIPLGENGTFLSNLNK  839
             SDG++PL+CTMYASSE YFGVNL+PL  P DV++T+LPNM YFEF+PL ++G  L+   +
Sbjct  263   SDGRIPLVCTMYASSESYFGVNLRPLCSPKDVSYTILPNMAYFEFVPL-DDGLRLAEDGE  321

Query  838   egeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYRIGDVLQVAGFHNKAPQFKF  659
                     ++ + KLV LV V++GCYYELVVTTF+GLYRYR+GDVLQV GF+N+APQFKF
Sbjct  322   --------AVEKEKLVGLVDVKVGCYYELVVTTFAGLYRYRVGDVLQVTGFYNRAPQFKF  373

Query  658   TCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEYTSYADTSSVPGHYVIYWEI  479
              CRRNV+LS+D+DKTN+EDLH S++ AKK+LE    +L+EYTS+ DTS+VPGHYV++WE+
Sbjct  374   ICRRNVILSVDADKTNEEDLHGSVSRAKKILEDRGHILLEYTSFTDTSTVPGHYVLFWEV  433

Query  478   MH-----AGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLM  314
                    +G A +DAQVL+ CC+A+EE LD VYRRCR+HD+ +GPLEIR+V+ G FD LM
Sbjct  434   KATPTSGSGGARLDAQVLESCCVAVEESLDCVYRRCRAHDRSVGPLEIRLVEAGAFDALM  493

Query  313   GNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
                +++G SINQYKTPRCI+   +AL++L+S   A +FSPRDP
Sbjct  494   DLLVSQGGSINQYKTPRCIEPGGAALELLDSKATASFFSPRDP  536



>ref|XP_006303207.1| hypothetical protein CARUB_v10011293mg [Capsella rubella]
 gb|EOA36105.1| hypothetical protein CARUB_v10011293mg [Capsella rubella]
Length=608

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/546 (59%), Positives = 418/546 (77%), Gaps = 7/546 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS AE+L+R
Sbjct  60    FKNKVPVVNYDDIKPFIQRIADGESSDIVSAQPITELLTSSGTSAGKPKLMPSTAEELER  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++PIM++Y+ G+DEGK MYL F+K E+ T  GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPIMNKYVNGLDEGKGMYLLFIKPEIKTLSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+ ELADEIE  C   SW+GI+ RLWPKAKY
Sbjct  240   LCADIRTGTVTSWITDSACRDSVLSILDGPNQELADEIESKCAEKSWEGILRRLWPKAKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL DPADV++TLLPNM 
Sbjct  300   VEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYASSECYFGINLNPLCDPADVSYTLLPNMA  358

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ +      +       ++E+++ +  +VDLV+V +G YYE+V+TTF+GLYRYR
Sbjct  359   YFEFLPVDDKSHEEIHFASHSNTDDEDALKEDLIVDLVNVEVGRYYEIVITTFTGLYRYR  418

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQALLV  542
             +GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T AK   L +P   LL+
Sbjct  419   VGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLNHLQQPSSLLLM  478

Query  541   EYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
             EYTSYADTSS+PGHYV++WE+          +D + ++DCC  +E+ LDYVYRRCR+ DK
Sbjct  479   EYTSYADTSSIPGHYVLFWELKPRYSNDPPKLDDKTMEDCCSEVEDCLDYVYRRCRNRDK  538

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              IGPLEIRVV  GTFD LM   +++GSS+NQYKTPRC+KS   AL+IL+S V  R+FS R
Sbjct  539   SIGPLEIRVVSLGTFDSLMDFCVSQGSSLNQYKTPRCVKSG-GALEILDSRVIGRFFSKR  597

Query  190   DPAWKP  173
              P W+P
Sbjct  598   VPRWEP  603



>gb|KFK44683.1| hypothetical protein AALP_AA1G290100 [Arabis alpina]
Length=608

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/546 (58%), Positives = 415/546 (76%), Gaps = 7/546 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMP+ AE+L+R
Sbjct  60    FKNKVPVVNYDDIKPFIQRIADGESSDIVSSQPITELLTSSGTSAGKPKLMPATAEELER  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YN+++PIM++Y+ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYNMLVPIMNKYVSGLDEGKGMYLLFIKPEIKTPSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHFKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  +L  P+ ELADEIE  C   SW+GI+ RLWPKAKY
Sbjct  240   LCADIRTGTVTSWITDSACRDSVLSVLQGPNQELADEIEAKCAEKSWEGILTRLWPKAKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL  P+DV++TLLPNM 
Sbjct  300   VEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYASSECYFGINLNPLCSPSDVSYTLLPNMA  358

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ +      +     +   +E++ +  +VDLV+V +G YYE+V+TTF+GLYRYR
Sbjct  359   YFEFLPVDDKSHEEIHFASHEDNHSDEALKEDLIVDLVNVEVGRYYEIVITTFTGLYRYR  418

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQALLV  542
             +GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T AK   L +P   LL 
Sbjct  419   VGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLNHLQQPSSLLLT  478

Query  541   EYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
             EYTSYADTSS+PGHYV++WE+          +D + ++ CC  +E+ LDYVYRRCR+ DK
Sbjct  479   EYTSYADTSSIPGHYVLFWELKPRYSNDPPKLDDKTMELCCSEVEDCLDYVYRRCRNRDK  538

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              IGPLEIRVV  GTFD LM   +++GSS+NQYKTPRC+KS   AL+IL+S V  R+FS R
Sbjct  539   SIGPLEIRVVSLGTFDSLMDFCVSQGSSVNQYKTPRCVKSG-GALEILDSRVVGRFFSQR  597

Query  190   DPAWKP  173
              P W+P
Sbjct  598   VPQWEP  603



>ref|NP_174134.1| indole-3-acetic acid-amido synthetase GH3.17 [Arabidopsis thaliana]
 sp|Q9FZ87.1|GH317_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.17; AltName: 
Full=Auxin-responsive GH3-like protein 17; Short=AtGH3-17 
[Arabidopsis thaliana]
 gb|AAF98442.1|AC021044_21 Unknown protein [Arabidopsis thaliana]
 gb|AAG51481.1|AC069471_12 unknown protein [Arabidopsis thaliana]
 gb|AAK96476.1| At1g28130/F3H9_19 [Arabidopsis thaliana]
 gb|AAM47375.1| At1g28130/F3H9_19 [Arabidopsis thaliana]
 gb|AEE30921.1| indole-3-acetic acid-amido synthetase GH3.17 [Arabidopsis thaliana]
Length=609

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/550 (58%), Positives = 423/550 (77%), Gaps = 14/550 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+D++P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS AE+L+R
Sbjct  60    FKNKVPVVNYDDVKPFIQRIADGESSDIVSAQPITELLTSSGTSAGKPKLMPSTAEELER  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++PIM++Y+ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPIMNKYVDGLDEGKGMYLLFIKPEIKTPSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+ ELADEIE  C   SW+GI+ R+WPKAKY
Sbjct  240   LCADIRTGTVTSWITDSSCRDSVLSILNGPNQELADEIESECAEKSWEGILRRIWPKAKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL DPADV++TLLPNM 
Sbjct  300   VEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYASSECYFGINLNPLCDPADVSYTLLPNMA  358

Query  895   YFEFIPLGENG----TFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGL  728
             YFEF+P+ +       F ++ N    +++++++ +  +V+LV+V +G YYE+V+TTF+GL
Sbjct  359   YFEFLPVDDKSHEEIHFATHSN---TDDDDDALKEDLIVNLVNVEVGQYYEIVITTFTGL  415

Query  727   YRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQ  554
             YRYR+GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T AK   L  P  
Sbjct  416   YRYRVGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLNHLQHPSS  475

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIM--HAG-AAAIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL EYTSYADTSS+PGHYV++WE+   H+     +D + ++DCC  +E+ LDYVYRRCR
Sbjct  476   LLLTEYTSYADTSSIPGHYVLFWELKPRHSNDPPKLDDKTMEDCCSEVEDCLDYVYRRCR  535

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
             + DK IGPLEIRVV  GTFD LM   +++GSS+NQYKTPRC+KS   AL+IL+S V  R+
Sbjct  536   NRDKSIGPLEIRVVSLGTFDSLMDFCVSQGSSLNQYKTPRCVKSG-GALEILDSRVIGRF  594

Query  202   FSPRDPAWKP  173
             FS R P W+P
Sbjct  595   FSKRVPQWEP  604



>ref|XP_008222270.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Prunus mume]
Length=611

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/547 (60%), Positives = 414/547 (76%), Gaps = 7/547 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             DFK+ VPV++YED++PYI RIANG+    I+ Q ITE+L SSGTSGG+PK+MPS  EDLD
Sbjct  61    DFKKKVPVVSYEDVKPYIERIANGEPSDIISAQKITELLTSSGTSGGQPKMMPSTVEDLD  120

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL++P+M++Y+ G+D+GK MYL F+K E+STPCGL AR VLTSYYKS +F+ R 
Sbjct  121   RKTFFYNLLVPVMNKYVDGLDQGKGMYLLFIKPEISTPCGLVARPVLTSYYKSSNFRNRP  180

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ YN  TSPD+ ILCSD+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+ +W 
Sbjct  181   FNRYNIYTSPDEIILCSDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDHWK  240

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +I +G +S  I D  CR+A+S +L  P+P+LA+ IE      SW+GIV RLWP+ K
Sbjct  241   ELCSNIGSGHVSDWITDLSCRNAVSLVLSKPNPDLANLIEHEFNNKSWEGIVKRLWPRTK  300

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIE ++TGSM+QY+P L +YS G LPLI TMYASSECYFG+N  PLS P DVA+TLLPNM
Sbjct  301   YIEVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECYFGINFNPLSKPHDVAYTLLPNM  359

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKL--VDLVHVRLGCYYELVVTTFSGLY  725
              YFEF+P+ ++   ++  N   ++   +   +  L  VDLV V+LG YYELVVTTF+GLY
Sbjct  360   AYFEFLPVEKHHEEVALCNGVSDQSCIKEEEKENLETVDLVDVKLGHYYELVVTTFTGLY  419

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L V GFHNKAPQF+F  RRNVVLSID+DKTN+EDL  ++T AK LL+P   LL
Sbjct  420   RYRVGDILMVTGFHNKAPQFRFMHRRNVVLSIDTDKTNEEDLLNAVTKAKLLLDPLGFLL  479

Query  544   VEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSYADTSS+PGHYV++WE+          +D  +++ CC  +EE LD VYRRCR  D
Sbjct  480   IEYTSYADTSSIPGHYVLFWELKTKEKNDLIELDTNIMEQCCSTVEESLDSVYRRCRRKD  539

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
               IGPLEIR+VK G FD LM   +++GSS+NQYKTPRCIKS   A+KIL+S V  R+FS 
Sbjct  540   NSIGPLEIRIVKHGAFDALMDFSVSQGSSVNQYKTPRCIKS-EEAIKILDSRVVGRFFSK  598

Query  193   RDPAWKP  173
               P W+P
Sbjct  599   STPLWEP  605



>ref|XP_010460587.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17 [Camelina 
sativa]
Length=607

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/546 (59%), Positives = 418/546 (77%), Gaps = 8/546 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             F+  VPV+ Y+DI+P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS AE+L+R
Sbjct  60    FRNKVPVVNYDDIKPFIQRIADGESSDIVSAQPITELLTSSGTSAGKPKLMPSTAEELER  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++PIM++Y+ G+DEGK MYL F+K E+ T  GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPIMNKYVNGLDEGKGMYLLFIKPEIKTLSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+ ELADEIE  C   SW+GI+ +LWPKAKY
Sbjct  240   LCADIRTGTVTSWITDS-CRDSVLSILNGPNQELADEIESECAEKSWEGILRKLWPKAKY  298

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL DPADV++TLLPNM 
Sbjct  299   VEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYASSECYFGINLNPLCDPADVSYTLLPNMA  357

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ +      N       ++E+++ +  +VDLV+V +G YYE+V+TTF+GLYRYR
Sbjct  358   YFEFLPVDDKSHEEINFASHSNTDDEDALKEDLIVDLVNVEVGRYYEIVITTFTGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQALLV  542
             +GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T AK   L +P   LL+
Sbjct  418   VGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLNHLQQPSSLLLM  477

Query  541   EYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
             EYTSYADTSS+PGHYV++WE+          +D + ++DCC  +E+ LDYVYRRCR+ DK
Sbjct  478   EYTSYADTSSIPGHYVLFWELKPRYSNDPPKLDDKTMEDCCSEVEDCLDYVYRRCRNRDK  537

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              IGPLEIRVV  GTFD LM   +++GSS+NQYKTPRC+KS   AL+IL+S V  R+FS R
Sbjct  538   SIGPLEIRVVSLGTFDSLMDFCVSQGSSLNQYKTPRCVKS-GGALEILDSRVIGRFFSKR  596

Query  190   DPAWKP  173
              P W+P
Sbjct  597   VPRWEP  602



>ref|XP_010478176.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
isoform X1 [Camelina sativa]
 ref|XP_010478177.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
isoform X2 [Camelina sativa]
Length=607

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/546 (59%), Positives = 418/546 (77%), Gaps = 8/546 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS AE+L+R
Sbjct  60    FKNKVPVVNYDDIKPFIQRIADGESSDIVSAQPITELLTSSGTSAGKPKLMPSTAEELER  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++PIM++Y+ G+DEGK MYL F+K E+ T  GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPIMNKYVNGLDEGKGMYLLFIKPEIKTLSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+ ELADEIE  C   SW+GI+ +LWPKAKY
Sbjct  240   LCADIRTGTVTSWITDS-CRDSVLSILNGPNQELADEIESECAEKSWEGILRKLWPKAKY  298

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL DPADV++TLLPNM 
Sbjct  299   VEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYASSECYFGINLNPLCDPADVSYTLLPNMA  357

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ +      N       ++E+++ +  +VDLV+V +G YYE+V+TTF+GLYRYR
Sbjct  358   YFEFLPVDDKSHEEINFASHSNTDDEDALKEDLIVDLVNVEVGRYYEIVITTFTGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQALLV  542
             +GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T AK   L +P   LL+
Sbjct  418   VGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLNHLQQPSSLLLM  477

Query  541   EYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
             EYTSYADTSS+PGHYV++WE+          +D + ++DCC  +E+ LDYVYRRCR+ DK
Sbjct  478   EYTSYADTSSIPGHYVLFWELKPRYSNDPPKLDDKTMEDCCSEVEDCLDYVYRRCRNRDK  537

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              IGPLEIRVV  GTFD LM   +++GSS+NQYKTPRC+K+   AL+IL+S V  R+FS R
Sbjct  538   SIGPLEIRVVSLGTFDSLMDFCVSQGSSLNQYKTPRCVKT-GGALEILDSRVIGRFFSKR  596

Query  190   DPAWKP  173
              P W+P
Sbjct  597   VPRWEP  602



>ref|XP_006286048.1| hypothetical protein CARUB_v10007580mg [Capsella rubella]
 gb|EOA18946.1| hypothetical protein CARUB_v10007580mg [Capsella rubella]
Length=597

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/544 (58%), Positives = 410/544 (75%), Gaps = 14/544 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P+I RIA+GD    ++ QPI E+L SSGTSGG+PKLMPS AE+LDR
Sbjct  60    FKNKVPVVDYEDMKPFIQRIADGDSSHILSSQPIIELLTSSGTSGGKPKLMPSTAEELDR  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YN+++P+M++++ G+DEGK MYL FVK E+ T  GL AR VLTSYYKS+ FK R F
Sbjct  120   KTFFYNMLVPVMNKFVNGLDEGKGMYLLFVKPEIKTLSGLKARPVLTSYYKSQQFKNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN +TSP+++ILC D+ QSMYCQLL GLV R  VLRLGA+FASAFLRA+ FL++++  
Sbjct  180   NKYNVITSPNETILCEDSKQSMYCQLLCGLVQRSHVLRLGAIFASAFLRAVKFLENHYTQ  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+ +LADE+E +C A SW+GI+ R+WPK KY
Sbjct  240   LCADIRTGTVASWITDSSCRESVLSILNGPNSDLADEVEALCSAKSWEGILRRIWPKTKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TGSM+QY+P L +YS G LPL+  MYASSEC+FG+N+ PL  P+DV++TLLPNM 
Sbjct  300   IEVIVTGSMAQYIPTLDFYSGG-LPLVSVMYASSECFFGININPLCKPSDVSYTLLPNMA  358

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ E         K           Q ++VDLV+V  G YYELV+TTF+GLYRYR
Sbjct  359   YFEFLPVDEKSH-----EKIHSGSYNLKDDQGRIVDLVNVETGRYYELVITTFAGLYRYR  413

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHNKAPQF F  RRNVVLSID+DKT++EDL +++  AK    P   LL EY
Sbjct  414   VGDILKVTGFHNKAPQFSFVERRNVVLSIDTDKTSEEDLMKAVAQAK----PSSFLLTEY  469

Query  535   TSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
             TSYADTSS+PGHYV++WE+          +D +V++DCC  +E+ LDYVYRRCR+ DK I
Sbjct  470   TSYADTSSIPGHYVLFWELRPRHKDDPPKLDEKVMEDCCSEVEDCLDYVYRRCRNKDKSI  529

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIRVV  GTFD LM   I++GSS+NQYKTPRC+KS   AL+IL+S V  R+FS R+P
Sbjct  530   GPLEIRVVSFGTFDSLMDFSISQGSSVNQYKTPRCVKSG-GALQILDSRVIGRFFSKREP  588

Query  184   AWKP  173
              W+P
Sbjct  589   QWEP  592



>ref|XP_010445414.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Camelina sativa]
Length=597

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/543 (58%), Positives = 413/543 (76%), Gaps = 14/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P+I RIA+G+    +  QPITE+L SSGTSGG+PKLMPS AE+LDR
Sbjct  60    FKNKVPVVNYEDMKPFIRRIADGESSDILASQPITELLTSSGTSGGKPKLMPSTAEELDR  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YN+++P+M++Y+ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+ FK R F
Sbjct  120   KTFFYNMLVPVMNKYVNGLDEGKGMYLLFIKPEIKTPSGLKARPVLTSYYKSQQFKNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN +TSP+++ILC D+ QSMYCQLL GLV R  VLRLGA+FASAFLRA+ FL++N+  
Sbjct  180   NKYNVITSPNETILCEDSKQSMYCQLLCGLVQRSHVLRLGAIFASAFLRAVKFLENNFTQ  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+PELADE+E +C A SW+GI+ R+WPK KY
Sbjct  240   LCADIRTGTVASWITDSTCRESVLSILNGPNPELADEVEALCSAMSWEGILRRIWPKTKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TGSM+QY+P L +YS G LPL+  MYASSEC+FG+N+ PL  P+DV++TLLPNM 
Sbjct  300   IEVIVTGSMAQYIPTLEFYSGG-LPLVSVMYASSECFFGININPLCKPSDVSYTLLPNMA  358

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ E         +      +    + ++VDLV+V  G YYELV+TTF+GLYRY+
Sbjct  359   YFEFLPVDEKSH-----EEIHSGSHDTLKDEDRIVDLVNVETGRYYELVITTFAGLYRYK  413

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHNKAP F F  RRNVVLSID+DKT++EDL +++  AK    P   LL EY
Sbjct  414   VGDILKVTGFHNKAPHFSFVERRNVVLSIDTDKTSEEDLMKAVAQAK----PSSFLLTEY  469

Query  535   TSYADTSSVPGHYVIYWEI--MHAG-AAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
             TSYADTSS+PGHYV++WE+  +H   +  ++ ++++DCC  +E+ LDYVYRRCR+ DK I
Sbjct  470   TSYADTSSMPGHYVLFWELKPLHDNDSPKLNEKMMEDCCSEVEDCLDYVYRRCRNKDKSI  529

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIRVV  GTFD LM   I++GSS+NQYKTPRC+KS   AL+IL+S V  R+FS R P
Sbjct  530   GPLEIRVVSLGTFDSLMDFSISKGSSVNQYKTPRCVKS-GGALQILDSRVIGRFFSKRVP  588

Query  184   AWK  176
              W+
Sbjct  589   QWE  591



>ref|XP_010436584.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Camelina sativa]
Length=597

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/543 (57%), Positives = 414/543 (76%), Gaps = 14/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P+I RI++G+    ++ QPI E+L SSGTSGG+PKLMPS AE+LDR
Sbjct  60    FKNKVPVVNYEDMKPFIQRISDGESSDILSSQPIVELLTSSGTSGGKPKLMPSTAEELDR  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YN+++P+M++Y+ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+ FK R F
Sbjct  120   KTFFYNMLVPVMNKYVNGLDEGKGMYLLFIKPEIKTPSGLKARPVLTSYYKSQQFKNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN +TSP+++ILC D+ QSMYCQLL GLV R  VLRLGA+FASAFLRA+ FL++N+P 
Sbjct  180   NKYNVITSPNETILCEDSKQSMYCQLLCGLVQRSHVLRLGAIFASAFLRAVKFLENNFPQ  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+PELADE+E +C A SW+GI+ R+WPK KY
Sbjct  240   LCADIRTGTVASWITDSTCRDSVLSILNGPNPELADEVEALCSAKSWEGILRRIWPKTKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TGSM+QY+P L +YS G +PL+  MYASSEC+FG+N+ PL  P+DV++TLLPNM 
Sbjct  300   IEVIVTGSMAQYIPTLEFYSGG-MPLVSVMYASSECFFGININPLCKPSDVSYTLLPNMA  358

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ E         +      +    + ++VDLV+V  G YYELV+TTF+GLYRY+
Sbjct  359   YFEFLPVDEKSHV-----EIHSGSYDTLKDEDRIVDLVNVETGRYYELVITTFAGLYRYK  413

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHNKAPQF F  RRNVVLSID+DK+++EDL +++  AK    P   LL EY
Sbjct  414   VGDILKVTGFHNKAPQFSFVERRNVVLSIDTDKSSEEDLMKAVAQAK----PSSFLLTEY  469

Query  535   TSYADTSSVPGHYVIYWEI--MHAG-AAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
             TSYADT+S+PGHYV++WE+  +H      ++ ++++DCC  +E+ LDYVYRRCR+ DK I
Sbjct  470   TSYADTTSIPGHYVLFWELKPLHDNDPPKLNEKMMEDCCSEVEDSLDYVYRRCRNKDKSI  529

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIRVV  GTFD LM   I++GSS+NQYKTPRC+KS   AL+IL+S V  ++FS R P
Sbjct  530   GPLEIRVVSLGTFDSLMDFSISQGSSVNQYKTPRCVKS-GGALQILDSRVIGKFFSKRVP  588

Query  184   AWK  176
              W+
Sbjct  589   QWE  591



>emb|CDY15692.1| BnaA07g08630D [Brassica napus]
Length=609

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/550 (58%), Positives = 422/550 (77%), Gaps = 14/550 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS A++LDR
Sbjct  60    FKNKVPVVNYDDIKPFIQRIADGESSDIVSVQPITELLTSSGTSAGKPKLMPSTAKELDR  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++P+M++Y+ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPVMNKYVNGLDEGKGMYLLFIKPEIKTPSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+G VFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGTVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I +  CR ++  +L  P+ ELADEIE  C   SW+GI+ RLWPKAKY
Sbjct  240   LCADIRTGTVTSWITEPACRDSVLSVLQGPNQELADEIESECAEKSWEGILRRLWPKAKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL DP+DV++TLLPNM 
Sbjct  300   VEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYASSECYFGINLNPLCDPSDVSYTLLPNMA  358

Query  895   YFEFIPLG----ENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGL  728
             YFEF+P+     E   F S+ N    +++++++ +  +VDLV+V +G YYE+V+TTF+GL
Sbjct  359   YFEFLPVDDKSHEEIHFASHSN---TDDDDDALKEDLIVDLVNVEVGRYYEIVITTFTGL  415

Query  727   YRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAA--KKLLEPHQ  554
             YRYR+GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T A  K L +P  
Sbjct  416   YRYRVGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLKHLQKPSC  475

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL EYTSYADTSS+PGHYV++WE+    +     +D + ++ CC  +E++LDYVYRRCR
Sbjct  476   PLLTEYTSYADTSSIPGHYVLFWELKPRYNNDPPKLDDKTMEKCCSEVEDRLDYVYRRCR  535

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
             + DK IGPLEIRVV  GTFDLLM   +++GSS+NQYKTPRC+KS   AL+IL+S V  R+
Sbjct  536   NKDKSIGPLEIRVVSLGTFDLLMDFCVSQGSSVNQYKTPRCVKSG-GALEILDSRVIGRF  594

Query  202   FSPRDPAWKP  173
             FS R P W+P
Sbjct  595   FSQRVPQWEP  604



>ref|XP_007043752.1| Auxin-responsive GH3 family protein [Theobroma cacao]
 gb|EOX99583.1| Auxin-responsive GH3 family protein [Theobroma cacao]
Length=646

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/550 (60%), Positives = 416/550 (76%), Gaps = 11/550 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VPV+ YEDI+PYI RIANGD  + IT +P+TE+L SSGTSGG+PK+MPS AEDL R
Sbjct  98    FKKKVPVVNYEDIKPYIERIANGDSSNIITAEPVTELLTSSGTSGGQPKMMPSTAEDLHR  157

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YNL++P+M+QY+ G+D+GK MYL FVK E+ TP GL AR VLTSYYKS +F+ R F
Sbjct  158   KTFFYNLLVPVMNQYVDGLDDGKGMYLLFVKPEIKTPSGLMARPVLTSYYKSSNFRNRPF  217

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + +N  TSPD++ILCSD+ QSMYCQLL GLV R++VLR+GAVFASAFLRAI FL+  W  
Sbjct  218   NRFNVYTSPDETILCSDSKQSMYCQLLCGLVQRKEVLRVGAVFASAFLRAIKFLEDYWKE  277

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC +IRTG +S  I D  CR  +S IL  P+ ELA+ IE  C   SW+GI+ +LWP+ KY
Sbjct  278   LCSNIRTGHVSDWITDPSCRKVVSLILSKPNSELANLIEHECSNKSWEGIIKKLWPRTKY  337

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TGSM+QY+  L +YS G LPL+ TMYASSECYFG+N KPLS P+DV++TL+PN+ 
Sbjct  338   IEVIVTGSMAQYISTLEFYSGG-LPLVSTMYASSECYFGINFKPLSKPSDVSYTLVPNVA  396

Query  895   YFEFIPLGEN------GTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             YFEF+P+ +N          + + +E   EEE      + VDLV V+LG YYELVVTTF+
Sbjct  397   YFEFLPVKKNHEDATQDVQCNGICEENCMEEETGKEDIETVDLVDVKLGHYYELVVTTFT  456

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYR+GD+L V GFHN APQF+F  RRNVVLSID+DKTN+EDL +++T AK LLE   
Sbjct  457   GLYRYRVGDILMVTGFHNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTKAKLLLESLG  516

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGAA---AIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL+EYTSYADTSS+PGHYV++WE  + G      +D ++++ CC  +EE LD VYRRCR
Sbjct  517   FLLIEYTSYADTSSIPGHYVLFWEFTNKGGNDLPELDPKIMKQCCSTVEESLDSVYRRCR  576

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
               D  IGPLEIRVVK GTFD LM   +++GSS+NQYKTPRCIKS + A+ IL+S V  R+
Sbjct  577   RKDNSIGPLEIRVVKHGTFDALMDFCVSQGSSVNQYKTPRCIKS-AEAINILDSKVVGRF  635

Query  202   FSPRDPAWKP  173
             FS   P+W+P
Sbjct  636   FSQNAPSWEP  645



>ref|XP_010499312.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Camelina sativa]
Length=607

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/546 (58%), Positives = 417/546 (76%), Gaps = 8/546 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+ +I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS AE+L+R
Sbjct  60    FKNKVPVVNYDDIKLFIQRIADGESSDIVSAQPITELLTSSGTSAGKPKLMPSTAEELER  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++PIM++Y+ G+DEGK MYL F+K E+ T  GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPIMNKYVNGLDEGKGMYLLFIKPEIKTLSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+ ELADEIE  C   SW+GI+ +LWPKAKY
Sbjct  240   LCADIRTGTVTSWITDS-CRDSVLSILNGPNQELADEIESECAEKSWEGILRKLWPKAKY  298

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL DPADV++TLLPNM 
Sbjct  299   VEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYASSECYFGINLNPLCDPADVSYTLLPNMA  357

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ +      N       ++++++ +  +VDLV+V +G YYE+V+TTF+GLYRYR
Sbjct  358   YFEFLPVDDKSHEEINFASHSNTDDDDALKEDLIVDLVNVEVGRYYEIVITTFTGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQALLV  542
             +GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T AK   L +P   LL+
Sbjct  418   VGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLNHLQQPSSLLLM  477

Query  541   EYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
             EYTSYADTSS+PGHYV++WE+          +D + ++DCC  +E+ LDYVYRRCR+ DK
Sbjct  478   EYTSYADTSSIPGHYVLFWELKPRYSNDPPKLDDKTMEDCCSEVEDCLDYVYRRCRNRDK  537

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              IGPLEIRVV  GTFD LM   +++GSS+NQYKTPRC+KS   AL+IL+S V  R+FS R
Sbjct  538   SIGPLEIRVVSLGTFDSLMDFCVSQGSSLNQYKTPRCVKS-GGALEILDSRVIGRFFSKR  596

Query  190   DPAWKP  173
              P W+P
Sbjct  597   VPRWEP  602



>ref|XP_010538163.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Tarenaya hassleriana]
Length=612

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/547 (58%), Positives = 420/547 (77%), Gaps = 8/547 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YEDI+P+I RIA+G     I+ QPITE+L SSGTS G+PKLMPS A++LDR
Sbjct  62    FKNKVPVVNYEDIKPFIQRIADGQSPDVISSQPITELLTSSGTSEGQPKLMPSTAQELDR  121

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YN+++P+M++Y+ G+DEGK MYL F+K E+ T  GL AR VLTSYYKS++F+ R +
Sbjct  122   KTFFYNMLVPVMNKYVEGLDEGKGMYLLFIKPEIKTSSGLMARPVLTSYYKSQNFRNRPY  181

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPD +ILC D+ QSMYCQLL GL+ R +VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  182   NKYNIYTSPDDTILCLDSKQSMYCQLLCGLIQRHEVLRVGAVFASAFLRAVKFLEDHFKE  241

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG +   I DS CR A+  IL  P PELADEIE  C+  SW+GIV RLWP+AKY
Sbjct  242   LCSDIRTGSVCDWITDSGCRKAVMAILKDPSPELADEIERECKGESWEGIVKRLWPRAKY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL P  DP+DV++TLLPNM 
Sbjct  302   VEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYASSECYFGINLNPNCDPSDVSYTLLPNMA  360

Query  895   YFEFIPLGENG-TFLSNLNKegeeeeeESIPQSK--LVDLVHVRLGCYYELVVTTFSGLY  725
             YFEF+P+ +     +S  ++    E  +   +SK  +VDLV V++G YYELV+TTF+GLY
Sbjct  361   YFEFLPVADKSHDEISGGSQCNGVENGDHNLESKDQIVDLVDVQIGQYYELVITTFTGLY  420

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L V GFHNKAPQF+F  RRNVVLSID+DKT++EDL +++T AK+LL+P   LL
Sbjct  421   RYRVGDILMVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLKAVTQAKQLLQPSNLLL  480

Query  544   VEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSYADTSS+PGHYV++WE+    +     +    +++CC  +E+ LDYVYRRCR+ D
Sbjct  481   MEYTSYADTSSIPGHYVLFWELKPRYNDDPFELKTPTMEECCSEVEDCLDYVYRRCRNKD  540

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
             + IG LEIRVV+ GTFD+LM + +++GSS+NQYKTPRC+KS   A++IL++ V  R+FS 
Sbjct  541   RSIGALEIRVVRMGTFDVLMDHCVSQGSSVNQYKTPRCVKSQ-GAIEILDTRVIGRFFSS  599

Query  193   RDPAWKP  173
             R P W+P
Sbjct  600   RLPKWEP  606



>ref|XP_002299361.1| auxin-responsive GH3 family protein [Populus trichocarpa]
 gb|EEE84166.1| auxin-responsive GH3 family protein [Populus trichocarpa]
Length=606

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/556 (58%), Positives = 415/556 (75%), Gaps = 25/556 (4%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             +FK  VP++ YEDI+P I RIANG+  S I+ QPITE+L SSGTSGG+PK+MPS AE+L+
Sbjct  57    NFKNKVPIVNYEDIKPCIERIANGEPSSIISTQPITELLTSSGTSGGQPKIMPSTAEELE  116

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL++P+M++Y+ G+D+GKAMYL F+K E+STP GL AR VLTSYYKS +F+ R+
Sbjct  117   RKTFFYNLLVPVMNKYVDGLDQGKAMYLLFIKPEISTPSGLMARPVLTSYYKSNNFRNRA  176

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ YN  TSPD++ILCSD+ QSMYCQLL GLV R +VLR+GA+FASAFLRAI FL+    
Sbjct  177   FNRYNVYTSPDETILCSDSKQSMYCQLLCGLVQRDEVLRVGAIFASAFLRAIKFLEEYLK  236

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +IRTG +S  I D  CR+A+  IL  P+ ELAD IE+ C   SW+GI+ +LWP+ K
Sbjct  237   ELCSNIRTGSVSDWITDPNCRNAVLSILSKPNSELADLIEDECSGKSWEGIIKKLWPRTK  296

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIE ++TGSM+QY+P L +YS G LPL+ TMY SSECY G+N KPLS+P DV++TLLPNM
Sbjct  297   YIEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYGSSECYLGINFKPLSNPYDVSYTLLPNM  355

Query  898   GYFEFIPLGE-----------NGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYEL  752
              YFEF+P+             NG  +++ N +          + + VDLV V+LG YYEL
Sbjct  356   AYFEFLPVDNNHKEVVPDVQCNGVSVTDRNGKE---------KVEAVDLVDVKLGHYYEL  406

Query  751   VVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKK  572
             +VTTF+GLYRYR+GD+L V GF+N APQF+F  RRNVVLSID+DKTN+EDL +++T AK 
Sbjct  407   IVTTFTGLYRYRVGDILMVTGFYNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTQAKV  466

Query  571   LLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDY  401
             LLEP   LL EYTS+ADT+S+PGHYV++WE+   G      +D  +++ CC  +EE LD 
Sbjct  467   LLEPLGFLLTEYTSFADTASIPGHYVLFWELKMRGTNDLPELDPVIMEQCCSIVEESLDS  526

Query  400   VYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILES  221
             VYRRCR  DK IGPLE+RVV  GTFD LM   +++GSS+NQYKTPRCIKS   ALKIL+S
Sbjct  527   VYRRCRKKDKSIGPLEVRVVTHGTFDALMDFCVSQGSSVNQYKTPRCIKS-EEALKILDS  585

Query  220   NVRARYFSPRDPAWKP  173
              V  R+ S + P W+P
Sbjct  586   RVVGRFSSNKTPFWEP  601



>ref|XP_006415692.1| hypothetical protein EUTSA_v10007112mg [Eutrema salsugineum]
 gb|ESQ34045.1| hypothetical protein EUTSA_v10007112mg [Eutrema salsugineum]
Length=609

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/547 (58%), Positives = 420/547 (77%), Gaps = 8/547 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS AE+L+R
Sbjct  60    FKNKVPVVNYDDIKPFIQRIADGESSDIVSAQPITELLTSSGTSAGKPKLMPSTAEELER  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++P+M++Y+ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPVMNKYVNGLDEGKGMYLLFIKPEIKTPSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQAILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHFKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL   + +LADEIE  C   SW+GI+ RLWPKAKY
Sbjct  240   LCADIRTGTVTSWITDSACRDSVLSILKGSNQDLADEIESECAEKSWEGILKRLWPKAKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL +P+DV++TLLPNM 
Sbjct  300   VEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYASSECYFGINLNPLCNPSDVSYTLLPNMA  358

Query  895   YFEFIPLGENG-TFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             YFEF+P+ +     +   +    +++++++ +  +VDLV+V +G YYE+V+TTF+GLYRY
Sbjct  359   YFEFLPVDDKSHEEIHYASHSNIDDDDDALKEDLIVDLVNVEVGRYYEIVITTFTGLYRY  418

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQALL  545
             R+GD+L+V GFHN APQF+F  RRNVVLSID+DKT++EDL  ++T AK   L +P   LL
Sbjct  419   RVGDILKVTGFHNNAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLNHLQQPSSLLL  478

Query  544   VEYTSYADTSSVPGHYVIYWEIM--HAG-AAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
              EYTSYADTSS+PGHYV++WE+   H+     +D + ++ CC  +E+ LDYVYRRCR+ D
Sbjct  479   TEYTSYADTSSIPGHYVLFWELKPRHSNDPPKLDDKTMEKCCSVVEDCLDYVYRRCRNRD  538

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
             K IGPLEIRVV  GTFDLLM   +++GSS+NQYKTPRC+KS   AL+IL+S V  R+FS 
Sbjct  539   KSIGPLEIRVVSLGTFDLLMDFCVSQGSSVNQYKTPRCVKS-GGALEILDSRVIGRFFSQ  597

Query  193   RDPAWKP  173
             R P W+P
Sbjct  598   RVPQWEP  604



>emb|CDY63330.1| BnaCnng41900D [Brassica napus]
Length=609

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/550 (58%), Positives = 421/550 (77%), Gaps = 14/550 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS A++LDR
Sbjct  60    FKNKVPVVNYDDIKPFIQRIADGESSDIVSVQPITELLTSSGTSAGKPKLMPSTAKELDR  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF Y++++P+M++Y+ G+ EGK MYL F+K E+ TP GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTFFYSMLVPVMNKYVNGLGEGKGMYLLFIKPEIKTPSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNIYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I DS CR ++  IL  P+ ELADEIE  C   SW+GI+ RLWPKAKY
Sbjct  240   LCADIRTGTITSWITDSACRDSVLSILDGPNQELADEIESECAEKSWEGILRRLWPKAKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL DP+DV++TLLPNM 
Sbjct  300   VEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYASSECYFGINLNPLCDPSDVSYTLLPNMA  358

Query  895   YFEFIPLG----ENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGL  728
             YFEF+P+     E   F S+ N    +++++++ +  +VDLV+V +G YYE+V+TTF+GL
Sbjct  359   YFEFLPVDDKSHEEIHFASHSN---TDDDDDALKEDLIVDLVNVEVGRYYEIVITTFTGL  415

Query  727   YRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAA--KKLLEPHQ  554
             YRYR+GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T A  K L +P  
Sbjct  416   YRYRVGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLKHLQKPSC  475

Query  553   ALLVEYTSYADTSSVPGHYVIYWEI---MHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL EYTSYADTSS+PGHYV++WE+    +     ++ + ++ CC  +E+ LDYVYRRCR
Sbjct  476   PLLTEYTSYADTSSIPGHYVLFWELKPRQNNEPPELENKTMELCCSEVEDYLDYVYRRCR  535

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
             + DK IGPLEIRVV  GTFDLLM   +++GSS+NQYKTPRC+K    AL+IL+S V  R+
Sbjct  536   NKDKSIGPLEIRVVSLGTFDLLMDFCVSQGSSVNQYKTPRCVKP-GGALEILDSRVIGRF  594

Query  202   FSPRDPAWKP  173
             FS R P W+P
Sbjct  595   FSQRVPQWQP  604



>ref|XP_007222041.1| hypothetical protein PRUPE_ppa003065mg [Prunus persica]
 gb|EMJ23240.1| hypothetical protein PRUPE_ppa003065mg [Prunus persica]
Length=607

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/547 (59%), Positives = 412/547 (75%), Gaps = 7/547 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             DFK+ VPV+ YED++PYI RIANG+    I+ Q ITE+L SSGTSGG+PK+MPS  EDLD
Sbjct  57    DFKKKVPVVNYEDVKPYIERIANGEPSDIISAQKITELLTSSGTSGGQPKMMPSTVEDLD  116

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL++P+M++Y+ G+D+GK MYL F+K E+STP GL AR VLTSYYKS +F+ R 
Sbjct  117   RKTFFYNLLVPVMNKYVDGLDQGKGMYLLFIKPEISTPSGLVARPVLTSYYKSSNFRNRP  176

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ YN  TSPD+ ILCSD+ QSMYCQLL GLV R +V+R+GAVFASAFLRAI FL+ +W 
Sbjct  177   FNRYNIYTSPDEIILCSDSKQSMYCQLLCGLVQRDEVMRVGAVFASAFLRAIKFLEDHWK  236

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +I +G +S  I D  CR+A+S +L  P+P+LA+ I+      SW+GIV RLWP+ K
Sbjct  237   ELCSNIGSGHVSEWITDPSCRNAVSLVLSKPNPDLANLIKHEFNNKSWEGIVKRLWPRTK  296

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIE ++TGSM+QY+P L +YS G LPLI TMYASSECYFG+N  PLS P DVA+TLLPNM
Sbjct  297   YIEVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECYFGINFNPLSKPNDVAYTLLPNM  355

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKL--VDLVHVRLGCYYELVVTTFSGLY  725
              YFEF+P+ ++   ++  N   ++   +   +  L  VDLV V+LG YYELVVTTF+GLY
Sbjct  356   AYFEFLPVEKHHEEVALCNGVSDQSCIKEEEKENLETVDLVDVKLGHYYELVVTTFTGLY  415

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L V GFHNKAPQF+F  RRNVVLSID+DKTN+EDL  ++T AK LL+P   LL
Sbjct  416   RYRVGDILMVTGFHNKAPQFRFMHRRNVVLSIDTDKTNEEDLLNAVTQAKLLLDPLGFLL  475

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAA---AIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSYADTSS+PGHYV++WE+          +D  +++ CC  +EE LD VYRRCR  D
Sbjct  476   IEYTSYADTSSIPGHYVLFWELKTKEKNDFIELDTNIMEQCCSTVEESLDSVYRRCRRKD  535

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
               IGPLEIR+VK G FD LM   +++GSS+NQYKTPRCIKS   A+KIL+S V  R+FS 
Sbjct  536   NSIGPLEIRIVKHGAFDALMDFSVSQGSSVNQYKTPRCIKS-EEAIKILDSRVVGRFFSK  594

Query  193   RDPAWKP  173
               P W+P
Sbjct  595   STPLWEP  601



>ref|XP_010929717.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Elaeis guineensis]
Length=602

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/549 (60%), Positives = 410/549 (75%), Gaps = 21/549 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR VPVI YE ++PYI RIANG+    I+ QPITE+L SSGTSGG+PKLMPS AEDLDR
Sbjct  59    FKRQVPVIDYEQVKPYIERIANGEPSHIISSQPITELLTSSGTSGGQPKLMPSTAEDLDR  118

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             + FLYNL++P+M++Y+ G+D GK MYL FVK E+STP GL AR VLTSYYKS +F+ R F
Sbjct  119   KNFLYNLLIPVMNKYVDGLDRGKGMYLLFVKPEISTPSGLTARPVLTSYYKSSNFRNRPF  178

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
               +N  TSPD++ILCSD+ QSMYCQLL GL+ R +VLR+GAVFASAFLRAI FL+ +W  
Sbjct  179   TKFNVYTSPDETILCSDSKQSMYCQLLCGLIQRDEVLRVGAVFASAFLRAIKFLEDHWEE  238

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC +IRTG +S  I D+ CR+A  +IL  P+ ELA+ IE  CR   W+ I+ RLWPK KY
Sbjct  239   LCSNIRTGHVSDWITDTSCRNAAGRILDRPNSELAELIETECRKEPWEAIIRRLWPKTKY  298

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL+PL  P+DV++ LLPNM 
Sbjct  299   VDVIVTGSMAQYIPLLEFYSGG-LPLVSTMYASSECYFGINLRPLDLPSDVSYVLLPNMA  357

Query  895   YFEFIPL-----GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             YFEFI +      E      N N            +SK+VDL +V +GCYYELVVTTF+G
Sbjct  358   YFEFIKVERTDEDEASRIECNGNG-----------ESKVVDLTNVEVGCYYELVVTTFTG  406

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYR+GD+L V GFHN APQF+F  RRNVVLSID+DKTN+EDL ++IT AK LL+P   
Sbjct  407   LYRYRVGDILMVTGFHNTAPQFRFVHRRNVVLSIDTDKTNEEDLLKAITQAKLLLQPLGC  466

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             LL EYTSYADTSS+PGHYV++WE    G+   + +D  V+++CC  +E  LD VYRRCRS
Sbjct  467   LLTEYTSYADTSSIPGHYVLFWEFKTKGSSDLSNLDQTVMEECCSTVEACLDSVYRRCRS  526

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
              D+ IGPLEIRVV+ G FD LM   +++GSS+NQYKTPRCIKS +  + ILE  V  R+F
Sbjct  527   KDRSIGPLEIRVVQCGAFDALMDFCVSQGSSVNQYKTPRCIKS-TEGIGILEEKVVRRFF  585

Query  199   SPRDPAWKP  173
             S + P W+P
Sbjct  586   SRKVPLWEP  594



>ref|XP_009353499.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Pyrus x bretschneideri]
Length=611

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/547 (59%), Positives = 417/547 (76%), Gaps = 7/547 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             DFK+ VPV+ YED++PYI RIANG+    I+ Q ITE+L SSGTSGG+PK+MPS  EDLD
Sbjct  61    DFKKKVPVVNYEDVKPYIERIANGEPSEIISAQKITELLTSSGTSGGQPKMMPSTVEDLD  120

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL++P+M++Y+ G+D+GK MYL F+K E+STP G+ AR VLTSYYKS +F+ R 
Sbjct  121   RKTFFYNLLVPVMNKYVDGLDQGKGMYLLFIKPEISTPSGMVARPVLTSYYKSTNFRNRP  180

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ +N  TSPD++ILCSD+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+ +W 
Sbjct  181   FNRFNIYTSPDEAILCSDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDHWE  240

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +I +G +S  I DS CR+A+S +L  P+PELAD I       S +GIV RLWP+ K
Sbjct  241   ELCSNIGSGLVSDWITDSSCRNAVSLVLSKPNPELADLIRHEFSNKSLEGIVKRLWPRTK  300

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIE ++TGSM+QY+P L +YS G LPLI TMYASSECYFG+N  PLS P DVA+TLLPNM
Sbjct  301   YIEVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECYFGINFNPLSKPHDVAYTLLPNM  359

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKL--VDLVHVRLGCYYELVVTTFSGLY  725
              YFEF+P+ ++   +++ N   ++E  ++  +  L  VDLV V+LG YYELVVTTF+GLY
Sbjct  360   AYFEFLPVEKHHEEVASHNGVSDQECPKADEEETLETVDLVDVKLGHYYELVVTTFTGLY  419

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L V GFHNKAPQF+F  RRNVVLSID+DKTN+EDL  ++T A+ LLEP   LL
Sbjct  420   RYRVGDILMVIGFHNKAPQFRFMHRRNVVLSIDTDKTNEEDLLNAVTQARLLLEPLGFLL  479

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAA---AIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSYADTSS+PGHYV++WE+    +     ++  +++ CC  +E+ LD VYRRCR  D
Sbjct  480   IEYTSYADTSSIPGHYVLFWELKTKESNDMIELETSIMEQCCSTVEQSLDSVYRRCRRKD  539

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
               IGPLEIR+VK GTFD LM   I++GSS+NQYKTPRCI+S   A++IL+S V  R+FS 
Sbjct  540   NSIGPLEIRIVKQGTFDALMDFSISQGSSVNQYKTPRCIQS-EEAIRILDSRVVGRFFSK  598

Query  193   RDPAWKP  173
               P W+P
Sbjct  599   STPLWEP  605



>gb|KDO46538.1| hypothetical protein CISIN_1g007149mg [Citrus sinensis]
Length=616

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/550 (58%), Positives = 413/550 (75%), Gaps = 6/550 (1%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D++  FK+ VPV+ YEDI+PYI RIANG+    I+ QPITE L SSGTSGG+PK+MPS  
Sbjct  62    DVLQVFKKNVPVVNYEDIKPYIERIANGEPSDIISAQPITEFLTSSGTSGGQPKMMPSTD  121

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             EDL+R+TF YN+++P+M++Y+  +D+GKAMYL FVK E+ TP GL AR VLTSYYKS  F
Sbjct  122   EDLERKTFFYNMLIPVMNKYVDDLDKGKAMYLLFVKPEIRTPSGLMARPVLTSYYKSNSF  181

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
             + R F+ YN  TSPD++ILC D+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+
Sbjct  182   RNRPFNRYNVYTSPDETILCPDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLE  241

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
               W  LC +IR G +S  I D  CR+A+S IL   + +LA+ IE  C   SW+GI+ ++W
Sbjct  242   DYWKELCSNIRIGHVSDWITDPSCRNAVSLILGRANQDLANLIENECGGESWEGIIKKIW  301

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             P+ KYIE ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+N KPL  P+DV++TL
Sbjct  302   PRTKYIEVIVTGSMAQYIPILEFYSGG-LPLVSTMYASSECYFGINFKPLCKPSDVSYTL  360

Query  910   LPNMGYFEFIPLGE-NGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             LPNM YFEF+P+ + NG         G  +++    ++++VDL +V+LG  YELVVTTF+
Sbjct  361   LPNMAYFEFLPVEKSNGELTQEFQCNGISDQDCQHDETEIVDLTNVKLGHCYELVVTTFT  420

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYR+GD+L V GFHN APQF F  R+NV+LSID+DKTN+EDL +++T AK L+EP  
Sbjct  421   GLYRYRVGDILMVTGFHNNAPQFWFVHRKNVILSIDTDKTNEEDLLKAVTEAKLLIEPLG  480

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL EYT+YADT S+PGHYV++WE+   G+   + +D  +++ CC  +EE LD VYRRCR
Sbjct  481   FLLTEYTAYADTCSIPGHYVVFWELKSKGSNNLSELDTDIMEQCCSRVEESLDSVYRRCR  540

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
               D  IGPLEIRVVK GTFD LM   +++GSS+NQYKTPRCIKS   A+ +L+S V  R+
Sbjct  541   KKDNSIGPLEIRVVKDGTFDALMDFSVSQGSSVNQYKTPRCIKS-EEAINLLDSKVVGRF  599

Query  202   FSPRDPAWKP  173
             FS R P+W+P
Sbjct  600   FSKRVPSWEP  609



>ref|XP_010234157.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11 
isoform X2 [Brachypodium distachyon]
Length=483

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/491 (64%), Positives = 388/491 (79%), Gaps = 12/491 (2%)
 Frame = -1

Query  1645  MPSIAEDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYY  1466
             MP+I+EDLDRRT+LY+L+MPIM++Y+ G+ EGKAMYL FVKAE  T  G+P R+VLTSYY
Sbjct  1     MPAISEDLDRRTYLYSLLMPIMNKYVSGLGEGKAMYLLFVKAETLTDSGIPVRSVLTSYY  60

Query  1465  KSKHFKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRA  1286
             KS HF  R  D YN+ TSPD+ ILC D+ QSMYCQLL GL+ R  VLRLGAVFASAFLR+
Sbjct  61    KSPHFLHRKHDLYNNYTSPDEVILCPDSQQSMYCQLLCGLIERHHVLRLGAVFASAFLRS  120

Query  1285  ISFLQHNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGI  1106
             ISFL+ +W  L  DIR G+L+  + ++ CR AM   L  P+PELADE+EEIC    WKGI
Sbjct  121   ISFLEQHWRDLVNDIRIGKLNSNVTNNACRLAMVGFLALPNPELADELEEICSCGPWKGI  180

Query  1105  VYRLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPAD  926
             + RLWP  KYIEAV+TG+M+QY+P L +YS G++PL+CTMYASSE YFGVNL+PL +P D
Sbjct  181   LGRLWPNVKYIEAVLTGTMAQYIPMLEFYSGGRIPLVCTMYASSESYFGVNLRPLCNPTD  240

Query  925   VAFTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVV  746
             V++T+LPNM YFEFIPL E+G  +++        +E+ +   KLV LV V++GCYYELVV
Sbjct  241   VSYTILPNMAYFEFIPL-EDGLRVTD--------DEDVVENDKLVSLVDVKVGCYYELVV  291

Query  745   TTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLL  566
             TTFSGLYRYR+GDVLQV GF+N APQFKF CRRNV+LSIDSDKTN+EDLH S+T AKK+L
Sbjct  292   TTFSGLYRYRVGDVLQVTGFYNCAPQFKFICRRNVILSIDSDKTNEEDLHNSVTRAKKIL  351

Query  565   EPHQALLVEYTSYADTSSVPGHYVIYWEIMHA--GAAAIDAQVLQDCCIAIEEQLDYVYR  392
             E    +L+EYTSYADTS+VPGHYV++WEI     G A +DAQ+L+ CC A+EE LDY+YR
Sbjct  352   EDRNYILLEYTSYADTSTVPGHYVLFWEIKSTCEGGAPLDAQLLESCCTAVEESLDYIYR  411

Query  391   RCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVR  212
             RCR+HDK +GPLEIR+V+ G FD LM   +++GSSINQYKTPRCI+S   ALK+L S V 
Sbjct  412   RCRAHDKSVGPLEIRLVEAGAFDALMDLLVSQGSSINQYKTPRCIES-GLALKVLNSKVI  470

Query  211   ARYFSPRDPAW  179
             A +FSPRDP W
Sbjct  471   ASFFSPRDPQW  481



>ref|XP_006494790.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Citrus sinensis]
Length=626

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/550 (58%), Positives = 413/550 (75%), Gaps = 6/550 (1%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D++  FK+ VPV+ YEDI+PYI RIANG+    I+ QPITE L SSGTSGG+PK+MPS  
Sbjct  72    DVLQVFKKNVPVVNYEDIKPYIERIANGEPSDIISAQPITEFLTSSGTSGGQPKMMPSTD  131

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             EDL+R+TF YN+++P+M++Y+  +D+GKAMYL FVK E+ TP GL AR VLTSYYKS  F
Sbjct  132   EDLERKTFFYNMLIPVMNKYVDDLDKGKAMYLLFVKPEIRTPSGLMARPVLTSYYKSNSF  191

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
             + R F+ YN  TSPD++ILC D+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+
Sbjct  192   RNRPFNRYNVYTSPDETILCPDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLE  251

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
               W  LC +IR G +S  I D  CR+A+S IL   + +LA+ IE  C   SW+GI+ ++W
Sbjct  252   DYWKELCSNIRIGHVSDWITDPSCRNAVSLILGRANQDLANLIENECGGESWEGIIKKIW  311

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             P+ KYIE ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+N KPL  P+DV++TL
Sbjct  312   PRTKYIEVIVTGSMAQYIPILEFYSGG-LPLVSTMYASSECYFGINFKPLCKPSDVSYTL  370

Query  910   LPNMGYFEFIPLGE-NGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             LPNM YFEF+P+ + NG         G  +++    ++++VDL +V+LG  YELVVTTF+
Sbjct  371   LPNMAYFEFLPVEKSNGELTQEFQCNGISDQDCQHDETEIVDLTNVKLGHCYELVVTTFT  430

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYR+GD+L V GFHN APQF F  R+NV+LSID+DKTN+EDL +++T AK L+EP  
Sbjct  431   GLYRYRVGDILMVTGFHNNAPQFWFVHRKNVILSIDTDKTNEEDLLKAVTEAKLLIEPLG  490

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL EYT+YADT S+PGHYV++WE+   G+   + +D  +++ CC  +EE LD VYRRCR
Sbjct  491   FLLTEYTAYADTCSIPGHYVVFWELKSKGSNNLSELDTDIMEQCCSRVEESLDSVYRRCR  550

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
               D  IGPLEIRVVK GTFD LM   +++GSS+NQYKTPRCIKS   A+ +L+S V  R+
Sbjct  551   KKDNSIGPLEIRVVKDGTFDALMDFSVSQGSSVNQYKTPRCIKS-EEAINLLDSKVVGRF  609

Query  202   FSPRDPAWKP  173
             FS R P+W+P
Sbjct  610   FSKRVPSWEP  619



>ref|XP_008797151.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Phoenix dactylifera]
Length=601

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/549 (59%), Positives = 412/549 (75%), Gaps = 21/549 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VPVI YE ++PYI RIANG+    I+ QPITE+L SSGTSGG+PK+MPS AEDLDR
Sbjct  58    FKKQVPVIDYEQVKPYIERIANGEPSHIISSQPITELLTSSGTSGGQPKMMPSTAEDLDR  117

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TFLYNL++P+M+QY+ G+D+GK MYL FVK E+STP GL AR VLTSYYKS +F+ R F
Sbjct  118   KTFLYNLLIPVMNQYVEGLDQGKGMYLLFVKPEISTPSGLTARPVLTSYYKSSNFRNRPF  177

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + +N  TSPD++ILCSD+ QSMYCQLL GL+ R +VLR+GAVFASAFLRAI FL+ +W  
Sbjct  178   NKFNVYTSPDETILCSDSKQSMYCQLLCGLIQRDEVLRVGAVFASAFLRAIKFLEDHWEE  237

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC +IRTG +   I D+ CR+A+ KIL  P+PELAD IE  CR   W+ I+ RLWP+ KY
Sbjct  238   LCSNIRTGHVGDWITDTSCRNAVGKILDKPNPELADSIELECRKEPWEAIIRRLWPRTKY  297

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TGSM+QY+P L +Y  G LPL+ TMYASSECYFG+NL+PL  P+DV++ LLPNM 
Sbjct  298   VDVIVTGSMAQYIPLLEFYGGG-LPLVSTMYASSECYFGINLRPLDLPSDVSYVLLPNMA  356

Query  895   YFEFIPL-----GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             YFEFI +      E G+   N N            +S++VDL +V +G YYELVVTTF+G
Sbjct  357   YFEFIKVERTDEDETGSIECNGNG-----------ESRVVDLANVEVGSYYELVVTTFTG  405

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYR+GD+L V GFHN AP+F+F  RRNVVLSID+DKTN+EDL ++IT AK LLEP   
Sbjct  406   LYRYRVGDILMVTGFHNTAPRFRFVHRRNVVLSIDTDKTNEEDLLKAITQAKLLLEPLGY  465

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAGAAAID---AQVLQDCCIAIEEQLDYVYRRCRS  380
             LL EYTSYADTSS+PGHYV++WE+   G + +      V+++CC  +E  LD VYRRCRS
Sbjct  466   LLTEYTSYADTSSIPGHYVLFWELKTKGCSDLSNLHQTVMEECCSTVEACLDSVYRRCRS  525

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
              D+ IGPLEIRVV+ G FD LM   +++GSS+NQYKTPRCIKS    + ILE  V  R+F
Sbjct  526   KDRSIGPLEIRVVQCGAFDALMDFCVSQGSSVNQYKTPRCIKSR-EGIGILEERVVRRFF  584

Query  199   SPRDPAWKP  173
             S + P W+P
Sbjct  585   SGKVPLWEP  593



>ref|XP_002303740.2| auxin-responsive GH3 family protein [Populus trichocarpa]
 gb|EEE78719.2| auxin-responsive GH3 family protein [Populus trichocarpa]
Length=594

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/545 (59%), Positives = 404/545 (74%), Gaps = 16/545 (3%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             +FK  VP++ YEDI+P I RIANG+  S I+ QPITE+L SSGTSGG+PK+MPS AE+L+
Sbjct  57    NFKNKVPIVNYEDIKPCIERIANGEPSSIISAQPITELLTSSGTSGGQPKMMPSTAEELE  116

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL+MPIM++Y+ G+D+GK MYL F K E+STP GL AR VLTSYYKS +F+ R+
Sbjct  117   RKTFFYNLLMPIMNKYVDGLDQGKGMYLLFTKPEISTPSGLMARPVLTSYYKSSNFRNRA  176

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ YN  TSPD++ILC D+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+    
Sbjct  177   FNRYNVYTSPDETILCPDSKQSMYCQLLCGLVQREEVLRVGAVFASAFLRAIKFLEEYQK  236

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +IRTG+LS  I D  CR+A+S  L  P+ ELAD IE  C   S +GI+ +LWP+ K
Sbjct  237   ELCSNIRTGRLSDWITDPNCRNAVSSFLSKPNSELADLIEVECSGKSCEGIIKKLWPRTK  296

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIE ++TGSM+QY+P L +YS G LPL+ TMY SSECY G+N KPLS+P+DV++TL+PNM
Sbjct  297   YIEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYGSSECYLGINFKPLSNPSDVSYTLIPNM  355

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
              YFEF+P+ ++   +    K             + VDL  V+LG YYELVVTTF+GLYRY
Sbjct  356   AYFEFLPVDKDNKKVIQAEK-----------DVEAVDLEDVKLGHYYELVVTTFTGLYRY  404

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GD+L V GF+N APQF+F  RRNVVLSID+DKTN+EDL +++T AK LLEP   LL E
Sbjct  405   RVGDILMVTGFYNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTQAKVLLEPLGFLLTE  464

Query  538   YTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             YTS+ADTSS+PGHYV++WE+   G      +D   ++ CC  +EE LD +YRRCR  DK 
Sbjct  465   YTSFADTSSIPGHYVLFWELKTQGTNDLPELDPITMEKCCSTVEESLDSIYRRCRKKDKS  524

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             IGPLEIRVV  GTFD LM   +++GSS+NQYKT RCIKS   A KIL S V  R+FS + 
Sbjct  525   IGPLEIRVVTHGTFDALMDFCVSQGSSVNQYKTTRCIKS-EEAFKILHSRVVGRFFSKKT  583

Query  187   PAWKP  173
             P W+P
Sbjct  584   PFWEP  588



>ref|XP_011036210.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Populus euphratica]
Length=607

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/556 (57%), Positives = 413/556 (74%), Gaps = 25/556 (4%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             +FK  VP++ YEDI+P I RIA+G+  S I+ QPITE+L SSGTSGG+PK+MPS AE+L+
Sbjct  57    NFKNKVPIVNYEDIKPCIERIASGEPSSIISAQPITELLTSSGTSGGQPKMMPSTAEELE  116

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+T  YNL++P+M++Y+ G+D+GKAMYL F+K E+STP GL AR VLTSYYKS +F+ R+
Sbjct  117   RKTLFYNLLVPVMNKYVDGLDQGKAMYLLFIKPEISTPSGLMARPVLTSYYKSNNFRNRA  176

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ YN  TSPD++ILCSD+ QSMYCQLL GLV R +VLR+GA+FASAFLRAI FL+    
Sbjct  177   FNRYNVYTSPDETILCSDSKQSMYCQLLCGLVQRDEVLRVGAIFASAFLRAIKFLEEYLK  236

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
               C +IRTG +S  I D  CR A+  IL  P+ ELAD IE+ C   SW+GI+ +LWP+ K
Sbjct  237   EFCSNIRTGSVSDWITDPNCRKAVLSILSKPNSELADLIEDECSGKSWEGIIKKLWPRTK  296

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIE ++TGSM+QY+P L +YS G LPL+ TMY SSECY G+N KPLS+P+DV++TLLPNM
Sbjct  297   YIEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYGSSECYLGINFKPLSNPSDVSYTLLPNM  355

Query  898   GYFEFIPLGE-----------NGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYEL  752
              +FEF+P+             NG  +++ N +          + + VDLV V+LG YYEL
Sbjct  356   AFFEFLPVDNNHKEVVPDVQCNGVSVTDRNGKE---------KVEAVDLVDVKLGHYYEL  406

Query  751   VVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKK  572
             +VTTF+GLYRYR+GD+L V GF+N APQF+F  RRNVVLSID+DKTN+EDL +++T AK 
Sbjct  407   IVTTFTGLYRYRVGDILMVTGFYNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTQAKF  466

Query  571   LLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDY  401
             LLEP   LL EYTS+ADT+S+PGHYV++WE+   G      +D  +++ CC  +EE LD 
Sbjct  467   LLEPLGFLLTEYTSFADTASIPGHYVLFWELKMRGTNDLPELDPVIMEQCCSIVEESLDS  526

Query  400   VYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILES  221
             VYRRCR  DK IGPLE+RVV  GTFD LM   +++GSS+NQYKTPRCIKS   ALKIL+S
Sbjct  527   VYRRCRKKDKSIGPLEVRVVTHGTFDALMDFCVSQGSSVNQYKTPRCIKS-EEALKILDS  585

Query  220   NVRARYFSPRDPAWKP  173
              V  R+ S + P W+P
Sbjct  586   RVVGRFSSNKTPFWEP  601



>ref|XP_009380137.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17 [Musa 
acuminata subsp. malaccensis]
Length=604

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/549 (59%), Positives = 414/549 (75%), Gaps = 20/549 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VPV+ Y+ ++PYI R+ANG+    I+ QPI+E+L SSGTSGG+PK+MPS  E+LDR
Sbjct  59    FKKKVPVVEYDQVKPYIDRLANGEPSQIISAQPISELLTSSGTSGGQPKMMPSTDEELDR  118

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TFLYNL++P+M+QY+ G+D+GK MYL F+K E+STP GL AR VLTSYYKS+HF+ R F
Sbjct  119   KTFLYNLLIPVMNQYVDGLDQGKGMYLLFIKPEISTPAGLTARPVLTSYYKSRHFRSRPF  178

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + +N  TSPD++ILC D+ QSM+CQLL GL  R +VLR+GAVFASAFLRAI FL+ +WP 
Sbjct  179   NRFNVYTSPDEAILCPDSKQSMFCQLLCGLAQRDEVLRVGAVFASAFLRAIKFLEDHWPE  238

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC +IRTG +S  I D+ CR A+ +IL  P+ ELAD IE  CR   W+ IV RLWP+ KY
Sbjct  239   LCSNIRTGTVSDWITDASCRDAVGRILREPNAELADVIEWECRREPWEAIVRRLWPRTKY  298

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL+PL  P+DV++TLLPNM 
Sbjct  299   VDVIVTGSMAQYIPLLEFYSGG-LPLVSTMYASSECYFGINLRPLDLPSDVSYTLLPNMA  357

Query  895   YFEFIPL-----GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             YFEFI       GE G+   N   +            K+VDLV V +G YYELVVTTF+G
Sbjct  358   YFEFIEADKTEGGETGSVECNYTGDLI----------KVVDLVDVEVGRYYELVVTTFTG  407

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYR+GD+L+V GFHN APQF+F  RRNVVLS+D+DKTN+EDL +++T AK LLEP   
Sbjct  408   LYRYRVGDILKVTGFHNAAPQFRFVHRRNVVLSVDTDKTNEEDLLKAVTQAKLLLEPLGC  467

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             LL EYTSYADTSS+PGHYV++WE+    +   + +D+ V++DCC  IE  LD VYRRCRS
Sbjct  468   LLTEYTSYADTSSIPGHYVLFWELKTKASSDPSDVDSAVMEDCCSTIESCLDSVYRRCRS  527

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
              D+ IGPLEIRVV+ G FD LM   ++ GSS+NQYKTPRCIKS   A+++LE  V  ++F
Sbjct  528   RDRSIGPLEIRVVRCGAFDALMDYCVSLGSSVNQYKTPRCIKSR-EAIQLLEEKVVGKFF  586

Query  199   SPRDPAWKP  173
             S + P WKP
Sbjct  587   SRKLPFWKP  595



>ref|XP_009113698.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Brassica rapa]
 emb|CDY46626.1| BnaA09g27530D [Brassica napus]
Length=609

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/550 (57%), Positives = 419/550 (76%), Gaps = 14/550 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RIA+G+    ++ QPITE+L SSGTS G+PKLMPS AE+L+R
Sbjct  60    FKNKVPVVNYDDIKPFIQRIADGESSDIVSSQPITELLTSSGTSAGKPKLMPSTAEELER  119

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +T  Y++++P+M++Y+ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+HF+ R F
Sbjct  120   KTIFYSMLVPVMNKYVNGLDEGKGMYLLFIKPEIKTPSGLMARPVLTSYYKSQHFRNRPF  179

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+GAVFASAFLRA+ FL+ ++  
Sbjct  180   NKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKE  239

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I +  CR ++  +L  P+ ELADEIE  C   SW+GI+ RLWPKAKY
Sbjct  240   LCADIRTGTVTSWITEPACRDSVLSVLQGPNQELADEIESECAEKSWEGILRRLWPKAKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL PL DP+DV++TLLPNM 
Sbjct  300   VEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYASSECYFGINLNPLCDPSDVSYTLLPNMA  358

Query  895   YFEFIPLG----ENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGL  728
             YFEF+P+     E   F S+ N    +++++++ +  +VDLV+V +G YYE+V+TTF+GL
Sbjct  359   YFEFLPVDDKSHEEIHFASHSN---TDDDDDALKEDLIVDLVNVEVGRYYEIVITTFTGL  415

Query  727   YRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK--KLLEPHQ  554
             YRYR+GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++ DL  ++T AK   L +P  
Sbjct  416   YRYRVGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEGDLLNAVTQAKLNHLQKPSC  475

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL EYTSYADTSS+PGHYV++WE+    +     ++ + ++ CC  +E+ LDYVYRRCR
Sbjct  476   PLLTEYTSYADTSSIPGHYVLFWELKPRHNNEPPELENKTMELCCSEVEDYLDYVYRRCR  535

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
             + DK IGPLEIRVV  GTFDLLM   +++GSS+NQYKTPRC+K    AL+IL+S V  R+
Sbjct  536   NKDKSIGPLEIRVVSLGTFDLLMDFCVSQGSSVNQYKTPRCVKP-GGALEILDSRVIGRF  594

Query  202   FSPRDPAWKP  173
             FS R P W+P
Sbjct  595   FSQRVPQWQP  604



>ref|XP_010249302.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17 [Nelumbo 
nucifera]
 ref|XP_010249303.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17 [Nelumbo 
nucifera]
 ref|XP_010249304.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17 [Nelumbo 
nucifera]
Length=615

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/556 (59%), Positives = 422/556 (76%), Gaps = 19/556 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +P++ YEDI+PYI  IANG+    I+ QPITE+L SSGTSGG PK+MPS AED+DR
Sbjct  58    FKKKIPIVVYEDIKPYIEHIANGEASQIISAQPITELLTSSGTSGGLPKMMPSTAEDMDR  117

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TFLYNL++P+M+QY+ G+D+GK MYL F+K E+STP GL AR VLTSYYKS +F+ R F
Sbjct  118   KTFLYNLLVPVMNQYVDGLDQGKGMYLLFIKPEISTPAGLMARPVLTSYYKSSNFRNRPF  177

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + +N  TSPD++ILCSD+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+  W  
Sbjct  178   NRFNVYTSPDETILCSDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDYWQE  237

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             +C +IR G +S  I D  C++A+S IL  P+ ELA  IE  C   SW+ I+ RLWP+ KY
Sbjct  238   MCSNIRMGHVSDWITDPGCQNAVSGILRHPNSELAHLIESECNGKSWEEIIRRLWPRTKY  297

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NLKPLSDP+ V++TLLPNM 
Sbjct  298   VDVIVTGSMAQYIPTLDFYSGG-LPLVSTMYASSECYFGINLKPLSDPSSVSYTLLPNMA  356

Query  895   YFEFIPLGENGTFLSN------------LNKegeeeeeESIPQSKLVDLVHVRLGCYYEL  752
             YFEF+P+ +N   L++            LNKEG+EE EE   ++  VDLV V++G YYEL
Sbjct  357   YFEFLPVEKNHEELNHGVRCNGDSEPNCLNKEGQEEGEEQEQEA--VDLVQVKVGHYYEL  414

Query  751   VVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKK  572
             VVTTF+GLYRYR+GD+L V GFHN APQF+F  RRNVVLSID+DKTN+EDL +++T AK 
Sbjct  415   VVTTFTGLYRYRVGDILMVTGFHNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTKAKL  474

Query  571   LLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGAA---AIDAQVLQDCCIAIEEQLDY  401
             LLEP   LL EYTSYADT S+PGHYV++WE+   G      ++ +++++CC  +E+ LD 
Sbjct  475   LLEPLGFLLTEYTSYADTCSIPGHYVLFWELKMRGNGDLPELETRIMEECCSTVEQSLDS  534

Query  400   VYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILES  221
             VYRRCRS DK IGPLEIRVVK GTFD LM   +++GSS+NQYKTPRCIKS   AL IL+S
Sbjct  535   VYRRCRSKDKSIGPLEIRVVKHGTFDALMDFCVSQGSSVNQYKTPRCIKS-EKALNILDS  593

Query  220   NVRARYFSPRDPAWKP  173
                  +FS + P W+P
Sbjct  594   RAVGIFFSRKTPHWEP  609



>ref|XP_011020911.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Populus euphratica]
Length=612

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/557 (58%), Positives = 414/557 (74%), Gaps = 12/557 (2%)
 Frame = -1

Query  1813  EDLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSI  1634
             + +  +FK  VP++ YEDI+P I RIANG+  S I+ QPITE+L SSGTSGG+PK+MPS 
Sbjct  52    DSIKENFKNKVPIVNYEDIKPCIERIANGEPSSIISAQPITELLTSSGTSGGQPKMMPST  111

Query  1633  AEDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKH  1454
              E+L+R+TF YNL++PIM++Y+ G+D+GK MYL F K E+STP GL AR VLTSYYKS +
Sbjct  112   TEELERKTFFYNLLVPIMNKYVDGLDQGKGMYLLFTKPEISTPSGLMARPVLTSYYKSSN  171

Query  1453  FKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFL  1274
             F+ R+F+ YN  TSPD++ILC D+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL
Sbjct  172   FRNRAFNRYNVYTSPDETILCPDSKQSMYCQLLCGLVQREEVLRVGAVFASAFLRAIKFL  231

Query  1273  QHNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRL  1094
             +     LC +IRTG+LS  I D  CR+A+S  L  P+ ELAD IE  C   S KGI+ +L
Sbjct  232   EEYRKELCFNIRTGRLSDWITDPNCRNAVSSFLSKPNSELADLIEIECSGKSCKGIIKKL  291

Query  1093  WPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFT  914
             WP+ KYIE ++TGSM+QY+P L +YS G LPL+ TMY SSECY G+N KPLS+P DV++T
Sbjct  292   WPRTKYIEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYGSSECYLGINFKPLSNPYDVSYT  350

Query  913   LLPNMGYFEFIPLG-ENGTFLSNL------NKegeeeeeESIPQSKLVDLVHVRLGCYYE  755
             L+PNM YFEF+P+  +N   + ++      +  G++EE+      + VDLV V+LG YYE
Sbjct  351   LIPNMAYFEFLPVDKDNKKVIQDVQCNGATDHNGKQEEDGKEKDVEAVDLVDVKLGHYYE  410

Query  754   LVVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAK  575
             LVVTTF+GLYRYR+GD+L V GF+N APQF+F  RRNVVLSID+DKTN+EDL +++T AK
Sbjct  411   LVVTTFTGLYRYRVGDILMVTGFYNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTQAK  470

Query  574   KLLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLD  404
              LLEP   LL EYTS+AD SS+PGHYV++WE+   G      +D   ++ CC  +EE LD
Sbjct  471   VLLEPLGFLLTEYTSFADASSIPGHYVLFWELKTQGTNDLQELDPITMEQCCSTVEESLD  530

Query  403   YVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILE  224
              +YRRCR  DK IGPLEIRVV  GTFD LM   +++GSS+NQYKTPRCIKS   A KIL+
Sbjct  531   SIYRRCRKKDKSIGPLEIRVVTQGTFDALMDFCVSQGSSVNQYKTPRCIKS-EEAFKILD  589

Query  223   SNVRARYFSPRDPAWKP  173
             S V  R+FS + P W+P
Sbjct  590   SRVVGRFFSKKIPFWEP  606



>ref|NP_200262.1| indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana]
 sp|Q9LSQ4.1|GH36_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.6; AltName: 
Full=Auxin-responsive GH3-like protein 6; Short=AtGH3-6; 
AltName: Full=Protein DWARF IN LIGHT 1; Short=DFL-1 [Arabidopsis 
thaliana]
 dbj|BAA97524.1| auxin-responsive-like protein [Arabidopsis thaliana]
 dbj|BAB17304.1| auxin-responsive GH3 homologue [Arabidopsis thaliana]
 gb|AAX12878.1| At5g54510 [Arabidopsis thaliana]
 gb|ACI46505.1| At5g54510 [Arabidopsis thaliana]
 gb|AED96504.1| indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana]
Length=612

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/541 (59%), Positives = 403/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHIMPVVTYEDIQPEINRIANGDKSQVLCSNPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+MDQ++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMDQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILCSD+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I DS  R A+ +I L PDP+LAD +E  CR  SW+GI+ RLWP  KY
Sbjct  250   LARDIRTGTLSSEITDSSVREAVGEI-LKPDPKLADFVESECRKTSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+PNM 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLSVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKMVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWS  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_008390224.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Malus domestica]
Length=611

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/547 (59%), Positives = 412/547 (75%), Gaps = 7/547 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             DFK+ VPV+ YED++PYI RIANG+    I+ Q ITE+L SSGTSGG+PK+MPS  EDLD
Sbjct  61    DFKKKVPVVNYEDVKPYIERIANGEPSEIISAQKITELLTSSGTSGGQPKMMPSTVEDLD  120

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL++P+M++Y+ G+D+GK MYL F+K E+STP G+ AR VLTSYYKS +F+ R 
Sbjct  121   RKTFFYNLLVPVMNKYVDGLDQGKGMYLLFIKPEISTPSGMVARPVLTSYYKSSNFRNRP  180

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ +N  TSPD +ILCSD+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+ +W 
Sbjct  181   FNRFNIYTSPDATILCSDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDHWE  240

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +I +G +S  I DS CR A+S +L  P+PELAD I       S +GIV RLWP+ K
Sbjct  241   ELCSNIGSGLVSDWITDSSCRXAVSLVLSKPNPELADLIRHEFSNKSLEGIVKRLWPRTK  300

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIE ++TGSM+QY+P L +YS G LPLI TMYASSECYFG+N  PLS P DVA+TLLPNM
Sbjct  301   YIEVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECYFGINFNPLSKPHDVAYTLLPNM  359

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKL--VDLVHVRLGCYYELVVTTFSGLY  725
              YFEF+P+ +    +++      +E  ++  +  L  VDL+ V+LG YYELVVTTF+GLY
Sbjct  360   AYFEFLPVEKRHEEVASREGVSGQECPKADEEETLETVDLMDVKLGHYYELVVTTFTGLY  419

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L V GFHNKAPQF+F  RRNVVLSID+DKTN+EDL  ++T AK LLEP   LL
Sbjct  420   RYRVGDILMVTGFHNKAPQFRFMHRRNVVLSIDTDKTNEEDLLNAVTQAKLLLEPLGFLL  479

Query  544   VEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSYADTSS+PGHYV++WE+    +     ++  +++ CC  +E+ LD VYRRCR  D
Sbjct  480   IEYTSYADTSSIPGHYVLFWELKTKENNDMIELETSIMEQCCSTVEQSLDSVYRRCRRKD  539

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
               IGPLEIR+VK GTFD LM   +++GSS+NQYKTPRCI+S   A++IL+S V  R+FS 
Sbjct  540   NSIGPLEIRIVKQGTFDALMDFSVSQGSSVNQYKTPRCIQS-EEAIRILDSRVVGRFFSK  598

Query  193   RDPAWKP  173
               P W+P
Sbjct  599   STPLWEP  605



>ref|XP_010540435.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
isoform X3 [Tarenaya hassleriana]
Length=606

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/544 (58%), Positives = 410/544 (75%), Gaps = 17/544 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RI+ G     I+ QPITE+L SSGTS G+PKLMPS A++LDR
Sbjct  71    FKNKVPVVNYDDIKPFIERISGGASSDIISSQPITELLTSSGTSAGKPKLMPSTAQELDR  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YN+++P+M++Y+ G+D+GK MYL F+K E+ TP GL AR VLTSYYKS++F+ R +
Sbjct  131   KTFFYNMLVPVMNKYVEGLDDGKGMYLLFIKPEIKTPSGLMARPVLTSYYKSQNFRNRLY  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPD++ILC D+ QSM+CQLL GL+ R+ VLR+GAVFASAFLRAI FL+ ++  
Sbjct  191   NKYNVYTSPDETILCLDSKQSMFCQLLCGLIQRKDVLRVGAVFASAFLRAIKFLEDHFKE  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC +IRTG +S  I DS CR+A+  IL  P+P LADEIE+ C   SW+GIV RLWP+AKY
Sbjct  251   LCSNIRTGDVSEWITDSRCRNAVLSILKLPNPNLADEIEQDCAEKSWEGIVKRLWPRAKY  310

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             +E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+N+ P+  P DV++TLLPNM 
Sbjct  311   VEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYASSECYFGININPMCKPCDVSYTLLPNMA  369

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ ++       N               +VDLV V++G YYELV+TTF+GLYRYR
Sbjct  370   YFEFLPVLDDKDDNDPRN------------DDMIVDLVDVQIGRYYELVITTFTGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL V GFHNKAPQF F  RRNVVLSID+DKT++EDL +++T +++LL+    LL+EY
Sbjct  418   VGDVLVVTGFHNKAPQFGFVQRRNVVLSIDTDKTSEEDLLKAVTKSRQLLQTSNLLLMEY  477

Query  535   TSYADTSSVPGHYVIYWEIMHAGAA---AIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
             TS  DTSS+PGHYVI+WE+          + A  +++CC  +EE LDYVYRRCRS DK I
Sbjct  478   TSCTDTSSIPGHYVIFWELNPRNKTDPFELSASTMEECCSQVEECLDYVYRRCRSRDKSI  537

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIRVV+ GTFD LM   ++ GSS+NQYKTPRC+KS   A++IL+S V  R+FSPR P
Sbjct  538   GPLEIRVVRMGTFDELMDFCVSMGSSLNQYKTPRCVKSQ-GAIQILDSRVIGRFFSPRAP  596

Query  184   AWKP  173
              W+P
Sbjct  597   KWEP  600



>gb|AFG33002.1| GH3 family protein [Malus sieversii]
Length=607

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/547 (59%), Positives = 412/547 (75%), Gaps = 7/547 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             DFK  VPV+ YED++PYI RIANG+    I+ Q ITE+L SSGTSGG+PK+MPS  EDLD
Sbjct  57    DFKNKVPVVNYEDVKPYIERIANGETSEIISAQKITELLTSSGTSGGQPKMMPSTVEDLD  116

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL++P+M++Y+ G+D+GK MYL F+K E+STP GL AR VLTSYYKS +F+ R 
Sbjct  117   RKTFFYNLLVPVMNKYVDGLDQGKGMYLLFIKPEISTPSGLVARPVLTSYYKSSNFRNRP  176

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ +N  TSPD++ILCSD+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+ +W 
Sbjct  177   FNRFNIYTSPDETILCSDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDHWE  236

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +I +G +S  I DS CR+A+S +L  P+P+L D I       S +GIV RLWP+ K
Sbjct  237   ELCSNISSGIVSAWITDSSCRNAVSLVLSKPNPDLGDLIRHEFSNKSMEGIVKRLWPRTK  296

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YI+ ++TGSM+QY+P L +YS G LPLI TMYASSECYFG+N  PLS P DVA+TLLPNM
Sbjct  297   YIDVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECYFGINFNPLSKPHDVAYTLLPNM  355

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKL--VDLVHVRLGCYYELVVTTFSGLY  725
              YFEF+P+ ++   ++  N    ++   +  +  L  VDLV V+LG YYELVVTTF+GLY
Sbjct  356   AYFEFLPVEKHHEEVAPCNGVSGQDCANADEEENLRTVDLVDVKLGHYYELVVTTFTGLY  415

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L V GFHNKAPQF+F  RRNVVLSID+DKTN+EDL  ++T AK LLEP   LL
Sbjct  416   RYRVGDILMVTGFHNKAPQFRFMHRRNVVLSIDTDKTNEEDLLNAVTQAKLLLEPLGFLL  475

Query  544   VEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSYADTSS+PGHYV++WE+    +     ++  +++ CC  +E+ LD VYRRCR  D
Sbjct  476   IEYTSYADTSSIPGHYVLFWELKTKENNDTIELETIIMEQCCSTVEQSLDSVYRRCRRKD  535

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
               IGPLEIR+V+ GTFD LM   +++GSS+NQYKTPRCI+S   A++IL+S V  R+FS 
Sbjct  536   NSIGPLEIRIVQHGTFDALMDFSVSQGSSVNQYKTPRCIQS-EEAIRILDSRVVGRFFSK  594

Query  193   RDPAWKP  173
               P W+P
Sbjct  595   STPLWEP  601



>gb|AAL47444.1| AT5g54510/F24B18_13 [Arabidopsis thaliana]
Length=612

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/539 (59%), Positives = 402/539 (75%), Gaps = 6/539 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHIMPVVTYEDIQPEINRIANGDKSQVLCSNPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+MDQ++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMDQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILCSD+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I DS  R A+ +I L PDP+LAD +E  CR  SW+GI+ RLWP  KY
Sbjct  250   LARDIRTGTLSSEITDSSVREAVGEI-LKPDPKLADFVESECRKTSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+PNM 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLSVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W
Sbjct  545   EIKMVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKW  602



>ref|XP_008355612.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Malus domestica]
Length=611

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/547 (59%), Positives = 412/547 (75%), Gaps = 7/547 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             DFK  VPV+ YED++PYI RIANG+    I+ Q ITE+L SSGTSGG+PK+MPS  EDLD
Sbjct  61    DFKNKVPVVNYEDVKPYIERIANGETSEIISAQKITELLTSSGTSGGQPKMMPSTVEDLD  120

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL++P+M++Y+ G+D+GK MYL F+K E+STP GL AR VLTSYYKS +F+ R 
Sbjct  121   RKTFFYNLLVPVMNKYVDGLDQGKGMYLLFIKPEISTPSGLVARPVLTSYYKSSNFRNRP  180

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ +N  TSPD++ILCSD+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+ +W 
Sbjct  181   FNRFNIYTSPDETILCSDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDHWE  240

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +I +G +S  I DS CR+A+S +L  P+P+L D I       S +GIV RLWP+ K
Sbjct  241   ELCSNISSGIVSAWITDSSCRNAVSLVLSKPNPDLGDLIRHEFSNKSMEGIVKRLWPRTK  300

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YI+ ++TGSM+QY+P L +YS G LPLI TMYASSECYFG+N  PLS P DVA+TLLPNM
Sbjct  301   YIDVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECYFGINFNPLSKPHDVAYTLLPNM  359

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKL--VDLVHVRLGCYYELVVTTFSGLY  725
              YFEF+P+ ++   ++  N    ++   +  +  L  VDLV V+LG YYELVVTTF+GLY
Sbjct  360   AYFEFLPVEKHHEEVAPCNGVSGQDCANADEEENLRTVDLVDVKLGHYYELVVTTFTGLY  419

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L V GFHNKAPQF+F  RRNVVLSID+DKTN+EDL  ++T AK LLEP   LL
Sbjct  420   RYRVGDILMVTGFHNKAPQFRFMHRRNVVLSIDTDKTNEEDLLNAVTQAKLLLEPLGFLL  479

Query  544   VEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSYADTSS+PGHYV++WE+    +     ++  +++ CC  +E+ LD VYRRCR  D
Sbjct  480   IEYTSYADTSSIPGHYVLFWELKTKENNDTIELETIIMEQCCSTVEQSLDSVYRRCRRKD  539

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
               IGPLEIR+V+ GTFD LM   +++GSS+NQYKTPRCI+S   A++IL+S V  R+FS 
Sbjct  540   NSIGPLEIRIVQHGTFDALMDFSVSQGSSVNQYKTPRCIQS-EEAIRILDSRVVGRFFSK  598

Query  193   RDPAWKP  173
               P W+P
Sbjct  599   STPLWEP  605



>ref|XP_009122951.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Brassica rapa]
Length=606

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/549 (56%), Positives = 413/549 (75%), Gaps = 6/549 (1%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             ++  +FK   PV+ YEDI+P+I RI++GD    ++ QPITE+L SSGTSGG+PK MPS A
Sbjct  56    NIQENFKNKAPVVNYEDIKPFIQRISDGDSSDILSAQPITELLTSSGTSGGKPKFMPSTA  115

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             E+LDR+TF YN+++P+M++++ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+ F
Sbjct  116   EELDRKTFFYNMLVPVMNKFVNGLDEGKGMYLLFIKPEIKTPSGLQARPVLTSYYKSEQF  175

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
             K R F+ YN +TSP+ +ILC D+ QSMYCQLL GLV R  VLRLGA+FASAFLRA+ FL+
Sbjct  176   KNRPFNKYNVITSPNDAILCEDSQQSMYCQLLCGLVQRSDVLRLGAIFASAFLRAVKFLE  235

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
             +++  LC DIRTG ++  I DS CR ++  IL  P+ ELADEIE +  A S +GI+ R+W
Sbjct  236   NHFTELCADIRTGTVASWITDSGCRDSVLSILNGPNQELADEIEALFNAKSREGILKRIW  295

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             PK KYIE ++TGSM+QY+P L +YS G LPL+  MYASSEC+FG+N+ PL  P+DV++TL
Sbjct  296   PKTKYIEVIVTGSMAQYIPTLEFYS-GGLPLVSVMYASSECFFGLNINPLCKPSDVSYTL  354

Query  910   LPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             LPNM YFEF+P+ +     ++L     ++   +  + ++VDLV V +G YYEL++TTF+G
Sbjct  355   LPNMAYFEFLPVDDKSHEETHLESRSTDDVSLT-DKDRIVDLVSVEIGRYYELIITTFAG  413

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYR+GD+L+V GFHNKAPQF F  RRNVVLSID+DKT++EDL +++T AK        
Sbjct  414   LYRYRVGDILKVTGFHNKAPQFSFVERRNVVLSIDTDKTSEEDLMKAVTQAKLNHLQGLF  473

Query  550   LLVEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             LL EYTSYADTSS+PGHYV++WE+          +D ++++DCC  +E+ LDYVYRRCR+
Sbjct  474   LLTEYTSYADTSSIPGHYVLFWELKPRYDNDPPKLDKKMMEDCCSEVEDCLDYVYRRCRN  533

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
              D+ IG LEIRVV  GTFD LM   I++GSS+NQYKTPRC+KS   AL+IL+S V  R+F
Sbjct  534   KDRSIGALEIRVVSLGTFDALMDFSISQGSSVNQYKTPRCVKS-GGALQILDSRVIGRFF  592

Query  199   SPRDPAWKP  173
             + R P W+P
Sbjct  593   TKRVPQWEP  601



>emb|CAN78161.1| hypothetical protein VITISV_040921 [Vitis vinifera]
Length=676

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/560 (58%), Positives = 415/560 (74%), Gaps = 28/560 (5%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VP++ YEDI+P+I RIANG+    I+ QPITE+L SSGTSGG+PKLMPS AEDLDR
Sbjct  62    FKKKVPIVNYEDIKPHIERIANGEPSRIISAQPITELLTSSGTSGGQPKLMPSTAEDLDR  121

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YNL++P+M++Y+ G+D+GK MYL F+K E+STP GL AR VLTSYYKS +F+ R F
Sbjct  122   KTFFYNLLIPVMNKYVDGLDQGKGMYLLFIKPEISTPSGLMARPVLTSYYKSSNFRNRPF  181

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             +P+N  TSPD++ILC D+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+ +W  
Sbjct  182   NPFNVYTSPDETILCLDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDHWRE  241

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC +IRTG +S  I D  CR+A+S  L  P P+LAD IE  C   SW+GI+ +LWP+ KY
Sbjct  242   LCSNIRTGCVSDWITDPSCRNAVSSFLSKPQPDLADFIEFECNGESWEGIIKKLWPRTKY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TGSM+QY+P L +YS G LPL+ TMYASSECY+G+NLKPLS P+DV++TLLPNM 
Sbjct  302   IEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYASSECYYGINLKPLSKPSDVSYTLLPNMA  360

Query  895   YFEFIPLGENG---TFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG--  731
             YFEF+ + +N    T     N    ++E E + + ++V LV V++G YYELVVTTF+G  
Sbjct  361   YFEFLHVQKNNGEVTQQVQCNGGCIKKEGERV-EIEVVGLVDVKVGHYYELVVTTFTGEF  419

Query  730   -----------------LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDED  602
                              LYRYR GD+L V GF+N APQF+F  RRNVVLSID+DKTN+ED
Sbjct  420   FLLRSVSHASFMSCSSWLYRYRTGDILMVTGFYNNAPQFRFVQRRNVVLSIDTDKTNEED  479

Query  601   LHRSITAAKKLLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGAAAI---DAQVLQDC  431
             L +++T AK LLEP+  LL EYTSYADTSS+PGHYV++WE+   G   +   D  +++ C
Sbjct  480   LLKAVTQAKLLLEPYGFLLTEYTSYADTSSIPGHYVLFWELKTRGNNDLSEPDHTIMEQC  539

Query  430   CIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKS  251
             C  +EE LD VYRRCR  D  IGPLEIR+VKPGTFD LM   +++GSS+NQYKTPRCIKS
Sbjct  540   CSTVEESLDSVYRRCRRRDNSIGPLEIRIVKPGTFDALMDFCVSQGSSVNQYKTPRCIKS  599

Query  250   NSSALKILESNVRARYFSPR  191
                A+KIL+S V  + FS +
Sbjct  600   K-EAIKILDSRVVGKVFSKK  618



>ref|XP_006280192.1| hypothetical protein CARUB_v10026098mg [Capsella rubella]
 gb|EOA13090.1| hypothetical protein CARUB_v10026098mg [Capsella rubella]
Length=613

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 401/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  71    FKHVVPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDR  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  131   RSLLYSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPF  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  191   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A+ +I L PDP+LAD +E  CR  SW+GI+ R+WP  KY
Sbjct  251   LARDIRTGTLSSEITDLSVREAVGEI-LKPDPKLADFVESECRKTSWQGIITRIWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+PNM 
Sbjct  310   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  369   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL VAGF N +PQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  426   VGDVLSVAGFKNNSPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  486   TSYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  546   EIKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVNSYFSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>ref|XP_009359857.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Pyrus x bretschneideri]
Length=611

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/547 (59%), Positives = 411/547 (75%), Gaps = 7/547 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             DFK  VPV+ YED++PYI RIANG+    I+ Q ITE+L SSGTSGG+PK+MPS  EDLD
Sbjct  61    DFKNKVPVVNYEDVKPYIERIANGETSEIISAQKITELLTSSGTSGGQPKMMPSTVEDLD  120

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             R+TF YNL++P+M++Y+ G+D+GK MYL F+K E+STP GL AR VL+SYYKS +F+ R 
Sbjct  121   RKTFFYNLLVPVMNKYVDGLDQGKGMYLLFIKPEISTPSGLVARPVLSSYYKSSNFRNRP  180

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             F+ +N  TSPD++ILCSD+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+  W 
Sbjct  181   FNRFNIYTSPDETILCSDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDYWE  240

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC +I +G +S  I DS CR+A+S +L  P+P+LAD I       S +GIV RLWP+ K
Sbjct  241   ELCSNISSGIVSAWITDSSCRNAVSLVLGKPNPDLADLIRHEFSNKSMEGIVKRLWPRTK  300

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YIE ++TGSM+QY+P L +YS G LPLI TMYASSECYFG+N  PLS P DVA+TLLPNM
Sbjct  301   YIEVIVTGSMAQYIPTLEFYSGG-LPLISTMYASSECYFGINFNPLSKPHDVAYTLLPNM  359

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKL--VDLVHVRLGCYYELVVTTFSGLY  725
              YFEF+P+ ++   ++  N    ++   +  +  L  VDLV V+LG  YELVVTTF+GLY
Sbjct  360   AYFEFLPVEKHHEEVAPCNSVSGQDCANADEEENLGTVDLVDVKLGHCYELVVTTFTGLY  419

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L V GFHNKAPQF+F  RRNVVLSID+DKTN+EDL  ++T AK LLEP   LL
Sbjct  420   RYRVGDILMVTGFHNKAPQFRFMHRRNVVLSIDTDKTNEEDLLNAVTQAKLLLEPLGFLL  479

Query  544   VEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             +EYTSYADTSS+PGHYV++WE+    +     ++  +++ CC  +E+ LD VYRRCR  D
Sbjct  480   IEYTSYADTSSIPGHYVLFWELKTKENNDTIEMETIIMEQCCSTVEQSLDSVYRRCRRKD  539

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
               IGPLEIR+V+ GTFD LM   +++GSS+NQYKTPRCI+S   A++IL+S V  R+FS 
Sbjct  540   NSIGPLEIRIVQHGTFDALMDFSVSQGSSVNQYKTPRCIQS-EEAIRILDSRVVGRFFSK  598

Query  193   RDPAWKP  173
               P W+P
Sbjct  599   STPLWEP  605



>gb|KFK27060.1| hypothetical protein AALP_AA8G329100 [Arabis alpina]
Length=612

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/541 (58%), Positives = 403/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHVLPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+MDQ++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMDQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKKRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L LDIRTG L+  I D   R A+ +I L PDP+LAD +E  CR +SW+GI+ RLWP  KY
Sbjct  250   LALDIRTGTLNSEITDPSVREAVGEI-LKPDPKLADFVESECRKSSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NV LSID+DKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVAGFKNNAPQFSFICRKNVALSIDADKTDEVELQNAVKNAVTHLVPFDATLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G  AI   V +DCC+ IEE L+ VYR+ R  D+ IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCMNGNTAIPPSVFEDCCLTIEESLNSVYRQGRVSDRSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L + V   YFSP+ P W 
Sbjct  545   EIKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNTRVVDSYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>emb|CDY22728.1| BnaA08g05580D [Brassica napus]
Length=594

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/549 (56%), Positives = 407/549 (74%), Gaps = 17/549 (3%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             ++  +FK   PV+ YEDI+P+I RI++GD    ++ QPITE+L SSGTSGG+PK MPS A
Sbjct  55    NIQENFKNKAPVVNYEDIKPFIQRISDGDSSDILSAQPITELLTSSGTSGGKPKFMPSTA  114

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             E+LDR+TF YN+++P+M++++ G+DEGK MYL F+K E+ TP GL AR VLTSYYKS+ F
Sbjct  115   EELDRKTFFYNMLVPVMNKFVNGLDEGKGMYLLFIKPEIKTPAGLQARPVLTSYYKSEQF  174

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
             K R F+ YN +TSP+ +ILC D+ QSMYCQLL GLV R  VLRLGA+FASAFLRA+ FL+
Sbjct  175   KNRPFNKYNVITSPNDAILCEDSQQSMYCQLLCGLVQRSHVLRLGAIFASAFLRAVKFLE  234

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
             +++  LC DIRTG ++  I DS CR +   IL  P+ ELADEIE +  A S +GI+ R+W
Sbjct  235   NHFTELCADIRTGTVASWITDSGCRDSALSILNGPNQELADEIEALFNAKSREGILKRIW  294

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             PK KYIE ++TGSM+QY+P L +YS G LPL+  MYASSEC+FG+N+ PL  P+DV++TL
Sbjct  295   PKTKYIEVIVTGSMAQYIPTLEFYS-GGLPLVSVMYASSECFFGLNINPLCKPSDVSYTL  353

Query  910   LPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             LPNM YFEF+P+ +     + L               ++VDLV V +G YYEL++TTF+G
Sbjct  354   LPNMAYFEFLPVDDKSHEETQLES------------HRIVDLVSVEIGRYYELIITTFAG  401

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYR+GD+L+V GFHNKAPQF F  RRNVVLSID+DKT++EDL +++T AK        
Sbjct  402   LYRYRVGDILKVTGFHNKAPQFSFVERRNVVLSIDTDKTSEEDLMKAVTQAKLNHLQGLF  461

Query  550   LLVEYTSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
             LL EYTSYADTSS+PGHYV++WE+          +D ++++DCC  +E+ LDYVYRRCR+
Sbjct  462   LLTEYTSYADTSSIPGHYVLFWELKPRYDNDPPKLDKKMMEDCCSEVEDCLDYVYRRCRN  521

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
              D+ IG LEIRVV  GTFD LM   I++GSS+NQYKTPRC+KS   AL+IL+S V  R+F
Sbjct  522   KDRSIGALEIRVVSLGTFDALMDFSISQGSSVNQYKTPRCVKS-GGALQILDSRVIGRFF  580

Query  199   SPRDPAWKP  173
             + R P W+P
Sbjct  581   TKRVPQWEP  589



>ref|XP_002866046.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42305.1| hypothetical protein ARALYDRAFT_918581 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 401/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHVMPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  130   RSLLYSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN+ TSP+Q+ILCSD+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYNNYTSPNQTILCSDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWSE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A+ +I L PDP+LAD +E  CR  SW+GI+ RLWP  KY
Sbjct  250   LARDIRTGTLSSEITDLSVREAVGEI-LKPDPKLADFVESECRKTSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+PNM 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL VAGF N APQF F CR+NV LSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLSVAGFKNNAPQFSFICRKNVALSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYA+TSS+PGHYV++WE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  485   TSYAETSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKMVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWA  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_010539260.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Tarenaya 
hassleriana]
Length=611

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/541 (58%), Positives = 402/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR +PVI YEDI+P I RIANGD+F  +  +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKRVMPVITYEDIQPDINRIANGDNFPILCSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R F
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSEAKTPSGLLARPVLTSYYKSSHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL  R +VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQRMEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A+ KI L PDP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  250   LACDIRTGILSAQITDPSVRGAVDKI-LKPDPKLADFIENECGKESWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+  L YYS+G LPL+CTMYASSECYFGVNL+P+  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIQTLDYYSNG-LPLVCTMYASSECYFGVNLRPICKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNNGVTNSINLPKSLTERE---QKELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P +A L EY
Sbjct  425   VGDVLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKKAVTHLVPFEATLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT++VPGHYV++WE+   G   I   + +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTTTVPGHYVLFWELTLKGQTPIPPSIFEDCCLTIEESLNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  545   EIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSSYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_010112000.1| hypothetical protein L484_004686 [Morus notabilis]
 gb|EXC32345.1| hypothetical protein L484_004686 [Morus notabilis]
Length=608

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/557 (58%), Positives = 413/557 (74%), Gaps = 27/557 (5%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +P++ Y+DI+PYI RIA+GD    I+ +PITE+L SSGTSGG+PK+MPS AE+LDR
Sbjct  59    FKTKLPIVDYQDIQPYIERIAHGDKSHIISAKPITELLTSSGTSGGKPKMMPSTAEELDR  118

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YNL++P++++Y+ G++ GK MYL FVK E+ T  GL AR VLTSYYKS +F+ R F
Sbjct  119   KTFFYNLLVPVLNKYVEGLEHGKGMYLLFVKPEIRTSSGLMARPVLTSYYKSSNFRKRPF  178

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + YN  TSPD++ILC DT QSMYCQLL GLV R +VLR+GAVFASA LRAI FL+  W  
Sbjct  179   NRYNVFTSPDETILCPDTKQSMYCQLLCGLVQRHEVLRVGAVFASALLRAIKFLEDFWRD  238

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEIC-RAASWKGIVYRLWPKAK  1079
             LC DIR+G+LS  IAD  CR A+S +L  P+PELAD IE  C    SW+GI+ R+WP+ K
Sbjct  239   LCSDIRSGRLSDWIADGGCREALSCVLKKPNPELADAIERECGGGGSWEGIIRRMWPRTK  298

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
              +E ++TGSM+QY+  L +YS G LPL+ TMYASSECYFG+N KPLS P DV++TL+PNM
Sbjct  299   LVEVIVTGSMAQYISTLEFYS-GGLPLVSTMYASSECYFGINFKPLSKPCDVSYTLIPNM  357

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG----  731
              YFEF+PL         LN    +     + +S+ VDLV V+LG YYELVVTTF+G    
Sbjct  358   AYFEFLPL---------LNDRDRDYCNGQVVKSQAVDLVDVKLGRYYELVVTTFTGGLDF  408

Query  730   ----LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLE  563
                 LYR+R+GD+L V GFHNKAPQF+F  RRNVVLSID+DKTN+EDL  ++  AK LL 
Sbjct  409   LITWLYRFRVGDILMVTGFHNKAPQFRFVQRRNVVLSIDTDKTNEEDLLNAMNRAKLLLH  468

Query  562   PHQALLVEYTSYADTSSVPGHYVIYWEIMHAGAA-------AIDAQVLQDCCIAIEEQLD  404
             P   LL +YTSYADTSS+PGHYV++WE+ H  +        ++D+ ++++CC ++EE LD
Sbjct  469   PLGLLLTDYTSYADTSSIPGHYVLFWELTHDSSKPNLLVRDSLDSCLMEECCWSVEESLD  528

Query  403   YVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILE  224
              VYRRCR  DK IGPLEIRVV+ GTFD LM   ++ GSS+NQYKTPRCIKS+  AL IL+
Sbjct  529   SVYRRCRRKDKSIGPLEIRVVRCGTFDALMDLCVSRGSSLNQYKTPRCIKSD-EALHILD  587

Query  223   SNVRARYFSPRDPAWKP  173
             S V AR+FSP  P+W+P
Sbjct  588   SRVVARFFSPTTPSWEP  604



>ref|XP_009132438.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Brassica 
rapa]
Length=608

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/541 (58%), Positives = 399/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  67    FKHVMPVVTYEDIQPDINRIANGDKSQILCSSPISEFLTSSGTSGGERKLMPTIEEELDR  126

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  127   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  186

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL    +VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  187   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHSEVLRVGAVFASGFIRAIKFLEKHWPQ  246

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG L+  I D   R A+ +I L PDP LAD IE  CR  SW+GI+ RLWP  KY
Sbjct  247   LVHDIRTGTLNSEITDLSVREAVEEI-LKPDPRLADFIETECRKTSWQGIITRLWPNTKY  305

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+P+  P++V++TL+P M 
Sbjct  306   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPVCKPSEVSYTLIPTMA  364

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  365   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  421

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  422   VGDVLRVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  481

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   +   VL+DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  482   TSYADTSSIPGHYVLFWELCLNGGTPVPPSVLEDCCLTIEESLNSVYRQGRVSDKSIGPL  541

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  542   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVKTYFSPKCPKWI  600

Query  175   P  173
             P
Sbjct  601   P  601



>ref|XP_010267862.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nelumbo 
nucifera]
Length=616

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/541 (57%), Positives = 397/541 (73%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV++YED++  I RIANGD    + G PI+E L SSGTS GE KLMP+I E+L+R
Sbjct  73    FKKVIPVVSYEDLQSDINRIANGDTSPILCGLPISEFLTSSGTSAGERKLMPTIEEELNR  132

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+MDQ++PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  133   RSLLYSLLMPVMDQFVPGLDKGKGMYFLFIKSEAKTPGGLIARPVLTSYYKSSHFKRRPY  192

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL    +VLR+GAVFAS F+RAI FL+ +W  
Sbjct  193   DPYTNYTSPNETILCPDSYQSMYTQLLCGLCQNEEVLRVGAVFASGFIRAIRFLEKHWSL  252

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I+D+  R A+SKI L P PELAD IE  CR  +W+GI+ RLWP  KY
Sbjct  253   LCNDIRTGTINPQISDASVRDAVSKI-LKPKPELADFIEAECRKETWQGIITRLWPNTKY  311

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFG+NL PL  P++V +TL+P M 
Sbjct  312   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGLNLNPLCKPSEVCYTLIPTMA  370

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N       N     +      Q  LVDL  V+LG  YELVVTT++GLYRYR
Sbjct  371   YFEFLPVQRNNGV---ANSVSVPKSLNEKEQQDLVDLTDVKLGQEYELVVTTYAGLYRYR  427

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  428   VGDVLRVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQAAVKNATNHLVPFDATLTEY  487

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+ H G   I   V +DCC+ IEE L+ VYR+ RS DK IGPL
Sbjct  488   TSYADTTTIPGHYVLYWELRHDGVTPIPPSVFEDCCLTIEESLNSVYRQGRSSDKSIGPL  547

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S VR+ YFSP+ P W 
Sbjct  548   EIKVVESGTFDKLMDYAISRGASINQYKTPRCVKF-APIVELLNSRVRSNYFSPKCPKWV  606

Query  175   P  173
             P
Sbjct  607   P  607



>emb|CDY62097.1| BnaCnng39150D [Brassica napus]
Length=612

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/541 (58%), Positives = 399/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHVMPVVTYEDIQPEINRIANGDKSQILCSTPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A+ +I L PDP+LAD IE  C+  SW+GI+ RLWP  KY
Sbjct  250   LTRDIRTGTLSSEITDLSVREAVGEI-LKPDPKLADFIESECKKNSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNNGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   +   V +DCC+ IEE  + VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELYLNGNTPVPPSVYEDCCLTIEESFNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVKSYFSPKCPKWT  603

Query  175   P  173
             P
Sbjct  604   P  604



>emb|CDY43824.1| BnaC03g14570D [Brassica napus]
Length=612

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/541 (58%), Positives = 400/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RI+NGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHVMPVVTYEDIQPDINRISNGDKSQILCSSPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL    +VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHNEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG L+  I D   R A+ +I L PDP+LAD +E  CR  SW+GI+ RLWP  KY
Sbjct  250   LVHDIRTGTLNSEITDLSVREAVEEI-LKPDPKLADFVETECRKTSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   +   VL+DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLNGGTPVPPSVLEDCCLTIEESLNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVKTYFSPKCPKWI  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_006432395.1| hypothetical protein CICLE_v10000544mg [Citrus clementina]
 gb|ESR45635.1| hypothetical protein CICLE_v10000544mg [Citrus clementina]
Length=649

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/540 (58%), Positives = 404/540 (75%), Gaps = 6/540 (1%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D +  FK+ VPV+ YEDI+PYI RIANG+    I+ QPITE L SSGTSGG+PK+MPS  
Sbjct  62    DALQVFKKNVPVVNYEDIKPYIERIANGEPSDIISAQPITEFLTSSGTSGGQPKMMPSTD  121

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             EDL+R+TF YN+++P+M++Y+  +D+GKAMYL FVK E+ TP GL AR VLTSYYKS  F
Sbjct  122   EDLERKTFFYNMLIPVMNKYVDDLDKGKAMYLLFVKPEIRTPSGLMARPVLTSYYKSNSF  181

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
             + R F+ YN  TSPD++ILC D+ QSMYCQLL GLV R +VLR+GAVFASAFLRAI FL+
Sbjct  182   RNRPFNRYNVYTSPDETILCPDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLE  241

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
               W  LC +IR G +S  I D  CR+A+S IL   + +LA+ IE  C   SW+GI+ ++W
Sbjct  242   DYWKELCSNIRIGHVSDWITDPSCRNAVSLILGRANQDLANLIENECGGESWEGIIKKIW  301

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             P+ KYIE ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+N KPL  P+DV++TL
Sbjct  302   PRTKYIEVIVTGSMAQYIPILEFYSGG-LPLVSTMYASSECYFGINFKPLCKPSDVSYTL  360

Query  910   LPNMGYFEFIPLGE-NGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             LPNM YFEF+P+ + NG         G  +++    ++++VDL +V+LG  YELVVTTF+
Sbjct  361   LPNMAYFEFLPVEKSNGELTQEFQCNGISDQDCQHDETEIVDLTNVKLGHCYELVVTTFT  420

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYR+GD+L V GFHN APQF F  R+NV+LSID+DKTN+EDL +++T AK L+EP  
Sbjct  421   GLYRYRVGDILMVTGFHNNAPQFWFVHRKNVILSIDTDKTNEEDLLKAVTEAKLLIEPLG  480

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL EYT+YADT S+PGHYV++WE+   G+   + +D  +++ CC  +EE LD VYRRCR
Sbjct  481   FLLTEYTAYADTCSIPGHYVVFWELKSKGSNNLSELDTDIMEQCCSRVEESLDSVYRRCR  540

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
               D  IGPLEIRVVK GTFD LM   +++GSS+NQYKTPRCIKS   A+ +L+S V  RY
Sbjct  541   KKDNSIGPLEIRVVKDGTFDALMDFSVSQGSSVNQYKTPRCIKS-EEAINLLDSKVVGRY  599



>emb|CDY67943.1| BnaAnng25610D [Brassica napus]
Length=612

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/541 (58%), Positives = 399/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHVMPVVTYEDIQPEINRIANGDTSQILCSSPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A+ +I L PDP+LAD IE  C+  SW+GI+ RLWP  KY
Sbjct  250   LTRDIRTGTLSSEITDLSVREAVGEI-LKPDPKLADFIESECKKNSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNNGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   +   V +DCC+ IEE  + VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLNGNTPVPPSVYEDCCLTIEESFNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVKSYFSPKCPKWT  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_010250483.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Nelumbo nucifera]
Length=630

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/569 (58%), Positives = 423/569 (74%), Gaps = 30/569 (5%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VP++ YEDI+PYI RIANG+    I+ Q ITE+L SSGTSGG+PK+MPS A+DLDR
Sbjct  58    FKNKVPIVTYEDIKPYIERIANGEASRIISSQQITELLTSSGTSGGQPKIMPSTAQDLDR  117

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TFLYNL++P+M+QY+ G+D+GK MYL F+K E+ TP GL AR VLTSYYKS +F+ R F
Sbjct  118   KTFLYNLLVPVMNQYVDGLDQGKGMYLLFIKPEIRTPSGLMARPVLTSYYKSCNFRNRPF  177

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + +N  TSPD++ILCSD  QSMYCQLL GL+ R +VLR+GAVFASA LRAI FL+  W  
Sbjct  178   NRFNVYTSPDETILCSDCRQSMYCQLLCGLIQRDEVLRVGAVFASALLRAIKFLEDYWQE  237

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEIC--RAASWKGIVYRLWPKA  1082
             LC +IRTG +S  I D  CR+A+S IL  P+ ELA  IE  C     SW+GI+ RLWP+ 
Sbjct  238   LCSNIRTGHVSDWITDPGCRNAVSDILRQPNSELAHLIESECIGNGKSWEGIIKRLWPRT  297

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KY++ ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NLKPLS+P+DV++TLLPN
Sbjct  298   KYVDVIVTGSMAQYIPTLDFYSGG-LPLVSTMYASSECYFGINLKPLSEPSDVSYTLLPN  356

Query  901   MGYFEFIPLGEN---------------GTFLSNLNKegeeeeeESIPQSKL--VDLVHVR  773
             M YFEF+P+  N               G+  + L +E EEEEEE   + +   VDLV V+
Sbjct  357   MAYFEFLPVERNHDQAAVTQGIQCNGGGSDRNGLRREEEEEEEEEEEEEEEEAVDLVQVK  416

Query  772   LGCYYELVVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHR  593
              G YYELVVTTF+GLYRYR+GD+L+V GFHN APQF+F  R NVVLSID+DKTN+EDL +
Sbjct  417   PGHYYELVVTTFTGLYRYRVGDILKVTGFHNNAPQFRFVHRLNVVLSIDTDKTNEEDLLK  476

Query  592   SITAAKKLLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAG---------AAAIDAQVL  440
             ++T AK LLEP   LL EYTSYADT S+PGHYV++WE+   G         AA ++  ++
Sbjct  477   AVTQAKLLLEPLGFLLTEYTSYADTCSIPGHYVLFWELKMKGNGNQQQQQQAAELNPSIM  536

Query  439   QDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRC  260
             ++CC  +E+ LD VYRRCRS D+ IGPLEIRVV+ GTFD LM   +++GSS+NQYKTPRC
Sbjct  537   EECCSTVEQSLDSVYRRCRSKDRSIGPLEIRVVQHGTFDALMDFCVSQGSSVNQYKTPRC  596

Query  259   IKSNSSALKILESNVRARYFSPRDPAWKP  173
             IKS  + +++L+S V  R+FS + P W+P
Sbjct  597   IKSEKT-IELLDSRVVGRFFSKKTPHWEP  624



>ref|XP_009127083.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Brassica 
rapa]
Length=612

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/541 (58%), Positives = 398/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHVMPVVTYEDIQPEINRIANGDTSQILCSSPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A+ +I L PDP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  250   LTRDIRTGTLSSEITDLSVREAVGEI-LKPDPKLADFIESECMKNSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNNGVTSSISLPKALTEKE---QKELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVAGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   +   V +DCC+ IEE  + VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLNGNTPVPPSVYEDCCLTIEESFNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVKSYFSPKCPKWT  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_010540432.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010540433.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
isoform X2 [Tarenaya hassleriana]
Length=633

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/571 (55%), Positives = 411/571 (72%), Gaps = 44/571 (8%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ Y+DI+P+I RI+ G     I+ QPITE+L SSGTS G+PKLMPS A++LDR
Sbjct  71    FKNKVPVVNYDDIKPFIERISGGASSDIISSQPITELLTSSGTSAGKPKLMPSTAQELDR  130

Query  1615  RTFLYNLIMPIMDQYIP---------------------------GMDEGKAMYLYFVKAE  1517
             +TF YN+++P+M++Y+P                           G+D+GK MYL F+K E
Sbjct  131   KTFFYNMLVPVMNKYVPPCFSFVLFLNLDRQETIGVFFFCRYVEGLDDGKGMYLLFIKPE  190

Query  1516  MSTPCGLPARTVLTSYYKSKHFKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYR  1337
             + TP GL AR VLTSYYKS++F+ R ++ YN  TSPD++ILC D+ QSM+CQLL GL+ R
Sbjct  191   IKTPSGLMARPVLTSYYKSQNFRNRLYNKYNVYTSPDETILCLDSKQSMFCQLLCGLIQR  250

Query  1336  RQVLRLGAVFASAFLRAISFLQHNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPE  1157
             + VLR+GAVFASAFLRAI FL+ ++  LC +IRTG +S  I DS CR+A+  IL  P+P 
Sbjct  251   KDVLRVGAVFASAFLRAIKFLEDHFKELCSNIRTGDVSEWITDSRCRNAVLSILKLPNPN  310

Query  1156  LADEIEEICRAASWKGIVYRLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYAS  977
             LADEIE+ C   SW+GIV RLWP+AKY+E ++TGSM+QY+P L +YS G LPL+ TMYAS
Sbjct  311   LADEIEQDCAEKSWEGIVKRLWPRAKYVEVIVTGSMAQYIPTLEFYS-GGLPLVSTMYAS  369

Query  976   SECYFGVNLKPLSDPADVAFTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSK  797
             SECYFG+N+ P+  P DV++TLLPNM YFEF+P+ ++       N               
Sbjct  370   SECYFGININPMCKPCDVSYTLLPNMAYFEFLPVLDDKDDNDPRN------------DDM  417

Query  796   LVDLVHVRLGCYYELVVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDK  617
             +VDLV V++G YYELV+TTF+GLYRYR+GDVL V GFHNKAPQF F  RRNVVLSID+DK
Sbjct  418   IVDLVDVQIGRYYELVITTFTGLYRYRVGDVLVVTGFHNKAPQFGFVQRRNVVLSIDTDK  477

Query  616   TNDEDLHRSITAAKKLLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGAA---AIDAQ  446
             T++EDL +++T +++LL+    LL+EYTS  DTSS+PGHYVI+WE+          + A 
Sbjct  478   TSEEDLLKAVTKSRQLLQTSNLLLMEYTSCTDTSSIPGHYVIFWELNPRNKTDPFELSAS  537

Query  445   VLQDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTP  266
              +++CC  +EE LDYVYRRCRS DK IGPLEIRVV+ GTFD LM   ++ GSS+NQYKTP
Sbjct  538   TMEECCSQVEECLDYVYRRCRSRDKSIGPLEIRVVRMGTFDELMDFCVSMGSSLNQYKTP  597

Query  265   RCIKSNSSALKILESNVRARYFSPRDPAWKP  173
             RC+KS   A++IL+S V  R+FSPR P W+P
Sbjct  598   RCVKSQ-GAIQILDSRVIGRFFSPRAPKWEP  627



>ref|XP_007021139.1| Auxin-responsive GH3 family protein [Theobroma cacao]
 gb|EOY12664.1| Auxin-responsive GH3 family protein [Theobroma cacao]
Length=611

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/541 (57%), Positives = 396/541 (73%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+P+I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  69    FKKVMPVITYEDIQPHIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  129   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSEAKTPSGLVARPVLTSYYKSSHFKDRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  189   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWPL  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR G +   I D   R A+ KI L PDP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  249   LCKDIRAGTVDAQITDQPVREAVMKI-LKPDPKLADFIEAECSKDSWQGIITRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNLKPL  P++V++TL+P M 
Sbjct  308   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLKPLCKPSEVSYTLIPTMA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N       N     +      Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  367   YFEFLPVHRNNGV---TNSISVPKSLNEKEQQQLVDLVDVKLGQEYELVVTTYAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  424   VGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQHAVKNAVNHLLPFDATLAEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  484   TSYADTTTIPGHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPL  543

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S   + YFSP+ P W 
Sbjct  544   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRAVSSYFSPKCPKWL  602

Query  175   P  173
             P
Sbjct  603   P  603



>ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus 
communis]
 gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus 
communis]
Length=612

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/541 (58%), Positives = 403/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVIAYEDI+P+I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  69    FKKIMPVIAYEDIQPHINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+++GK MY  F+K+E  TP GL AR VLTSYYKS HFK R F
Sbjct  129   RSLLYSLLMPVMNQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKDRPF  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL  R  VLR+GAVFAS F+RAI FL+ +W  
Sbjct  189   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQRNDVLRVGAVFASGFIRAIRFLEKHWQL  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I D   R A+ KI L PDP+LAD I   C   SW+GI+ RLWP  KY
Sbjct  249   LCNDIRTGTVNPQITDLSVREAVMKI-LKPDPKLADFIAAECSQESWQGIITRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  308   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    ++++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  367   YFEFLPVHRNNGVTNSISMPKSLNEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  424   VGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATLAEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+S+PGHYV++WEI   G+  I   + +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  484   TSYADTTSIPGHYVLFWEITLNGSTPIPPSIFEDCCLTIEESLNSVYRQGRVSDKSIGPL  543

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  544   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSSYFSPKCPKWV  602

Query  175   P  173
             P
Sbjct  603   P  603



>ref|XP_006413097.1| hypothetical protein EUTSA_v10024696mg [Eutrema salsugineum]
 dbj|BAJ34606.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54550.1| hypothetical protein EUTSA_v10024696mg [Eutrema salsugineum]
Length=612

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/541 (58%), Positives = 403/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKNVMPVITYEDIQPEINRIANGDKSHILSIKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A++KI L P+P+LAD +E  C+  SW+GI+ RLWP  KY
Sbjct  250   LVCDIRTGVLSSLITDPSVREAVAKI-LKPNPKLADFVESECKKKSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNLKPL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLKPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  368   YFEFLPVHRNTGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEESLNTVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+P TFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKIVEPNTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>emb|CDX92823.1| BnaC07g40810D [Brassica napus]
Length=612

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/541 (57%), Positives = 401/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKNVMPVITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+ +MP+M Q++PG+D+GK MY  FVK+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  130   RSLLYSFLMPVMSQFVPGLDKGKGMYFLFVKSESKTPGGLPARPVLTSYYKSPHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY D TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTDYTSPNETILCPDSYQSMYSQMLCGLCQYQEVLRVGAVFASGFIRAIKFLEKHWTE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A++KI L P P+LAD +E  C+  SW+G++ RLWP  KY
Sbjct  250   LVRDIRTGTLSSLITDPSVREAVAKI-LKPSPKLADFVESECQKKSWQGVITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  368   YFEFLPVYRNTGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAMTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE  + VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_008674951.1| PREDICTED: LOW QUALITY PROTEIN: probable indole-3-acetic acid-amido 
synthetase GH3.1 [Zea mays]
Length=608

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/547 (57%), Positives = 404/547 (74%), Gaps = 18/547 (3%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D V  F+R VP++ YE ++P ILRIANGD    ++G+PI+E L SSGTSGGE KLMP+IA
Sbjct  67    DAVEAFRRVVPLVTYEGLQPDILRIANGDASPILSGKPISEFLTSSGTSGGERKLMPTIA  126

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             ++LDRR+ LY+L MP+M Q +PG+D+GKAMYL FVKAE  TP GL AR VLTSYY+S+ F
Sbjct  127   DELDRRSLLYSLQMPVMSQSVPGLDKGKAMYLLFVKAESRTPGGLVARPVLTSYYRSRQF  186

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
               R  DPY + TSP+++ILC D+ QSMY QLL GLV+R  VLR+GAVFAS FLRAI FL+
Sbjct  187   LERPHDPYTEYTSPNEAILCVDSYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIRFLE  246

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
              +WP LC DIRTG L   I D   R A++++L   DP LADEIE +C  +SW+ I+ RLW
Sbjct  247   KHWPRLCRDIRTGTLDPEITDRAVRDAVARVLRGADPALADEIEAVCGGSSWESIIRRLW  306

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             P+ +Y++ ++TG+MSQY+P L +Y  G LPL CTMYASSECYFG+NL P+  P DVA+TL
Sbjct  307   PRTRYVDVIVTGAMSQYIPTLEFYGGG-LPLACTMYASSECYFGLNLNPMCKPGDVAYTL  365

Query  910   LPNMGYFEFIPLG-ENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             +P M YFEF+PL   NG    +                 LV LV V+LG  YELVVTT+S
Sbjct  366   IPTMCYFEFLPLQCSNGKAEPS--------------HRDLVGLVDVKLGHEYELVVTTYS  411

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYR+GDVL+VAGF N+AP FKF  R+NV LS+DSDKT++ +LH +++ A + L P  
Sbjct  412   GLYRYRVGDVLRVAGFKNEAPMFKFVRRQNVALSVDSDKTDETELHAAVSGAVQHLAPFG  471

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             A LVEYTSYAD +++PGHYV++WE + AG+ A+ A V +DCC+++EE+L+ VYR+CR+ D
Sbjct  472   ASLVEYTSYADAATIPGHYVLFWE-LRAGSTAVPASVFEDCCLSVEEELNSVYRQCRACD  530

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
             K IGPLEIRVV  GTFD LM   I+ G+SINQYK PRC++     +++L++ V+A+YFSP
Sbjct  531   KSIGPLEIRVVSEGTFDKLMDYAISRGASINQYKAPRCVRPG-PVVELLDARVQAKYFSP  589

Query  193   RDPAWKP  173
             + P W P
Sbjct  590   KCPKWSP  596



>ref|XP_009137648.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5 isoform 
X1 [Brassica rapa]
Length=612

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/541 (57%), Positives = 400/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKNVMPVITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+ +MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  130   RSLLYSFLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY D TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTDYTSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A++KI L P P+LAD +E  C+  SW GI+ RLWP  KY
Sbjct  250   LVRDIRTGTLSSLITDPSVREAVAKI-LKPSPKLADFVEFECKKKSWHGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  368   YFEFLPVHRNTGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAMTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE  + VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_010443025.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Camelina 
sativa]
Length=539

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/537 (58%), Positives = 398/537 (74%), Gaps = 6/537 (1%)
 Frame = -1

Query  1783  VPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDRRTFL  1604
             +PV+ YEDI+P I RIANGD    +    I+E L SSGTSGGE KLMP+I E+LDRR+ L
Sbjct  1     MPVVTYEDIQPEINRIANGDKSQILCSNHISEFLTSSGTSGGERKLMPTIEEELDRRSLL  60

Query  1603  YNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSFDPYN  1424
             Y+L+MP+M+Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R FDPY 
Sbjct  61    YSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKKRPFDPYT  120

Query  1423  DMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPSLCLD  1244
             + TSP+Q+ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP L  D
Sbjct  121   NYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPELARD  180

Query  1243  IRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKYIEAV  1064
             IRTG LS  I D   R A+ +I L PDP+LAD +E  CR  SW+GI+ R+WP  KY++ +
Sbjct  181   IRTGTLSSEITDLSVREAVGEI-LKPDPKLADFVESECRKTSWQGIITRIWPNTKYVDVI  239

Query  1063  ITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMGYFEF  884
             +TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+PNM YFEF
Sbjct  240   VTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMAYFEF  298

Query  883   IPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYRIGDV  704
             +P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR+GDV
Sbjct  299   LPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYRVGDV  355

Query  703   LQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEYTSYA  524
             + V GF N APQF F CR+NVVLSID+DKT++ +L  ++  A   L P +A L EYTSYA
Sbjct  356   ISVTGFKNNAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVTHLVPFEASLSEYTSYA  415

Query  523   DTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRV  344
             DTSS+PGHYV++WE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPLEI++
Sbjct  416   DTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKI  475

Query  343   VKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWKP  173
             V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W P
Sbjct  476   VESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDNYFSPKCPKWVP  531



>ref|NP_194456.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana]
 sp|O81829.1|GH35_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.5; AltName: 
Full=Auxin-responsive GH3-like protein 5; Short=AtGH3-5 
[Arabidopsis thaliana]
 emb|CAA19720.1| GH3 like protein [Arabidopsis thaliana]
 emb|CAB79581.1| GH3 like protein [Arabidopsis thaliana]
 gb|AAL49795.1| putative GH3 protein [Arabidopsis thaliana]
 gb|AAM20166.1| putative GH3 protein [Arabidopsis thaliana]
 gb|ABF58888.1| auxin-responsive GH3-like [Arabidopsis thaliana]
 gb|AEE85318.1| indole-3-acetic acid-amido synthetase GH3.5 [Arabidopsis thaliana]
Length=612

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/541 (57%), Positives = 403/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKNIMPVITYEDIEPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG++ GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQFVPGLENGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILCSD+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWIE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A++KI L P P+LAD +E  C+ +SW+GI+ RLWP  KY
Sbjct  250   LVRDIRTGTLSSLITDPSVREAVAKI-LKPSPKLADFVEFECKKSSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P+M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPSMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  368   YFEFLPVHRNNGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE  + VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNTVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_003564364.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Brachypodium distachyon]
Length=615

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/548 (57%), Positives = 405/548 (74%), Gaps = 17/548 (3%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D V  F+RCVP++ YED++P ILRIANGD    ++G+PI+E L SSGTSGGE KLMP+IA
Sbjct  65    DAVDSFRRCVPLVTYEDLQPDILRIANGDTSPILSGKPISEFLTSSGTSGGERKLMPTIA  124

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             ++LDRR+ LY+L+MP+M Q +PG+D+GKAMYL FVKAE  TP GL AR VLTSYY+S+ F
Sbjct  125   DELDRRSLLYSLLMPVMSQSVPGLDKGKAMYLLFVKAESRTPGGLAARPVLTSYYRSRQF  184

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
               R  DPY   TSP+++ILC D+ QSMY QLL GLV+R  VLR+GAVFAS  LRAI FL+
Sbjct  185   LDRPHDPYTAYTSPNEAILCVDSYQSMYAQLLCGLVHRTDVLRVGAVFASGLLRAIRFLE  244

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKIL--LAPDPELADEIEEICRAASWKGIVYR  1097
              +WP LC DIRTG+L   I D   R A+ +IL   A  P LADEIE  C   SW+GIV R
Sbjct  245   KHWPRLCHDIRTGELDPEITDRPVRDAVGRILRGAANRPALADEIEAECLKPSWEGIVRR  304

Query  1096  LWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAF  917
             LWP+ KYI+ ++TG+MSQY+P L +Y  G LPL CTMYASSECYFG+NL P+  P+DVA+
Sbjct  305   LWPRTKYIDVIVTGAMSQYIPTLEFYGGG-LPLTCTMYASSECYFGLNLNPMCKPSDVAY  363

Query  916   TLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTF  737
             TL+P M YFEF+P+       SN N +             LVDLV V+LG YYELVVTTF
Sbjct  364   TLIPTMCYFEFLPVHRG----SNTNAKPS--------HQDLVDLVDVKLGHYYELVVTTF  411

Query  736   SGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPH  557
             SGL RYR+GDVL+VAGF N+AP F F  R+NV LSIDSDKT++ +LH ++++A + L P 
Sbjct  412   SGLCRYRVGDVLRVAGFKNEAPMFSFVRRQNVALSIDSDKTDETELHTAVSSAVQHLAPF  471

Query  556   QALLVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSH  377
              A LVEYTSYADT+++PGHYV++WE + AG+ A+ A V ++CC+++EE L+ VYR+ R+ 
Sbjct  472   GATLVEYTSYADTAAIPGHYVLFWE-LRAGSTAVPASVFEECCLSVEEALNSVYRQGRAS  530

Query  376   DKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFS  197
             D+ IGPLEIRVV  GTFD LM   ++ G+SINQYK PRC++     +++L+  V+A+YFS
Sbjct  531   DRSIGPLEIRVVSEGTFDKLMDYALSRGASINQYKAPRCVRPG-PVVELLDDRVQAKYFS  589

Query  196   PRDPAWKP  173
             P+ P W P
Sbjct  590   PKCPKWSP  597



>ref|XP_006283319.1| hypothetical protein CARUB_v10004357mg, partial [Capsella rubella]
 gb|EOA16217.1| hypothetical protein CARUB_v10004357mg, partial [Capsella rubella]
Length=634

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/541 (57%), Positives = 399/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  92    FKNVMPVITYEDIQPEINRIANGDKSLILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  151

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  152   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY  211

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  212   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTE  271

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A++KI L P P+LAD +E  C+ +SW+GI+ RLWP  KY
Sbjct  272   LVRDIRTGTLSALITDPSVREAVAKI-LKPSPKLADFVEFECKKSSWQGIITRLWPNTKY  330

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  331   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  389

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N       N     +      Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  390   YFEFLPVHRNNAV---TNSISLPKALTEKEQQELVDLVDVKLGQEYELVVTTYAGLCRYR  446

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  447   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  506

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE L+ VYR+ R  DK IGPL
Sbjct  507   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEESLNTVYRQGRVSDKSIGPL  566

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  567   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDTYFSPKCPKWV  625

Query  175   P  173
             P
Sbjct  626   P  626



>ref|XP_006401565.1| hypothetical protein EUTSA_v10012997mg [Eutrema salsugineum]
 gb|ESQ43018.1| hypothetical protein EUTSA_v10012997mg [Eutrema salsugineum]
Length=612

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/541 (57%), Positives = 398/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHVMPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS  FK R +
Sbjct  130   RSLLYSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSQFKNRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG L+  I D   R A+ +I L PDP LAD +E  CR  SW+GI+ RLWP  KY
Sbjct  250   LAHDIRTGTLNSEITDVSVREAVGEI-LKPDPRLADFVEWECRKTSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSID+DKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVAGFKNNAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC  IEE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCFTIEESLNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVKTYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_003566071.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.4 
[Brachypodium distachyon]
Length=629

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/549 (56%), Positives = 400/549 (73%), Gaps = 21/549 (4%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             DF+R  P++ YEDI P++ RIANGD    ++G+PI E L SSGTSGGE KLMPSIAE+++
Sbjct  75    DFRRLAPLVTYEDILPFVTRIANGDSSPILSGRPIREFLTSSGTSGGERKLMPSIAEEME  134

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             RR+ LY+L+MP+M Q +PG+D+GKAMYLYFVKAE  TP GLPAR VLTSYYKS+HF+ R+
Sbjct  135   RRSLLYSLLMPVMSQAVPGLDKGKAMYLYFVKAESRTPGGLPARPVLTSYYKSRHFRERA  194

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
              DP+   TSPD++ILC D +QSMY QLL GLV+R  VLR+GAVFAS FLRAI FL+ +WP
Sbjct  195   HDPFTVHTSPDEAILCVDAHQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIDFLRQHWP  254

Query  1258  SLCLDIRTGQL-SGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKA  1082
              LC DIRTG + +G+I D   R A+ ++L APDP LAD +E+ C  ASW+GI+ ++WP  
Sbjct  255   RLCHDIRTGAVDAGVITDRAVRGAVERVLRAPDPALADAVEDACAGASWQGIIRKVWPNT  314

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KYI+ ++TG+M+QY+P L +Y  G LPL CTMYASSECYFG+NL P+ DPA+VA+TL+P 
Sbjct  315   KYIDVIVTGAMAQYIPTLEHYGGG-LPLACTMYASSECYFGLNLNPICDPAEVAYTLIPT  373

Query  901   MGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYR  722
             M +FEF+P+  N       +               LV L  V+LG  YELVVTT+SGLYR
Sbjct  374   MCFFEFLPVQSNAETGEEPD------------HRDLVGLADVKLGHEYELVVTTYSGLYR  421

Query  721   YRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLV  542
             YR+GDVL+VAGF N AP F F  R+NV LSID+DKT++ +LH +++AA + LEP  A LV
Sbjct  422   YRVGDVLRVAGFKNAAPSFNFVRRKNVALSIDADKTDEAELHAAVSAAVQHLEPFGASLV  481

Query  541   EYTSYADTSSV-PGHYVIYWEIMHAGAAA-----IDAQVLQDCCIAIEEQLDYVYRRCRS  380
             EYTSYADT+   PGHYV++WE+    +       + A V +DCC+A+EE L+ VYR+CR 
Sbjct  482   EYTSYADTAGTSPGHYVLFWELRLRASGTPTPMPVPASVFEDCCLAMEESLNSVYRQCRV  541

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
              D+ +GPLEIRVV  GTFD LM   ++ G+SINQYK PRC++     +++L+  V  RYF
Sbjct  542   ADRSVGPLEIRVVAAGTFDKLMDYALSRGASINQYKAPRCVRPG-PVVELLDGRVEERYF  600

Query  199   SPRDPAWKP  173
             SP+ P W P
Sbjct  601   SPKCPKWNP  609



>emb|CDY43037.1| BnaA03g11840D [Brassica napus]
Length=603

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/541 (57%), Positives = 393/541 (73%), Gaps = 15/541 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKHVMPVVTYEDIQPDINRIANGDKSQILCSSPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKNRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL    +VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHNEVLRVGAVFASGFIRAIKFLEKHWPQ  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG L+  I D   R A+ +I L PDP+LAD IE  CR  SW+GI+ RLWP  KY
Sbjct  250   LVHDIRTGTLNSEITDLSVREAVEEI-LKPDPKLADFIETECRKTSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+P+  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPVCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N   L+               Q  LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHRNSGALTEKE------------QQDLVDLVDVKLGQEYELVVTTYAGLYRYR  415

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VA F N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  416   VGDVLRVADFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVAHLVPFDASLSEY  475

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   +   VL+DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  476   TSYADTSSIPGHYVLFWELCLNGDTPVPPSVLEDCCLTIEESLNSVYRQGRVSDKSIGPL  535

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  536   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVKTYFSPKCPKWI  594

Query  175   P  173
             P
Sbjct  595   P  595



>emb|CDY46653.1| BnaA03g48550D [Brassica napus]
Length=612

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/541 (57%), Positives = 401/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGG+ KLMP+I E+LDR
Sbjct  70    FKNVMPVITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGQRKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+ +MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  130   RSLLYSFLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY D TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTDYTSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWIE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A++KI L P P+LAD +E  C+  SW+GI+ RLWP  KY
Sbjct  250   LVRDIRTGTLSSLITDPSVREAVAKI-LKPSPKLADFVEFECKKKSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  368   YFEFLPVHRNTGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAMTHLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE  + VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_008797411.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Phoenix dactylifera]
Length=607

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/539 (58%), Positives = 401/539 (74%), Gaps = 16/539 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR +PVI YED++P +LRIA+GD    ++G+PI+E L SSGTSGGE KLMP+I ++LDR
Sbjct  71    FKRLIPVITYEDLQPDVLRIAHGDTSPILSGRPISEFLTSSGTSGGERKLMPTIHDELDR  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+  Y+L+ P+M Q++PG+D+GKAMYLYFVK+E  TP GL AR VLTSYYKS+HF  R F
Sbjct  131   RSLFYSLMTPVMSQFVPGLDKGKAMYLYFVKSESRTPGGLVARPVLTSYYKSRHFLERPF  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN +TSP+++ILC D+ QSMY QLL GLV R  V+R+GAVFAS FLRAI FL+ +WP 
Sbjct  191   DPYNILTSPNEAILCPDSYQSMYAQLLCGLVQRADVVRVGAVFASGFLRAIKFLEKHWPR  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG L   I D   R A+ ++ L PDP LA EIE  C  ASW+GI+ R+WP  KY
Sbjct  251   LCCDIRTGMLDTEITDRAVREAVERV-LRPDPGLAGEIETECSKASWQGIIRRIWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+M+QY+P L +Y  G LPL CTMY SSECYFG+NL P+  P++VA+TL+P M 
Sbjct  310   IDIIVTGAMAQYIPTLEFYGGG-LPLACTMYGSSECYFGINLNPMCKPSEVAYTLIPTMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+        + +            Q  LVDLV V+LG  YELVVTT+SGLYRYR
Sbjct  369   YFEFLPVHHINHGAKDYD------------QRDLVDLVDVKLGQEYELVVTTYSGLYRYR  416

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF +KAPQF F  R+NV LSIDSDKT++ +LH ++  A   LEP  A LVEY
Sbjct  417   VGDVLRVAGFKDKAPQFNFVRRKNVALSIDSDKTDEVELHAAVRNAVNHLEPFGASLVEY  476

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE + AG  A+   V +DCC+A EE L+ VYR+ R+ DK IGPL
Sbjct  477   TSYADTSSIPGHYVLFWE-LKAGGTAVPPSVFEDCCLAAEESLNSVYRQGRACDKSIGPL  535

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             EIRVV+ GTFD LM   +++G+SINQYK PRC++S   A+++L+  V++R+FSP+ P W
Sbjct  536   EIRVVEEGTFDKLMDYALSQGASINQYKAPRCVRSG-PAVELLDGRVQSRFFSPKCPKW  593



>ref|XP_010438643.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5-like [Camelina 
sativa]
Length=613

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/541 (57%), Positives = 402/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  71    FKNVMPVITYEDIQPEINRIANGDKSLILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  131   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  191   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTE  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG L+ +I D   R A++KI L P P+LAD +E  C+ +SW+GI+ RLWP  KY
Sbjct  251   LVRDIRTGTLNALITDPSVREAVAKI-LKPSPKLADFVEFECKKSSWQGIITRLWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  310   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  369   YFEFLPVHRNNGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  426   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+ +EE L+ VYR+ R  DK IGPL
Sbjct  486   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLTVEESLNTVYRQGRVSDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +K+L S V   Y SP+ P W 
Sbjct  546   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIKLLNSRVVDSYLSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>gb|EAY81150.1| hypothetical protein OsI_36332 [Oryza sativa Indica Group]
Length=662

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/569 (56%), Positives = 409/569 (72%), Gaps = 36/569 (6%)
 Frame = -1

Query  1816  EEDLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPS  1637
             E++L + FK  VPV+ YED++PYI RIANG   S I+ +PITE+L SSGTSGG+PKLMP+
Sbjct  93    EDELAAAFKERVPVVEYEDVKPYIERIANGAPSSLISSKPITELLTSSGTSGGQPKLMPA  152

Query  1636  IAEDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSK  1457
               E+LDR+TFLYNL++P+M++Y+ G+DEG+ MYL FVK E++T  G+ AR VLTSYYKS+
Sbjct  153   TEEELDRKTFLYNLLVPVMNKYVEGLDEGRGMYLLFVKPEITTASGMVARPVLTSYYKSR  212

Query  1456  HFKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISF  1277
             HF+ R   PY   TSPD +ILC D+ QSMY QLL GL  R +VLR+GAVFASAFLRA+ F
Sbjct  213   HFRRRPDSPYTRYTSPDAAILCPDSRQSMYAQLLCGLARRGEVLRVGAVFASAFLRAVKF  272

Query  1276  LQHNWPSLCLDIRTGQLS-GMIADSECRSAMSKILLA-PDPELADEIEEICRAASWKGIV  1103
             L+ +W +LC DIR G+    ++ D+ CR A+  +L A  DP+LAD I   C  ASW+GIV
Sbjct  273   LEGHWRALCADIRAGRADPAVVTDAACRGAVDAVLAARADPDLADAIAAECGGASWRGIV  332

Query  1102  YRLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADV  923
              RLWP+ KYI+ ++TGSM+QY+P L +Y  G LPL+ TMYASSE YFG+NL+PL  P +V
Sbjct  333   RRLWPRTKYIDVIVTGSMAQYIPLLEFYG-GGLPLVSTMYASSESYFGINLRPLDPPEEV  391

Query  922   AFTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVT  743
              +TLLPNM Y+EFI + ++G               E +   ++VDLV V +G YYELVVT
Sbjct  392   VYTLLPNMCYYEFIKVEKDGD-------------GEKVRDGEVVDLVGVEVGAYYELVVT  438

Query  742   TFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLE  563
             TF+GLYRYR+GD+LQVAGFHN APQF+F  RRNVVLS+D+DKT+++DL R++TAAK LL+
Sbjct  439   TFTGLYRYRVGDILQVAGFHNAAPQFRFVHRRNVVLSVDTDKTSEDDLLRAVTAAKPLLD  498

Query  562   PHQALLVEYTSYADTSSVPGHYVIYWEIMHA-------------GAAAID------AQVL  440
             P   +L EYT+YADTSS+PGHYV++WE+  +              AA I       A V+
Sbjct  499   PLSCVLAEYTAYADTSSIPGHYVLFWELTPSPSPPPPPCHDDANDAADIGEDKDKVAHVM  558

Query  439   QDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRC  260
               CC A+E  LD VYRRCRS D+ IGPLEIRVV PG FD LM   ++ GSS+NQYKTPRC
Sbjct  559   AACCAAVEAGLDSVYRRCRSRDRSIGPLEIRVVAPGAFDALMDMCVSHGSSVNQYKTPRC  618

Query  259   IKSNSSALKILESNVRARYFSPRDPAWKP  173
             IK +  A+ +LE  V  R+FS   P W+P
Sbjct  619   IK-HPDAIAVLEQRVVGRFFSDAVPHWEP  646



>ref|XP_010448162.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5 [Camelina 
sativa]
Length=613

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/541 (57%), Positives = 403/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  71    FKNVMPVITYEDIQPEINRIANGDKSLILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  131   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILCSD+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  191   DPYTNYTSPNEAILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTE  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A++KI L P  +LA+ +E  C+ +SW+GI+ RLWP  KY
Sbjct  251   LVRDIRTGTLSALITDPSVREAVAKI-LKPSSKLANFVEFECKKSSWQGIITRLWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  310   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  369   YFEFLPVHRNNGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  426   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASLSEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+ +EE L+ VYR+ R  DK IGPL
Sbjct  486   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLTVEESLNTVYRQGRVSDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  546   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>emb|CDY29291.1| BnaC01g19430D [Brassica napus]
Length=612

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/541 (57%), Positives = 400/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKNVMPVITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+FLY+ +MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  130   RSFLYSFLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILCSD+ QSMY Q+L GL    +VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCSDSYQSMYSQMLCGLCQHHEVLRVGAVFASGFIRAIKFLEKHWTE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A++KI L P P+LA+ +E  C+  SW+GI+ RLWP  KY
Sbjct  250   LVRDIRTGTLSSSITDPSVREAVAKI-LKPSPKLAEFVESECKKKSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  368   YFEFLPVHRNTGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  425   VGDLLKVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASVSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLALEESLNTVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I  G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKIVEAGTFDKLMDYAICLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_010448236.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Camelina 
sativa]
Length=613

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/541 (57%), Positives = 397/541 (73%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  71    FKHVMPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDR  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  131   RSLLYSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKKRPF  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  191   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A+ +I L PDP+LAD +E  CR  SW+GI+ R+WP  KY
Sbjct  251   LARDIRTGTLSSEITDLSVREAVGEI-LKPDPKLADFVESECRKTSWQGIITRIWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+PNM 
Sbjct  310   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPNMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG   +  VTT++GLYRYR
Sbjct  369   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQGTQKXVTTYAGLYRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDV+ V GF N APQF F CR+NV LSID+DKT++ +L  ++  A   L P +A L EY
Sbjct  426   VGDVISVTGFKNNAPQFSFICRKNVALSIDADKTDEVELQNAVKNAVTHLVPFEASLSEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  486   TSYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  546   EIKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>ref|XP_010520883.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Tarenaya 
hassleriana]
Length=612

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/542 (57%), Positives = 400/542 (74%), Gaps = 7/542 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR +PVI YEDI+  I RIANGD    ++ +P++E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKRLMPVITYEDIQTDINRIANGDTSPILSSKPVSEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+DEGK MY  F+K+E  TP GL AR VLTSYYKS HFK R F
Sbjct  130   RSLLYSLLMPVMSQFVPGLDEGKGMYFLFIKSESKTPSGLLARPVLTSYYKSSHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    +VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHNEVLRVGAVFASGFIRAIKFLEKHWPE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG +S  I D   R A+ KI L P+P+LAD +E+ C   SW+GI+ RLWP  KY
Sbjct  250   LARDIRTGTVSAQITDPSVREAVGKI-LKPNPKLADFVEDECGKESWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ +N    +++N      E+E   Q +L DLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVHKNNGVTNSINVPKSLTEKE---QKELADLVDVKLGHEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+V GF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVTGFKNNAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDATLSEY  484

Query  535   TSYAD-TSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             TSYAD T+SVPGHYV++WE+   G   I   V +DCC+ IEE L+ VYR+ R  D+ IGP
Sbjct  485   TSYADTTTSVPGHYVLFWELTLKGKTPIPPSVFEDCCLTIEESLNSVYRQGRVSDRSIGP  544

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W
Sbjct  545   LEIKIVEQGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSCYFSPKSPKW  603

Query  178   KP  173
              P
Sbjct  604   AP  605



>ref|XP_009143243.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5 [Brassica 
rapa]
Length=612

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/541 (57%), Positives = 399/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKNVMPVITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+FLY+ +MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  130   RSFLYSFLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    +VLR+GAVFAS F+RAI FL+  W  
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHHEVLRVGAVFASGFIRAIKFLEKRWTE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A++KI L   P+LA+ +E  C+  SW+GI+ RLWP  KY
Sbjct  250   LVRDIRTGTLSSSITDPSVREAVAKI-LKQSPKLAEFVESECKKKSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  368   YFEFLPVHRNTGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  425   VGDLLKVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASVSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLALEESLNTVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  545   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_010240996.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Nelumbo 
nucifera]
Length=621

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/541 (57%), Positives = 400/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV+ YED++  I RIANGD    + G PI+E L SSGTS GE KLMP+I E+L+R
Sbjct  76    FKKVMPVVTYEDLQSDINRIANGDTSPILCGLPISEFLTSSGTSAGERKLMPTIEEELER  135

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+MDQ++PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  136   RSLLYSLLMPVMDQFVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSLHFKHRPY  195

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   +QVLR+GAVFAS F+RAI FL+ +W  
Sbjct  196   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKQVLRVGAVFASGFIRAIRFLEKHWSL  255

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I D   R A+ +I L PDPELAD IE  C   +W+GI+ RLWP  KY
Sbjct  256   LCNDIRTGAINPQITDPSVRDAVLRI-LKPDPELADFIESECTREAWQGIITRLWPNTKY  314

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFG+NL PL  P +V++TL+P M 
Sbjct  315   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGLNLNPLCKPNEVSYTLIPTMA  373

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N  F ++++      E+E   Q  LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  374   YFEFLPVHRNNGFTTSISVPKSLNEKE---QQDLVDLVDVKLGQEYELVVTTYAGLYRYR  430

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L+EY
Sbjct  431   VGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKDAINHLVPFDASLIEY  490

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+ H     I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  491   TSYADTTTIPGHYVLYWELRHDSTTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  550

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  551   EIKIVETGTFDKLMDYAISRGASINQYKTPRCVKF-APIVELLNSRVLSNYFSPKCPKWV  609

Query  175   P  173
             P
Sbjct  610   P  610



>gb|KHG29342.1| Indole-3-acetic acid-amido synthetase GH3.6 -like protein [Gossypium 
arboreum]
Length=613

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/541 (57%), Positives = 398/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+PY+ RIANGD    ++  PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  70    FKTIMPVITYEDIQPYVDRIANGDTSPILSSHPISEFLTSSGTSGGERKLMPTIEEELGR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSEAKTPSGLVARPVLTSYYKSTHFKDRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWRF  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG +   I D   R A++KI L PDP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  250   LCNDIRTGTIDSQINDQSVREAVTKI-LKPDPKLADFIEAECSKDSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YY++G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYTNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT+SGLYRYR
Sbjct  368   YFEFLPVQRNNGVTSSISVPKTLNEKE---QQELVDLVDVKLGQEYELVVTTYSGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVL IDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVAGFKNNAPQFNFICRKNVVLCIDSDKTDEVELQNAVKNAVNHLLPFGATLAEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTTTIPGHYVLYWELSLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S   + YFSP+ P W 
Sbjct  545   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRAVSSYFSPKCPKWF  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_009763610.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Nicotiana 
sylvestris]
Length=609

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/541 (57%), Positives = 402/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +  QPI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  66    FKKTMPVITYEDIQSVITRIANGDKSPILCSQPISEFLTSSGTSGGERKLMPTIEEELER  125

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++P +++GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R  
Sbjct  126   RSKLYSLLMPVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLPARPVLTSYYKSPHFKNRRP  185

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILCSD+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  186   DPYTNYTSPNETILCSDSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPL  245

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I D   R A+ KI L PD +LAD IE  C   SW+GI+ RLWP  KY
Sbjct  246   LCHDIRTGTINSQITDPSVREAVMKI-LKPDNKLADFIEVECSKNSWQGIITRLWPNTKY  304

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++VA+TL+P MG
Sbjct  305   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPTMG  363

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    ++++      E+E   Q +LVDLV V++G  YELVVTT++GLYRYR
Sbjct  364   YFEFLPVHRNNGVTNSISMPKSLNEKE---QQELVDLVDVKIGQEYELVVTTYAGLYRYR  420

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  421   VGDVLRVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVSHLMPFDAHVTEY  480

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV++WE+   G+  +   V +DCC+ IEE L+ VYR+ R+ DK IGPL
Sbjct  481   TSYADTTTIPGHYVLFWELNVNGSTPVPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPL  540

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  541   EIKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSSYFSPKCPKWV  599

Query  175   P  173
             P
Sbjct  600   P  600



>ref|XP_008789772.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Phoenix dactylifera]
Length=607

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/543 (57%), Positives = 399/543 (73%), Gaps = 16/543 (3%)
 Frame = -1

Query  1801  SDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDL  1622
             S FK  +PVI YED++P ILRIA+GD    I+G+PI+E L SSGTSGGE KLMP+I ++L
Sbjct  69    SAFKLLIPVITYEDLQPDILRIAHGDTSPIISGRPISEFLTSSGTSGGERKLMPTIDDEL  128

Query  1621  DRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCR  1442
             DRR+  Y+L+ P+M Q++PG+D GKAMYLYFVK+E  TP GL AR VLTSYYKS+HF  R
Sbjct  129   DRRSLFYSLMTPVMSQFVPGLDRGKAMYLYFVKSESRTPGGLVARPVLTSYYKSRHFLER  188

Query  1441  SFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNW  1262
              FDPYN +TSP+++ILC D+ QSMY QLL GLV R +V+R+GA+FAS F+RAI FL+ +W
Sbjct  189   PFDPYNTLTSPNEAILCLDSYQSMYAQLLCGLVQRAEVVRVGAIFASGFIRAIKFLEKHW  248

Query  1261  PSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKA  1082
             P LC DIRTG L   IAD   R A+ ++ L PDP LA +IE  C   SW+ I+ R+WP  
Sbjct  249   PRLCRDIRTGMLDPEIADRAVREAVERV-LRPDPGLAGQIEAECSKPSWEAIIRRIWPNT  307

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KYI+ ++TG+M+QY+P L +Y  G LPL CTMY SSECYFG+NL P+  P++VA+TL+P 
Sbjct  308   KYIDVIVTGAMAQYIPTLDFYGGG-LPLACTMYGSSECYFGINLNPMCKPSEVAYTLIPT  366

Query  901   MGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYR  722
             M YFEF+P+   G    + +            Q  LVDLV V+LG  YELVVTT+SGLYR
Sbjct  367   MAYFEFLPVRHAGNGAKDYD------------QRDLVDLVDVKLGQEYELVVTTYSGLYR  414

Query  721   YRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLV  542
             YR+GDVL+VAGF NKAPQF F  R NV LS+DS+KTN+ +LH ++ +A   LEP  A LV
Sbjct  415   YRVGDVLRVAGFKNKAPQFNFVRRNNVALSVDSEKTNEVELHAAVRSAANHLEPFGASLV  474

Query  541   EYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             EYTSYA+T S+PGHYV++WE + AG  A+   V +DCC+A+EE L+ VYR+ R  D  IG
Sbjct  475   EYTSYAETWSIPGHYVLFWE-LKAGGTAVPPSVFEDCCLAVEESLNSVYRQGRVCDSSIG  533

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVV+ GTFD LM   +++G+SINQYK PRC++S    +++L+  V++R+FSP+ P 
Sbjct  534   PLEIRVVEEGTFDKLMDYALSQGASINQYKAPRCVRSG-PVVELLDGRVQSRFFSPKSPK  592

Query  181   WKP  173
             W P
Sbjct  593   WVP  595



>ref|XP_003576014.2| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.13 
[Brachypodium distachyon]
Length=628

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/555 (57%), Positives = 403/555 (73%), Gaps = 31/555 (6%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             F+  VPV+ YED++PYI RIANG   S I   PITE+L SSGTSGG+PKLMP+  E+LDR
Sbjct  66    FRERVPVVEYEDVKPYIERIANGAPSSLICAAPITELLTSSGTSGGQPKLMPATEEELDR  125

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF+Y+L++P+M+ ++PG+D+G+ MYL FVK E++TP GL AR VLTSYYKS+HF+ R  
Sbjct  126   KTFMYSLLVPLMNAHVPGLDQGRGMYLLFVKPEITTPSGLVARPVLTSYYKSRHFRNRPD  185

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
              PY   TSPD++ILC D+ QSMY QLL GL  R +VLR GAVFASAFLRAI FL+ +W +
Sbjct  186   SPYTRYTSPDEAILCPDSQQSMYAQLLCGLSRRGEVLRAGAVFASAFLRAIKFLEAHWRA  245

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR GQ +  + D  C   +SK++  PDP LAD IE  C  +SW+GIV RLWP+ KY
Sbjct  246   LCADIRAGQSASRVHDPACLEGVSKVVAMPDPALADAIEAECSGSSWRGIVRRLWPRCKY  305

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ V+TGSM+QYVP L +Y  G LPL+ TMYASSEC+FG+NL+PL  P DVA+TLLPNM 
Sbjct  306   IDVVVTGSMAQYVPMLEFYG-GGLPLVSTMYASSECFFGINLRPLDRPEDVAYTLLPNMC  364

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             Y+EFI + ++G                 + + ++V LV VRLGCYYELVVTTF+GLYRYR
Sbjct  365   YYEFIEVEKDGE---------------EVREGEMVGLVGVRLGCYYELVVTTFAGLYRYR  409

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+LQV+GFHN APQF+F  RRNVVLS+D+DKT ++DL R++TAAK LL P + LL EY
Sbjct  410   VGDILQVSGFHNAAPQFRFVQRRNVVLSVDTDKTTEDDLLRAVTAAKPLLAPLRRLLSEY  469

Query  535   TSYADTSSVPGHYVIYWEIMHA---GAAAID-----------AQVLQDCCIAIEEQLDYV  398
             T+YAD SS+PGHYV++WE+       A A+D           A  +  CC ++E  LD V
Sbjct  470   TAYADASSIPGHYVLFWELTPNPLDAAPAVDEEEEEEEASRFAGAMAACCASVEAGLDAV  529

Query  397   YRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESN  218
             YRRCRS D+ +GPLEIRVV PG FD LM   ++ GSS+NQYKTPRCIK +  A+ +LE+ 
Sbjct  530   YRRCRSRDRSVGPLEIRVVSPGAFDALMDLCVSAGSSVNQYKTPRCIK-HPDAIAVLEAY  588

Query  217   VRARYFSPRDPAWKP  173
             V  R+FS   P W+P
Sbjct  589   VVGRFFSDAVPHWEP  603



>ref|XP_009408668.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Musa acuminata subsp. malaccensis]
Length=606

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/544 (57%), Positives = 402/544 (74%), Gaps = 21/544 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR VPV+ YED++P ILRIA+GD    ++G+PI+E L SSGTSGGE KLMP+I ++LDR
Sbjct  69    FKRLVPVVTYEDLQPDILRIAHGDTSPILSGRPISEFLTSSGTSGGERKLMPTIDDELDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MYL FVK+E  TP GL AR VLTSYYKS+HF  R F
Sbjct  129   RSLLYSLLMPVMSQFVPGLDKGKGMYLLFVKSEARTPGGLVARPVLTSYYKSRHFLSRPF  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILCSD+ QSMY QLL GL+ R QV+R+GAVFAS F+RAI FL+ +WPS
Sbjct  189   DPYNVYTSPNEAILCSDSYQSMYSQLLCGLIQRTQVVRVGAVFASGFIRAIRFLEKHWPS  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG+L   I D   R A++  +L PDPELA +IE  CR  SW+GI+ RLWP  KY
Sbjct  249   LCRDIRTGELDPDITDRAVREAVA-CVLRPDPELALQIETECRKGSWQGIISRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L +YSD  LPL CTMYASSECYFG+NL P   P+DV++TL+P M 
Sbjct  308   VDVIVTGAMAQYIPTLDFYSDC-LPLTCTMYASSECYFGLNLDPTCTPSDVSYTLIPTMA  366

Query  895   YFEFIPL---GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             YFEF+P+    +NG                 +    LVDLV V+LG  YELVVTT++GLY
Sbjct  367   YFEFLPIQKCSDNGGV--------------ELDHHDLVDLVDVKLGQEYELVVTTYAGLY  412

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYRIGDVL+VAGF NKAPQF F  R+NV LSIDSDKT++ +LH ++  A   LEP    L
Sbjct  413   RYRIGDVLRVAGFKNKAPQFNFIRRKNVALSIDSDKTDEVELHDAVGNAVNNLEPFGTSL  472

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
             VEYTSYADTSS+PGHYV++WE + AG   +   V +DC + +EE L+ VYR+ R  DK I
Sbjct  473   VEYTSYADTSSIPGHYVLFWE-LRAGGTPVPPSVFEDCGLTVEESLNSVYRQGRVCDKSI  531

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIRVV  GTFD LM   +++G+SINQYK PRC+++    + +L+  V++R+FSP+ P
Sbjct  532   GPLEIRVVAEGTFDKLMDYALSQGASINQYKAPRCVRAG-PVVDLLDGRVKSRFFSPKCP  590

Query  184   AWKP  173
              W+P
Sbjct  591   KWRP  594



>ref|XP_002869571.1| GH3.5/WES1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45830.1| GH3.5/WES1 [Arabidopsis lyrata subsp. lyrata]
Length=612

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/541 (57%), Positives = 402/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKNVMPVITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG++ GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQFVPGLENGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILCSD+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCSDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A+SKI L P+ +LA+ +E  C+ +SW+GI+ RLWP  KY
Sbjct  250   LVRDIRTGTLSSLITDPSVREAVSKI-LKPNSKLAEFVEFECKKSSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P+M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPSMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  368   YFEFLPVHRNNGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLCRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSID+DKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVTYLVPFDASLSEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+ +EE  + VYR+ R  DK IGPL
Sbjct  485   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLTVEESFNTVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   Y SP+ P W 
Sbjct  545   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVNSYLSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>gb|KDP39002.1| hypothetical protein JCGZ_00759 [Jatropha curcas]
Length=613

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/541 (57%), Positives = 403/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  70    FKKTLPVITYEDIQTDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+++GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMNQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKDRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL  R +VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQRNEVLRVGAVFASGFIRAIRFLEKHWQL  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I D   R A+ KI L PDP+LAD +E  CR  SW+GI+ R+WP  KY
Sbjct  250   LCDDIRTGTINPQITDLSVREAVMKI-LKPDPKLADFLETECRKDSWQGIITRIWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNLKP+  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLKPICKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    ++++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVQRNNGVTNSISMPKSLNEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATLAEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+S+PGHYV++WE+   G+  I   + +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTTSIPGHYVLFWELSLNGSTPIPPSIFEDCCLTIEESLNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + Y SP+ P W 
Sbjct  545   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSSYLSPKCPKWI  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_010062931.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Eucalyptus 
grandis]
 gb|KCW70081.1| hypothetical protein EUGRSUZ_F03386 [Eucalyptus grandis]
Length=611

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/541 (57%), Positives = 399/541 (74%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YED++P + RIANGD    +   PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  69    FKKTLPVITYEDLQPDVTRIANGDKSPILCSHPISEFLTSSGTSGGERKLMPTIEEELNR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M QY+P +++GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  129   RSLLYSLLMPVMSQYVPNLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKERPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+++W  
Sbjct  189   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQHKEVLRVGAVFASGFIRAIRFLENHWAL  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I D   R A+ +I L PDP+LAD IE  C   SW GI+ RLWP  KY
Sbjct  249   LCRDIRTGSINPEITDPAIREAVMRI-LKPDPKLADFIEAECGNDSWGGIITRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  308   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +  N     +      Q  LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  367   YFEFLPVHRNNGAAN--NPISMPKSLNEKEQRDLVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A++ EY
Sbjct  425   VGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNALNHLAPFDAIVAEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTS++PGHYV++WE+   G+  I   V +DCC+A+EE L+ VYR+ R  D+ IGPL
Sbjct  485   TSYADTSTIPGHYVLFWELSLNGSNPIPPSVFEDCCLAVEESLNSVYRQGRVSDRSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  L+IL S V ++YFSP+ P W 
Sbjct  545   EIKIVEPGTFDKLMDCAISYGASINQYKTPRCVKF-APLLEILNSRVVSKYFSPKCPKWV  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_004970208.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like 
[Setaria italica]
Length=616

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/549 (57%), Positives = 402/549 (73%), Gaps = 17/549 (3%)
 Frame = -1

Query  1819  VEEDLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMP  1640
              ++D V  F+R VP++ YE ++P ILRIANGD    ++ +PI+E L SSGTSGGE KLMP
Sbjct  66    ADDDAVEAFRRLVPLVTYEGLQPDILRIANGDTSPILSSKPISEFLTSSGTSGGERKLMP  125

Query  1639  SIAEDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKS  1460
             +IA++LDRR+ LY+L MP+M Q +PG+D+GKAMYL FVKAE  TP GL AR VLTSYY+S
Sbjct  126   TIADELDRRSLLYSLQMPVMSQSVPGLDKGKAMYLLFVKAESRTPGGLVARPVLTSYYRS  185

Query  1459  KHFKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAIS  1280
             + F  R  DPY D TSP+++ILC D+ QSMY QLL GLV+R  VLR+GAVFAS FLRAI 
Sbjct  186   RQFLERPHDPYTDYTSPNEAILCVDSYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIR  245

Query  1279  FLQHNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVY  1100
             FL+ +WP LC DIRTG L   I D   R A+ ++L A DP LA EIE  C  ASW+GI+ 
Sbjct  246   FLEKHWPRLCRDIRTGALDPEITDRAVRDAVGRVLRA-DPALAGEIEAECGRASWEGIIR  304

Query  1099  RLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVA  920
             RLWP+ KYI+ ++TG+MSQY+P L +Y  G LPL CTMYASSECYFG+NLKP+  P+DVA
Sbjct  305   RLWPRTKYIDVIVTGAMSQYIPTLEFYGGG-LPLACTMYASSECYFGLNLKPMCKPSDVA  363

Query  919   FTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTT  740
             +TL+P M YFEF+PL       SN   E             LVDLV V+LG  YELVVTT
Sbjct  364   YTLIPTMCYFEFLPL-----RCSNAKAEPS--------HRDLVDLVDVKLGHEYELVVTT  410

Query  739   FSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEP  560
             +SGL RYR+GDVL+VAGF N+AP F F  R+NV LSIDSDKT++ +LH +++ A + L P
Sbjct  411   YSGLCRYRVGDVLRVAGFKNEAPMFSFVRRQNVALSIDSDKTDETELHAAVSGAVQHLAP  470

Query  559   HQALLVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRS  380
               A LVEYTSYAD +++PGHYV++WE + AG  A+ A V +DCC+++EE L+ VYR+CR+
Sbjct  471   FGASLVEYTSYADAAAIPGHYVLFWE-LRAGTTAVPASVFEDCCLSVEEALNSVYRQCRA  529

Query  379   HDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYF  200
              D+ IGPLEIRVV  GTFD LM   I+ G+SINQYK PRC++     +++L++ V+ RYF
Sbjct  530   CDRSIGPLEIRVVSEGTFDKLMDYAISRGASINQYKAPRCVRPG-PVVELLDARVQGRYF  588

Query  199   SPRDPAWKP  173
             SP+ P W P
Sbjct  589   SPKCPKWSP  597



>emb|CDX89263.1| BnaA01g16300D [Brassica napus]
Length=602

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/541 (57%), Positives = 392/541 (72%), Gaps = 16/541 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKNVMPVITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+FLY+ +MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  130   RSFLYSFLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    +VLR+GAVFAS F+RAI FL+  W  
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHHEVLRVGAVFASGFIRAIKFLEKRWTE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R A++KI L   P+LA+ +E  C+  SW+GI+ RLWP  KY
Sbjct  250   LVRDIRTGTLSSSITDPSVREAVAKI-LKQSPKLAEFVESECKKKSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N                    Q +LVDLV V+LG  YELVVTT++GL RYR
Sbjct  368   YFEFLPVHRNTALTEK-------------EQQELVDLVDVKLGQEYELVVTTYAGLCRYR  414

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  415   VGDLLKVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDASVSEY  474

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE L+ VYR+ R  DK IGPL
Sbjct  475   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLALEESLNTVYRQGRVSDKSIGPL  534

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  535   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  593

Query  175   P  173
             P
Sbjct  594   P  594



>ref|XP_010924006.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Elaeis guineensis]
Length=607

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/541 (58%), Positives = 403/541 (74%), Gaps = 16/541 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR +PVI YED++P ILRIA+GD    ++G+PI+E L SSGTSGGE KLMP+I ++L R
Sbjct  71    FKRLIPVITYEDLQPDILRIAHGDPSPILSGRPISEFLTSSGTSGGERKLMPTIHDELVR  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+  Y+L+ P+M Q++PG+D+GKAMYLYFVK+E  TP GL AR VLTSYYKS+HF  R F
Sbjct  131   RSLFYSLMTPVMSQFVPGLDKGKAMYLYFVKSESRTPGGLVARPVLTSYYKSRHFLDRPF  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN +TSP+++ILCSD+ QSMY QLL GLV    V+R+GAVFAS FLRA  FL+ +WP 
Sbjct  191   DPYNILTSPNEAILCSDSYQSMYAQLLCGLVQSADVVRVGAVFASGFLRATKFLEKHWPR  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG L   I D   R A+ ++ L PDP LA  IE  C  ASW+GI+ R+WP  KY
Sbjct  251   LCCDIRTGMLDPQITDRTVREAVERV-LRPDPGLAGHIEFECSKASWQGIIRRIWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+M+QY+P L +Y  G LPL CTMY SSECYFG+NL P+  P++VA+TL+P M 
Sbjct  310   IDIIVTGAMAQYIPTLEFYGGG-LPLACTMYGSSECYFGINLNPMCKPSEVAYTLIPTMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P       + ++NK  ++++     Q  LVDLV V+LG  YELVVTT+SGLYRYR
Sbjct  369   YFEFLP-------VHHINKGAKDDD-----QRDLVDLVDVKLGQEYELVVTTYSGLYRYR  416

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F  R+NV LSIDSDKT++ +LH ++  A   LEP  A LVEY
Sbjct  417   VGDVLRVAGFKNKAPQFNFVRRKNVALSIDSDKTDEVELHAAVRNAVNHLEPFGASLVEY  476

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE + AG  A+   V +DCC+A EE L+ VYR+ R  DK IGPL
Sbjct  477   TSYADTSSIPGHYVLFWE-LKAGGTAVPPSVFEDCCLAAEESLNSVYRQGRVCDKSIGPL  535

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EIRVV+ GTFD LM   +++G+SINQYK PRC++S    +++L+  V++R+FSP+ P W 
Sbjct  536   EIRVVEEGTFDKLMDCALSQGASINQYKAPRCVRSG-PVVELLDGRVQSRFFSPKCPKWV  594

Query  175   P  173
             P
Sbjct  595   P  595



>gb|KDO47749.1| hypothetical protein CISIN_1g046696mg [Citrus sinensis]
Length=609

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/541 (56%), Positives = 398/541 (74%), Gaps = 13/541 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YED++PY+ RIANGD    +  QPI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  71    FKKVMPVITYEDLKPYVDRIANGDCSPILCSQPISEFLTSSGTSGGERKLMPTIEEELER  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP++DQ++PG+D+GKAMY  F+K+E  TP GL AR VLTSYYKS  FK R F
Sbjct  131   RSLLYSLLMPVVDQFVPGLDKGKAMYFLFIKSEAKTPGGLVARPVLTSYYKSSLFKDRPF  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    QVLR+GAVFAS F+RAI FL+ +WP 
Sbjct  191   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQNLQVLRVGAVFASGFIRAIRFLEKHWPL  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR G +   I D   R A+ KI L P+ +LAD IE  C   SWKGI+ RLWP  KY
Sbjct  251   LCNDIRKGTIDPKITDPSVREAVLKI-LKPNTQLADFIEAECSKESWKGIITRLWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFG+NL P+ +P++V++TLLP M 
Sbjct  310   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGLNLNPMCNPSEVSYTLLPTMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+        +L ++          Q +++DL  V LG  YELVVTT++GLYRYR
Sbjct  369   YFEFLPVNRKNGEPKSLKED----------QQQVLDLTDVELGQEYELVVTTYAGLYRYR  418

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+VAGF NKAPQF F CR+NV LSIDSDKT++ +L  ++  A   L P  A L+EY
Sbjct  419   VGDILKVAGFKNKAPQFNFVCRKNVALSIDSDKTDEVELQNAVKNAANHLSPFDASLIEY  478

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTS++PG YV++WEI  +GA  I   V +DCC++IEE L+ VYR+ R  DK IGPL
Sbjct  479   TSYADTSTIPGRYVLFWEISQSGATQIPPSVFEDCCLSIEESLNSVYRQGRVSDKSIGPL  538

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   +++G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  539   EIKLVESGTFDKLMDYALSQGASINQYKTPRCVKY-APIIELLNSKVVSNYFSPKCPKWV  597

Query  175   P  173
             P
Sbjct  598   P  598



>ref|XP_006447440.1| hypothetical protein CICLE_v10017968mg [Citrus clementina]
 ref|XP_006469782.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Citrus 
sinensis]
 gb|ESR60680.1| hypothetical protein CICLE_v10017968mg [Citrus clementina]
Length=609

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/541 (56%), Positives = 398/541 (74%), Gaps = 13/541 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YED++PY+ RIANGD    +  QPI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  71    FKKVMPVITYEDLKPYVDRIANGDCSPILCSQPISEFLTSSGTSGGERKLMPTIEEELER  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP++DQ++PG+D+GKAMY  F+K+E  TP GL AR VLTSYYKS  FK R F
Sbjct  131   RSLLYSLLMPVVDQFVPGLDKGKAMYFLFIKSEAKTPGGLVARPVLTSYYKSSLFKDRPF  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    QVLR+GAVFAS F+RAI FL+ +WP 
Sbjct  191   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQNLQVLRVGAVFASGFIRAIRFLEKHWPL  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR G +   I D   R A+ KI L P+ +LAD IE  C   SWKGI+ RLWP  KY
Sbjct  251   LCNDIRKGTIDPKITDPSVREAVLKI-LKPNTQLADFIEAECSKESWKGIITRLWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFG+NL P+ +P++V++TLLP M 
Sbjct  310   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGLNLNPMCNPSEVSYTLLPTMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+        +L ++          Q +++DL  V LG  YELVVTT++GLYRYR
Sbjct  369   YFEFLPVNRKNGEPKSLKED----------QQQVLDLTDVELGQEYELVVTTYAGLYRYR  418

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+VAGF NKAPQF F CR+NV LSIDSDKT++ +L  ++  A   L P  A L+EY
Sbjct  419   VGDILKVAGFKNKAPQFNFVCRKNVALSIDSDKTDEVELQNAVKNAANHLSPFDASLIEY  478

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTS++PG YV++WEI  +GA  I   V +DCC++IEE L+ VYR+ R  DK IGPL
Sbjct  479   TSYADTSTIPGRYVLFWEISQSGATQIPPSVFEDCCLSIEESLNSVYRQGRVSDKSIGPL  538

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   +++G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  539   EIKLVESGTFDKLMDYALSQGASINQYKTPRCVKY-APIIELLNSKVVSNYFSPKCPKWV  597

Query  175   P  173
             P
Sbjct  598   P  598



>ref|XP_002456458.1| hypothetical protein SORBIDRAFT_03g036680 [Sorghum bicolor]
 gb|EES01578.1| hypothetical protein SORBIDRAFT_03g036680 [Sorghum bicolor]
Length=610

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/547 (57%), Positives = 401/547 (73%), Gaps = 17/547 (3%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D V  F+R VP++ YE ++P ILRIA+GD    ++G+PI+E L SSGTSGGE KLMP+IA
Sbjct  67    DAVEAFRRVVPLVTYEGLQPDILRIASGDTSPILSGKPISEFLTSSGTSGGERKLMPTIA  126

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             ++LDRR+ LY+L MP+M Q +PG+D+GKAMYL FVKAE  TP GL AR VLTSYY+S+ F
Sbjct  127   DELDRRSLLYSLQMPVMSQSVPGLDKGKAMYLLFVKAESRTPGGLVARPVLTSYYRSRQF  186

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
               R  DPY + TSP+++ILC D+ QSMY QLL GLV+R  VLR+GAVFAS FLRA+ FL+
Sbjct  187   LERPHDPYTEYTSPNEAILCVDSYQSMYTQLLCGLVHRADVLRVGAVFASGFLRAVRFLE  246

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSA-MSKILLAPDPELADEIEEICRAASWKGIVYRL  1094
              +WP LC DIRTG L   I D   R A + ++L   +P LADEIE  C   SW+GI+ RL
Sbjct  247   KHWPRLCRDIRTGTLDPEITDRAVRDAVVGRVLRGANPALADEIEAECAGPSWEGIIRRL  306

Query  1093  WPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFT  914
             WP+ KYI+ ++TG+MSQY+P L +Y  G LPL CTMYASSECYFG+NLKP+  P DVA+T
Sbjct  307   WPRTKYIDVIVTGAMSQYIPTLEFYGGG-LPLACTMYASSECYFGLNLKPMCKPGDVAYT  365

Query  913   LLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             L+P M YFEF+PL                + +       LV LV V+LG  YELVVTT+S
Sbjct  366   LIPTMCYFEFLPL-------------QCSDGKAEPSHRDLVGLVDVKLGHEYELVVTTYS  412

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYR+GDVL+VAGF N+AP FKF  R+NV LSIDSDKT++ +LH +++ A + L P  
Sbjct  413   GLYRYRVGDVLRVAGFKNEAPMFKFIRRQNVALSIDSDKTDETELHAAVSGAVQHLAPFG  472

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHD  374
             A LVEYTSYAD +++PGHYV++WE + AG+ A+ A V +DCC+++EE L+ VYR+CR+ D
Sbjct  473   ASLVEYTSYADAATIPGHYVLFWE-LRAGSTAVPASVFEDCCLSVEEALNSVYRQCRACD  531

Query  373   KCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSP  194
             K IGPLEIRVV  GTFD LM   I+ G+SINQYK PRC++     +++L++ V+A+YFSP
Sbjct  532   KSIGPLEIRVVSEGTFDKLMDYAISRGASINQYKAPRCVRPG-PVVELLDARVQAKYFSP  590

Query  193   RDPAWKP  173
             + P W P
Sbjct  591   KCPKWSP  597



>gb|KHG06705.1| Indole-3-acetic acid-amido synthetase GH3.6 -like protein [Gossypium 
arboreum]
Length=604

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/541 (57%), Positives = 398/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+P+I RIANGD    ++   I+E L SSGTSGGE K+MP+I E+L R
Sbjct  61    FKKTMPVITYEDIQPHIDRIANGDTSPILSSNAISEFLTSSGTSGGERKMMPTIEEELGR  120

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  121   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKSEAKTPSGLVARPVLTSYYKSTHFKDRPY  180

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  181   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWRF  240

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG +   I D   R A++KI L PDP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  241   LCNDIRTGTIDSQINDQSVREAVTKI-LKPDPKLADFIEAECSKDSWQGIITRLWPNTKY  299

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YY++G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  300   VDVIVTGTMSQYIPTLDYYTNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMA  358

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT+SGLYRYR
Sbjct  359   YFEFLPVQRNNGVNSSISVPKTLNEKE---QQELVDLVDVKLGQEYELVVTTYSGLYRYR  415

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVL IDSDKT++ +L  ++  A   L P  A L EY
Sbjct  416   VGDVLRVAGFKNNAPQFNFICRKNVVLCIDSDKTDEVELQNAVKNAVNHLLPFDATLAEY  475

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  476   TSYADTTTIPGHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVCDKSIGPL  535

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S   + +FSP+ P W 
Sbjct  536   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRAVSSFFSPKCPKWF  594

Query  175   P  173
             P
Sbjct  595   P  595



>ref|XP_004961601.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.4-like 
[Setaria italica]
Length=626

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/545 (56%), Positives = 394/545 (72%), Gaps = 16/545 (3%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V  F R  P++ YEDI P +LRIANGD    ++G+PI E L SSGTSGGE KLMPSIA++
Sbjct  68    VEAFLRAAPLVTYEDILPDVLRIANGDTSPILSGKPIREFLTSSGTSGGERKLMPSIADE  127

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             +DRR+ +Y L+MP+M Q +PG+D+GK MYLYFVKAE  TP GLPAR VLTS+Y+S+HF  
Sbjct  128   MDRRSLMYTLLMPVMSQAVPGLDKGKCMYLYFVKAESRTPAGLPARPVLTSFYRSRHFLE  187

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DPY   TSPD+++LC D+ QSMY  LL G+V+R  VLR+GAVFAS FLRAI FL+ +
Sbjct  188   RPHDPYTVYTSPDEAVLCVDSYQSMYAHLLCGIVHRADVLRVGAVFASGFLRAIRFLEKH  247

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             WP LC DIR+G L   + D   R+A+ ++L A DP LAD +E  C   SW+GI+ R+WP 
Sbjct  248   WPRLCRDIRSGTLDAEVTDRSVRAAVERVLRA-DPALADAVEAECARPSWEGIIRRVWPN  306

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYI+ ++TG+M+QY+P L +Y  G LPL CTMYASSECYFG+NL P+  P+DVA+TL+P
Sbjct  307   TKYIDVIVTGAMAQYIPTLEFYGGG-LPLTCTMYASSECYFGINLNPMCKPSDVAYTLIP  365

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQS-KLVDLVHVRLGCYYELVVTTFSGL  728
              MGYFEF+P+  +G                + PQ   LV+LV V+LG  YELV+TT+SGL
Sbjct  366   TMGYFEFLPVPSSGG------------SPAAEPQPCDLVNLVDVKLGHEYELVLTTYSGL  413

Query  727   YRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQAL  548
             YRYR+GDVL+VAGF N+AP F F  R NVVLSIDSDKT++ +LH ++  A + L P  A 
Sbjct  414   YRYRVGDVLRVAGFKNQAPMFNFVRRNNVVLSIDSDKTDEAELHAAVAGAVQHLAPFGAS  473

Query  547   LVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             LVEYTSYAD +++PGHYV++WE+   GA  + A V +DCC+A+EE L+ VYR+ R+ D+ 
Sbjct  474   LVEYTSYADAATIPGHYVLFWELRGGGATPVPASVFEDCCLAVEEALNSVYRQGRAADRS  533

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             IGPLEIRVV  GTFD LM   +  G+SINQYK PRC++     +++L+  V+ARY SP+ 
Sbjct  534   IGPLEIRVVSEGTFDKLMDYALAHGASINQYKAPRCVRPG-PLVELLDGRVQARYLSPKC  592

Query  187   PAWKP  173
             P W P
Sbjct  593   PKWSP  597



>ref|XP_006475255.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Citrus 
sinensis]
Length=628

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/546 (57%), Positives = 400/546 (73%), Gaps = 20/546 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD  S +  +PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  68    FKKTMPVITYEDIQADINRIANGDTSSILCSKPISEFLTSSGTSGGERKLMPTIEEELER  127

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q+IPG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  128   RSLLYSLLMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPY  187

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  188   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPL  247

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             +  DIRTG +   I D   R A+ KI L P+P+LAD IE  CR   W+GI+ RLWP  KY
Sbjct  248   VVKDIRTGTIDSQITDPSVRDAVMKI-LKPNPKLADFIENECRKDCWQGIITRLWPNTKY  306

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  307   VDVIVTGTMSQYIPILDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLVPTMA  365

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQS-------KLVDLVHVRLGCYYELVVTTF  737
             YFEF+P+  N    +++          S+P+S       +LVDLV V+LG  YELVVTT+
Sbjct  366   YFEFLPVHRNNGVANSI----------SMPKSLNEKERQELVDLVDVKLGQEYELVVTTY  415

Query  736   SGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPH  557
             +GLYRYR+GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P 
Sbjct  416   AGLYRYRVGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPF  475

Query  556   QALLVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSH  377
              A + EYTSYADT++VPGHYV+YWE+   G   I   V +DCC+ IEE L+ VYR+ R  
Sbjct  476   DAAVSEYTSYADTTTVPGHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVC  535

Query  376   DKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFS  197
             DK IGPLEI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFS
Sbjct  536   DKSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVSNYFS  594

Query  196   PRDPAW  179
             P+ P W
Sbjct  595   PKCPKW  600



>ref|XP_007214798.1| hypothetical protein PRUPE_ppa002986mg [Prunus persica]
 gb|EMJ15997.1| hypothetical protein PRUPE_ppa002986mg [Prunus persica]
Length=614

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/541 (57%), Positives = 399/541 (74%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI   I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  70    FKKIIPVIKYEDIEADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELER  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q +P +D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQSVPELDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKRRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++V+R+GAVFAS F+RAI FL+ +WPS
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVIRVGAVFASGFIRAIRFLEKHWPS  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI +G L+  I DS  R A+ K  L PDP+LA+ IE  C   SW+GI+ RLWP  KY
Sbjct  250   LCKDIASGTLNPQITDSSVREAVMKT-LKPDPKLANYIETECGEKSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFG+NL PL  P++V++TL+P+MG
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGLNLNPLCKPSEVSYTLVPSMG  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N     N N     +      Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVQRNNGI--NSNSLSVPKALNEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  426   VGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQTAVKNAVSHLVPFDATVSEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TS+ADTS++PGHYV++WE+   G+  I   V +DCC+A+EE L+ VYR+ R+ DK IGPL
Sbjct  486   TSFADTSTIPGHYVLFWELCLNGSTPIPPSVYEDCCLAVEESLNSVYRQGRASDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  546   EIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSNYFSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>ref|XP_007043391.1| Auxin-responsive GH3 family protein [Theobroma cacao]
 gb|EOX99222.1| Auxin-responsive GH3 family protein [Theobroma cacao]
Length=618

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/542 (57%), Positives = 401/542 (74%), Gaps = 8/542 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV++YED++P I RIANGD    +  QPI+E L SSGTS GE KLMP+I E+LDR
Sbjct  75    FKKVIPVVSYEDLKPDIERIANGDTSPILCSQPISEFLTSSGTSAGERKLMPTIEEELDR  134

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  135   RSLLYSLLMPVMNQFVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSLHFKDRPY  194

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC ++ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  195   DPYTNYTSPNETILCVNSYQSMYAQLLCGLCQNKEVLRVGAVFASGFIRAIQFLEKHWSL  254

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR+G +   I D+  R A+ KI L P+ +LAD IE  C   SWKGI+ RLWP  KY
Sbjct  255   LCRDIRSGNIHSKITDASVREAVLKI-LKPNSKLADFIEAECSKGSWKGIITRLWPNTKY  313

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFG+NL PL  P++V++TL+P M 
Sbjct  314   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGINLNPLCKPSEVSYTLIPTMA  372

Query  895   YFEFIPL-GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             YFEF+P+ G+ G   SN       ++E    + +LVDLV V+LG  YELVVTT++GLYRY
Sbjct  373   YFEFLPVNGQKGLTGSNSEPASLNDKE----KQELVDLVSVKLGQDYELVVTTYAGLYRY  428

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GD+L+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L+E
Sbjct  429   RVGDILRVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQHAVKNAANQLLPFDASLIE  488

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTSYADTS++PGHYV+YWEI    A  I A V +DCC  +EE L+ VYR+ R  DK IGP
Sbjct  489   YTSYADTSAIPGHYVLYWEISVNDATLIPASVFEDCCFTVEESLNSVYRQGRVWDKSIGP  548

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEI++V+ GTFD LM   +++G+SINQYKTPRC+K     +++L S V + YFSP+ P W
Sbjct  549   LEIKIVENGTFDKLMDFALSQGASINQYKTPRCVKY-VPIIELLNSRVISSYFSPKCPRW  607

Query  178   KP  173
              P
Sbjct  608   TP  609



>emb|CDM84494.1| unnamed protein product [Triticum aestivum]
Length=613

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/546 (57%), Positives = 404/546 (74%), Gaps = 17/546 (3%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D V  F+RCVP++ YED++P ILRIANGD    ++G+PI+E L SSGTSGGE KLMP+IA
Sbjct  68    DAVDAFRRCVPLVTYEDLQPDILRIANGDTSPILSGKPISEFLTSSGTSGGERKLMPTIA  127

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             ++LDRR+ LY+L+MP+M Q +PG+D+GKAMYL FVKAE  TP GL AR VLTSYY+S+ F
Sbjct  128   DELDRRSLLYSLLMPVMSQSLPGLDKGKAMYLLFVKAESRTPGGLAARPVLTSYYRSRQF  187

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
               R  DPY   TSP+++ILC D+ QSMY QLL GLV+R  VLR+GAVFAS  LRAI FL+
Sbjct  188   LDRPHDPYTAYTSPNKAILCVDSYQSMYAQLLCGLVHRTDVLRVGAVFASGLLRAIRFLE  247

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
              +WP LC DIRTG+L   I D   R A+ ++L A +P LA EIE  C   SW+GI+ RLW
Sbjct  248   KHWPRLCHDIRTGELDPEITDHAVRDAVGRLLHA-NPALASEIEAECSKPSWEGIIRRLW  306

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             P+ KYI+ ++TG+MSQY+  L +Y  G LPLICTMYASSECYFG+NL P+  P DVA+TL
Sbjct  307   PRTKYIDVIVTGAMSQYIQTLEFYGGG-LPLICTMYASSECYFGLNLNPMCKPGDVAYTL  365

Query  910   LPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             +P M +FEF+P+       SN N E             LVDLV V+LG  YELVVTTFSG
Sbjct  366   IPTMCHFEFLPV-----HCSNANAEPS--------HRDLVDLVDVKLGHDYELVVTTFSG  412

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             L RYR+GDVL+VAGF N+AP F F  RRNV LSIDSDKT++ +LH ++++A + L P  A
Sbjct  413   LCRYRVGDVLRVAGFKNEAPMFSFVRRRNVALSIDSDKTDETELHTAVSSAVQHLAPFGA  472

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
              LVEYTSYADT+++PGHYV++WE +  G+ A+ A V ++CC+++EE L+ VYR+CR+ D+
Sbjct  473   SLVEYTSYADTAAIPGHYVLFWE-LREGSTAVPASVFEECCLSVEEALNSVYRQCRACDR  531

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              IGPLEIRVV  GTF+ LM   +++G+SINQYK PRC++     +++L++ ++A YFSP+
Sbjct  532   SIGPLEIRVVSEGTFEKLMDYALSQGASINQYKAPRCVRPG-PVVELLDARMQASYFSPK  590

Query  190   DPAWKP  173
              P W P
Sbjct  591   CPKWSP  596



>gb|KHG01600.1| Uncharacterized protein F383_23170 [Gossypium arboreum]
Length=594

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/549 (58%), Positives = 397/549 (72%), Gaps = 34/549 (6%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VPV+ YEDI+PYI RIANGD  + I+ +PI E+L SSGTSGG+PK+MPS AEDL R
Sbjct  69    FKKTVPVVNYEDIKPYIERIANGDSSNIISAEPIIELLTSSGTSGGQPKMMPSTAEDLHR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             +TF YNL++P+M++Y+ G+DEGKAMYL FVK E  TP GL AR VLTSYYKS +F+ R F
Sbjct  129   KTFFYNLLVPVMNKYVDGLDEGKAMYLLFVKPETKTPSGLMARPVLTSYYKSNNFQNRPF  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             + +N  TSPD++ILCSD+ QSMYCQLL GLV R++VLR+GAVFASAFLRAI FL+ NW  
Sbjct  189   NRFNVFTSPDETILCSDSKQSMYCQLLCGLVQRQEVLRVGAVFASAFLRAIKFLEDNWKE  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC +IRTG +S  I D  CR  +S +L  P PELAD IE  C                  
Sbjct  249   LCSNIRTGHVSDWITDPGCRKVVSLVLNKPKPELADLIEHEC------------------  290

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
                  + SM+QYV  L YYS G LPL+ TMYASSECYFG+N KPLS P DV++TL+PNM 
Sbjct  291   -----SSSMAQYVSTLEYYSGG-LPLVSTMYASSECYFGINFKPLSKPWDVSYTLIPNMA  344

Query  895   YFEFIPL---GENGTFLSNLN---KegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             YFEF+P+    E+G      N   KE   E+E      + V+LV V+LG YYELVVTTF+
Sbjct  345   YFEFLPVKEKNEDGAQYVQCNGVCKENCMEKETEKEDVETVELVDVKLGQYYELVVTTFT  404

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYR+GD+L V GFHNKAPQF+F  RRNVVLSID+DKT++EDL +++T AK ++E   
Sbjct  405   GLYRYRVGDILMVTGFHNKAPQFRFVHRRNVVLSIDTDKTSEEDLLKAVTKAKVIVESLG  464

Query  553   ALLVEYTSYADTSSVPGHYVIYWEIMHAGA---AAIDAQVLQDCCIAIEEQLDYVYRRCR  383
              LL+EYTSYADTSS+PGHYV++WE+   G      +D ++++ CC  +EE LD VYRRCR
Sbjct  465   ILLIEYTSYADTSSIPGHYVLFWELTSKGNNHLPVLDPKIMEQCCSTVEESLDSVYRRCR  524

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
               D  IGPLEIRVV+ GTFD LM   +++GSS+NQYKTPRCIKS   A+ IL+S V AR+
Sbjct  525   RKDNSIGPLEIRVVQHGTFDALMDFCVSQGSSVNQYKTPRCIKS-GEAINILDSRVVARF  583

Query  202   FSPRDPAWK  176
             FS + P W+
Sbjct  584   FSQKAPFWE  592



>ref|XP_006452114.1| hypothetical protein CICLE_v10007746mg [Citrus clementina]
 gb|ESR65354.1| hypothetical protein CICLE_v10007746mg [Citrus clementina]
 gb|KDO74387.1| hypothetical protein CISIN_1g006862mg [Citrus sinensis]
Length=628

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/546 (57%), Positives = 399/546 (73%), Gaps = 20/546 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  68    FKKTMPVITYEDIQADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELER  127

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q+IPG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  128   RSLLYSLLMPVMSQFIPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSCHFKERPY  187

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  188   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWPL  247

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             +  DIRTG +   I D   R A+ KI L P+P+LAD IE  CR   W+GI+ RLWP  KY
Sbjct  248   VVKDIRTGTIDSQITDPSVRDAVMKI-LKPNPKLADFIENECRKDCWQGIITRLWPNTKY  306

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  307   VDVIVTGTMSQYIPILDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLVPTMA  365

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQS-------KLVDLVHVRLGCYYELVVTTF  737
             YFEF+P+  N    +++          S+P+S       +LVDLV V+LG  YELVVTT+
Sbjct  366   YFEFLPVHRNNGVANSI----------SMPKSLNEKERQELVDLVDVKLGQEYELVVTTY  415

Query  736   SGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPH  557
             +GLYRYR+GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P 
Sbjct  416   AGLYRYRVGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPF  475

Query  556   QALLVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSH  377
              A + EYTSYADT++VPGHYV+YWE+   G   I   V +DCC+ IEE L+ VYR+ R  
Sbjct  476   DAAVSEYTSYADTTTVPGHYVLYWELSLNGTTPIPPSVFEDCCLTIEESLNSVYRQGRVC  535

Query  376   DKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFS  197
             DK IGPLEI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFS
Sbjct  536   DKSIGPLEIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVSNYFS  594

Query  196   PRDPAW  179
             P+ P W
Sbjct  595   PKCPKW  600



>ref|XP_009615928.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615930.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009615931.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 
X3 [Nicotiana tomentosiformis]
Length=609

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/541 (57%), Positives = 401/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +  QPI+E L SSGTSGGE KLMP+I E+L R
Sbjct  66    FKKIMPVITYEDIQSDITRIANGDKSPILCSQPISEFLTSSGTSGGERKLMPTIEEELVR  125

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++P +++GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R  
Sbjct  126   RSKLYSLLMPVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLPARPVLTSYYKSPHFKNRRP  185

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILCSD+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  186   DPYTNYTSPNETILCSDSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWSL  245

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I D   R A+ KI L PD +LAD IE  C   SW+GI+ RLWP  KY
Sbjct  246   LCHDIRTGTINSQITDPSVREAVMKI-LKPDNKLADFIEVECSKKSWQGIITRLWPNTKY  304

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++VA+TL+P MG
Sbjct  305   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPTMG  363

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    ++++      E+E   Q +LVDLV V++G  YELVVTT++GLYRYR
Sbjct  364   YFEFLPVHRNNGVTNSISMPKSLNEKE---QQELVDLVDVKIGQEYELVVTTYAGLYRYR  420

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSID+DKT++ +L  ++  A   L P  A ++EY
Sbjct  421   VGDVLRVAGFKNNAPQFNFICRKNVVLSIDADKTDEVELQNAVKNAVSHLMPFDAHVIEY  480

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV++WE+   G+  +   V +DCC+ IEE L+ VYR+ R+ DK IGPL
Sbjct  481   TSYADTTTIPGHYVLFWELNVNGSTPVPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPL  540

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  541   EIKIVENGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSSYFSPKCPKWV  599

Query  175   P  173
             P
Sbjct  600   P  600



>ref|XP_009621450.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
tomentosiformis]
Length=603

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/541 (56%), Positives = 394/541 (73%), Gaps = 12/541 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +P++ YED++P I RIA+GD  S +  QPI+E L SSGTSGGE KLMP++ E+L R
Sbjct  67    FKKIMPLVTYEDLKPDIDRIADGDRSSILCSQPISEFLTSSGTSGGERKLMPTVEEELGR  126

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+MDQ++P + +GK MY  F+K+E  TP GL AR VLTSYYKS +FK R +
Sbjct  127   RSLLYSLLMPVMDQFVPDLHKGKGMYFLFIKSEAKTPGGLLARPVLTSYYKSSYFKKRPY  186

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    QVLR+GAVFAS F+RAI FL+ +WP 
Sbjct  187   DPYTNYTSPNETILCLDSYQSMYSQILCGLCQNTQVLRVGAVFASGFIRAIRFLEKHWPI  246

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI+TG L+  I D E R A+ KI L P+P+LA+ IE  C   SWKGI+ RLWP  KY
Sbjct  247   LCNDIKTGSLNPQITDPEVREAVMKI-LKPNPKLAEFIETECCKESWKGIIPRLWPNTKY  305

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YY +  LPL+CTMYASSECYFG+NL PL  P++VA+TL+P MG
Sbjct  306   VDVIVTGTMSQYIPTLNYYGN-DLPLVCTMYASSECYFGINLNPLCKPSEVAYTLIPTMG  364

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+          N         +  ++ LVDLV V LG  YELVVTT++GLYRYR
Sbjct  365   YFEFLPVAREDEGAEKAN---------TYDKNDLVDLVDVELGHEYELVVTTYAGLYRYR  415

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+VAGF NKAPQF F CR+NV LSIDSDKT++ +LH ++  A   L P +A L EY
Sbjct  416   VGDILKVAGFKNKAPQFHFVCRKNVALSIDSDKTDEVELHDAVVKASIHLLPFEASLTEY  475

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TS++DTS++PGHYV+YWEI  +    I   V QDCC+ IEE L+ VYR+CR  DK IGPL
Sbjct  476   TSFSDTSAIPGHYVLYWEINKSSETIIPTTVFQDCCLTIEESLNSVYRQCRVSDKSIGPL  535

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYK PRC+K  +  +++L S V A YFSP+ P W 
Sbjct  536   EIKVVENGTFDKLMDYAISNGASINQYKAPRCVKY-APIIELLNSRVIANYFSPKCPNWV  594

Query  175   P  173
             P
Sbjct  595   P  595



>gb|KHG17209.1| Indole-3-acetic acid-amido synthetase GH3.6 -like protein [Gossypium 
arboreum]
Length=615

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/540 (57%), Positives = 401/540 (74%), Gaps = 8/540 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV+ YED++P I RIANGD    +  QPI+E L SSGTS GE KLMP+I E+L R
Sbjct  72    FKKVIPVVTYEDLKPDIERIANGDTSPILCSQPISEFLTSSGTSAGERKLMPTIEEELGR  131

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  FVK+E  TP GL AR VLTSYYKS HFK R  
Sbjct  132   RSLLYSLLMPVMSQFLPGLDKGKGMYFLFVKSEAKTPGGLVARPVLTSYYKSSHFKNRPN  191

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP ++ILC D+ QSMY QLL GL     V+R+GAVFAS F+RAI FL+ +W  
Sbjct  192   DPYTNYTSPKETILCLDSYQSMYSQLLCGLFQNEDVVRVGAVFASGFIRAIQFLEKHWSL  251

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG +   I D   R A+ KI L P+P+LAD +E  C   SWKGI+ RLWP+ KY
Sbjct  252   LCKDIRTGTIDSKITDPSVREAVMKI-LKPNPKLADFVEAECSKGSWKGIITRLWPETKY  310

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+PAL YYS+  LPL+CTMYASSECYFG+NL PL  P++V++TL+PNM 
Sbjct  311   IDVIVTGTMSQYIPALDYYSNA-LPLVCTMYASSECYFGINLNPLCSPSEVSYTLIPNMA  369

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+        +++      ++E   + +LVDLVHV+LG  YELVVTT++GLYRYR
Sbjct  370   YFEFLPVTRKDELTGSISGPTALNDKE---KQQLVDLVHVKLGQDYELVVTTYAGLYRYR  426

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSI-TAAKKLLEPHQALLVE  539
             +GD+L+V+GF NKAPQF F CR+NV LSIDSDKT++ +L  ++ TAA +LL+ ++A LVE
Sbjct  427   VGDILRVSGFKNKAPQFNFICRKNVALSIDSDKTDEVELQNAVKTAANQLLQ-YEASLVE  485

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTSYADTS++PGHYV++WE+    +  I   V +DCC  +EE L+ VYR+ R  DK IGP
Sbjct  486   YTSYADTSAIPGHYVLFWELSVKDSTLIAPSVFEDCCFTVEESLNSVYRQGRVCDKSIGP  545

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIRVV+ GTFD+LM   +++GSSINQYKTPRC+K  +  +++L S V + YFSP+ P W
Sbjct  546   LEIRVVENGTFDMLMDFALSQGSSINQYKTPRCVKY-APIIELLSSRVISSYFSPKCPRW  604



>gb|AGH61310.1| indole-3-acetic acid amido synthetase [Morus alba var. multicaulis]
Length=611

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/541 (55%), Positives = 396/541 (73%), Gaps = 10/541 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+P I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E++ R
Sbjct  72    FKKVIPVITYEDIQPDIKRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEEMGR  131

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+++GK MY  F+K+E  TP GL AR VLT+YYKS HF+ R +
Sbjct  132   RSLLYSLLMPVMSQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTAYYKSSHFRNRPY  191

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  192   DPYTNYTSPNEAILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWRV  251

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC D+RTG L+  I D   R A+ KI L PDP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  252   LCNDVRTGNLNPQITDPAVRDAVGKI-LQPDPKLADFIESECSKESWQGIITRLWPNTKY  310

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL +P +V++TL+P M 
Sbjct  311   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLYEPCEVSYTLIPTMA  369

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  +   ++ +          S    +LV+L  V+LG  YELVVTT++GLYRYR
Sbjct  370   YFEFLPVNRSNNSINGVTN-------NSKEHLELVNLADVKLGQEYELVVTTYAGLYRYR  422

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSID+DKT++ +L  ++  A   L P  A + EY
Sbjct  423   VGDVLRVAGFKNKAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVNHLVPFDANVSEY  482

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYA+T+++PGHYV+YWE+   G+  I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  483   TSYANTTTIPGHYVLYWEMSLKGSTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  542

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V A YFSP+ P W 
Sbjct  543   EIKIVEAGTFDKLMDYAISRGASINQYKTPRCVKF-APIVELLNSRVEAEYFSPKCPKWV  601

Query  175   P  173
             P
Sbjct  602   P  602



>ref|XP_011009953.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Populus 
euphratica]
Length=611

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/541 (56%), Positives = 395/541 (73%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VPVI YEDI+P I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  69    FKKAVPVITYEDIQPDINRIANGDASQILCSKPISEFLTSSGTSGGERKLMPTIEEELGR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+++GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  129   RSLLYSLLMPVMTQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSTHFKDRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  189   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWKL  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG +   I D   R A+ KIL + DP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  249   LANDIRTGIIDPQITDPSVREAVMKILKS-DPKLADFIEAECSKESWQGIITRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL P+  P++V++TL+P M 
Sbjct  308   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N      +N     +      Q +LVDLV V+L   YELVVTT++GLYRYR
Sbjct  367   YFEFLPVHRNN---GAINSVSMPKSLNEKEQQELVDLVDVKLDQEYELVVTTYAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  424   VGDVLRVAGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQSAVKNAVNHLIPFDATLAEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV++WE+   G+  I   V +DCC+ IEE L+ VYR+ R+ DK IGPL
Sbjct  484   TSYADTTTIPGHYVLFWELSLNGSTPIPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPL  543

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  544   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVTCYFSPKCPKWA  602

Query  175   P  173
             P
Sbjct  603   P  603



>ref|XP_009377289.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Pyrus 
x bretschneideri]
Length=614

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/541 (56%), Positives = 394/541 (73%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  70    FKKIMPVIKYEDIQSDINRIANGDTSHILCSKPISEFLTSSGTSGGERKLMPTIEEELER  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M QY+PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTI  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI +G L+  I D   R A+ KI L PDP+LA  IE  CR  SW GI+ RLWP  KY
Sbjct  250   LCKDIASGTLNPQITDPSVREAVMKI-LKPDPKLASFIEGECRKDSWHGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P MG
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMG  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N     N N     +      Q +LVDL  V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVQRNNGI--NTNPVSVRKSLNEKEQQELVDLADVKLGQEYELVVTTYAGLYRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VA F NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  426   VGDVLRVASFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATVTEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV++WE+   G   I   V +DCC+ +EE L+ VYR+ R+ DK IGPL
Sbjct  486   TSYADTTTIPGHYVLFWELGLNGTTPIPPSVFEDCCLTVEESLNSVYRQGRASDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L + V + Y+SP+ P W 
Sbjct  546   EIKIVETGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLTTRVVSNYYSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>ref|XP_011097950.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Sesamum 
indicum]
Length=613

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/539 (56%), Positives = 394/539 (73%), Gaps = 7/539 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV+ YEDI P I RIANGD    +  +PI+E L SSGTSGGE K+MP+I E+L R
Sbjct  69    FKKIMPVVTYEDILPDINRIANGDMSPILCSRPISEFLTSSGTSGGERKMMPTIEEELGR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  F+K E  TP GL AR VLTSYYKS HFK R F
Sbjct  129   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFIKCETKTPGGLLARPVLTSYYKSSHFKDRPF  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  189   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTL  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG L+ +I D   R A+S+I L P+P+LAD +E  C   SW+GI+ RLWP  KY
Sbjct  249   LCHDIRTGTLNSLITDPSVRDAVSRI-LKPEPKLADFVESECSKESWQGIITRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P+DVA+TL+P M 
Sbjct  308   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLRKPSDVAYTLIPTMA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N +   ++             Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  367   YFEFLPVYRNNSITHSI---AIPRSLNEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSID+DKT++  L  ++  A   L P  A L EY
Sbjct  424   VGDVLRVAGFKNNAPQFNFVCRKNVVLSIDTDKTDEVQLQNAVKNAVSHLMPFDARLTEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE++ +G   I   V +DCC+ IEE LD VYR+ R  +  IGPL
Sbjct  484   TSYADTTTIPGHYVLYWELIQSGTIPIPPSVFEDCCLTIEESLDTVYRQNRVFE-AIGPL  542

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + +FSP+ P W
Sbjct  543   EIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSSFFSPKCPKW  600



>ref|XP_009779551.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana 
sylvestris]
Length=603

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/541 (56%), Positives = 396/541 (73%), Gaps = 12/541 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV+ YED++P I RIA+GD  S +  QPI+E L SSGTSGGE KLMP++ E+L R
Sbjct  67    FKKIMPVVTYEDLKPDIDRIADGDRSSILCSQPISEFLTSSGTSGGERKLMPTVEEELGR  126

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+MDQ++P + +GK MY  F+K+E  TP GL AR VLTSYYKS +FK R +
Sbjct  127   RSLLYSLLMPVMDQFVPDLHKGKGMYFLFIKSEAKTPGGLLARPVLTSYYKSSYFKKRPY  186

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    QVLR+GAVFAS F+RAI FL+ +WP 
Sbjct  187   DPYTNYTSPNETILCLDSYQSMYSQILCGLCQNTQVLRVGAVFASGFIRAIRFLEKHWPI  246

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI+TG L+  I D E R A+ KI L P+P+LA+ IE  C   SWKGI+ RLWP  KY
Sbjct  247   LCNDIKTGSLNPQITDPEVREAVLKI-LKPNPKLAEFIETECSKESWKGIIPRLWPNTKY  305

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YY +  LPL+CTMYASSECYFG+NL PL  P++VA+TL+P MG
Sbjct  306   VDVIVTGTMSQYIPTLNYYGN-HLPLVCTMYASSECYFGINLNPLCKPSEVAYTLIPTMG  364

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P            ++   E+  +  ++ LVDLV V LG  YELVVTT++GLYRYR
Sbjct  365   YFEFLPTAR---------EDEGPEKASTYDKNDLVDLVDVELGHEYELVVTTYAGLYRYR  415

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+VAGF NKAPQF F CR+NV LSIDSDKT++ +LH ++  A   L P +A L+EY
Sbjct  416   VGDILKVAGFKNKAPQFHFVCRKNVALSIDSDKTDEVELHDAVVKASIHLLPFEASLIEY  475

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TS+ADTS++PGHYV+YWE+  +    I   V QDCC+ IEE L+ VYR+CR  DK IGPL
Sbjct  476   TSFADTSAIPGHYVLYWELNKSSETIIPTTVFQDCCLTIEESLNSVYRQCRVSDKSIGPL  535

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYK PRC+K  +  +++L S V + YFSP  P W 
Sbjct  536   EIKVVENGTFDKLMDYAISNGASINQYKAPRCVKY-APIIELLNSRVISNYFSPTCPKWV  594

Query  175   P  173
             P
Sbjct  595   P  595



>ref|XP_010928643.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Elaeis guineensis]
Length=607

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/541 (57%), Positives = 400/541 (74%), Gaps = 16/541 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR +PVI Y+D++P ILRIA+GD    ++G+PI+E L SSGTSGGE KLMP+I ++LDR
Sbjct  71    FKRLIPVITYDDLQPDILRIAHGDTSPILSGRPISEFLTSSGTSGGERKLMPTIDDELDR  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+  Y+L+ P+M Q++PG+D GKAMYLYFVK+E  TP GL AR VLTSYYKS+HF  R F
Sbjct  131   RSLFYSLMTPVMSQFVPGLDRGKAMYLYFVKSESRTPGGLVARPVLTSYYKSRHFLDRPF  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN +TSP+++ILC D+ QSMY QLL GLV R +V+R+GA+FAS F+RAI FL+ +WP 
Sbjct  191   DPYNILTSPNEAILCQDSYQSMYAQLLCGLVQRAEVVRVGAIFASGFIRAIKFLEKHWPR  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG L   I D   R A+ ++ L PDP LA +IE  C   S +GI+ R+WP  +Y
Sbjct  251   LCRDIRTGILDPEITDGAVREAIERV-LRPDPGLAGQIEAECSKPSCEGIIRRIWPNTRY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+M+QY+P L +Y  G LPL CTMY SSECY G+NL P+  P++VA+TL+P M 
Sbjct  310   IDVIVTGAMAQYIPTLDFYG-GGLPLACTMYGSSECYLGINLNPMCKPSEVAYTLIPTMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+      +SN  K           Q  LVDLV V+LG  YELVVTT+SGLYRYR
Sbjct  369   YFEFMPVHH----VSNGAK--------DYDQRDLVDLVDVKLGQEYELVVTTYSGLYRYR  416

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F  R+NV LSIDSDKT++ +LH ++  A   LEP  A LVEY
Sbjct  417   VGDVLRVAGFKNKAPQFNFVRRKNVALSIDSDKTDEVELHAAVRNAVSHLEPFGASLVEY  476

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE + AG  A+   V +DCC+A+EE L+ VYR+ R  DK IGPL
Sbjct  477   TSYADTSSIPGHYVLFWE-LKAGGTAVPPSVFEDCCLAVEESLNTVYRQGRVCDKSIGPL  535

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EIRVV+ GTFD +M   +++G+SINQYK PRC++S    +++L+  V++R+FSP+ P W 
Sbjct  536   EIRVVEEGTFDKMMDYALSQGASINQYKAPRCVRSG-PVVELLDGRVQSRFFSPKCPKWV  594

Query  175   P  173
             P
Sbjct  595   P  595



>ref|XP_009137649.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.5 isoform 
X2 [Brassica rapa]
Length=608

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/541 (57%), Positives = 396/541 (73%), Gaps = 10/541 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YEDI+P I RIANGD    ++ +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKNVMPVITYEDIQPEINRIANGDKSPILSSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+ +MP+M Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  130   RSLLYSFLMPVMSQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKERPF  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY D TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTDYTSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIKFLEKHWTE  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A++KI L P P+LAD +E  C+  SW GI+ RLWP  KY
Sbjct  250   LVRDIRTGTLSSLITDPSVREAVAKI-LKPSPKLADFVEFECKKKSWHGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL+PL  P++V++TL+P M 
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLRPLCKPSEVSYTLIPTMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +++N      E+E   Q +LVDLV V+LG  YELVVTT++G     
Sbjct  368   YFEFLPVHRNTGVTNSINLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAG----G  420

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  421   VGDLLRVTGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAMTHLVPFDASLSEY  480

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+A+EE  + VYR+ R  DK IGPL
Sbjct  481   TSYADTSSIPGHYVLFWELCLDGNTPIPPSVFEDCCLAVEESFNSVYRQGRVSDKSIGPL  540

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  541   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDSYFSPKCPKWV  599

Query  175   P  173
             P
Sbjct  600   P  600



>ref|XP_008226758.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Prunus 
mume]
Length=614

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/541 (56%), Positives = 397/541 (73%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI   I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  70    FKKIIPVIKYEDIEADINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELER  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q +P +D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQSVPELDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKRRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++V+R+GAVFAS F+RAI FL+ +WPS
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVIRVGAVFASGFIRAIRFLEKHWPS  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI +G L+  I D   R A+ K  L PDP+LA+ IE  C   SW+GI+ RLWP  KY
Sbjct  250   LCRDIASGTLNPQITDPSVREAVMKT-LKPDPKLANCIETECGKKSWQGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFG+NL PL  P++V++TL+P+MG
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGLNLNPLCKPSEVSYTLVPSMG  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N     N N     +      Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVQRNNGI--NSNSLSVPKSLNEKEQQELVDLVDVKLGQEYELVVTTYAGLYRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  426   VGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQTAVKNAVSHLVPFDATVSEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TS+ADTS++PGHYV++WE+   G+  I   V +DCC+A+EE L+ VYR+ R  DK IGPL
Sbjct  486   TSFADTSTIPGHYVLFWELCLNGSTPIPPSVYEDCCLAVEESLNSVYRQGRVSDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  546   EIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSNYFSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>ref|XP_011095287.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Sesamum 
indicum]
Length=612

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/539 (57%), Positives = 400/539 (74%), Gaps = 7/539 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI P I RIANGD    +  +PI+E L SSGTS GE K+MP+I E+L+R
Sbjct  69    FKKIMPVITYEDILPDINRIANGDTSPILCSEPISEFLTSSGTSAGERKVMPTIEEELER  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GKAMY  F+K E  TP GL AR VLTSYYKS HFK R F
Sbjct  129   RSLLYSLLMPVMSQFVPGLDQGKAMYFLFIKCETKTPGGLLARPVLTSYYKSSHFKDRPF  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC+D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  189   DPYTNYTSPNETILCADSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTL  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++ +I D   R A+ +I L PDP+LAD IE  C   SW+GI+ +LWP  KY
Sbjct  249   LCHDIRTGTVNSLITDPSVREAVMRI-LKPDPKLADFIESECSKESWQGIITKLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYSDG LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  308   IDVIVTGTMSQYIPTLDYYSDG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMC  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             Y+EF+P+  N    ++++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  367   YYEFLPVHRNNGLTNSISMPKSLNEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSID+DKT++ +L  ++  A   L P  A L EY
Sbjct  424   VGDVLRVAGFKNNAPQFNFVCRKNVVLSIDTDKTDEVELQNAVRNAVSHLMPFGARLTEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G+  I   V +DCC+ IEE LD VYR+ R  +  IGPL
Sbjct  484   TSYADTTTIPGHYVLYWELSQMGSTPIPPSVFEDCCLTIEESLDNVYRQNRVFE-AIGPL  542

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V ++YFSP+ P W
Sbjct  543   EIKIVETGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSKYFSPKCPKW  600



>ref|XP_002449599.1| hypothetical protein SORBIDRAFT_05g019810 [Sorghum bicolor]
 gb|EES08587.1| hypothetical protein SORBIDRAFT_05g019810 [Sorghum bicolor]
Length=668

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/557 (55%), Positives = 410/557 (74%), Gaps = 26/557 (5%)
 Frame = -1

Query  1813  EDLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSI  1634
             ++L + FK  VPV+ YED++PYI RIANG   S I+ + ITE+L SSGTSGG+PKLMPS 
Sbjct  104   DELAATFKDRVPVVEYEDVKPYIERIANGAPSSLISSKTITELLTSSGTSGGQPKLMPST  163

Query  1633  AEDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKH  1454
              E+LDR+TFLYNL++P+M++Y+ G+D+G+ MYL FVK E++T  GL AR VLTSYYKS+H
Sbjct  164   EEELDRKTFLYNLLVPVMNKYVEGLDKGRCMYLLFVKPEITTASGLVARPVLTSYYKSRH  223

Query  1453  FKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFL  1274
             F+ R   PY   TSP+++ILC D+ QSMY QLL GL  R +VLR+GAVFASAFLRA+ FL
Sbjct  224   FRERPDSPYTRYTSPNEAILCPDSAQSMYAQLLCGLARRGEVLRVGAVFASAFLRAVKFL  283

Query  1273  QHNWPSLCLDIRTGQL-SGMIADSECRSAMSKILLAPDPELADEIEEICR---AASWKGI  1106
             + +W +LC DIR G++ +  + D+ CR A+++++  PDP LAD I   C    ++SW+GI
Sbjct  284   EAHWRALCDDIRAGRVDASRVTDAACRDAVARVVARPDPALADAIAAECEGSSSSSWRGI  343

Query  1105  VYRLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPAD  926
             V RLWP+ KYI+ ++TGSM+QY+P L +Y  G LPL+ TMYASSECYFG+NL+PL  P D
Sbjct  344   VRRLWPRTKYIDVIVTGSMAQYIPLLEFYG-GGLPLVSTMYASSECYFGINLRPLDPPED  402

Query  925   VAFTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVV  746
             VA+TLLPNM Y+EFI + ++G              EE+    K+VDLV V  G YYEL+V
Sbjct  403   VAYTLLPNMCYYEFIKVEKDG--------------EEAREDGKVVDLVDVEAGGYYELLV  448

Query  745   TTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLL  566
             TTF+GLYRYR+GD+LQV+GFHN APQF+F  RRNVVLS+D+DKT+++DL R++TAAK+LL
Sbjct  449   TTFTGLYRYRVGDILQVSGFHNAAPQFRFVHRRNVVLSVDTDKTSEDDLLRAVTAAKRLL  508

Query  565   EP--HQALLVEYTSYADTSSVPGHYVIYWEIMHA----GAAAIDAQVLQDCCIAIEEQLD  404
              P     +L EYT+YADT+S+PGHYV++WE+       G     A+V+  CC  +E  LD
Sbjct  509   APLGGATILSEYTAYADTASIPGHYVLFWELTPTPPMPGDGDTAARVMAACCAEVEAGLD  568

Query  403   YVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILE  224
              VY+RCRS D+ +GPLEIRVV  G FD LM   ++ GSS+NQYKTPRCIK +  A+ +LE
Sbjct  569   AVYQRCRSRDRSVGPLEIRVVSTGAFDALMDLCVSHGSSVNQYKTPRCIK-HPDAIAVLE  627

Query  223   SNVRARYFSPRDPAWKP  173
             + V  R+FS   P W+P
Sbjct  628   ARVVGRFFSDTVPHWEP  644



>ref|XP_004244168.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Solanum 
lycopersicum]
Length=607

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/543 (56%), Positives = 393/543 (72%), Gaps = 7/543 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             +FK+ +PVI YEDI+  I RIANGD    +  QPI+E L SSGTSGGE KLMP+I E+L 
Sbjct  62    NFKKIMPVITYEDIQSDITRIANGDKSQILCSQPISEFLTSSGTSGGERKLMPTIEEELA  121

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             RR+ LY+L+MP+M Q++P +++GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R 
Sbjct  122   RRSQLYSLLMPVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLPARPVLTSYYKSPHFKNRQ  181

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
              DPY + TSP+++ILCSD+ QSMY Q+L GL   +QVLR+GAVFAS F+RAI FL+ +WP
Sbjct  182   PDPYTNYTSPNETILCSDSYQSMYSQMLCGLCQNKQVLRVGAVFASGFIRAIRFLEKHWP  241

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC DIR G ++  I D   R A+  I L PD  LAD +E  C   SW+GI+ RLWP  K
Sbjct  242   LLCHDIRVGTINSQITDLSIREAVMNI-LKPDTNLADFVEAECSKNSWQGIITRLWPNTK  300

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YI+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++VA+TL+P M
Sbjct  301   YIDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPTM  359

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             GYFEF+P+  N       N     +      Q +LVDLV V++G  YEL+VTT++GLYRY
Sbjct  360   GYFEFLPVHRNNGV---SNSIAMPKSLNEKEQQELVDLVDVKIGQEYELIVTTYAGLYRY  416

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + E
Sbjct  417   RVGDVLRVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLMPFDAHVTE  476

Query  538   YTSYAD-TSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             YTSYAD T+++PGHYV+YWE+   G+  +   V +DCC+ IEE L+ VYR+ R+ DK IG
Sbjct  477   YTSYADTTTTIPGHYVLYWELNVNGSTPVPPSVFEDCCLTIEESLNSVYRQGRASDKSIG  536

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEI++V+ GTFD LM   I+ G+SINQYKTPRC+K     +++L S V + YFSP+ P 
Sbjct  537   PLEIKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-EPIVELLNSRVVSNYFSPKCPK  595

Query  181   WKP  173
             W P
Sbjct  596   WVP  598



>gb|EYU19184.1| hypothetical protein MIMGU_mgv1a003042mg [Erythranthe guttata]
Length=612

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/539 (57%), Positives = 390/539 (72%), Gaps = 11/539 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI P I RIANGD    +   PI+E L SSGTS GE K+MP+I E+L R
Sbjct  73    FKKIMPVITYEDILPDINRIANGDKSPILCSDPISEFLTSSGTSAGERKVMPTIEEELGR  132

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+D+GK MY  FVK E  TP GLPAR VLTSYYKS HFK R F
Sbjct  133   RSLLYSLLMPVMSQFVPGLDKGKGMYFLFVKCETKTPGGLPARPVLTSYYKSSHFKDRPF  192

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    QVLR+GAVFAS F+RAI FL+ NW  
Sbjct  193   DPYTNYTSPNETILCPDSYQSMYSQMLCGLFQNNQVLRVGAVFASGFIRAIRFLEKNWAL  252

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG ++ +I D   R A+++I L PDP+LAD IE  C   SW+GI+ ++WP  KY
Sbjct  253   LAHDIRTGTVNSLITDPSVRDAVTRI-LKPDPKLADFIEAECGKESWQGIITKIWPNTKY  311

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYSDG LPL+CTMYASSECYFGVNL PL  P+DVA+TL+P M 
Sbjct  312   IDVIVTGTMSQYIPTLDYYSDG-LPLVCTMYASSECYFGVNLNPLCKPSDVAYTLIPTMC  370

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             Y+EF+P+  N       N     +      Q +LVDLV V LG  YELVVTT++GLYRYR
Sbjct  371   YYEFLPVSRN-------NGMPLPKSLNEKEQQELVDLVDVELGHEYELVVTTYAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N APQF F CR+NVVLSID+DKT++ +L  ++  A   L P  + L EY
Sbjct  424   VGDVLRVAGFKNNAPQFNFVCRKNVVLSIDTDKTDEVELQNAVKNAVTHLIPFDSRLTEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G+  I A V +DCC+ IEE LD VYR+ R  D  IGPL
Sbjct  484   TSYADTATIPGHYVLYWELSQIGSTQIPASVYEDCCLTIEESLDSVYRQNRHFD-AIGPL  542

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V A YFSP+ P W
Sbjct  543   EIKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVACYFSPKCPKW  600



>ref|XP_002975803.1| hypothetical protein SELMODRAFT_103740 [Selaginella moellendorffii]
 gb|EFJ23432.1| hypothetical protein SELMODRAFT_103740 [Selaginella moellendorffii]
Length=598

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/545 (55%), Positives = 409/545 (75%), Gaps = 16/545 (3%)
 Frame = -1

Query  1801  SDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDL  1622
             + F++C+PVI YED+ P I RIANGD    ++  PI+E L SSGTS G+ KLMP+I+E+ 
Sbjct  56    ASFRQCLPVITYEDLEPEIQRIANGDTSPILSAHPISEFLTSSGTSAGQRKLMPTISEEF  115

Query  1621  DRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCR  1442
             +RR  LY+L+MP+M+QY+PG+D+GK MYL+F+K+E  TP GL AR VLTSYYKS++F  R
Sbjct  116   ERRCLLYSLLMPVMNQYLPGLDQGKGMYLFFIKSEAKTPGGLLARPVLTSYYKSRYFTER  175

Query  1441  SFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNW  1262
              +DP N  TSP++++LC D +QSMYCQLL GL+ R +VLR+GAVFAS FLRAI FL+ +W
Sbjct  176   PYDPCNVYTSPNETVLCPDAHQSMYCQLLCGLLQRHEVLRMGAVFASGFLRAIRFLETHW  235

Query  1261  PSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKA  1082
               LC DIR G L+ ++ D+  R A+  ++  PDP LAD+I E CR  SW GI+ RLWP  
Sbjct  236   RELCDDIRAGGLNELVVDAAARRAVLALMPRPDPALADDIAEQCRKESWAGIIARLWPNT  295

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KYI+ ++TG+M+QY+P L YYS G LPL+CTMYASSECYFG+NL+PL  P++V++TLLPN
Sbjct  296   KYIDVIVTGTMAQYIPTLDYYSGG-LPLVCTMYASSECYFGINLQPLCPPSEVSYTLLPN  354

Query  901   MGYFEFIPLGENGTFLSNLNKegeeeeeESIPQ-SKLVDLVHVRLGCYYELVVTTFSGLY  725
             M YFEF+P          +  +  + +   +P  S+LV+LV V++G  YELV+TT++GL 
Sbjct  355   MAYFEFLP----------IKPKSGKSKAARVPDPSELVELVDVKMGHEYELVITTYAGLC  404

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLE-PHQAL  548
             RYR+GD+L+V GFHN APQF F CR+NVVLSIDSDKT +EDL +++ +A   +E  + A 
Sbjct  405   RYRVGDILRVTGFHNSAPQFAFVCRKNVVLSIDSDKTGEEDLAKAVRSATAGIESSYGAR  464

Query  547   LVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             L+EYTSYADT+++PGHYV++WE+    ++ I   VL++CC+AIEE LD VYR+ R+ D+ 
Sbjct  465   LIEYTSYADTTTIPGHYVLFWELR--SSSPIPKDVLEECCLAIEESLDSVYRQGRASDRS  522

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             IGPLEI+VVKPGTFD LM   ++ G+SINQYKTPRC+K  +  +++L + V + YFSPR 
Sbjct  523   IGPLEIKVVKPGTFDQLMDYALSRGASINQYKTPRCVKF-TPIVELLNARVVSSYFSPRL  581

Query  187   PAWKP  173
             P W P
Sbjct  582   PKWSP  586



>ref|XP_004980566.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.17-like 
[Setaria italica]
Length=681

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/573 (55%), Positives = 416/573 (73%), Gaps = 24/573 (4%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             +L + FK  VPV+ YED++PYI RIANG   S I+ + ITE+L SSGTSGG+PKLMPS  
Sbjct  112   ELAAAFKARVPVVEYEDVKPYIERIANGAPSSLISSKTITELLTSSGTSGGQPKLMPSTE  171

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             E+LDR+TFLYNL++P+M++Y+ G+DEG+ MYL FVK E++T  GL AR VLTSYYKS+HF
Sbjct  172   EELDRKTFLYNLLVPVMNKYVAGLDEGRCMYLLFVKPEITTASGLVARPVLTSYYKSRHF  231

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
             + R   PY   TSP+++ILC D+ QSMY QLL GL  R +VLR+GAVFASAFLRA+ FL+
Sbjct  232   RDRPDSPYTRYTSPNEAILCPDSAQSMYAQLLCGLARRGEVLRVGAVFASAFLRAVKFLE  291

Query  1270  HNWPSLCLDIRTGQLSG-MIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRL  1094
              +W +LC DIR G++    +AD  CR A ++++  PDPELAD +   C A SW+GIV RL
Sbjct  292   GHWRALCDDIREGRVDAERVADRACREAAARVVARPDPELADAVAAECAAPSWRGIVRRL  351

Query  1093  WPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFT  914
             WP+ KYI+ ++TGSM+QY+P L +Y  G LPL+ TMYASSECYFG+NL+PL  P DVA+T
Sbjct  352   WPRTKYIDVIVTGSMAQYIPLLEFYG-GGLPLVSTMYASSECYFGINLRPLDRPEDVAYT  410

Query  913   LLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
             LLPNM Y+EFI + ++G                 +   ++VDLV V +G YYELVVTTF+
Sbjct  411   LLPNMCYYEFIKVEKDGE---------------DVRDGEVVDLVDVEIGGYYELVVTTFT  455

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEP-H  557
             GLYRYR+GD+LQV+GFHN APQF+F  RRNVVLS+D+DKT+++DL R++TAAK+LL P  
Sbjct  456   GLYRYRVGDILQVSGFHNTAPQFRFVHRRNVVLSVDTDKTSEDDLLRAVTAAKRLLVPLG  515

Query  556   QALLVEYTSYADTSSVPGHYVIYWEIMHAGAAAID-----AQVLQDCCIAIEEQLDYVYR  392
              A+L EYT+YADT+S+PGHYV++WE+        D     A+V+  CC  +E  LD VYR
Sbjct  516   GAILSEYTAYADTASIPGHYVLFWELTPPPLPTSDDGDAVARVMAACCAEVEAGLDAVYR  575

Query  391   RCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVR  212
             RCRS D+ +GPLEIRVV PG FD LM   ++ GSS+NQYKTPRCIK +  A+ +LE+ V 
Sbjct  576   RCRSRDRSVGPLEIRVVCPGAFDALMDLCVSHGSSVNQYKTPRCIK-HPDAIAVLEARVV  634

Query  211   ARYFSPRDPAWKP*LVSIINSLCSGLFITVLIN  113
              R+FS   P W+P  V+   +  +G    +L N
Sbjct  635   GRFFSDAVPHWEPFQVNAAAAAATGCCHPLLEN  667



>emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera]
Length=613

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/541 (56%), Positives = 394/541 (73%), Gaps = 7/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YED++P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  71    FKKLMPVITYEDLQPDITRIANGDTSLILCSNPISEFLTSSGTSGGERKLMPTIEEELER  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q + G+++GK MY  F+K+E  TP GL AR VLTSYYKS HF+ R +
Sbjct  131   RSLLYSLLMPVMSQSVQGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFRERPY  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GLV  ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  191   DPYTNYTSPNETILCPDSYQSMYSQMLCGLVQNKEVLRVGAVFASGFIRAIRFLEKHWTL  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG +   I D   R A+ ++ L PDP+LAD +E  CR  SW+GI+ RLWP  KY
Sbjct  251   LCRDIRTGTIDQQITDPSVREAVMRV-LKPDPKLADFVEGECRKESWQGIITRLWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+  LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  310   VDVIVTGTMSQYIPTLDYYSN-DLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMA  368

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +  N     +      Q  LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  369   YFEFLPVHRN----NGTNSISVPKSLNDKEQQDLVDLVDVKLGQEYELVVTTYAGLYRYR  424

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  425   VGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKNAVNHLMPFDATLTEY  484

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G+  I   V +DCC+ +EE L+ VYR+ R  DK IGPL
Sbjct  485   TSYADTTTIPGHYVLYWELSLRGSTPIPPSVFEDCCLTVEESLNSVYRQGRVSDKSIGPL  544

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             E+++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  545   EMKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVSNYFSPKCPKWI  603

Query  175   P  173
             P
Sbjct  604   P  604



>ref|XP_003540050.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine 
max]
Length=607

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/542 (57%), Positives = 403/542 (74%), Gaps = 7/542 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+P I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  63    FKKLLPVITYEDIQPDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGR  122

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+++GK MYL F+K+E  TP G+ AR VLTSYYKS +FK R +
Sbjct  123   RSLLYSLLMPVMSQFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSYFKDRPY  182

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP++++LC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  183   DPYTNYTSPNETVLCPDSYQSMYSQLLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWPL  242

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I D   R A+ KI L PDP L D I+  C  +SW+GI+ RLWP  KY
Sbjct  243   LCHDIRTGTINNTITDLSVRDAVMKI-LKPDPRLGDLIQSECGKSSWQGIITRLWPNTKY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  302   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMC  360

Query  895   YFEFIPLGE-NGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             Y+EF+P+   NG    +L+      E+E   Q +LV+LV V+LG  YELVVTT++GLYRY
Sbjct  361   YYEFLPVNRSNGVSHDSLHTPRSLNEKE---QQELVELVDVKLGQEYELVVTTYAGLYRY  417

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + E
Sbjct  418   RVGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMKNAVTHLVPFDASVSE  477

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTSYADT+++PGHYV+YWE+   G+  I   V +DCC+AIEE L+ VYR+ R  DK IGP
Sbjct  478   YTSYADTTTIPGHYVLYWELSLKGSTPIPPCVFEDCCLAIEESLNSVYRQGRVSDKSIGP  537

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V  +YFSP+ P W
Sbjct  538   LEIKIVEQGTFDKLMDYAISLGASINQYKTPRCVKF-APVVELLNSRVVEKYFSPKCPKW  596

Query  178   KP  173
              P
Sbjct  597   VP  598



>ref|XP_002276241.2| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Vitis 
vinifera]
Length=614

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/539 (57%), Positives = 399/539 (74%), Gaps = 7/539 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VPV+ YED+ P I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  74    FKKIVPVVTYEDMLPDIERIANGDMSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGR  133

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q +PG+DEGK MY  FVK+E  TP GL AR VLTSYYKS +F+ R +
Sbjct  134   RSLLYSLLMPVMNQSVPGLDEGKGMYFLFVKSEAKTPGGLMARPVLTSYYKSSYFRDRPY  193

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  194   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWVL  253

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR G L   I D   R A+ +I L P+PELAD IE  CR  SW+GI+ RLWP  KY
Sbjct  254   LCKDIRAGTLDSQINDPSVREAVKRI-LKPNPELADFIEAECRRESWEGIITRLWPNTKY  312

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFG+NL PL  P++V++TL+P M 
Sbjct  313   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGLNLNPLCKPSEVSYTLIPTMA  371

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+     F +N+++     E+E     +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  372   YFEFLPVNRKNGF-TNVSESAPLNEKE---HQELVDLVDVKLGQEYELVVTTYAGLYRYR  427

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L VAGF NKAPQFKF CR+NV LSIDSDKT++ +L  ++  A   L    A + EY
Sbjct  428   VGDILCVAGFKNKAPQFKFICRKNVALSIDSDKTDEFELQNAVKNAADHLLQFDASVTEY  487

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTS++PGHYV+YWEI  +GA  I   V +DCC+ +EE L+ VYR+ R+ DK IGPL
Sbjct  488   TSYADTSTIPGHYVLYWEIGLSGATPIPPSVFEDCCLIMEESLNSVYRQGRASDKSIGPL  547

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             EIR+V+ GTFD LM   +++G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W
Sbjct  548   EIRIVEGGTFDKLMDYALSQGASINQYKTPRCVKY-APIIELLNSRVVSNYFSPKCPKW  605



>ref|NP_001044467.1| Os01g0785400 [Oryza sativa Japonica Group]
 sp|Q8LQM5.1|GH31_ORYSJ RecName: Full=Probable indole-3-acetic acid-amido synthetase 
GH3.1; AltName: Full=Auxin-responsive GH3-like protein 1; Short=OsGH3-1 
[Oryza sativa Japonica Group]
 dbj|BAB92590.1| putative auxin-regulated protein GH3 [Oryza sativa Japonica Group]
 dbj|BAF06381.1| Os01g0785400 [Oryza sativa Japonica Group]
 gb|EAZ13782.1| hypothetical protein OsJ_03707 [Oryza sativa Japonica Group]
 dbj|BAG88666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=610

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/546 (56%), Positives = 401/546 (73%), Gaps = 17/546 (3%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D+V  F+R VP++ YE ++P ILRIANGD     +G+PI+E L SSGTSGGE KLMP+IA
Sbjct  65    DVVDAFRRLVPLVTYEGLQPDILRIANGDTSPIFSGKPISEFLTSSGTSGGERKLMPTIA  124

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             ++++RR+ LY+L+MP+M Q + G+D+GKAMYL FVKAE  TP GL AR VLTSYY+S+ F
Sbjct  125   DEMNRRSLLYSLLMPVMSQSVSGLDKGKAMYLLFVKAESRTPGGLAARPVLTSYYRSRQF  184

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
               R  DPY   TSPD++ILC D+ QSMY QLL GLV+R  VLR+GAVFAS FLRAI FL+
Sbjct  185   LDRPRDPYTSYTSPDEAILCVDSYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIHFLE  244

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
              +W  LC DIRTG+L   I D   R A+ ++L A DP LAD IE+ C  ASW+GI+ RLW
Sbjct  245   KHWARLCHDIRTGELDPEITDRVVRDAVGRVLRA-DPALADAIEDECARASWEGIIRRLW  303

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             P+ KYI+ ++TG+MSQY+P L +Y  G LPL CTMYASSECYFG+NL P+  P+DVA+TL
Sbjct  304   PRTKYIDVIVTGTMSQYIPTLEFYGGG-LPLTCTMYASSECYFGLNLNPMCKPSDVAYTL  362

Query  910   LPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             +P M Y+EF+P+  N       ++              LVDLV V+LG  YELVVTT+SG
Sbjct  363   IPTMCYYEFLPVNCNNATAEASHR-------------DLVDLVDVKLGHEYELVVTTYSG  409

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYR+GDVL+VAGF NKAP F F  R+NV LS+DSDKT++ +LH +++ A + L P  A
Sbjct  410   LYRYRVGDVLRVAGFKNKAPMFSFVRRQNVALSVDSDKTDETELHAAVSGAVQHLAPFGA  469

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
              LVEYTSYAD +++PGHYV++WE + AG+ A+ A V ++CC+++EE L+ VYR+ R+ D+
Sbjct  470   SLVEYTSYADAATIPGHYVLFWE-LRAGSTAVPASVFEECCLSVEEALNSVYRQGRACDR  528

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              IGPLEIRVV  GTFD LM   I+ G+SINQYK PRC++     +++L++ V+ +YFSP+
Sbjct  529   SIGPLEIRVVAEGTFDKLMDYAISRGASINQYKAPRCVRPG-PVVELLDARVQGKYFSPK  587

Query  190   DPAWKP  173
              P W P
Sbjct  588   CPKWSP  593



>ref|XP_010548443.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.3 [Tarenaya 
hassleriana]
Length=595

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/544 (55%), Positives = 392/544 (72%), Gaps = 19/544 (3%)
 Frame = -1

Query  1801  SDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDL  1622
             + FK  VPV+ YED++P I RIANGD    ++  PI+E L SSGTS GE KLMP+I EDL
Sbjct  66    TTFKSKVPVVTYEDLKPEIQRIANGDRSPILSSHPISEFLTSSGTSAGERKLMPTIDEDL  125

Query  1621  DRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCR  1442
             DRR  LY+L+MP+M+ Y+PG+D+GKA+Y  FVKAE  TP GLPAR VLTSYYKS HFK R
Sbjct  126   DRRQLLYSLLMPVMNLYVPGLDKGKALYFLFVKAETKTPGGLPARPVLTSYYKSDHFKKR  185

Query  1441  SFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNW  1262
              +DPYN+ TSP+++ILC D++QSMY Q+L GL+ R +VLRLGAVFAS  LRAISFLQ+NW
Sbjct  186   PYDPYNNYTSPNEAILCPDSSQSMYTQMLCGLLMRHEVLRLGAVFASGLLRAISFLQNNW  245

Query  1261  PSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKA  1082
               L  DI TG L+  I D   R  M+KIL  PD ELAD I  +C   SW+GI+ ++WP  
Sbjct  246   LELVRDISTGTLNPKITDPAIRDCMAKILTKPDQELADVITRVCSQESWQGIITKIWPNT  305

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KY++ ++TG+M+QY+P L +YS G LP+ CTMYASSE YFG+NLKP+  P +V++T++PN
Sbjct  306   KYLDVIVTGAMAQYIPTLEFYSGG-LPMACTMYASSESYFGINLKPMCKPTEVSYTIMPN  364

Query  901   MGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYR  722
             M YFEFIP   +G                S   + LV+L  V +G  YELV+TTF+GLYR
Sbjct  365   MAYFEFIPFEHDG----------------STDPAALVELADVEVGKEYELVITTFAGLYR  408

Query  721   YRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLV  542
             YR+GD+LQV GFHN APQFKF  R+NV+LSI+SDKT++ +L +++  A  LL  ++  ++
Sbjct  409   YRVGDILQVTGFHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASGLLAGYETRVI  468

Query  541   EYTSYADTSSVPGHYVIYWEIM-HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
             EYTSYA+T ++PGHYVIYWE++      A D +++  CC+ +EE L+ VYR+ R  DK I
Sbjct  469   EYTSYAETKTIPGHYVIYWELLVKDQKNAPDDEMMARCCLEMEESLNSVYRQSRVADKSI  528

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIRVVK GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P
Sbjct  529   GPLEIRVVKAGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVESSHFSPALP  587

Query  184   AWKP  173
              W P
Sbjct  588   HWSP  591



>ref|XP_006370580.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa]
 gb|ERP67149.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa]
Length=611

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/541 (56%), Positives = 394/541 (73%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ VPVI YEDI+P I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  69    FKKAVPVITYEDIQPDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELGR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+++GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  129   RSLLYSLLMPVMTQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSTHFKDRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  189   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWKL  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG +   I D   R A+ KIL + DP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  249   LANDIRTGIIDPQITDPSVREAVMKILKS-DPKLADFIEAECSKESWQGIITRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL P+  P++V++TL+P M 
Sbjct  308   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N      +N     +      Q +LVDLV V+L   YELVVTT++GLYRYR
Sbjct  367   YFEFLPVHRNNGV---INSVSMPKSLNEKEQQELVDLVDVKLDQEYELVVTTYAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+V GF NKAP+F F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  424   VGDVLRVVGFKNKAPRFSFICRKNVVLSIDSDKTDEVELQSAVKNAVNHLIPFDATLAEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV++WE+   G+  I   V +DCC+ IEE L+ VYR+ R+ DK IGPL
Sbjct  484   TSYADTTTIPGHYVLFWELSLNGSTPIPPSVFEDCCLTIEESLNSVYRQGRASDKSIGPL  543

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  544   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVTCYFSPKCPKWA  602

Query  175   P  173
             P
Sbjct  603   P  603



>ref|XP_006360114.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
tuberosum]
Length=607

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/543 (56%), Positives = 397/543 (73%), Gaps = 7/543 (1%)
 Frame = -1

Query  1798  DFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             +FK+ +P I YEDI+  I RIANGD    +  QPI+E L SSGTSGGE KLMP+I E+L 
Sbjct  62    NFKKIMPAITYEDIQSDITRIANGDKSQILCSQPISEFLTSSGTSGGERKLMPTIEEELA  121

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             RR+ LY+L+MP+M Q++P +++GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R 
Sbjct  122   RRSQLYSLLMPVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLPARPVLTSYYKSPHFKNRR  181

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
              DPY + TSP+ +ILCSD+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP
Sbjct  182   PDPYTNYTSPNDTILCSDSYQSMYSQMLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWP  241

Query  1258  SLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
              LC DIR G ++  I D   R A+ KI L PD  LAD +E  C   SW+GI+ RLWP  K
Sbjct  242   LLCHDIRAGTINSQITDLSVREAVMKI-LKPDKNLADFVEAECSKDSWQGIITRLWPNTK  300

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             YI+ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++VA+TL+P M
Sbjct  301   YIDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPTM  359

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             GYFEF+P+  N    ++++      E+E   Q +LVDLV V++G  YEL+VTT++GLYRY
Sbjct  360   GYFEFLPVHRNNGVTNSISMPKSLNEKE---QQELVDLVDVKIGQEYELIVTTYAGLYRY  416

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + E
Sbjct  417   RVGDVLRVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLMPFDAHVTE  476

Query  538   YTSYAD-TSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             YTSYAD T+++PGHYV+YWE+   G+  +   V +DCC+ IEE L+ VYR+ R+ DK IG
Sbjct  477   YTSYADTTTTIPGHYVLYWELNVNGSTPVPPSVFEDCCLTIEESLNSVYRQGRASDKSIG  536

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEI++V+ GTFD LM   I+ G+SINQYKTPRC+K     +++L S V + YFSP+ P 
Sbjct  537   PLEIKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-EPIVELLNSKVVSNYFSPKCPK  595

Query  181   WKP  173
             W P
Sbjct  596   WVP  598



>ref|XP_002973755.1| hypothetical protein SELMODRAFT_99818 [Selaginella moellendorffii]
 gb|EFJ25415.1| hypothetical protein SELMODRAFT_99818 [Selaginella moellendorffii]
Length=598

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/545 (55%), Positives = 408/545 (75%), Gaps = 16/545 (3%)
 Frame = -1

Query  1801  SDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDL  1622
             + F++C+PVI YED+ P I RIANGD    ++  PI+E L SSGTS G+ KLMP+I+E+ 
Sbjct  56    TSFRQCLPVITYEDLEPEIQRIANGDTSPILSAHPISEFLTSSGTSAGQRKLMPTISEEF  115

Query  1621  DRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCR  1442
             +RR  LY+L+MP+M+QY+PG+D+GK MYL+F+K+E  TP GL AR VLTSYYKS++F  R
Sbjct  116   ERRCLLYSLLMPVMNQYLPGLDQGKGMYLFFIKSEAKTPGGLLARPVLTSYYKSRYFTER  175

Query  1441  SFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNW  1262
              +DP N  TSP++++LC D +QSMYCQLL GL+ R +VLR+GAVFAS FLRAI FL+ +W
Sbjct  176   PYDPCNVYTSPNETVLCPDAHQSMYCQLLCGLLQRHEVLRMGAVFASGFLRAIRFLETHW  235

Query  1261  PSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKA  1082
               LC DIR G L+ ++ D+  R A+  ++  PDP LAD+I E CR  SW GI+ RLWP  
Sbjct  236   RELCDDIRAGGLNELVVDAAARRAVLALMPRPDPALADDIAEQCRKESWAGIIARLWPNT  295

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KYI+ ++TG+M+QY+P L YYS G LPL+CTMYASSECYFG+NL+PL  P++V++TLLPN
Sbjct  296   KYIDVIVTGTMAQYIPTLDYYSGG-LPLVCTMYASSECYFGINLQPLCPPSEVSYTLLPN  354

Query  901   MGYFEFIPLGENGTFLSNLNKegeeeeeESIPQ-SKLVDLVHVRLGCYYELVVTTFSGLY  725
             M YFEF+P          +  +  + +   +P  S+LV+LV V++G  YELV+TT++GL 
Sbjct  355   MAYFEFLP----------IKPKSGKSKAPRVPDPSELVELVDVKMGHEYELVITTYAGLC  404

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLE-PHQAL  548
             RYR+GD+L+V GFHN APQF F CR+NVVLSIDSDKT +EDL +++ +A   +E  + A 
Sbjct  405   RYRVGDILRVTGFHNSAPQFAFVCRKNVVLSIDSDKTGEEDLAKAVRSATAGIESSYGAR  464

Query  547   LVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             L+EYTSYADT+++PGHYV++WE+    ++ I   VL++CC+AIEE LD VYR+ R  D+ 
Sbjct  465   LIEYTSYADTTTIPGHYVLFWELR--SSSPIPKDVLEECCLAIEESLDSVYRQGRVSDRS  522

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             IGPLEI+VVKPGTFD LM   ++ G+SINQYKTPRC+K  +  +++L + V + YFSPR 
Sbjct  523   IGPLEIKVVKPGTFDQLMDYALSRGASINQYKTPRCVKF-TPIVELLNARVVSSYFSPRL  581

Query  187   PAWKP  173
             P W P
Sbjct  582   PKWSP  586



>ref|XP_004958635.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.11-like 
isoform X3 [Setaria italica]
Length=467

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/472 (64%), Positives = 362/472 (77%), Gaps = 15/472 (3%)
 Frame = -1

Query  1579  DQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSFDPYNDMTSPDQS  1400
             DQYI G+ EGKAMYL FVKAE  T  G+P R+VLTSYYKS HF  R +D YN  TSPD+ 
Sbjct  4     DQYIRGLGEGKAMYLLFVKAETLTNAGIPIRSVLTSYYKSPHFLQRKYDLYNKYTSPDEV  63

Query  1399  ILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPSLCLDIRTGQLSG  1220
             ILC D  QSMYCQLL GLV R+ VLRLGAVFASAFLR+ISFL+ +W  L  DIR GQLS 
Sbjct  64    ILCPDNKQSMYCQLLCGLVERQHVLRLGAVFASAFLRSISFLEQHWCDLVNDIRIGQLSS  123

Query  1219  MIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKYIEAVITGSMSQY  1040
              I +S C+ AM   L  P+PELADEIE IC + SWKGI+ RLWP  KYIEAV+TG+M+QY
Sbjct  124   NITNSTCQLAMQSFLALPNPELADEIEAICSSGSWKGILGRLWPNVKYIEAVLTGTMAQY  183

Query  1039  VPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMGYFEFIPLGENGT  860
             +P L +YSDG++PL+CTMYASSE YFGVNL+PL  P DV++T+LPNM YFEFIPL E+G 
Sbjct  184   IPMLEFYSDGRIPLVCTMYASSESYFGVNLRPLCSPKDVSYTILPNMAYFEFIPL-EDGL  242

Query  859   FLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYRIGDVLQVAGFHN  680
              L+         + E +   KLV +V V++GCYYELVVTTFSGLYRYR+GDVLQV GF+N
Sbjct  243   KLTE--------DYEVVENDKLVSMVDVKIGCYYELVVTTFSGLYRYRVGDVLQVTGFYN  294

Query  679   KAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEYTSYADTSSVPGH  500
             +APQFKF CRRNV+LS+D+DKTN+EDLH S+T AKK+LE    LL+EYTS  DTS++PGH
Sbjct  295   RAPQFKFICRRNVILSVDTDKTNEEDLHNSVTRAKKILESRNYLLLEYTSCTDTSTIPGH  354

Query  499   YVIYWEIMHAGAAA-----IDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKP  335
             YV++WEI      A     IDAQ L+ CCIA+EE LDYVYRRCR+HDK +GPLEIR+V+ 
Sbjct  355   YVLFWEIKSTYEDATPCVPIDAQFLESCCIAVEEALDYVYRRCRAHDKSVGPLEIRLVEA  414

Query  334   GTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             G FD LM   +++GSSINQYKTPRCI+S   ALK+L S V   +FSPRDP W
Sbjct  415   GAFDALMDLLVSQGSSINQYKTPRCIESG-PALKLLNSRVTGSFFSPRDPEW  465



>ref|XP_008365943.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Malus 
domestica]
 ref|XP_008345064.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Malus 
domestica]
Length=614

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/541 (56%), Positives = 392/541 (72%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  70    FKKIMPVIKYEDIQSDINRIANGDTSHILCSKPISEFLTSSGTSGGERKLMPTIEEELER  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M QY+PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTI  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI +G L+  I D   R A+ KI L PDP+LA  IE  CR  SW GI+ RLWP  KY
Sbjct  250   LCKDIASGTLNPQITDPSVREAVMKI-LKPDPKLASFIEGECRRDSWHGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P MG
Sbjct  309   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMG  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N     N N     +        +LVDL  V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVQRNNGI--NTNPVSVRKSLNEKEHQELVDLADVKLGQEYELVVTTYAGLYRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+V  F NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P +A + EY
Sbjct  426   VGDVLRVTSFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFEATVTEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV++WE+   G   +   V +DCC+ +EE L+ VYR+ R+ DK IGPL
Sbjct  486   TSYADTTTIPGHYVLFWELSFNGTTPVPPSVFEDCCLTVEESLNSVYRQGRASDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L + V + Y SP+ P W 
Sbjct  546   EIKIVETGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLTTRVVSNYHSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>ref|XP_002283229.2| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Vitis 
vinifera]
Length=654

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/541 (56%), Positives = 394/541 (73%), Gaps = 7/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YED++P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  112   FKKLMPVITYEDLQPDITRIANGDTSLILCSNPISEFLTSSGTSGGERKLMPTIEEELER  171

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q + G+++GK MY  F+K+E  TP GL AR VLTSYYKS HF+ R +
Sbjct  172   RSLLYSLLMPVMSQSVQGLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFRERPY  231

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GLV  ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  232   DPYTNYTSPNETILCPDSYQSMYSQMLCGLVQNKEVLRVGAVFASGFIRAIRFLEKHWTL  291

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG +   I D   R A+ ++ L PDP+LAD +E  CR  SW+GI+ RLWP  KY
Sbjct  292   LCRDIRTGTIDQQITDPSVREAVMRV-LKPDPKLADFVEGECRKESWQGIITRLWPNTKY  350

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+  LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  351   VDVIVTGTMSQYIPTLDYYSN-DLPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMA  409

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    +  N     +      Q  LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  410   YFEFLPVHRN----NGTNSISVPKSLNDKEQQDLVDLVDVKLGQEYELVVTTYAGLYRYR  465

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  466   VGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQAAVKNAVNHLMPFDATLTEY  525

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G+  I   V +DCC+ +EE L+ VYR+ R  DK IGPL
Sbjct  526   TSYADTTTIPGHYVLYWELSLRGSTPIPPSVFEDCCLTVEESLNSVYRQGRVSDKSIGPL  585

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             E+++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  586   EMKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVSNYFSPKCPKWI  644

Query  175   P  173
             P
Sbjct  645   P  645



>emb|CDP05830.1| unnamed protein product [Coffea canephora]
Length=621

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/539 (56%), Positives = 395/539 (73%), Gaps = 6/539 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV  YEDI+P + RIANGD    I  QPI+E L SSGTSGGE KLMP+  E+L+R
Sbjct  77    FKKIMPVTTYEDIQPDVNRIANGDKSQIICSQPISEFLTSSGTSGGERKLMPTTEEELER  136

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LYNL+MP+M Q++PG++ GK MY  F+K+E  TP GL AR VLTSYYKS HFK RSF
Sbjct  137   RSLLYNLLMPVMSQFVPGLERGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKNRSF  196

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSM+ Q+L GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  197   DPYMNYTSPNETILCPDSYQSMFSQMLCGLCLNKEVLRVGAVFASGFIRAIRFLEKHWSL  256

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG L+  I D   R A+ KI L PDP+LA+ IE  C   SW+GI+ RLWP  KY
Sbjct  257   LCNDIRTGTLNPRITDPSVREAVMKI-LKPDPQLAEFIEGECGMESWQGIITRLWPNTKY  315

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YYS+G LPL+CTMYASSEC+FGVNL PL  P++V++TL+P +G
Sbjct  316   IDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECFFGVNLNPLCKPSEVSYTLIPTLG  374

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N       N     +      + +LVDL  V+LG  YELVVTT++GLYRYR
Sbjct  375   YFEFLPVDRNNGV---TNCISMPKSLNGKEKQELVDLADVKLGQEYELVVTTYAGLYRYR  431

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSID+DKT++ +L  ++  A+  L P  A + +Y
Sbjct  432   VGDVLRVAGFKNKAPQFNFICRKNVVLSIDADKTDEVELQNAVKNAESHLVPFDAQVTDY  491

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV++WE+   G+  I   V +DCC+A+EE L+ VYR+ R  DK IGPL
Sbjct  492   TSYADTTTIPGHYVLFWELSLNGSTPIPPSVFEDCCLAVEESLNSVYRQGRVSDKSIGPL  551

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             EI++V+ GTFD LM   +  G+SINQYKTPRC+K  +  +++L S V+A Y SP+ P W
Sbjct  552   EIKIVEAGTFDKLMDYALILGASINQYKTPRCVKF-APIVELLNSRVKASYCSPKCPKW  609



>ref|XP_010694299.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Beta 
vulgaris subsp. vulgaris]
Length=622

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/541 (56%), Positives = 394/541 (73%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  75    FKKLIPVIKYEDIQSDITRIANGDKSPILCSHPISEFLTSSGTSGGERKLMPTIEEELDR  134

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M Q++PG+D+GK MY  FVK+E  TP GL AR VLTSYYKS HF+ R F
Sbjct  135   RCMLYSLLMPVMSQFVPGLDKGKGMYFLFVKSEAKTPGGLFARPVLTSYYKSSHFQNRPF  194

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             D Y + TSP+++ILCSD+ QSMY Q+L GL    +VLR+GAVFAS F+RAI FL+ +W  
Sbjct  195   DSYTNYTSPNETILCSDSYQSMYSQMLCGLCQNNEVLRVGAVFASGFIRAIKFLEKHWTL  254

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIR G L+  I D   R A+ +I L PDP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  255   LAHDIRVGSLNPEITDPIVRDAVMQI-LKPDPKLADFIELECSKESWQGIITRLWPNTKY  313

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P+MG
Sbjct  314   VDVIVTGTMAQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPSMG  372

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N   ++  N     +      Q +LV+L  V+LG  YELV+TT++GLYRYR
Sbjct  373   YFEFLPVQRNVNGVT--NSISMPKSLTEKEQQQLVELTDVKLGHEYELVITTYAGLYRYR  430

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L+P  A L+EY
Sbjct  431   VGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAVKNAVTHLQPFDATLLEY  490

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYAD S++PGHYV++WE+   G   +   V +DCC+AIEE L+ VYR+ R  DK IGPL
Sbjct  491   TSYADLSTIPGHYVLFWELSRNGCTTVPPSVFEDCCLAIEESLNSVYRQGRVSDKSIGPL  550

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI+VV+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + Y SP+ P W 
Sbjct  551   EIKVVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVSTYLSPKCPKWV  609

Query  175   P  173
             P
Sbjct  610   P  610



>ref|XP_004149936.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis 
sativus]
 ref|XP_004165416.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cucumis 
sativus]
 gb|KGN56171.1| hypothetical protein Csa_3G088930 [Cucumis sativus]
Length=604

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/545 (57%), Positives = 399/545 (73%), Gaps = 18/545 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPIT-GQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             FK  +P+++Y+ I+P++ RIANGD FSPI    PI+E L SSGTSGGE KLMP+I E+LD
Sbjct  65    FKTSIPLVSYDQIQPFVSRIANGD-FSPILCSSPISEFLTSSGTSGGERKLMPTIEEELD  123

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             RR+ LY+L+MP+M Q++PG+++GK MY  F+KAE  TP GL AR VLTSYYKS HFK R 
Sbjct  124   RRSLLYSLLMPVMTQFVPGLEKGKGMYFLFIKAEAKTPGGLLARPVLTSYYKSSHFKERP  183

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             +DPY + TSP+++ILC D+ QSMY QLL GL +R  VLR+GAVFAS F+RAI FL+ +W 
Sbjct  184   YDPYTNYTSPNEAILCPDSYQSMYAQLLCGLCHRLDVLRVGAVFASGFIRAIRFLEKHWQ  243

Query  1258  SLCLDIRTGQLSGMIADSECRSA-MSKILLAPDPELADEIEEICRAASWKGIVYRLWPKA  1082
              LC DIRTG L+  I D   R A MS +L  PDPELAD +   C    W+GI+ RLWP  
Sbjct  244   LLCHDIRTGTLNSQITDQAVRDAVMSSVLRGPDPELADYVHGECCKGWWQGIITRLWPNT  303

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KY++ ++TG+MSQY+  L YYS+G LPL+CTMYASSECYFGVNL PL  P++VA+TL+P+
Sbjct  304   KYVDVIVTGTMSQYITTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPS  362

Query  901   MGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYR  722
             M YFEF+P+       S++N       + S+ + +LVDL  V LG  YELVVTT++GLYR
Sbjct  363   MAYFEFLPVER-----SHIND------DNSLNEQQLVDLTDVELGKEYELVVTTYAGLYR  411

Query  721   YRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLV  542
             YR+GD+L+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  +   L P +A L 
Sbjct  412   YRVGDILRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNSVNNLMPFEATLA  471

Query  541   EYTSYADTSSVPGHYVIYWEIMHAGAAA--IDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             EYTSYA+TS++PGHYV+YWE+     AA  +   VL+DCC+ IEE L+ VYR+ R  DK 
Sbjct  472   EYTSYANTSTIPGHYVLYWELNQKEGAATPVPPSVLEDCCLTIEESLNSVYRQGRVSDKS  531

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             IGPLEI+VV+ GTFD LM   I+ G+SINQYKTPRC+K     +++L S V   YFSP+ 
Sbjct  532   IGPLEIKVVENGTFDKLMDYAISMGASINQYKTPRCVKFQ-PIVELLNSRVVGSYFSPKC  590

Query  187   PAWKP  173
             P W P
Sbjct  591   PKWVP  595



>ref|XP_008452341.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Cucumis 
melo]
Length=604

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/545 (57%), Positives = 396/545 (73%), Gaps = 18/545 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPIT-GQPITEMLCSSGTSGGEPKLMPSIAEDLD  1619
             FK  +P+++Y+ I+P++ RIANGD FSPI    PI+E L SSGTSGGE KLMP+I E+L+
Sbjct  65    FKTSIPLVSYDQIQPFVSRIANGD-FSPILCSSPISEFLTSSGTSGGERKLMPTIEEELE  123

Query  1618  RRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRS  1439
             RR+ LY+L+MP+M Q++PG+++GK MY  F+KAE  TP GL AR VLTSYYKS HFK R 
Sbjct  124   RRSLLYSLLMPVMSQFVPGLEKGKGMYFLFIKAEAKTPGGLLARPVLTSYYKSSHFKERP  183

Query  1438  FDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWP  1259
             +DPY + TSP+++ILC D+ QSMY QLL GL +R  VLR+GAVFAS F+RAI FL+ +W 
Sbjct  184   YDPYTNYTSPNEAILCPDSYQSMYAQLLCGLCHRLDVLRVGAVFASGFIRAIRFLEKHWQ  243

Query  1258  SLCLDIRTGQLSGMIADSECRSA-MSKILLAPDPELADEIEEICRAASWKGIVYRLWPKA  1082
              LC DIRTG L+  I D   R A M  +L  PDPELAD I   C   SW+GI+ RLWP  
Sbjct  244   LLCHDIRTGTLNSQITDQAVRDAVMLSVLRRPDPELADYIHGECCKGSWQGIITRLWPNT  303

Query  1081  KYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPN  902
             KY++ ++TG+MSQY+  L YYS+G LPL+CTMYASSECYFGVNL PL  P++VA+TL+P+
Sbjct  304   KYVDVIVTGTMSQYIATLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVAYTLIPS  362

Query  901   MGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYR  722
             M YFEF+P+  +     N           S+ + +LVDL  V LG  YELVVTT++GLYR
Sbjct  363   MAYFEFLPIERSHNNDDN-----------SLDEQQLVDLTDVELGKEYELVVTTYAGLYR  411

Query  721   YRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLV  542
             YR+GD+L+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  +   L P +A L 
Sbjct  412   YRVGDILRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNSMNHLVPFEATLA  471

Query  541   EYTSYADTSSVPGHYVIYWEIMHAGAAA--IDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             EYTSYA+TS++PGHYV+YWE+     AA  +   VL+DCC+ IEE L+ VYR+ R  DK 
Sbjct  472   EYTSYANTSTIPGHYVLYWEVNQKEGAATPVPPSVLEDCCLTIEESLNSVYRQGRVSDKS  531

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             IGPLEI+VV+ GTFD LM   I+ G+SINQYKTPRC+K     +++L S V   YFSP+ 
Sbjct  532   IGPLEIKVVENGTFDKLMDYAISMGASINQYKTPRCVKFQ-PIVELLNSRVVGSYFSPKC  590

Query  187   PAWKP  173
             P W P
Sbjct  591   PKWVP  595



>ref|XP_003526154.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine 
max]
Length=609

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/542 (57%), Positives = 401/542 (74%), Gaps = 7/542 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+P I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  63    FKKLLPVITYEDIQPDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGR  122

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+++GK MYL F+K+E  TP G+ AR VLTSYYKS +FK R +
Sbjct  123   RSLLYSLLMPVMSQFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSYFKDRPY  182

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP++++LC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  183   DPYTNYTSPNETVLCLDSYQSMYSQLLCGLCQHKEVLRVGAVFASGFIRAIRFLEKHWPL  242

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG +   + D   R A+ KI L PD  LAD I+  C  +SW+GI+ RLWP  KY
Sbjct  243   LCHDIRTGTIDNTVTDLSVRDAVMKI-LKPDARLADLIQCECGKSSWQGIITRLWPNTKY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  302   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMC  360

Query  895   YFEFIPLGE-NGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             YFEF+P+   NG    NL+      E+E   Q +LV+LV V+LG  YELVVTT++GLYRY
Sbjct  361   YFEFLPVNRSNGVSHDNLHTPRSLNEKE---QKELVELVDVKLGQEYELVVTTYAGLYRY  417

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + E
Sbjct  418   RVGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMKNAVTHLVPFDASVSE  477

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTSYADT+++PGHYV+YWE+   G+  I   V +DCC+ IEE L+ VYR+ R  DK IGP
Sbjct  478   YTSYADTTTIPGHYVLYWELSLKGSTPIPPCVFEDCCLTIEESLNSVYRQGRVSDKSIGP  537

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  L++L S V  +YFSP+ P W
Sbjct  538   LEIKIVEQGTFDKLMDYAISLGASINQYKTPRCVKF-APVLELLNSRVVEKYFSPKCPKW  596

Query  178   KP  173
              P
Sbjct  597   VP  598



>ref|NP_001055967.1| Os05g0500900 [Oryza sativa Japonica Group]
 sp|Q60EJ6.1|GH34_ORYSJ RecName: Full=Probable indole-3-acetic acid-amido synthetase 
GH3.4; AltName: Full=Auxin-responsive GH3-like protein 4; Short=OsGH3-4 
[Oryza sativa Japonica Group]
 gb|AAU90225.1| putative auxin-responsive protein GH3 [Oryza sativa Japonica 
Group]
 dbj|BAF17881.1| Os05g0500900 [Oryza sativa Japonica Group]
 gb|EAY98588.1| hypothetical protein OsI_20501 [Oryza sativa Indica Group]
 gb|EEE64261.1| hypothetical protein OsJ_19094 [Oryza sativa Japonica Group]
Length=629

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/541 (55%), Positives = 394/541 (73%), Gaps = 14/541 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             F+R  P++ YEDI P +LRIANGD    ++G+P++E L SSGTSGGE KLMP+I E+++R
Sbjct  74    FRRLAPLVTYEDILPDVLRIANGDTSPILSGKPVSEFLTSSGTSGGERKLMPTIEEEMER  133

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M + +PG+D+GKAMYLYFVK+E  TP GLPAR VLTS+Y+S++F  R  
Sbjct  134   RSGLYSLLMPVMSRQVPGLDKGKAMYLYFVKSEWRTPGGLPARPVLTSFYRSRYFLERPH  193

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY   TSPD+++LC D  QSMY QL+ GLV+R  VLR+GAVFAS FLRAI FL+ +WPS
Sbjct  194   DPYTVYTSPDEAVLCEDAYQSMYAQLICGLVHRADVLRVGAVFASGFLRAIRFLEKHWPS  253

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR G+L G + D   R A+ ++L   DP LAD IE  C   SW+GI+ R+WP  KY
Sbjct  254   LCRDIRAGELDGGVTDPAVRGAVGRVLRGADPALADAIEAECARPSWQGIIRRVWPSTKY  313

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+M+QY+P L +Y  G LPL CTMYASSECYFG+NL P+  P++VA+TL+P M 
Sbjct  314   IDVIVTGAMAQYIPTLEFYGGG-LPLACTMYASSECYFGLNLNPMCKPSEVAYTLIPTMC  372

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P          +N    +          LVDLV V+LG  YELVVTT+SGLYRYR
Sbjct  373   YFEFLP----------VNSGANDVAAPEPDHRGLVDLVDVKLGHEYELVVTTYSGLYRYR  422

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF N AP F F  R+NV LSIDSDKT++ +LH ++T A + L P  A LVEY
Sbjct  423   VGDVLRVAGFKNAAPMFAFVRRKNVALSIDSDKTDEAELHAAVTEAVQHLAPFGASLVEY  482

Query  535   TSYADT-SSVPGHYVIYWEIMH-AGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             TSYADT +++PGHYV++WE+   AG   + A V +DCC+A+EE L+ VYR+CR+ D+ IG
Sbjct  483   TSYADTATTIPGHYVLFWELRSPAGGTPVPASVFEDCCLAVEEGLNSVYRQCRAADRSIG  542

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVV  GTFD LM   ++ G+SINQYK PRC++     +++L+  V+A YFSP+ P 
Sbjct  543   PLEIRVVADGTFDKLMDYALSRGASINQYKAPRCVRPG-PVVELLDGRVQATYFSPKCPK  601

Query  181   W  179
             W
Sbjct  602   W  602



>ref|XP_002316954.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa]
 gb|EEE97566.1| DWARF IN LIGHT 1 family protein [Populus trichocarpa]
Length=611

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/541 (56%), Positives = 393/541 (73%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+P I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  69    FKKVMPVINYEDIQPDINRIANGDASPILCSKPISEFLTSSGTSGGERKLMPTIVEELGR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++P +++GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  129   RSLLYSLLMPVMSQFVPDLEKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSTHFKDRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+  W  
Sbjct  189   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIRFLEKYWKF  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG +   I D   R A+ KI L PD +LAD IE  C   SW+GI+ RLWP  KY
Sbjct  249   LANDIRTGIIDPQITDPSIREAVMKI-LKPDAKLADFIEAECSKESWQGIITRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL P+  P++V++TL+P M 
Sbjct  308   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N      +N     +  +   Q +LVDLV V+L   YELVVTT++GLYRYR
Sbjct  367   YFEFLPVNRNN---GGINSVSRPKSLKEKEQQELVDLVDVKLDQEYELVVTTYAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  424   VGDVLRVVGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQSAVKNAVNHLIPFDATLAEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV++WE+  +G+  I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  484   TSYADTTTIPGHYVLFWELSLSGSTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  543

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S   +RYFSP+ P W 
Sbjct  544   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRAVSRYFSPKCPKWV  602

Query  175   P  173
             P
Sbjct  603   P  603



>ref|XP_004510013.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Cicer 
arietinum]
Length=606

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/541 (56%), Positives = 404/541 (75%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI+YEDI+  I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  63    FKKILPVISYEDIQTDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELAR  122

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+++GK MYL F+K+E  TP G+ AR VLTSYYKS HF+ R +
Sbjct  123   RSLLYSLLMPVMSQFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSHFRDRPY  182

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP++++LC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  183   DPYTNYTSPNETVLCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTL  242

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG ++ +I DS  R ++ KI L PDP+LAD I+  C  +SW+GI+ RLWP  KY
Sbjct  243   LVNDIRTGTVNPLITDSSVRDSVMKI-LKPDPKLADFIQTECSESSWQGIITRLWPNTKY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L +YS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  302   VDVIVTGTMSQYIPILDHYSNG-LPLVCTMYASSECYFGVNLNPLCQPSEVSYTLIPTMC  360

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  +     +L+      E+E   Q +LV+LV V+LG  YELVVTT++GLYRYR
Sbjct  361   YFEFLPVNRSNGVTDSLHTPRSLNEKE---QQELVELVDVKLGQEYELVVTTYAGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  +++ A   L P  A + EY
Sbjct  418   VGDVLKVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMSNAMTHLVPFDATVSEY  477

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G+  I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  478   TSYADTTTIPGHYVLYWELTLNGSTPIPPCVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  537

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  538   EIKIVEQGTFDKLMDYAISLGASINQYKTPRCVKF-APVVELLNSRVMSSYFSPKCPKWV  596

Query  175   P  173
             P
Sbjct  597   P  597



>ref|XP_009346484.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Pyrus 
x bretschneideri]
Length=614

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/541 (56%), Positives = 389/541 (72%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKKMMPVIKYEDIQSDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M QY+PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTL  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI +G L+  I D   R A+ KI L PDP+LA  IE  C  ASW GI+ RLWP  KY
Sbjct  250   LCKDIASGTLNRQITDPSVREAVMKI-LKPDPKLASFIEAECGKASWHGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LP +CTMYASSECYFGVNL PL  P++V++TL+P MG
Sbjct  309   VDVIVTGTMSQYIPTLEYYSNG-LPQVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMG  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFE +P+  N     N N     +      Q +LVDL   +LG  YELVVTT++GLYRYR
Sbjct  368   YFELLPVQRNNGI--NSNPLSVPKSLNEKEQQQLVDLADAKLGQEYELVVTTYAGLYRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VA F NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  426   VGDVLRVASFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATVTEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TS+ADT+++PGHYV++WE+   G   I   V +DCC   EE L+ VYR+ R+ DK IGPL
Sbjct  486   TSFADTTTIPGHYVLFWELSLNGTTPIPPSVFEDCCFTAEESLNSVYRQGRASDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L + V + YFSP+ P W 
Sbjct  546   EIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLSTRVVSSYFSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>ref|XP_011020987.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Populus 
euphratica]
 ref|XP_011048519.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Populus 
euphratica]
Length=608

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/544 (56%), Positives = 394/544 (72%), Gaps = 12/544 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV++YED++P I RIANGD    I  QPI+E L SSGTS GE KLMP+I E+L R
Sbjct  65    FKKVMPVVSYEDLKPDIDRIANGDTCQIICSQPISEFLTSSGTSAGERKLMPTIEEELGR  124

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+D GK MY  F+K+E  TP GL AR VLTSYYKS +F+ R +
Sbjct  125   RSLLYSLLMPVMNQFVPGLDRGKGMYFLFIKSEAKTPGGLLARPVLTSYYKSSYFRDRPY  184

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN+ TSP+++ILC D+ QSMY QLL GL     VLR+GAVFAS F+RAI FL+ +W  
Sbjct  185   DPYNNYTSPNETILCQDSYQSMYSQLLCGLYQNYDVLRVGAVFASGFIRAIKFLEKHWIM  244

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR G +   I+D   R A+ KI L P+ +LAD +E  C   SWKGI+ RLWP  KY
Sbjct  245   LCNDIRNGTIDPKISDPSVREAVLKI-LKPNQKLADFVEAECTRESWKGIITRLWPNTKY  303

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YY DG LPL+CTMYASSECYFG+NL PLS P++V++TL+P M 
Sbjct  304   IDVIVTGTMSQYIPTLDYYCDG-LPLVCTMYASSECYFGLNLNPLSKPSEVSYTLIPTMA  362

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSK---LVDLVHVRLGCYYELVVTTFSGLY  725
             YFEF+P+      ++++          S+ Q K   LVDLV V+LG  YELVVTT++GLY
Sbjct  363   YFEFLPVNRKNGLINSIT------APTSLDQKKDEELVDLVDVKLGEEYELVVTTYAGLY  416

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L
Sbjct  417   RYRVGDILRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAVQNAANHLLPFGASL  476

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
              EYTSYADTS +PGHYV++WEI  +G   I   V +DCC+AIEE L+ VYR+ R  DK I
Sbjct  477   TEYTSYADTSKIPGHYVLFWEICLSGTTPIPPSVFEDCCLAIEESLNSVYRQGRVSDKSI  536

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIR+ + GTFD LM   +++G+SINQYK PRC+K  +  +++L S V + Y SP+ P
Sbjct  537   GPLEIRITERGTFDKLMDFALSQGASINQYKAPRCVKY-APIIELLNSRVVSNYISPKCP  595

Query  184   AWKP  173
              W P
Sbjct  596   KWVP  599



>tpg|DAA42049.1| TPA: hypothetical protein ZEAMMB73_501171, partial [Zea mays]
Length=651

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/555 (57%), Positives = 413/555 (74%), Gaps = 29/555 (5%)
 Frame = -1

Query  1813  EDLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSI  1634
             ++L + FK  VPV+ YED++PYI RIANG   S I+ + ITE+L SSGTSGG+PKLMPS 
Sbjct  106   DELAATFKERVPVVEYEDVKPYIERIANGAPSSLISSKTITELLTSSGTSGGQPKLMPST  165

Query  1633  AEDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKH  1454
              E+LDR+TFLYNL++P+M++Y+ G+DEG+ MYL FVK EM TP GL AR VLTSYYKS+H
Sbjct  166   EEELDRKTFLYNLLVPVMNKYVEGLDEGRCMYLLFVKPEMKTPSGLVARPVLTSYYKSRH  225

Query  1453  FKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFL  1274
             F+ R   PY   TSP+++ILC+D+ QSMY QLL GL  R +VLR+GAVFASAFLRA+ FL
Sbjct  226   FRERPDSPYTRYTSPNEAILCADSAQSMYAQLLCGLARRGEVLRVGAVFASAFLRALKFL  285

Query  1273  QHNWPSLCLDIRTGQL-SGMIADSECRSAMSKILLAPDPELADEIEEICR--AASWKGIV  1103
             + +W +LC DIR G++ +  + D  CR A+++++  PD  LAD I   C   AASW+GIV
Sbjct  286   EGHWRALCDDIRAGRVDAARVTDRACRDAVARVVARPDAALADAIAAECEAGAASWRGIV  345

Query  1102  YRLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADV  923
              RLWP+ KYI+ ++TGSM+QYVP L +Y  G LPL+ TMYASSECYFG+NL+PL  P DV
Sbjct  346   RRLWPRTKYIDVIVTGSMAQYVPLLEFYG-GGLPLVSTMYASSECYFGINLRPLDRPEDV  404

Query  922   AFTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVT  743
             A+TLLPNM Y+EFI + ++G               E +   ++VDLV V +G YYELVVT
Sbjct  405   AYTLLPNMCYYEFIKVEKDG---------------EEVRDGEVVDLVDVEVGAYYELVVT  449

Query  742   TFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLE  563
             TF+GLYRYR+GD+LQV+GFHN APQF+F  RRNVVLS+D+DKT+++DL R++TAAK+LL 
Sbjct  450   TFTGLYRYRVGDILQVSGFHNAAPQFRFVHRRNVVLSVDTDKTSEDDLLRAVTAAKRLLA  509

Query  562   PHQALLVEYTSYADTSSVPGHYVIYWEI-----MHAGAAAIDAQVLQDCCIAIEEQLDYV  398
             P  A+L EYT+YADT+S+PGHYV++WE+     + +GAA     V+  CC  +E  LD V
Sbjct  510   PLGAILSEYTAYADTASIPGHYVLFWELTPPPTLSSGAAG----VMAACCAEVEAGLDSV  565

Query  397   YRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESN  218
             YRRCRS D+ +GPLEIRVV PG FD LM   ++ GSS+NQYKTPRCIK +  A+ +LE+ 
Sbjct  566   YRRCRSRDRSVGPLEIRVVSPGAFDELMDLCVSHGSSVNQYKTPRCIK-HPDAIAVLEAR  624

Query  217   VRARYFSPRDPAWKP  173
             V  R+FS   P W+P
Sbjct  625   VVGRFFSDTVPHWEP  639



>ref|XP_004294315.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Fragaria 
vesca subsp. vesca]
Length=607

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/541 (56%), Positives = 393/541 (73%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI Y+ I+P I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  62    FKKLMPVITYDHIQPDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELER  121

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M QY+P ++ GK MY  FVK+E  TP GL AR VLTSYYKS HFK R +
Sbjct  122   RSLLYSLLMPVMSQYVPELETGKGMYFLFVKSEAKTPGGLVARPVLTSYYKSSHFKQRPY  181

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  182   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWSI  241

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI +G L+  I D   R ++SKI L PDP+LA  I   C   SW+GI+ RLWP  KY
Sbjct  242   LCKDIESGTLNSQITDPSVRDSVSKI-LKPDPKLAGFIATECGKKSWQGIITRLWPNTKY  300

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL P+  P++V++TL+P M 
Sbjct  301   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPMCKPSEVSYTLIPTMC  359

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N     N +     E      Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  360   YFEFLPVNRNNGV--NSDSVSVPESLTEKEQLQLVDLVDVKLGQEYELVVTTYAGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  418   VGDLLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVTHLVPFDANVGEY  477

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTS +PGHYV++WE+   G   I   V +DCC+AIEE L+ VYR+ R+ DK IGPL
Sbjct  478   TSYADTSKIPGHYVLFWELSLNGTTPIPPSVFEDCCLAIEESLNSVYRQGRASDKSIGPL  537

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  538   EIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVASTYFSPKCPKWV  596

Query  175   P  173
             P
Sbjct  597   P  597



>ref|XP_011030915.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Populus 
euphratica]
Length=611

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/541 (56%), Positives = 399/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+P I RIA+GD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  69    FKKVMPVINYEDIQPDINRIASGDASPILCSKPISEFLTSSGTSGGERKLMPTIVEELGR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+++GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  129   RSLLYSLLMPVMNQFVPGLEKGKGMYFLFIKSEAKTPSGLVARPVLTSYYKSTHFKDRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+  W  
Sbjct  189   DPYTNYTSPNETILCPDSYQSMYSQMLCGLCQHQEVLRVGAVFASGFIRAIRFLEKYWKF  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG +   I D   R A+ KI L PD +LAD IE  C   SW+GI+ RLWP  KY
Sbjct  249   LANDIRTGIIDPQITDPSIREAVMKI-LKPDAKLADFIEAECSKESWQGIITRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL P+  P++V++TL+P M 
Sbjct  308   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPICKPSEVSYTLIPTMA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N   ++++++    +E+E   Q +LVDLV V+L   YELVVTT++GLYRYR
Sbjct  367   YFEFLPVNRNNGVINSVSRPKSLKEKE---QQELVDLVDVKLDHEYELVVTTYAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+V GF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L EY
Sbjct  424   VGDVLRVVGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQSAVKKAVNHLIPFDATLAEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV++WE+   G+  I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  484   TSYADTTTIPGHYVLFWELSLNGSTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  543

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+PGTFD LM   I+ G+SINQYKTPRC+K  +  +++L S   + YFSP+ P W 
Sbjct  544   EIKIVEPGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRAVSCYFSPKCPKWV  602

Query  175   P  173
             P
Sbjct  603   P  603



>ref|XP_009355553.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Pyrus 
x bretschneideri]
Length=614

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/541 (56%), Positives = 389/541 (72%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKKMMPVIKYEDIQSDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M QY+PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTL  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI +G L+  I D     A+ KI L PDP+LA  IE  C  ASW GI+ RLWP  KY
Sbjct  250   LCKDIASGTLNPQITDPSVHEAVMKI-LKPDPKLASFIEAECGKASWHGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LP +CTMYASSECYFGVNL PL  P++V++TL+P MG
Sbjct  309   VDVIVTGTMSQYIPTLEYYSNG-LPQVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMG  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N     N N     +      Q +L+DL   +LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVQRNNGI--NSNPLSVPKSLNEKEQQQLLDLADAKLGQEYELVVTTYAGLYRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VA F NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  426   VGDVLRVASFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATVTEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TS+ADT+++PGHYV++WE+   G   I   V +DCC   EE L+ VYR+ R+ DK IGPL
Sbjct  486   TSFADTTTIPGHYVLFWELSLNGTTPIPPSVFEDCCFTAEESLNSVYRQGRASDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L + V + YFSP+ P W 
Sbjct  546   EIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLSTRVVSSYFSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>ref|XP_008670756.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.13 
[Zea mays]
 ref|XP_008670757.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.13 
[Zea mays]
 ref|XP_008670758.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.13 
[Zea mays]
 ref|XP_008670759.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.13 
[Zea mays]
 ref|XP_008670760.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.13 
[Zea mays]
 ref|XP_008670761.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.13 
[Zea mays]
Length=669

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/555 (57%), Positives = 413/555 (74%), Gaps = 29/555 (5%)
 Frame = -1

Query  1813  EDLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSI  1634
             ++L + FK  VPV+ YED++PYI RIANG   S I+ + ITE+L SSGTSGG+PKLMPS 
Sbjct  115   DELAATFKERVPVVEYEDVKPYIERIANGAPSSLISSKTITELLTSSGTSGGQPKLMPST  174

Query  1633  AEDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKH  1454
              E+LDR+TFLYNL++P+M++Y+ G+DEG+ MYL FVK EM TP GL AR VLTSYYKS+H
Sbjct  175   EEELDRKTFLYNLLVPVMNKYVEGLDEGRCMYLLFVKPEMKTPSGLVARPVLTSYYKSRH  234

Query  1453  FKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFL  1274
             F+ R   PY   TSP+++ILC+D+ QSMY QLL GL  R +VLR+GAVFASAFLRA+ FL
Sbjct  235   FRERPDSPYTRYTSPNEAILCADSAQSMYAQLLCGLARRGEVLRVGAVFASAFLRALKFL  294

Query  1273  QHNWPSLCLDIRTGQL-SGMIADSECRSAMSKILLAPDPELADEIEEICR--AASWKGIV  1103
             + +W +LC DIR G++ +  + D  CR A+++++  PD  LAD I   C   AASW+GIV
Sbjct  295   EGHWRALCDDIRAGRVDAARVTDRACRDAVARVVARPDAALADAIAAECEAGAASWRGIV  354

Query  1102  YRLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADV  923
              RLWP+ KYI+ ++TGSM+QYVP L +Y  G LPL+ TMYASSECYFG+NL+PL  P DV
Sbjct  355   RRLWPRTKYIDVIVTGSMAQYVPLLEFYG-GGLPLVSTMYASSECYFGINLRPLDRPEDV  413

Query  922   AFTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVT  743
             A+TLLPNM Y+EFI + ++G               E +   ++VDLV V +G YYELVVT
Sbjct  414   AYTLLPNMCYYEFIKVEKDG---------------EEVRDGEVVDLVDVEVGAYYELVVT  458

Query  742   TFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLE  563
             TF+GLYRYR+GD+LQV+GFHN APQF+F  RRNVVLS+D+DKT+++DL R++TAAK+LL 
Sbjct  459   TFTGLYRYRVGDILQVSGFHNAAPQFRFVHRRNVVLSVDTDKTSEDDLLRAVTAAKRLLA  518

Query  562   PHQALLVEYTSYADTSSVPGHYVIYWEI-----MHAGAAAIDAQVLQDCCIAIEEQLDYV  398
             P  A+L EYT+YADT+S+PGHYV++WE+     + +GAA     V+  CC  +E  LD V
Sbjct  519   PLGAILSEYTAYADTASIPGHYVLFWELTPPPTLSSGAAG----VMAACCAEVEAGLDSV  574

Query  397   YRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESN  218
             YRRCRS D+ +GPLEIRVV PG FD LM   ++ GSS+NQYKTPRCIK +  A+ +LE+ 
Sbjct  575   YRRCRSRDRSVGPLEIRVVSPGAFDELMDLCVSHGSSVNQYKTPRCIK-HPDAIAVLEAR  633

Query  217   VRARYFSPRDPAWKP  173
             V  R+FS   P W+P
Sbjct  634   VVGRFFSDTVPHWEP  648



>ref|XP_008359299.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like isoform 
X2 [Malus domestica]
Length=614

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/541 (56%), Positives = 388/541 (72%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  70    FKKMMPVIKYEDIQSDINRIANGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEELDR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M QY+PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK R +
Sbjct  130   RSLLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFKQRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP ++ILC D+ QSMY QLL  L   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPXETILCPDSYQSMYSQLLCSLCQNKEVLRVGAVFASGFIRAIRFLEKHWTL  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI +G L+  I D   R A+ KI L PDP+LA  IE  C  ASW GI+ RLWP  KY
Sbjct  250   LCKDIASGTLNPQITDPSVRQAVMKI-LKPDPKLASFIEAECGKASWHGIITRLWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LP +CTMYASSECYFGVNL PL  P++V++TL+P MG
Sbjct  309   VDVIVTGTMSQYIPTLEYYSNG-LPQVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMG  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N     N N     +      Q +LVDL  V+LG  YELVVTT++GLYRYR
Sbjct  368   YFEFLPVQRNNGI--NSNPLSVPKSLNEKEQQQLVDLADVKLGQEYELVVTTYAGLYRYR  425

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VA F N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  426   VGDVLRVASFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDATVTEY  485

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TS+ADT+++PGHYV++WE+   G   I   V +DCC   EE L+ VYR+ R+ DK IGPL
Sbjct  486   TSFADTTTIPGHYVLFWELSLNGTTPIPPSVFEDCCFTAEESLNSVYRQGRASDKSIGPL  545

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L + V + YFSP+ P W 
Sbjct  546   EIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLSTRVVSSYFSPKCPKWV  604

Query  175   P  173
             P
Sbjct  605   P  605



>gb|KEH19704.1| indole-3-acetic acid-amido synthetase [Medicago truncatula]
Length=606

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/541 (56%), Positives = 403/541 (74%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI+YEDI+P I RI+NGD    +  +PI+E L SSGTSGGE KLMP+I E+L R
Sbjct  63    FKKLLPVISYEDIQPDIDRISNGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELGR  122

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+++GK MYL F+K+E  TP G+ AR VLTSYYKS +F+ R +
Sbjct  123   RSLLYSLLMPVMSQFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSYFRDRPY  182

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP++++LC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  183   DPYTNYTSPNETVLCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWTL  242

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++ +I DS  R ++ KI L PDP+LAD I+  C   SW+GI+ RLWP  KY
Sbjct  243   LCNDIRTGTVNPLITDSTVRDSVMKI-LKPDPKLADFIQTECSKNSWQGIITRLWPNTKY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L +YS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  302   VDVIVTGTMSQYIPILDHYSNG-LPLVCTMYASSECYFGVNLNPLCQPSEVSYTLIPTMC  360

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  +     +L+      E+E   Q +LV+LV V+LG  YELVVTT++GLYRYR
Sbjct  361   YFEFLPVNRSNGVTDSLHTPRSLNEKE---QKELVELVDVKLGQEYELVVTTYAGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  418   VGDVLKVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMANAITHLVPFDATVSEY  477

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+    +  I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  478   TSYADTTTIPGHYVLYWELTLNKSTQIPPCVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  537

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V + YFSP+ P W 
Sbjct  538   EIKIVEQGTFDKLMDYAISLGASINQYKTPRCVKF-APVVELLNSRVMSSYFSPKCPKWV  596

Query  175   P  173
             P
Sbjct  597   P  597



>ref|XP_010092269.1| hypothetical protein L484_021129 [Morus notabilis]
 gb|EXB50903.1| hypothetical protein L484_021129 [Morus notabilis]
Length=611

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/541 (55%), Positives = 393/541 (73%), Gaps = 10/541 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+P I RIA GD    +  +PI+E L SSGTSGGE KLMP+I E++ R
Sbjct  72    FKKLIPVITYEDIQPDIDRIAKGDTSQILCSKPISEFLTSSGTSGGERKLMPTIEEEMGR  131

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+++GK MY  F+K+E  TP GL AR VLT+YYKS HF+ R +
Sbjct  132   RSLLYSLLMPVMSQFVPGLEKGKGMYFLFIKSEAKTPGGLVARPVLTAYYKSSHFRDRPY  191

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  192   DPYTNYTSPNEAILCPDSYQSMYSQLLCGLCQNKEVLRVGAVFASGFIRAIRFLEKHWRV  251

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG L+  I D   R A+ KI L PDP+LAD IE  C   SW+GI+ RLWP  KY
Sbjct  252   LCNDIRTGTLNPQITDPAVRDAVGKI-LQPDPKLADFIESECSKESWQGIITRLWPNTKY  310

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  311   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLYKPSEVSYTLIPTMA  369

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  +   ++ +          S    + V+L  V+LG  YELVVTT++GLYRYR
Sbjct  370   YFEFLPVNRSNNSINGVTN-------NSKEHLEPVNLADVKLGQEYELVVTTYAGLYRYR  422

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + EY
Sbjct  423   VGDVLRVAGFKNKAPQFSFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDANVSEY  482

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYA+T+++PGHYV+YWE+   G+  I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  483   TSYANTTTIPGHYVLYWEMSLKGSTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  542

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  543   EIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLNSRVVTEYFSPKCPKWV  601

Query  175   P  173
             P
Sbjct  602   P  602



>ref|XP_006644816.1| PREDICTED: LOW QUALITY PROTEIN: probable indole-3-acetic acid-amido 
synthetase GH3.1-like [Oryza brachyantha]
Length=611

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/546 (56%), Positives = 397/546 (73%), Gaps = 16/546 (3%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D V  F+R VP++ YE ++P ILRIANGD    ++G+PI+E L SSGTSGGE KLMP+IA
Sbjct  65    DAVDAFRRLVPLVTYEGLQPDILRIANGDTSPILSGKPISEFLTSSGTSGGERKLMPTIA  124

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             ++++RR+ LY+L+MP+M Q +PG+D+GKAMYL FVKAE  TP GL AR VLTSYY+S+ F
Sbjct  125   DEMNRRSLLYSLLMPVMSQSVPGLDKGKAMYLLFVKAESRTPGGLAARPVLTSYYRSRQF  184

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
               R  DPY   TSPD++ILC D+ QSMY QLL GLV+R  VLR+GAVFAS FLRAI FL+
Sbjct  185   LDRPRDPYTAYTSPDEAILCVDSYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIHFLE  244

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
              +W  LC DIRTG+L   I D   R A+ ++L A DP LAD IEE C  ASW+GI+ RLW
Sbjct  245   KHWARLCHDIRTGELDPEITDRAVRDAVGRVLRA-DPALADAIEEECARASWEGIIRRLW  303

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             P+ KYI+ ++TG+MSQY+P L +Y  G     CTMYASSECYFG+NL P+  P DVA+TL
Sbjct  304   PRTKYIDVIVTGTMSQYIPTLEFYGGGPPRRACTMYASSECYFGLNLNPMCKPRDVAYTL  363

Query  910   LPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             +P M Y+EF+P+       SN N E             LVDLV V++G  YELVVTT+SG
Sbjct  364   IPTMCYYEFLPVN-----CSNSNAEPS--------HRDLVDLVDVKVGHEYELVVTTYSG  410

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYR+GDVL+VAGF NKAP F F  R+NV LS+DSDKT++ +LH +++ + + L P  A
Sbjct  411   LYRYRVGDVLRVAGFKNKAPMFSFVRRQNVALSVDSDKTDETELHAAVSGSVQHLAPFGA  470

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDK  371
              LVEYTSYAD +++PGHYV++WE + AG+ A+ A V ++CC+++EE L+ VYR+ R+ D+
Sbjct  471   SLVEYTSYADAAAIPGHYVLFWE-LRAGSTAVPASVFEECCLSVEEALNSVYRQGRACDR  529

Query  370   CIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPR  191
              IGPLEIRVV  GTFD LM   ++ G+SINQYK PRC++     + +L+  V+A YFSP+
Sbjct  530   SIGPLEIRVVAEGTFDKLMDYALSRGASINQYKAPRCVRPG-PVVDLLDDRVQANYFSPK  588

Query  190   DPAWKP  173
              P W P
Sbjct  589   CPKWSP  594



>ref|XP_006360545.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
tuberosum]
Length=606

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/548 (55%), Positives = 396/548 (72%), Gaps = 14/548 (3%)
 Frame = -1

Query  1810  DLVSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIA  1631
             D   +FK+ +P++ YED++P I RIA+GD  S +  QPI+E L SSGTSGGE KLMP+I 
Sbjct  63    DDYENFKKIMPIVTYEDLKPDIDRIADGDRSSILCSQPISEFLTSSGTSGGERKLMPTIE  122

Query  1630  EDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHF  1451
             E+L RR+ LY+L+MP+M++++P + +GK MY  F+K+E  TP GL AR VLTSYYKS +F
Sbjct  123   EELGRRSLLYSLLMPVMNKFVPDLQKGKGMYFLFIKSEAKTPGGLLARPVLTSYYKSSYF  182

Query  1450  KCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQ  1271
             K R +DPY + TSP+++ILC D+ QSMY Q+L GL    QVLR+GAVFAS F+RAI FL+
Sbjct  183   KKRPYDPYTNYTSPNETILCLDSYQSMYSQMLCGLCQNTQVLRVGAVFASGFIRAIHFLE  242

Query  1270  HNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
              +WP LC DI+TG L+  I D   R ++ KI L PDP+LA+ IE  C   SWKGI+ RLW
Sbjct  243   KHWPILCRDIKTGTLNPQINDPMVRESVMKI-LKPDPDLAEFIEMECSKESWKGIIPRLW  301

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             P  KY++ ++TG+MSQY+P L+YY +  LPL+CTMYASSECYFG+NL PL  P++VA+TL
Sbjct  302   PNTKYVDVIVTGTMSQYIPTLKYYGN-DLPLVCTMYASSECYFGINLDPLCKPSEVAYTL  360

Query  910   LPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             +P MG+FEF+P+  +       NK           +  LVDLV V+LG  YELVVTT++G
Sbjct  361   IPTMGFFEFLPVARDDQGPEKSNKYD---------KDNLVDLVDVKLGHEYELVVTTYAG  411

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYR+GD+L+VAGF NKAPQF F CR+NV LSIDSDKT++ +LH ++  A   L P + 
Sbjct  412   LYRYRVGDILKVAGFKNKAPQFHFVCRKNVALSIDSDKTDEVELHDAVLKASTHLVPFET  471

Query  550   LLVEYTSYADTSSVPGHYVIYWEIMH--AGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSH  377
              L EYTSYADTS+ PGHYV+YWEI +  +    I   V +DCC+ IEE L+ VYR+CR  
Sbjct  472   SLTEYTSYADTSTNPGHYVLYWEINNDESDETLIPTSVFEDCCLTIEESLNSVYRQCRVS  531

Query  376   DKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFS  197
             DK IGPLEI+VV+ GTFD LM   I+ G+SINQYK PRC+ + +  +++L S V + YFS
Sbjct  532   DKSIGPLEIKVVENGTFDKLMDYAISNGASINQYKAPRCV-NYAPIIELLNSRVVSSYFS  590

Query  196   PRDPAWKP  173
             P+ P W P
Sbjct  591   PKCPKWVP  598



>ref|XP_010518490.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 
[Camelina sativa]
Length=667

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/413 (72%), Positives = 353/413 (85%), Gaps = 6/413 (1%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V +FKR VP+I Y+DI PYI RIANG+  S ITG PITE+LCSSGTSGGEPKLMP+I+ED
Sbjct  57    VLEFKRSVPIITYKDIYPYIHRIANGEDSSLITGHPITEILCSSGTSGGEPKLMPTISED  116

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             LDRRTFLYNLI+PI+++YIPG+D+GKAMYL FVKAE STPCG+P R VLTSYYKSKHF+C
Sbjct  117   LDRRTFLYNLIIPIVNKYIPGLDKGKAMYLNFVKAETSTPCGIPIRAVLTSYYKSKHFQC  176

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R +DP+ND+TSP Q+ILC D+NQSMYCQLLA L+ R +V+RLGAVFASAFLRAIS+L+  
Sbjct  177   RPYDPFNDLTSPIQTILCEDSNQSMYCQLLAALIQRHKVMRLGAVFASAFLRAISYLEQK  236

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC DIR+G+L+ MI D  C++AMS +L +P+PELA EIEEICR +SWKGI+ +LWPK
Sbjct  237   WSELCEDIRSGRLNPMITDPGCQTAMSSLLTSPNPELASEIEEICRGSSWKGILCQLWPK  296

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
             AK+IEAV+TGSMSQY+PAL  +S GK+PL+C MYASSE YFGVN++PLS P+DV FTLLP
Sbjct  297   AKFIEAVVTGSMSQYIPALELFSQGKIPLVCPMYASSETYFGVNVEPLSKPSDVVFTLLP  356

Query  904   NMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLY  725
             NM YFEFIPLG+NGT   +L+       +E +P  K+VDLV V+LG YYELVVTTF+GLY
Sbjct  357   NMCYFEFIPLGKNGTLSFDLDD------DEQVPCDKVVDLVSVKLGRYYELVVTTFAGLY  410

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLL  566
             RYRIGDVLQVAGF+NKAPQF+F CRRNVVLSID DKTN+EDLHRSIT AKK L
Sbjct  411   RYRIGDVLQVAGFYNKAPQFRFICRRNVVLSIDLDKTNEEDLHRSITLAKKKL  463


 Score =   150 bits (379),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 109/155 (70%), Gaps = 10/155 (6%)
 Frame = -1

Query  637  LSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEYTSYADTSSVPGHYVIYWEIMHAGAAA  458
            L   S     ED  +S++   K      ALL+EYTSYADTSS+PGHYV++WEI       
Sbjct  523  LGFVSHIKRQEDTRKSVSLGSK------ALLLEYTSYADTSSLPGHYVLFWEIQ----GK  572

Query  457  IDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQ  278
            ++ +++++CC+A+EE+LDY+YR+CR+ ++ IG LEIRVVKPGTF+ LM   I++G S NQ
Sbjct  573  LEPKLVEECCVAVEEELDYIYRQCRTKERSIGALEIRVVKPGTFEKLMDMIISQGGSFNQ  632

Query  277  YKTPRCIKSNSSALKILESNVRARYFSPRDPAWKP  173
            YKTPRC+K NS+  K+L  +V A +FS RDP W P
Sbjct  633  YKTPRCVKYNSATFKLLNGHVTASFFSTRDPTWVP  667



>ref|XP_002319398.1| hypothetical protein POPTR_0013s14740g [Populus trichocarpa]
 gb|EEE95321.1| hypothetical protein POPTR_0013s14740g [Populus trichocarpa]
Length=608

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/544 (56%), Positives = 392/544 (72%), Gaps = 12/544 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV++YED++P I RIANGD    I  QPI+E L SSGTS GE KLMP+I E+L R
Sbjct  65    FKKVMPVVSYEDLKPDIDRIANGDTSQIICSQPISEFLTSSGTSAGERKLMPTIEEELGR  124

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+D GK MY  F+K+E  TP GL AR VLTSYYKS +F+ R +
Sbjct  125   RSLLYSLLMPVMNQFVPGLDRGKGMYFLFIKSETKTPGGLLARPVLTSYYKSSYFRDRPY  184

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL     VLR+GAVFAS F+RAI FL+ +W  
Sbjct  185   DPYTNYTSPNETILCQDSYQSMYSQLLCGLYQNYDVLRVGAVFASGFIRAIKFLEKHWIL  244

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR G +   I+D   R A+ KI L P+ +LAD IE  C   SWKGI+ RLWP  KY
Sbjct  245   LCNDIRNGTIDPKISDPSVREAVLKI-LKPNQKLADFIEAECTRESWKGIITRLWPNTKY  303

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+P L YY DG LPL+CTMYASSECYFG+NL PLS P++V++TL+P M 
Sbjct  304   IDVIVTGTMSQYIPTLDYYCDG-LPLVCTMYASSECYFGLNLNPLSKPSEVSYTLIPTMA  362

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSK---LVDLVHVRLGCYYELVVTTFSGLY  725
             YFEF+P+      ++++          S+ Q K   LVDLV V+LG  YELVVTT++GLY
Sbjct  363   YFEFLPVNRKNGLINSIT------APTSLDQKKDQELVDLVDVKLGEEYELVVTTYAGLY  416

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RYR+GD+L+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A L
Sbjct  417   RYRVGDILRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAVQNAANHLLPFGASL  476

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
              EYTSYADTS +PGHYV++WEI  +G   I   V +DCC+AIEE L+ VYR+ R  DK I
Sbjct  477   TEYTSYADTSKIPGHYVLFWEICLSGTTPIPPSVFEDCCLAIEESLNSVYRQGRVSDKSI  536

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIR+ + G FD LM   +++G+SINQYK PRC+K  +  +++L S V + Y SP+ P
Sbjct  537   GPLEIRITERGAFDKLMDFALSQGASINQYKAPRCVKY-APIIELLNSRVVSNYISPKCP  595

Query  184   AWKP  173
              W P
Sbjct  596   KWVP  599



>ref|XP_006851205.1| hypothetical protein AMTR_s00043p00208540 [Amborella trichopoda]
 gb|ERN12786.1| hypothetical protein AMTR_s00043p00208540 [Amborella trichopoda]
Length=600

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/542 (57%), Positives = 397/542 (73%), Gaps = 10/542 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR +PVI YEDI+P I RIANGD    +    ++E L SSGTSGGE KLMP+I ED+DR
Sbjct  59    FKRMLPVITYEDIQPDIHRIANGDKSPILCSHAVSEFLTSSGTSGGERKLMPTIEEDMDR  118

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R   Y+L++PIM+Q++PG+D+GK MY  FVK+E  TP GL AR VLTSYYKSKHF  R +
Sbjct  119   RALFYSLLIPIMNQHVPGLDKGKGMYFLFVKSEAKTPSGLLARPVLTSYYKSKHFTERPY  178

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DP+N  TSP+++ILC D+ QSMY QLL GL   ++VLR+GAVFAS F+RAI FL+ +W  
Sbjct  179   DPFNVYTSPNEAILCPDSYQSMYSQLLCGLAQNQEVLRVGAVFASGFIRAIHFLEQHWRL  238

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC D+R+G ++  I D   R A+ KI L P P+LAD IE  C   SWK I+ RLWP  KY
Sbjct  239   LCEDLRSGSVNPHITDPGVREAVMKI-LKPKPKLADFIEMECSKGSWKSIITRLWPNTKY  297

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+  L +YS+G LPL+CTMY SSECYFG+NLKPL  P++VA+TLLP M 
Sbjct  298   IDVIVTGTMSQYIATLDFYSNG-LPLVCTMYGSSECYFGLNLKPLCKPSEVAYTLLPTMA  356

Query  895   YFEFIPLGE-NGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             YFEF+P+ + NG    ++ K+  E+E     +  LVDLV V +G  YELVVTT++GLYRY
Sbjct  357   YFEFLPVNKSNGVCEISVPKDLNEKE-----KKGLVDLVDVEVGQEYELVVTTYAGLYRY  411

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GDVL+VAGF NKAPQF F CR+NV LSI+SDKT++ +LH ++  A   LEP  A LVE
Sbjct  412   RVGDVLRVAGFKNKAPQFNFVCRKNVALSIESDKTDEVELHNAVIRASIHLEPFDASLVE  471

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTS+ADT+++PGHYV+YWE +  G   +   V +DCC+ IEE L+ VYR+ R+ DK IGP
Sbjct  472   YTSHADTTTIPGHYVLYWE-LRDGQTHVPPFVFEDCCLTIEESLNSVYRQSRASDKSIGP  530

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIRVV+ GTFD LM   ++ G+SINQYK PRC+K     +++L+S V  +YFSP+ P W
Sbjct  531   LEIRVVESGTFDKLMDYALSRGASINQYKAPRCVKFK-PIVELLDSRVVGKYFSPKCPKW  589

Query  178   KP  173
              P
Sbjct  590   VP  591



>ref|XP_008359298.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like isoform 
X1 [Malus domestica]
Length=618

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/545 (56%), Positives = 389/545 (71%), Gaps = 9/545 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEML----CSSGTSGGEPKLMPSIAE  1628
             FK+ +PVI YEDI+  I RIANGD    +  +PI+E L    CSSGTSGGE KLMP+I E
Sbjct  70    FKKMMPVIKYEDIQSDINRIANGDTSQILCSKPISEFLTSFCCSSGTSGGERKLMPTIEE  129

Query  1627  DLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFK  1448
             +LDRR+ LY+L+MP+M QY+PG+D+GK MY  F+K+E  TP GL AR VLTSYYKS HFK
Sbjct  130   ELDRRSLLYSLLMPVMSQYVPGLDKGKGMYFLFIKSEAKTPGGLVARPVLTSYYKSSHFK  189

Query  1447  CRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQH  1268
              R +DPY + TSP ++ILC D+ QSMY QLL  L   ++VLR+GAVFAS F+RAI FL+ 
Sbjct  190   QRPYDPYTNYTSPXETILCPDSYQSMYSQLLCSLCQNKEVLRVGAVFASGFIRAIRFLEK  249

Query  1267  NWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWP  1088
             +W  LC DI +G L+  I D   R A+ KIL  PDP+LA  IE  C  ASW GI+ RLWP
Sbjct  250   HWTLLCKDIASGTLNPQITDPSVRQAVMKIL-KPDPKLASFIEAECGKASWHGIITRLWP  308

Query  1087  KAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLL  908
               KY++ ++TG+MSQY+P L YYS+G LP +CTMYASSECYFGVNL PL  P++V++TL+
Sbjct  309   NTKYVDVIVTGTMSQYIPTLEYYSNG-LPQVCTMYASSECYFGVNLNPLCKPSEVSYTLI  367

Query  907   PNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGL  728
             P MGYFEF+P+  N     N N     +      Q +LVDL  V+LG  YELVVTT++GL
Sbjct  368   PTMGYFEFLPVQRNNGI--NSNPLSVPKSLNEKEQQQLVDLADVKLGQEYELVVTTYAGL  425

Query  727   YRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQAL  548
             YRYR+GDVL+VA F N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A 
Sbjct  426   YRYRVGDVLRVASFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAVKNAVNHLVPFDAT  485

Query  547   LVEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             + EYTS+ADT+++PGHYV++WE+   G   I   V +DCC   EE L+ VYR+ R+ DK 
Sbjct  486   VTEYTSFADTTTIPGHYVLFWELSLNGTTPIPPSVFEDCCFTAEESLNSVYRQGRASDKS  545

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             IGPLEI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L + V + YFSP+ 
Sbjct  546   IGPLEIKIVEAGTFDKLMDYAISLGASINQYKTPRCVKF-APIVELLSTRVVSSYFSPKC  604

Query  187   PAWKP  173
             P W P
Sbjct  605   PKWVP  609



>ref|XP_004251485.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Solanum 
lycopersicum]
Length=609

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/542 (56%), Positives = 393/542 (73%), Gaps = 7/542 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI+YEDI+  I RIA+GD    +  QP++E L SSGTSGGE KLMP+  E+L R
Sbjct  65    FKKVMPVISYEDIQHDINRIASGDTSPILCSQPVSEFLTSSGTSGGERKLMPTTEEELGR  124

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M  ++P ++ GK MY  FVK+E  TP GL AR VLTSYY S HFK R  
Sbjct  125   RSLLYSLLMPVMSHFVPDLETGKGMYFLFVKSESKTPGGLLARPVLTSYYNSPHFKNRRP  184

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    QVLR+GAVFAS F+RAI FL+ +W  
Sbjct  185   DPYTNYTSPNETILCPDSYQSMYSQMLCGLSQNAQVLRVGAVFASGFIRAIRFLEKHWSL  244

Query  1255  LCLDIRTGQL-SGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
             LC DIR+G + + +I DS  R A+ KIL  PDP+LAD IE  C   SW+GI+ RLWP  K
Sbjct  245   LCTDIRSGIMNTELITDSSVREAVMKIL-KPDPDLADFIEAECSKKSWQGIITRLWPNTK  303

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             Y++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P DVA+TL+P M
Sbjct  304   YVDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPEDVAYTLIPTM  362

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
              YFEF+P+  N   + ++       E E   Q  LVDLV V++G  YELVVTT++GLYRY
Sbjct  363   CYFEFLPIHRNNGVMDSIAAPKSLNENE---QQTLVDLVDVKIGQEYELVVTTYAGLYRY  419

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + E
Sbjct  420   RVGDVLRVAGFKNKAPQFNFICRKNVVLSIDSDKTDEVELQNAMKNAVSHLMPFDAHVTE  479

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTSYADT+ +PGHYV++WE+   G+  +   V +DCC+ IEE L+ VYR+ R+ DK IGP
Sbjct  480   YTSYADTTIIPGHYVLFWEVNVNGSTPVHPSVFEDCCLTIEESLNSVYRQGRASDKSIGP  539

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIR+V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V ++YFSP+ P W
Sbjct  540   LEIRIVEVGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVMSKYFSPKCPKW  598

Query  178   KP  173
              P
Sbjct  599   TP  600



>ref|XP_007133123.1| hypothetical protein PHAVU_011G153400g [Phaseolus vulgaris]
 gb|ESW05117.1| hypothetical protein PHAVU_011G153400g [Phaseolus vulgaris]
Length=606

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/539 (56%), Positives = 396/539 (73%), Gaps = 6/539 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+P I RIANGD    +  +PI+E L SSGTSGGE KLMP+I EDL R
Sbjct  63    FKKLLPVITYEDIQPDINRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEDLGR  122

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY L+MP+M  ++PG+++GK MYL F+K+E  TP G+ AR VLTSYYKS +FK R +
Sbjct  123   RRSLYGLLMPVMSLFVPGLEKGKGMYLMFIKSEAKTPGGIVARPVLTSYYKSSYFKDRPY  182

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP++++LC D+ QSMY QLL GL   ++V R+GAVFAS F+RAI FL+ +W  
Sbjct  183   DPYTNYTSPNETVLCPDSYQSMYSQLLCGLCQNKEVFRVGAVFASGFIRAIRFLEKHWSL  242

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG ++  I D+  R A+ KI L PDP+LAD I+  C   SW+GI+ RLWP  +Y
Sbjct  243   LCNDIRTGTVNPQITDTSVREAVMKI-LKPDPKLADLIQTECSKNSWQGIITRLWPNTRY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P++V++TL+P M 
Sbjct  302   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSEVSYTLIPTMC  360

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  +      L+      E+E   Q +LV+LV V+LG  YELVVTT++GLYRYR
Sbjct  361   YFEFLPVNRSNGVNDPLHTSRSLNEKE---QQELVELVDVKLGQEYELVVTTYAGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + +Y
Sbjct  418   VGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAMKNAVTHLVPFDASVSDY  477

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G+  I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  478   TSYADTTTIPGHYVLYWELALKGSTPIPPCVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  537

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V  +YFSP+ P W
Sbjct  538   EIKIVEQGTFDKLMDYAISLGASINQYKTPRCVKF-APVVELLNSRVVEKYFSPKCPKW  595



>emb|CDP11866.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/543 (56%), Positives = 392/543 (72%), Gaps = 16/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK   PV+ Y+D++P + RIANGD    +  QPI+E L SSGTSGGE KLMP+I E+L R
Sbjct  70    FKSTFPVVTYDDLKPDVDRIANGDTSPILCSQPISECLTSSGTSGGERKLMPTIEEELGR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+FLY+L+MP+M+Q++  +D+GK MY  FVK+E  TP GL AR VLTSYYKS HF+ R +
Sbjct  130   RSFLYSLLMPVMNQFVLDLDKGKGMYFLFVKSEAKTPGGLLARPVLTSYYKSSHFRDRPY  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY   TSP+++ILCSD+ QSMY Q+L GL  + +VLR+GAVFAS F+RAI FLQ++WP 
Sbjct  190   DPYASYTSPNEAILCSDSYQSMYSQMLCGLCQKDEVLRVGAVFASGFIRAIRFLQNHWPL  249

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG L+  I D   R A+ KI L P+P+LA+ +E  CR  SWKGI+ R+WP  KY
Sbjct  250   LCNDIRTGTLNPEIIDPSVREAVVKI-LKPNPQLAEVLEAECRKESWKGIIPRIWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             I+ ++TG+MSQY+  L +Y +  LPL+CTMYASSECYFGVNL PL  P++V +TL+P M 
Sbjct  309   IDVIVTGTMSQYIDTLNFYGNN-LPLVCTMYASSECYFGVNLNPLCMPSEVVYTLIPTMA  367

Query  895   YFEFIPL-GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             YFEF+P+  EN     N NK             KLVDLV V+LG  YELV+TT++GLYRY
Sbjct  368   YFEFLPVTSENEPVPLNPNK-----------HHKLVDLVDVQLGQDYELVITTYAGLYRY  416

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSIT-AAKKLLEPHQALLV  542
              +GD+L+VAGF NKAPQF F CR+NV LSIDSDKT++ +LH ++T AA   L    A L+
Sbjct  417   HVGDILRVAGFKNKAPQFTFICRKNVALSIDSDKTDEVELHNAVTKAANSHLLQFDASLI  476

Query  541   EYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             EYTSYADTS++PGHYV+YWEI    A +I   V +DCC+ +EE L+ VYR+ R  D  IG
Sbjct  477   EYTSYADTSTIPGHYVLYWEIGFNSAKSIPESVFEDCCLTVEESLNSVYRQGRVSDNSIG  536

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEI+VVK GTFD +M   I+ G+SINQYK PRC+K  +  ++IL S V   YFSP+ P 
Sbjct  537   PLEIKVVKNGTFDKVMDFAISNGASINQYKAPRCVKY-APIVEILNSGVVFNYFSPKCPK  595

Query  181   WKP  173
             W P
Sbjct  596   WSP  598



>ref|NP_195455.1| indole-3-acetic acid-amido synthetase GH3.2 [Arabidopsis thaliana]
 emb|CAB38206.1| auxin-responsive GH3-like protein [Arabidopsis thaliana]
 emb|CAB80404.1| auxin-responsive GH3-like protein [Arabidopsis thaliana]
 gb|AEE86787.1| indole-3-acetic acid-amido synthetase GH3.2 [Arabidopsis thaliana]
Length=603

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/543 (53%), Positives = 393/543 (72%), Gaps = 14/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P I RI+NGD    ++  PITE L SSGTS GE KLMP+I EDLDR
Sbjct  69    FKSKVPVVTYEDLKPEIQRISNGDCSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  T  GLPAR VLTSYYKS HFK R +
Sbjct  129   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTSGGLPARPVLTSYYKSDHFKRRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILCSD++QSMY Q+L GL+ R +VLRLGAVFAS  LRAISFLQ+NW  
Sbjct  189   DPYNVYTSPNEAILCSDSSQSMYAQMLCGLLMRHEVLRLGAVFASGLLRAISFLQNNWKE  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI TG LS  I D   ++ MSKIL  PD ELA+ +  +C   +W+GI+ ++WP  KY
Sbjct  249   LARDISTGTLSSRIFDPAIKNRMSKILTKPDQELAEFLVGVCSQENWEGIITKIWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM 
Sbjct  309   LDVIVTGAMAQYIPTLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P   +G              E S+ ++ LV+L +V +G  YELV+TT++GLYRYR
Sbjct  368   YFEFLPHNHDGD----------GAAEASLDETSLVELANVEVGKEYELVITTYAGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQFKF  R+NV+LS++SDKT++ +L +++  A +L       ++EY
Sbjct  418   VGDILRVTGFHNSAPQFKFIRRKNVLLSVESDKTDEAELQKAVENASRLFAEQGTRVIEY  477

Query  535   TSYADTSSVPGHYVIYWEIM--HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             TSYA+T ++PGHYVIYWE++      A +  +V+  CC+ +EE L+ VYR+ R  DK IG
Sbjct  478   TSYAETKTIPGHYVIYWELLGRDQSNALMSEEVMAKCCLEMEESLNSVYRQSRVADKSIG  537

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVV+ GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P 
Sbjct  538   PLEIRVVRNGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVVSAHFSPSLPH  596

Query  181   WKP  173
             W P
Sbjct  597   WSP  599



>gb|KFK30362.1| hypothetical protein AALP_AA7G251400 [Arabis alpina]
Length=600

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/543 (54%), Positives = 391/543 (72%), Gaps = 14/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P I RI+NGD    ++  PITE L SSGTS GE KLMP+I EDLDR
Sbjct  65    FKNKVPVVTYEDLKPEIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDR  124

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  T  GLPAR VLTSYYKS HFK R +
Sbjct  125   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTSGGLPARPVLTSYYKSDHFKRRPY  184

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILCSD++QSMY Q+L GL+ R +VLRLGAVFAS  LRAISFLQ+NW  
Sbjct  185   DPYNVYTSPNEAILCSDSSQSMYAQMLCGLLMRHEVLRLGAVFASGLLRAISFLQNNWKE  244

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI TG LS  I D+  ++ MSKIL  PD EL++ + E+C   +W+GI+ ++WP  KY
Sbjct  245   LARDISTGTLSSRIFDTAIKNRMSKILTKPDQELSEFLIEVCSQENWEGIITKIWPNTKY  304

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM 
Sbjct  305   LDVIVTGAMAQYIPTLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMA  363

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P   +G              E ++ Q+ LV+L  V +G  YELV+TT++GL RYR
Sbjct  364   YFEFLPHNHDGD----------GAAEGALDQTALVELADVEVGKEYELVITTYAGLCRYR  413

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQFKF  R+NV+LSI+SDKT++ +L +++  A KL       ++EY
Sbjct  414   VGDILRVTGFHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASKLFAGQGTRVIEY  473

Query  535   TSYADTSSVPGHYVIYWEIM--HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             TSYADT ++PGHYVIYWE++      A    +V+  CC+ +EE L+ VYR+ R  DK IG
Sbjct  474   TSYADTKTIPGHYVIYWELLGRDQSNALPSDEVMAKCCLEMEESLNSVYRQSRVADKSIG  533

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVV+ GTF+ LM   I+ G+SINQYK PRC+ S +  +++L S V + +FSP  P 
Sbjct  534   PLEIRVVQNGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLNSRVVSTHFSPSTPH  592

Query  181   WKP  173
             W P
Sbjct  593   WSP  595



>emb|CAJ14972.1| auxin-induced GH3 protein [Pinus pinaster]
Length=615

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/540 (56%), Positives = 392/540 (73%), Gaps = 11/540 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YED++P ILRIANGD    ++  PI+E L SSGTS GE K+MP+I E+L R
Sbjct  74    FKERLPVITYEDLQPEILRIANGDMSPILSAHPISEFLTSSGTSAGERKIMPTIHEELKR  133

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             RT LY+L+MP+M+QY+ G+D+GK MY  FVK+E  TP GL AR VLTSYYKS+ F  R +
Sbjct  134   RTLLYSLLMPVMNQYMKGLDKGKGMYFLFVKSETRTPGGLLARPVLTSYYKSQDFIERPY  193

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP ++ILCSD+ QSMYCQLL GL    +VLR+GAVFAS  LRAI FL+ +W S
Sbjct  194   DPYNVYTSPMEAILCSDSYQSMYCQLLCGLAQNHEVLRVGAVFASGLLRAIRFLEEHWQS  253

Query  1255  LCLDIRTGQLSGMIADSEC-RSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
             LC DIR+G ++       C R ++ KIL  P+ +LAD I   C   SW+GI+ RLWP A+
Sbjct  254   LCQDIRSGTVNDEEVTDPCLRESVMKIL-HPNTQLADLIRTECSKESWQGIITRLWPNAR  312

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             Y++ ++TG+M+QY+  L +YS G LP +CTMYASSECYFG+NLKPL  P +V++TL+PNM
Sbjct  313   YLDVIVTGAMAQYIKTLDFYSGG-LPQVCTMYASSECYFGINLKPLCQPWEVSYTLMPNM  371

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
              +FEF+P+  N       N++       +   ++LVDLV V++G  YELV+TT+SGLYRY
Sbjct  372   AFFEFLPVYRNK------NEDAGPVTTATEQPAELVDLVDVKVGQEYELVITTYSGLYRY  425

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GDVL+V GFHN APQF+F CR+NV+LSID+DKT++ +LH ++  A K LEP +A LVE
Sbjct  426   RVGDVLRVTGFHNAAPQFQFVCRKNVMLSIDADKTDEAELHNAVMNAVKHLEPLEATLVE  485

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTSY DTS++PGHYV+YWE +   A  +   V +DCC+ +EE L+ VYR+CR  DK IGP
Sbjct  486   YTSYTDTSTIPGHYVLYWE-LRTSALPVPPSVFEDCCLTVEESLNSVYRQCRVADKSIGP  544

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEI+VV+ GTFD LM   I+ GSSINQYK  RC+K  +  + IL S V A YFSPR P W
Sbjct  545   LEIKVVEMGTFDKLMDYAISRGSSINQYKAARCVKF-APMVDILNSRVSASYFSPRCPKW  603



>ref|XP_003543279.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Glycine 
max]
 gb|KHN36753.1| Indole-3-acetic acid-amido synthetase GH3.6 [Glycine soja]
Length=611

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/541 (55%), Positives = 394/541 (73%), Gaps = 6/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR +PVI YEDI+P I RIANGD    +T +P+TE L SSGTSGGE KLMP+I E+L R
Sbjct  68    FKRLLPVITYEDIQPDINRIANGDKSPILTSKPVTEFLTSSGTSGGERKLMPTIEEELGR  127

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MPIM+Q++P +++GK MYL F+K E  TP G+ AR VLTSYYKS +F+ RS+
Sbjct  128   RCMLYSLLMPIMNQFVPDLEKGKGMYLMFIKCESKTPGGIVARPVLTSYYKSPYFRDRSY  187

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP++++LC D+ QSMY QLL GL   ++VLR+GA+FAS F+RAI FL+ +W  
Sbjct  188   DPYTNYTSPNETVLCLDSYQSMYSQLLCGLCQHKEVLRVGAIFASGFIRAIRFLEKHWAL  247

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI+TG ++  I DS  R A+ +IL A DP+LAD I   C   SW+GI+ RLWP  KY
Sbjct  248   LCNDIKTGTINNSITDSSVREAVMRILKA-DPKLADFIHNECSKGSWQGIITRLWPNTKY  306

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P+ V++TL+P M 
Sbjct  307   VDVIVTGTMAQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPSHVSYTLIPTMC  365

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             Y+EF+P+  +    ++              Q +LV+LV V+LG  YELVVTT +GLYRYR
Sbjct  366   YYEFLPVNRSNELAAS---RPSPTSLNQAQQQELVELVDVKLGQEYELVVTTHAGLYRYR  422

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V+GF NKAPQF F CR+NV LSIDSDKT++ +L  ++  A   LEP  A + EY
Sbjct  423   VGDILKVSGFKNKAPQFSFVCRKNVALSIDSDKTDEVELQNAMKNAVTHLEPFDAHVSEY  482

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G+  I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  483   TSYADTTTIPGHYVLYWELNLKGSTPIPPCVYEDCCLTIEESLNSVYRQGRVSDKSIGPL  542

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYK PRC+K  +  +++L S V + YFSP+ P W 
Sbjct  543   EIKIVEQGTFDKLMDYAISLGASINQYKAPRCVKF-APIVELLNSRVTSNYFSPKCPKWV  601

Query  175   P  173
             P
Sbjct  602   P  602



>ref|XP_006363511.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum 
tuberosum]
Length=614

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/542 (56%), Positives = 393/542 (73%), Gaps = 7/542 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YEDI+  I RIA+GD       QP++E L SSGTSGGE KLMP+  E+L R
Sbjct  70    FKKVMPVITYEDIQHDINRIASGDKSPIFCSQPVSEFLTSSGTSGGERKLMPTTEEELGR  129

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M  ++P ++ GK MY  FVK+E  TP GL AR VLTSYYKS HFK R  
Sbjct  130   RSLLYSLLMPVMSHFVPDLETGKGMYFLFVKSESKTPGGLLARPVLTSYYKSPHFKNRRP  189

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY Q+L GL    QVLR+GAVFAS F+RAI FL+ +W  
Sbjct  190   DPYTNYTSPNEAILCPDSYQSMYSQMLCGLSQNAQVLRVGAVFASGFIRAIRFLEKHWSL  249

Query  1255  LCLDIRTGQL-SGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAK  1079
             LC DIR+G + + +I DS  R A+ KIL  PDP+LAD IE  C   SW+GI+ RLWP  K
Sbjct  250   LCSDIRSGIMNTELITDSSVREAVMKIL-KPDPDLADFIEAECSKKSWQGIITRLWPNTK  308

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             Y++ ++TG+MSQY+P L YYS+G L L+CTMYASSECYFGVNL PL  P DVA+TL+P M
Sbjct  309   YVDVIVTGTMSQYIPTLDYYSNG-LSLVCTMYASSECYFGVNLNPLCKPEDVAYTLIPTM  367

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
              YFEF+P+  N   + +++      E+E   +  LVDLV V++G  YELVVTT++GLYRY
Sbjct  368   CYFEFLPIYRNNGVMDSISAPKSLNEKE---KQTLVDLVDVKIGQEYELVVTTYAGLYRY  424

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GDVL+VAGF N APQF F CR+NVVLSIDSDKT++ +L  ++  A   L P  A + E
Sbjct  425   RVGDVLRVAGFKNNAPQFNFICRKNVVLSIDSDKTDEVELQNAMKNAVSHLMPFDAHVTE  484

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTSYADT+++PGHYV++WEI   G+  +   V +DCC+ IEE L+ VYR+ R+ DK IGP
Sbjct  485   YTSYADTTTIPGHYVLFWEINVNGSTPVHPSVFEDCCLTIEESLNSVYRQGRASDKSIGP  544

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIR+V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V ++YFSP+ P W
Sbjct  545   LEIRIVEIGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVMSKYFSPKCPKW  603

Query  178   KP  173
              P
Sbjct  604   TP  605



>ref|XP_002868993.1| hypothetical protein ARALYDRAFT_490882 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45252.1| hypothetical protein ARALYDRAFT_490882 [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/543 (53%), Positives = 392/543 (72%), Gaps = 14/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P I RI+NGD    ++  PITE L SSGTS GE KLMP+I EDLDR
Sbjct  69    FKNKVPVVTYEDLKPEIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  T  GLPAR VLTSYYKS HF+ R +
Sbjct  129   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTSGGLPARPVLTSYYKSDHFRRRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILCSD++QSMY Q+L GL+ R +VLRLGAVFAS  LRAISFLQ+NW  
Sbjct  189   DPYNVYTSPNEAILCSDSSQSMYAQMLCGLLMRHEVLRLGAVFASGLLRAISFLQNNWKE  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI TG LS  I D   ++ MSKIL+ PD ELA+ +  +C   +W+GI+ ++WP  KY
Sbjct  249   LARDISTGTLSSRIFDPTIKNRMSKILIKPDQELAEFLIGVCSQENWEGIITKIWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM 
Sbjct  309   LDVIVTGAMAQYIPTLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P   +G   +            S+ ++ LV+L  V +G  YELV+TT++GLYRYR
Sbjct  368   YFEFLPHNHDGDGATE----------ASLDETSLVELADVEVGKEYELVITTYAGLYRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQFKF  R+NV+LSI+SDKT++ +L +++  A +L       ++EY
Sbjct  418   VGDILRVTGFHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASRLFAEQGTRVIEY  477

Query  535   TSYADTSSVPGHYVIYWEIM--HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             TSYA+T ++PGHYVIYWE++      A    +V+  CC+ +EE L+ VYR+ R  DK IG
Sbjct  478   TSYAETKTIPGHYVIYWELLGRDQSNALPSEEVMAKCCLEMEESLNSVYRQSRVADKSIG  537

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIR+V+ GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P 
Sbjct  538   PLEIRLVQNGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVVSAHFSPSLPH  596

Query  181   WKP  173
             W P
Sbjct  597   WSP  599



>gb|AFW82417.1| hypothetical protein ZEAMMB73_006681 [Zea mays]
Length=633

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/550 (55%), Positives = 393/550 (71%), Gaps = 21/550 (4%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V  F+R  P++ YEDI P +LRIANGD    ++G+PI E L SSGTSGGE KLMP+IA++
Sbjct  69    VEAFRRAAPLVTYEDILPDVLRIANGDTSPILSGKPIREFLTSSGTSGGERKLMPAIADE  128

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             +DRR+ LY+L+MP+M Q +PG+D G+ MYLYFVKAE  TP G PAR VLTS+Y+S+HF  
Sbjct  129   MDRRSLLYSLLMPVMSQAVPGLDRGRCMYLYFVKAESRTPGGHPARPVLTSFYRSRHFLE  188

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DPY   TSPD+++LC D  QSMY QLL GLV+R  VLR+GAVFAS FLRAI FL+ +
Sbjct  189   RPHDPYTVHTSPDEAVLCVDAYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIRFLEKH  248

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC D+R G L   + D   R+A++++L A DP LAD +E  C   SW+GI+ R+WP 
Sbjct  249   WQRLCRDLRRGALGAEVTDRSVRAAVARVLRA-DPALADAVEAECARPSWQGIIRRVWPG  307

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYI+ ++TG+M+QY+P L +Y  G LPL CTMYASSE YFG+NL P+  P++VA+TL+P
Sbjct  308   TKYIDVIVTGAMAQYIPTLEFYG-GGLPLTCTMYASSESYFGINLNPMCKPSEVAYTLIP  366

Query  904   NMGYFEFIPL---GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
              M YFEF+PL   G  GT  ++ +               LVDLV V+LG  YELVVTT+S
Sbjct  367   TMCYFEFLPLPQPGPGGTDDADPD------------HRDLVDLVDVKLGHEYELVVTTYS  414

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYR+GDVL+VAGF N+AP FKF  R+NVVLSIDSDKT++ +LH +++ A + L P  
Sbjct  415   GLYRYRVGDVLRVAGFKNQAPMFKFLRRKNVVLSIDSDKTDEAELHAAVSGAVQHLAPFG  474

Query  553   ALLVEYTSYADTSSVPGHYVIYWEI-MHAG--AAAIDAQVLQDCCIAIEEQLDYVYRRCR  383
             A LVEYTSYAD  ++PGHYV++WE+ + AG     + A V +DCC+A+EE L+ VYR+ R
Sbjct  475   ASLVEYTSYADAGTIPGHYVLFWELRLRAGDVPVPVPASVFEDCCLAVEEALNSVYRQGR  534

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
             + D+ IGPLEIRVV  GTFD LM   +  G+SINQYK PRC+      +++L+  V+A Y
Sbjct  535   AADRSIGPLEIRVVSDGTFDRLMDYALARGASINQYKVPRCVHPG-PVVELLDGRVQASY  593

Query  202   FSPRDPAWKP  173
              SP+ P W P
Sbjct  594   VSPKCPKWSP  603



>ref|XP_009123833.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.2 [Brassica 
rapa]
 emb|CDX75644.1| BnaA01g00580D [Brassica napus]
Length=587

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/542 (54%), Positives = 389/542 (72%), Gaps = 24/542 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P I RI+NGD    ++  PITE L SSGTS GE KLMP+I EDLDR
Sbjct  65    FKTKVPVVTYEDLKPEIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIDEDLDR  124

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  125   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTPGGLPARPVLTSYYKSDHFKRRPY  184

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILCSD++QSMY Q+L GL+ R  VLRLGAVFAS  LRAISFLQ+NW  
Sbjct  185   DPYNVYTSPNEAILCSDSSQSMYAQMLCGLLMRHDVLRLGAVFASGLLRAISFLQNNWKE  244

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI TG LS  I+D   ++ MSKIL  PD ELA+ + E+C   +W+GIV ++WP  KY
Sbjct  245   LARDISTGTLSSRISDHAIKNRMSKILTKPDQELAEFLVEVCSQDNWEGIVTKIWPNTKY  304

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM 
Sbjct  305   LDVIVTGAMAQYIPTLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMA  363

Query  895   YFEFIPL-GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
             YFEF+P  G  G                   +++LV+L  V +G  YELV+TT++GL RY
Sbjct  364   YFEFLPHDGAAGD------------------ETELVELADVEVGKEYELVITTYAGLCRY  405

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             ++GDVL+V GFHN APQFKF  R+NV+LSI+SDKT++ +L +++  A KL       ++E
Sbjct  406   KVGDVLRVTGFHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASKLFAAQGTRVIE  465

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTSYADT ++PGHYVIYWE+ +A        V+  CC+ +EE L+ VYR+ R  DK IGP
Sbjct  466   YTSYADTKTIPGHYVIYWELTNAVPG---DDVMAKCCLEMEESLNSVYRQSRVADKSIGP  522

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIRVV+ GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P W
Sbjct  523   LEIRVVQSGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVVSAHFSPSLPHW  581

Query  178   KP  173
              P
Sbjct  582   SP  583



>ref|XP_006411897.1| hypothetical protein EUTSA_v10024716mg [Eutrema salsugineum]
 gb|ESQ53350.1| hypothetical protein EUTSA_v10024716mg [Eutrema salsugineum]
Length=601

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/545 (54%), Positives = 391/545 (72%), Gaps = 20/545 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P I RI+NGD    ++  PITE L SSGTS GE KLMP+I EDLDR
Sbjct  69    FKNKVPVVTYEDLKPEIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  T  GLPAR VLTSYYKS HFK R +
Sbjct  129   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTSGGLPARPVLTSYYKSDHFKRRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILCSD++QSMY Q+L GL+ R  VLRLGAVFAS  LRAISFL++NW  
Sbjct  189   DPYNVYTSPNEAILCSDSSQSMYAQMLCGLMMRHDVLRLGAVFASGLLRAISFLKNNWKE  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI TG LS  I D   +S MSKIL  PD ELAD +  +C   +W GI+ ++WP  KY
Sbjct  249   LARDISTGTLSSRIFDPAIKSRMSKILTNPDQELADFLIGVCSQENWGGIITKIWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P+ V++T++PNM 
Sbjct  309   LDVIVTGAMAQYIPTLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSKVSYTIMPNMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P   NG              EE+  ++ LV+L  V +G  YELV+TT++GLYRYR
Sbjct  368   YFEFLPHEHNGAV------------EEASHETALVELADVEVGKEYELVITTYAGLYRYR  415

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQFKF  R+NV+LSI+SDKT++ +L +++  A +LL      ++EY
Sbjct  416   VGDILRVTGFHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASRLLAKQGTRVIEY  475

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDA----QVLQDCCIAIEEQLDYVYRRCRSHDKC  368
             TSYA+T ++PGHYV+YWE++  G    +A    +V+ +CC+ +EE L+ VYR+ R  DK 
Sbjct  476   TSYAETKTIPGHYVVYWELL--GKEQTNACPSDEVMANCCLQMEESLNSVYRQSRVADKS  533

Query  367   IGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRD  188
             IGPLEIRVV+ GTF+ LM   I+ G+SINQYK PRC+ S +  +++L S V + +FSP  
Sbjct  534   IGPLEIRVVQNGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLNSRVVSTHFSPSL  592

Query  187   PAWKP  173
             P W P
Sbjct  593   PQWSP  597



>emb|CDX69296.1| BnaC01g01570D [Brassica napus]
Length=587

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/541 (54%), Positives = 390/541 (72%), Gaps = 22/541 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P I RI+NGD    ++  PITE L SSGTS GE KLMP+I EDLDR
Sbjct  65    FKTKVPVVTYEDLKPEIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIDEDLDR  124

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  TP GLPAR VLTSYYKS HFK R +
Sbjct  125   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTPGGLPARPVLTSYYKSDHFKRRPY  184

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILCSD++QSMY Q+L GLV R  VLRLGAVFAS  LRAISFLQ+NW  
Sbjct  185   DPYNVYTSPNEAILCSDSSQSMYAQMLCGLVMRHDVLRLGAVFASGLLRAISFLQNNWKE  244

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI TG L+  I+D   ++ MSKIL  PD ELA+ + E+C   +W+GIV ++WP  KY
Sbjct  245   LARDISTGTLNSRISDHAIKTRMSKILTKPDQELAEFLVEVCSQDNWEGIVTKIWPNTKY  304

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM 
Sbjct  305   LDVIVTGAMAQYIPTLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMA  363

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P  E G                +  +++LV+L  V +G  YELV+TT++GL RY+
Sbjct  364   YFEFLP-HEGG----------------AGDETELVELADVEVGKEYELVITTYAGLCRYK  406

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+V G+HN APQFKF  R+NV+LSI+SDKT++ +L +++  A KL       ++EY
Sbjct  407   VGDVLRVTGYHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASKLFAAQGTRVIEY  466

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT ++PGHYVIYWE+ +A        V+  CC+ +EE L+ VYR+ R  DK IGPL
Sbjct  467   TSYADTRTIPGHYVIYWELTNAVPG---DDVMAKCCLEMEESLNSVYRQSRVADKSIGPL  523

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EIRVV+ GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P W 
Sbjct  524   EIRVVQSGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVVSAHFSPSLPHWS  582

Query  175   P  173
             P
Sbjct  583   P  583



>ref|XP_002271252.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Vitis vinifera]
Length=598

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/542 (55%), Positives = 394/542 (73%), Gaps = 16/542 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YED++P I RIANGD  + ++  PI+E L SSGTS GE KLMP+I E+LDR
Sbjct  68    FKSKIPVIKYEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDR  127

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  TP GL AR VLTSYYKS+HFK R +
Sbjct  128   RQMLYSLLMPVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSEHFKTRPY  187

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILC+D+ QSMY Q+L G+  R+QVLRLGAVFAS  LRAI FLQ NW  
Sbjct  188   DPYNVYTSPNEAILCADSFQSMYTQMLCGIYERKQVLRLGAVFASGLLRAIRFLQLNWHQ  247

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R+ ++ + L PDPELAD +   C   +W+GI+ R+WP  KY
Sbjct  248   LTHDIRTGTLSPKITDPSVRNCVAGV-LKPDPELADLVAGECSKDNWEGIITRIWPNTKY  306

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LPL CTMYASSECYFG+NL P+S P++V++T++PNM 
Sbjct  307   LDVIVTGAMAQYIPTLDYYSGG-LPLACTMYASSECYFGLNLNPMSKPSEVSYTIMPNMA  365

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P   +   LS           +S P  +LVDL HV +G  YELV+TT++GLYRYR
Sbjct  366   YFEFLPHEHSSIPLSR----------DSPP--RLVDLAHVEVGKEYELVITTYAGLYRYR  413

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQF F  R+NV+LSIDSDKT++ +L +++  A KLL      +VEY
Sbjct  414   VGDILRVTGFHNSAPQFHFVRRKNVLLSIDSDKTDEAELQKAVDNASKLLREVNTSVVEY  473

Query  535   TSYADTSSVPGHYVIYWEIMHAGAA-AIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             TS+ADT ++PGHYVIYWE++   +A +   ++L  CC+A+EE L+ VYR+ R  D  IGP
Sbjct  474   TSFADTKTIPGHYVIYWELLVKDSANSPSDELLGQCCLAMEESLNSVYRQGRVADNSIGP  533

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIRVVK GTF+ LM   I+ G+SINQYK PRC+ + +  +++L+S V + +FSP  P W
Sbjct  534   LEIRVVKSGTFEELMDYAISRGASINQYKVPRCV-NFTPIMELLDSRVVSSHFSPALPHW  592

Query  178   KP  173
              P
Sbjct  593   TP  594



>emb|CDY69969.1| BnaCnng66170D, partial [Brassica napus]
Length=498

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/502 (58%), Positives = 385/502 (77%), Gaps = 14/502 (3%)
 Frame = -1

Query  1663  GGEPKLMPSIAEDLDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPART  1484
              G+PKLMPS AE+L+R+TF Y++++P+M++Y+ G+DEGK MYL F+K E+ TP GL AR 
Sbjct  1     AGKPKLMPSTAEELERKTFFYSMLVPVMNKYVNGLDEGKGMYLLFIKPEIKTPSGLMARP  60

Query  1483  VLTSYYKSKHFKCRSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFA  1304
             VLTSYYKS+HF+ R F+ YN  TSPDQ+ILC D+ QSMYCQLL GLV R  VLR+G VFA
Sbjct  61    VLTSYYKSQHFRNRPFNKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGTVFA  120

Query  1303  SAFLRAISFLQHNWPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRA  1124
             SAFLRA+ FL+ ++  LC DIRTG ++  I +  CR ++  +L  P+ ELADEIE  C  
Sbjct  121   SAFLRAVKFLEDHYKELCADIRTGTVTSWITEPACRDSVLSVLQGPNQELADEIESECAE  180

Query  1123  ASWKGIVYRLWPKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKP  944
              SW+GI+ RLWPKAKY+E ++TGSM+QY+P L +YS G LPL+ TMYASSECYFG+NL P
Sbjct  181   KSWEGILRRLWPKAKYVEVIVTGSMAQYIPTLEFYSGG-LPLVSTMYASSECYFGINLNP  239

Query  943   LSDPADVAFTLLPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGC  764
             L DP+DV++TLLPNM YFEF+P+     F S+ N    +++++++ +  +VDLV+V +G 
Sbjct  240   LCDPSDVSYTLLPNMAYFEFLPIH----FASHSN---TDDDDDALKEDLIVDLVNVEVGR  292

Query  763   YYELVVTTFSGLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSIT  584
             YYE+V+TTF+GLYRYR+GD+L+V GFHNKAPQF+F  RRNVVLSID+DKT++EDL  ++T
Sbjct  293   YYEIVITTFTGLYRYRVGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVT  352

Query  583   AA--KKLLEPHQALLVEYTSYADTSSVPGHYVIYWEI---MHAGAAAIDAQVLQDCCIAI  419
              A  K L +P   LL EYTSYADTSS+PGHYV++WE+    +     ++ + ++ CC  +
Sbjct  353   QAKLKHLQKPSCPLLTEYTSYADTSSIPGHYVLFWELKPRQNNEPPELENKTMELCCSEV  412

Query  418   EEQLDYVYRRCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSA  239
             E+ LDYVYRRCR+ DK IGPLEIRVV  GTFDLLM   +++GSS+NQYKTPRC+K    A
Sbjct  413   EDCLDYVYRRCRNKDKSIGPLEIRVVSLGTFDLLMDFCVSQGSSVNQYKTPRCVKPG-GA  471

Query  238   LKILESNVRARYFSPRDPAWKP  173
             L+IL+S V  R+FS R P W+P
Sbjct  472   LEILDSRVIGRFFSQRVPRWQP  493



>pdb|4B2G|A Chain A, Crystal Structure Of An Indole-3-acetic Acid Amido Synthase 
From Vitis Vinifera Involved In Auxin Homeostasis
 pdb|4B2G|B Chain B, Crystal Structure Of An Indole-3-acetic Acid Amido Synthase 
From Vitis Vinifera Involved In Auxin Homeostasis
Length=609

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/542 (55%), Positives = 394/542 (73%), Gaps = 16/542 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YED++P I RIANGD  + ++  PI+E L SSGTS GE KLMP+I E+LDR
Sbjct  68    FKSKIPVIKYEDLQPEIQRIANGDRSAILSAHPISEFLTSSGTSAGERKLMPTIQEELDR  127

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  TP GL AR VLTSYYKS+HFK R +
Sbjct  128   RQMLYSLLMPVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSEHFKTRPY  187

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILC+D+ QSMY Q+L G+  R+QVLRLGAVFAS  LRAI FLQ NW  
Sbjct  188   DPYNVYTSPNEAILCADSFQSMYTQMLCGIYERKQVLRLGAVFASGLLRAIRFLQLNWHQ  247

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS  I D   R+ ++ + L PDPELAD +   C   +W+GI+ R+WP  KY
Sbjct  248   LTHDIRTGTLSPKITDPSVRNCVAGV-LKPDPELADLVAGECSKDNWEGIITRIWPNTKY  306

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LPL CTMYASSECYFG+NL P+S P++V++T++PNM 
Sbjct  307   LDVIVTGAMAQYIPTLDYYSGG-LPLACTMYASSECYFGLNLNPMSKPSEVSYTIMPNMA  365

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P   +   LS           +S P  +LVDL HV +G  YELV+TT++GLYRYR
Sbjct  366   YFEFLPHEHSSIPLSR----------DSPP--RLVDLAHVEVGKEYELVITTYAGLYRYR  413

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQF F  R+NV+LSIDSDKT++ +L +++  A KLL      +VEY
Sbjct  414   VGDILRVTGFHNSAPQFHFVRRKNVLLSIDSDKTDEAELQKAVDNASKLLREVNTSVVEY  473

Query  535   TSYADTSSVPGHYVIYWEIMHAGAA-AIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             TS+ADT ++PGHYVIYWE++   +A +   ++L  CC+A+EE L+ VYR+ R  D  IGP
Sbjct  474   TSFADTKTIPGHYVIYWELLVKDSANSPSDELLGQCCLAMEESLNSVYRQGRVADNSIGP  533

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIRVVK GTF+ LM   I+ G+SINQYK PRC+ + +  +++L+S V + +FSP  P W
Sbjct  534   LEIRVVKSGTFEELMDYAISRGASINQYKVPRCV-NFTPIMELLDSRVVSSHFSPALPHW  592

Query  178   KP  173
              P
Sbjct  593   TP  594



>ref|XP_006283369.1| hypothetical protein CARUB_v10004412mg [Capsella rubella]
 gb|EOA16267.1| hypothetical protein CARUB_v10004412mg [Capsella rubella]
Length=603

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/543 (54%), Positives = 388/543 (71%), Gaps = 14/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P I RI+NGD    ++  PITE L SSGTS GE KLMP+I EDLDR
Sbjct  69    FKSRVPVVTYEDLKPEIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  T  GLPAR VLTSYYKS HFK R +
Sbjct  129   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTSGGLPARPVLTSYYKSDHFKRRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP++ ILC D++QSMY Q+L GL+ R+ VLRLGAVFAS  LRAISFLQ+NW  
Sbjct  189   DPYNVYTSPNEVILCPDSSQSMYAQMLCGLLMRQDVLRLGAVFASGLLRAISFLQNNWKE  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI TG LS  I D   +S MSKIL  PD ELA+ +  +C   +W+GI+ ++WP  KY
Sbjct  249   LARDISTGSLSSRIFDPAIKSRMSKILTKPDQELAEFLTGVCSQENWEGIITKIWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM 
Sbjct  309   LDVIVTGAMAQYIPTLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P   +G   +            S+ ++ LVDL  V +G  YELV+TT++GL RYR
Sbjct  368   YFEFLPHNHDGDGAAQ----------ASLEETALVDLADVEVGKEYELVITTYAGLCRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQFKF  R+NV+LSI+SDKT++ +L +++  A +L       ++EY
Sbjct  418   VGDILRVTGFHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASRLFADQGTRVIEY  477

Query  535   TSYADTSSVPGHYVIYWEIM--HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             TSYADT ++PGHYVIYWE++      A    +V+  CC+ +EE L+ VYR+ R  DK IG
Sbjct  478   TSYADTKTIPGHYVIYWELLGRDQTNALPSDEVMAKCCLEMEESLNSVYRQSRVADKSIG  537

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVV+ GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P 
Sbjct  538   PLEIRVVQNGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVVSTHFSPSLPY  596

Query  181   WKP  173
             W P
Sbjct  597   WSP  599



>ref|XP_009402880.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Musa acuminata subsp. malaccensis]
Length=605

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/541 (55%), Positives = 396/541 (73%), Gaps = 16/541 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR +PV+ YEDIR  ILRIA+GD    ++G+PI+E L SSGTSGGE KLMP I ++LDR
Sbjct  69    FKRLIPVVTYEDIRLDILRIAHGDTSPILSGRPISEFLTSSGTSGGERKLMPMIEDELDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++PG+DEGK MYL FVK+E  TP GL AR VLTSYYKS+HF  + F
Sbjct  129   RSVLYSLLMPVMSQFVPGLDEGKGMYLLFVKSEARTPGGLIARPVLTSYYKSRHFLSQPF  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN +TSP+++ILC D+ QSMY QLL GL++R +V+R+GAVFAS F+RAI FL+  WP 
Sbjct  189   DPYNVLTSPNEAILCLDSYQSMYAQLLCGLIHRAEVVRVGAVFASGFIRAIRFLEKYWPR  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR+G+L   I D   R A+ ++ L PDPELA  IE      S +GI+ RLWP  KY
Sbjct  249   LCRDIRSGELDAEITDRAVREAVVRV-LRPDPELARLIEAEFARGSLQGIIPRLWPNTKY  307

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L +YS G LPL CTMY SSECYFG+NL P+  P++V++T +P   
Sbjct  308   VDVIVTGAMAQYIPTLDFYSGG-LPLTCTMYGSSECYFGLNLNPMCKPSEVSYTFIPTFA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  +G   +  +              +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  367   YFEFLPIHCSGNGRTEFD------------HRELVDLVDVKLGQEYELVVTTYAGLYRYR  414

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+VAGF NK PQF F  R++VVLSIDSDKT++ +L  +++ A   L+P  A LVEY
Sbjct  415   VGDVLRVAGFKNKTPQFNFIRRKSVVLSIDSDKTDEVELQAAVSNAVNHLKPFGASLVEY  474

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TS ADT S+PGHYV+YWE + AG   + A V +DCC+A+EE L+ VYR+ R  DK IGPL
Sbjct  475   TSCADTVSIPGHYVLYWE-LRAGDTTVPASVFEDCCLAVEESLNSVYRQGRVCDKSIGPL  533

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EIRVV+ GTFD +M   +++G+SINQYK PRC++ +   +++L+  V++ +FSP+ P W 
Sbjct  534   EIRVVEEGTFDKMMDYALSQGASINQYKAPRCVR-HGPVVELLDGRVQSTFFSPKCPKWA  592

Query  175   P  173
             P
Sbjct  593   P  593



>ref|NP_001146696.1| uncharacterized protein LOC100280297 [Zea mays]
 gb|ACL54563.1| unknown [Zea mays]
Length=633

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/550 (55%), Positives = 392/550 (71%), Gaps = 21/550 (4%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V  F+R  P++ YEDI P +LRIANGD    ++G+PI E L SSGTSGGE KLMP+IA++
Sbjct  69    VEAFRRAAPLVTYEDILPDVLRIANGDTSPILSGKPIREFLTSSGTSGGERKLMPAIADE  128

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             +DRR+ LY+L+MP+M Q +PG+D G+ MYLYFVKA   TP G PAR VLTS+Y+S+HF  
Sbjct  129   MDRRSLLYSLLMPVMSQAVPGLDRGRCMYLYFVKAGSRTPGGHPARPVLTSFYRSRHFLE  188

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DPY   TSPD+++LC D  QSMY QLL GLV+R  VLR+GAVFAS FLRAI FL+ +
Sbjct  189   RPHDPYTVHTSPDEAVLCVDAYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIRFLEKH  248

Query  1264  WPSLCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPK  1085
             W  LC D+R G L   + D   R+A++++L A DP LAD +E  C   SW+GI+ R+WP 
Sbjct  249   WQRLCRDLRRGALGAEVTDRSVRAAVARVLRA-DPALADAVEAECARPSWQGIIRRVWPG  307

Query  1084  AKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLP  905
              KYI+ ++TG+M+QY+P L +Y  G LPL CTMYASSE YFG+NL P+  P++VA+TL+P
Sbjct  308   TKYIDVIVTGAMAQYIPTLEFYG-GGLPLTCTMYASSESYFGINLNPMCKPSEVAYTLIP  366

Query  904   NMGYFEFIPL---GENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFS  734
              M YFEF+PL   G  GT  ++ +               LVDLV V+LG  YELVVTT+S
Sbjct  367   TMCYFEFLPLPQPGPGGTDDADPD------------HRDLVDLVDVKLGHEYELVVTTYS  414

Query  733   GLYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQ  554
             GLYRYR+GDVL+VAGF N+AP FKF  R+NVVLSIDSDKT++ +LH +++ A + L P  
Sbjct  415   GLYRYRVGDVLRVAGFKNQAPMFKFLRRKNVVLSIDSDKTDEAELHAAVSGAVQHLAPFG  474

Query  553   ALLVEYTSYADTSSVPGHYVIYWEI-MHAG--AAAIDAQVLQDCCIAIEEQLDYVYRRCR  383
             A LVEYTSYAD  ++PGHYV++WE+ + AG     + A V +DCC+A+EE L+ VYR+ R
Sbjct  475   ASLVEYTSYADAGTIPGHYVLFWELRLRAGDVPVPVPASVFEDCCLAVEEALNSVYRQGR  534

Query  382   SHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARY  203
             + D+ IGPLEIRVV  GTFD LM   +  G+SINQYK PRC+      +++L+  V+A Y
Sbjct  535   AADRSIGPLEIRVVSDGTFDRLMDYALARGASINQYKVPRCVHPG-PVVELLDGRVQASY  593

Query  202   FSPRDPAWKP  173
              SP+ P W P
Sbjct  594   VSPKCPKWSP  603



>ref|XP_002441339.1| hypothetical protein SORBIDRAFT_09g024710 [Sorghum bicolor]
 gb|EES19769.1| hypothetical protein SORBIDRAFT_09g024710 [Sorghum bicolor]
Length=647

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/553 (55%), Positives = 392/553 (71%), Gaps = 22/553 (4%)
 Frame = -1

Query  1804  VSDFKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAED  1625
             V  F+R  P++ YEDI P +LRIANGD    ++G+PI E L SSGTSGGE KLMP+IA++
Sbjct  73    VDAFRRAAPLVTYEDILPDVLRIANGDTSPILSGKPIREFLTSSGTSGGERKLMPAIADE  132

Query  1624  LDRRTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKC  1445
             +DRR+ LY+L+MP+M Q +PG+D+GK MYLYFVKAE  TP G PAR VLTS+Y+S+HF  
Sbjct  133   MDRRSLLYSLLMPVMSQAVPGLDKGKCMYLYFVKAESRTPGGHPARPVLTSFYRSRHFLE  192

Query  1444  RSFDPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHN  1265
             R  DPY   TSPD++ILC D  QSMY QLL GLV+R  VLR+GAVFAS FLRAI FL+ +
Sbjct  193   RPHDPYTVYTSPDEAILCVDAYQSMYAQLLCGLVHRADVLRVGAVFASGFLRAIRFLEKH  252

Query  1264  WPSLCLDIRTGQLSG-MIADSECRSAM-SKILLAPDPELADEIEEICRAASWKGIVYRLW  1091
             W  LC DIRTG L    + D   R+A+  ++LL  DP LAD +E  C   SW+GI+ R+W
Sbjct  253   WQRLCRDIRTGTLDAEAVTDRAVRAAVEQRVLLRADPALADAVEAECARTSWQGIIRRVW  312

Query  1090  PKAKYIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTL  911
             P  KYI+ ++TG+M+QY+P L +Y  G LPL CTMYASSE YFG+NL P+  P++VA+TL
Sbjct  313   PNTKYIDVIVTGAMAQYIPQLEFYG-GGLPLTCTMYASSESYFGINLNPMCKPSEVAYTL  371

Query  910   LPNMGYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSG  731
             +P M YFEF+PL + G            ++     Q  LVDLV V+LG  YELVVTT+SG
Sbjct  372   IPTMCYFEFLPLPQPGD-----------DDAGEPDQRDLVDLVDVKLGHEYELVVTTYSG  420

Query  730   LYRYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQA  551
             LYRYR+GDVL+VAGF N+AP F F  R+NVVLSID+DKT++ +LH +++ A + L P  A
Sbjct  421   LYRYRVGDVLRVAGFKNQAPMFNFLRRKNVVLSIDADKTDEAELHAAVSGAVQHLAPFGA  480

Query  550   LLVEYTSYADTSSVPGHYVIYWEI-------MHAGAAAIDAQVLQDCCIAIEEQLDYVYR  392
              LVEYTSYAD  ++PGHYV++WE+         A    + A V +DCC+A+EE L+ VYR
Sbjct  481   SLVEYTSYADAGTIPGHYVLFWELRLRAAAAAGATPTPVPASVFEDCCLAVEEALNSVYR  540

Query  391   RCRSHDKCIGPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVR  212
             + R+ D+ IGPLEIRVV  GTFD LM   +  G+SINQYK PRC++     +++L+  V+
Sbjct  541   QGRAADRSIGPLEIRVVSDGTFDKLMDYALARGASINQYKAPRCVRPG-PVVELLDGRVQ  599

Query  211   ARYFSPRDPAWKP  173
             A YFSP+ P W P
Sbjct  600   ASYFSPKCPKWSP  612



>gb|KHN25755.1| Indole-3-acetic acid-amido synthetase GH3.6 [Glycine soja]
Length=615

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/542 (55%), Positives = 392/542 (72%), Gaps = 14/542 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PV+ YED++PYI RIANGD    +  +PI+E L SSGTSGGE KLMP+I E+L+R
Sbjct  78    FKKIMPVVTYEDLKPYIDRIANGDTSPILCSKPISEFLTSSGTSGGERKLMPTIEEELER  137

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+MDQ++P +D+GK MY  F K+E  TP GL AR VLTSYYKS HFK R  
Sbjct  138   RSMLYSLLMPVMDQFVPALDKGKGMYFLFTKSEAKTPGGLLARPVLTSYYKSSHFKHRKH  197

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+++ILC D+ QSMY QLL GL    +VLR+GAVFAS F+RA+ FL+ ++ S
Sbjct  198   DPYTNYTSPNETILCPDSYQSMYSQLLCGLCQNEEVLRVGAVFASGFIRALKFLEKHFVS  257

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIR G L   I D   R A+ K+ L P+P LAD +E  C   SWKGIV R+WP  KY
Sbjct  258   LCNDIRKGTLDAKINDPLVREAVMKV-LKPNPTLADFVEAECMKGSWKGIVTRIWPNTKY  316

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFG+NL PL DP++VA+TL+P M 
Sbjct  317   VDVIVTGTMSQYIPILDYYSNG-LPLVCTMYASSECYFGLNLNPLCDPSEVAYTLIPTMA  375

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+PL E     ++++          + Q +L+DL  V+LG  YELVVTT++GLYRY+
Sbjct  376   YFEFLPLDEINGHTNSVSH---------LVQEQLLDLADVKLGQEYELVVTTYAGLYRYQ  426

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+VAGF NKAPQF F CR+NVVLSIDSDKT++ +L  ++ +    L    A L EY
Sbjct  427   VGDILRVAGFKNKAPQFNFVCRKNVVLSIDSDKTDEVELQNAVKSGADHLAQFGASLTEY  486

Query  535   TSYADTSSVPGHYVIYWEIMHAG-AAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             TS  DTS++PGHYV+YWEI   G    I + V   CC+AIEE L+ VYR+ R  +  IGP
Sbjct  487   TSCVDTSTIPGHYVLYWEISTNGHTPTIPSSVFGHCCLAIEESLNSVYRQGRVSES-IGP  545

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEI++V+ GTFD LM   +++G+SINQYKTPRC+ + +  L +L SNV + YFSP+ P W
Sbjct  546   LEIKIVENGTFDKLMDFALSQGASINQYKTPRCV-TYAPILDLLNSNVVSSYFSPKCPNW  604

Query  178   KP  173
              P
Sbjct  605   VP  606



>ref|NP_001060163.1| Os07g0592600 [Oryza sativa Japonica Group]
 sp|Q0D4Z6.1|GH38_ORYSJ RecName: Full=Probable indole-3-acetic acid-amido synthetase 
GH3.8; AltName: Full=Auxin-responsive GH3-like protein 8; Short=OsGH3-8 
[Oryza sativa Japonica Group]
 sp|A3BLS0.2|GH38_ORYSI RecName: Full=Probable indole-3-acetic acid-amido synthetase 
GH3.8; AltName: Full=Auxin-responsive GH3-like protein 8; Short=OsGH3-8 
[Oryza sativa Indica Group]
 dbj|BAC79627.1| putative Nt-gh3 deduced protein [Oryza sativa Japonica Group]
 dbj|BAF22077.1| Os07g0592600 [Oryza sativa Japonica Group]
 gb|ABN13880.1| auxin-responsive GH3-8 protein [Oryza sativa Indica Group]
 gb|EEC82374.1| hypothetical protein OsI_26708 [Oryza sativa Indica Group]
 gb|EEE67513.1| hypothetical protein OsJ_24963 [Oryza sativa Japonica Group]
Length=605

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/543 (54%), Positives = 387/543 (71%), Gaps = 19/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             F+  VPV++Y+D++PYI RIANGD    ++  P++E L SSGTS GE KLMP+I ++LDR
Sbjct  75    FRAKVPVVSYDDLQPYIQRIANGDRSPILSTHPVSEFLTSSGTSAGERKLMPTIMDELDR  134

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  TP GL AR VLTSYYKS HFK R +
Sbjct  135   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSETKTPGGLTARPVLTSYYKSDHFKNRPY  194

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY++ TSP  +ILC+D  QSMY Q++ GL  R  VLRLGAVFAS  LRAI FLQ NW  
Sbjct  195   DPYHNYTSPTAAILCADAFQSMYAQMVCGLCQRNDVLRLGAVFASGLLRAIRFLQLNWEQ  254

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI +G+L+  + D   R A++ ILL PDPELA  I   C    W GI+ R+WP  KY
Sbjct  255   LADDIESGELTPRVTDPSVREAVAAILL-PDPELAKLIRAECSKGDWAGIITRVWPNTKY  313

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L +YS G LP+ CTMYASSECYFG+NL+P+ DP++V++T++PNMG
Sbjct  314   LDVIVTGAMAQYIPTLEFYSGG-LPMACTMYASSECYFGLNLRPMCDPSEVSYTIMPNMG  372

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+ E G                S   ++LVDL  V +G  YELV+TT++GL RYR
Sbjct  373   YFEFLPVDETGA--------------ASGDATQLVDLARVEVGREYELVITTYAGLNRYR  418

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDVL+V GFHN APQF+F  R+NV+LSI+SDKT++ +L R++  A  LL PH A +VEY
Sbjct  419   VGDVLRVTGFHNAAPQFRFVRRKNVLLSIESDKTDEAELQRAVERASALLRPHGASVVEY  478

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAA--IDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             TS A T  +PGHYVIYWE++  GA A  +DA  L  CC+ +EE L+ VYR+ R  D  IG
Sbjct  479   TSQACTKRIPGHYVIYWELLTKGAGATVVDADTLGRCCLEMEEALNTVYRQSRVADGSIG  538

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVV+PGTF+ LM   I+ G+SINQYK PRC+ +    +++L+S V + +FSP  P 
Sbjct  539   PLEIRVVRPGTFEELMDYAISRGASINQYKVPRCV-TFPPIVELLDSRVVSSHFSPALPH  597

Query  181   WKP  173
             W P
Sbjct  598   WTP  600



>ref|XP_009117296.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.3 [Brassica 
rapa]
Length=596

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/543 (54%), Positives = 392/543 (72%), Gaps = 21/543 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPVI Y+DI+P I RIANGD    ++  PITE L SSGTS GE KLMP+I ED+DR
Sbjct  69    FKNKVPVITYDDIKPEIQRIANGDRSMILSSHPITEFLTSSGTSAGERKLMPTIEEDMDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L MP+M+ Y+PG+ +GKA++  FVK+E  TP GLPAR VLTSYYKS+HFK R +
Sbjct  129   RQLLYSLQMPVMNLYVPGLGKGKALHFLFVKSESKTPGGLPARPVLTSYYKSEHFKKRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILC D++QSMY Q+L GL+ R +VLRLGAVFAS  LRAI FLQ NW  
Sbjct  189   DPYNVYTSPNEAILCPDSSQSMYTQMLCGLLMRHEVLRLGAVFASGLLRAIRFLQTNWHE  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEI-CRAASWKGIVYRLWPKAK  1079
             L  DI TG LS  I+D   R +MSKIL  PD ELAD I  + C  ++W+G++ ++WP  K
Sbjct  249   LVNDISTGTLSSRISDPGIRESMSKILTKPDQELADYIASVCCHDSNWEGVITKIWPNTK  308

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             Y++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM
Sbjct  309   YLDVIVTGAMAQYIPMLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNM  367

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
              YFEF+P  E+ T  +                ++LV+L  V +G  YELV+TT++GLYRY
Sbjct  368   AYFEFLP-HEDATERT----------------TELVELADVEVGKEYELVITTYAGLYRY  410

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GD+LQV GF+N APQFKF  R+NV+LSI+SDKT++ +L +++  A  LLE     ++E
Sbjct  411   RVGDILQVTGFYNSAPQFKFVRRKNVLLSIESDKTDEAELQKAVENASVLLEEQGTRVIE  470

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDA-QVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             YTSYADT ++PGHYVIYWE++    A   + +V+  CC+ +EE L+ VYR+ R  DK IG
Sbjct  471   YTSYADTKTIPGHYVIYWELLVKDQANPPSDEVMAKCCLEMEESLNSVYRQSRVADKSIG  530

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVVK GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P 
Sbjct  531   PLEIRVVKNGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVASTHFSPALPQ  589

Query  181   WKP  173
             W P
Sbjct  590   WSP  592



>ref|XP_010485124.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Camelina 
sativa]
Length=596

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/541 (55%), Positives = 384/541 (71%), Gaps = 23/541 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI+P I RIANGD    +   PI+E L SSGTSGGE KLMP+I E+LDR
Sbjct  71    FKHVMPVVTYEDIQPEINRIANGDKSQILCSNPISEFLTSSGTSGGERKLMPTIEEELDR  130

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M+Q++PG+D+GK MY  F+K+E  TP GLPAR VLTSYYKS HFK R F
Sbjct  131   RSLLYSLLMPVMNQFVPGLDKGKGMYFLFIKSESKTPGGLPARPVLTSYYKSSHFKKRPF  190

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q+ILC D+ QSMY Q+L GL   ++VLR+GAVFAS F+RAI FL+ +WP 
Sbjct  191   DPYTNYTSPNQTILCPDSYQSMYSQMLCGLCQHKEVLRVGAVFASGFIRAIKFLEKHWPE  250

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG LS +I D   R A+ +I L PDP+LAD +E  CR  SW+GI+ R+WP  KY
Sbjct  251   LARDIRTGTLSSVITDLSVREAVGEI-LKPDPKLADFVESECRKTSWQGIITRIWPNTKY  309

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L Y                  Y GVNL+PL  P++V++TL+PNM 
Sbjct  310   VDVIVTGTMSQYIPTLDY------------------YIGVNLRPLCKPSEVSYTLIPNMA  351

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P+  N    S+++      E+E   Q +LVDLV V+LG  YELVVTT++GLYRYR
Sbjct  352   YFEFLPVHRNSGVTSSISLPKALTEKE---QQELVDLVDVKLGQEYELVVTTYAGLYRYR  408

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GDV+ V GF N APQF F CR+NVVLSID+DKT++ +L  ++  A   L P +A L EY
Sbjct  409   VGDVISVTGFKNNAPQFSFICRKNVVLSIDADKTDEVELQNAVKNAVTHLVPFEASLSEY  468

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADTSS+PGHYV++WE+   G   I   V +DCC+ IEE L+ VYR+ R  DK IGPL
Sbjct  469   TSYADTSSIPGHYVLFWELCLNGNTPIPPSVFEDCCLTIEESLNSVYRQGRVSDKSIGPL  528

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYKTPRC+K  +  +++L S V   YFSP+ P W 
Sbjct  529   EIKIVESGTFDKLMDYAISLGASINQYKTPRCVKF-APIIELLNSRVVDNYFSPKCPKWV  587

Query  175   P  173
             P
Sbjct  588   P  588



>emb|CDY46090.1| BnaA09g42140D [Brassica napus]
Length=596

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/543 (54%), Positives = 391/543 (72%), Gaps = 21/543 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPVI Y+DI+P I RIANGD    ++  PITE L SSGTS GE KLMP+I ED+DR
Sbjct  69    FKNKVPVITYDDIKPEIQRIANGDRSMILSSHPITEFLTSSGTSAGERKLMPTIEEDMDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L MP+M+ Y+PG+ +GKA++  FVK+E  TP GLPAR VLTSYYKS+HFK R +
Sbjct  129   RQLLYSLQMPVMNLYVPGLGKGKALHFLFVKSESKTPGGLPARPVLTSYYKSEHFKKRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILC D++QSMY Q+L GL+ R +VLRLGAVFAS  LRAI FLQ NW  
Sbjct  189   DPYNVYTSPNEAILCPDSSQSMYTQMLCGLLMRHEVLRLGAVFASGLLRAIRFLQTNWHE  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEI-CRAASWKGIVYRLWPKAK  1079
             L  DI TG LS  I+D   R +MSKIL  PD ELAD I  + C   +W+G++ ++WP  K
Sbjct  249   LVNDISTGTLSSRISDPGIRESMSKILTKPDQELADYIASVCCHDNNWEGVITKIWPNTK  308

Query  1078  YIEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNM  899
             Y++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM
Sbjct  309   YLDVIVTGAMAQYIPMLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNM  367

Query  898   GYFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRY  719
              YFEF+P  E+ T  +                ++LV+L  V +G  YELV+TT++GLYRY
Sbjct  368   AYFEFLP-HEDATERT----------------TELVELADVEVGKEYELVITTYAGLYRY  410

Query  718   RIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVE  539
             R+GD+LQV GF+N APQFKF  R+NV+LSI+SDKT++ +L +++  A  LLE     ++E
Sbjct  411   RVGDILQVTGFYNSAPQFKFVRRKNVLLSIESDKTDEAELQKAVENASMLLEEQGTRVIE  470

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDA-QVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             YTSYADT ++PGHYVIYWE++    A   + +V+  CC+ +EE L+ VYR+ R  DK IG
Sbjct  471   YTSYADTKTIPGHYVIYWELLVKDQANPPSDEVMAKCCLEMEESLNSVYRQSRVADKSIG  530

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVVK GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P 
Sbjct  531   PLEIRVVKNGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVASTHFSPALPQ  589

Query  181   WKP  173
             W P
Sbjct  590   WSP  592



>gb|KHN29920.1| Putative indole-3-acetic acid-amido synthetase GH3.1 [Glycine 
soja]
Length=567

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/542 (54%), Positives = 384/542 (71%), Gaps = 19/542 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YED++P I RIANGD    ++  PI+E L SSGTS GE KLMP+I E+LDR
Sbjct  40    FKSKIPVITYEDVQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDR  99

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  TP GL AR VLTSYYKS HFK R +
Sbjct  100   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY  159

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILCSD+ QSMY Q+L GL+ R  VLRLGAVFAS  LRAI FLQ NWP 
Sbjct  160   DPYNVYTSPNEAILCSDSFQSMYTQMLCGLIERHHVLRLGAVFASGLLRAIRFLQLNWPE  219

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI+TG L+  I D   RS M K+L + DPELA  + + C   +W+GI+ R+WP  KY
Sbjct  220   LAHDIQTGTLNSRITDPAIRSYMDKVLKS-DPELAQFVTQQCSKDNWEGIITRIWPNTKY  278

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LPL CTMYASSECYFG+NL P+  P++V++T++PNM 
Sbjct  279   LDVIVTGAMAQYIPTLNYYSGGGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMA  338

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P        S                SKLV+L  V +G  YELV+TT++GLYRYR
Sbjct  339   YFEFLPHDPKPGSTS----------------SKLVELADVEVGKEYELVITTYAGLYRYR  382

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQF F  R+NV+LSIDSDKT++ +L + I  A KLL      +VEY
Sbjct  383   VGDILRVTGFHNSAPQFHFVRRKNVLLSIDSDKTDESELQKGIENASKLLSEFNTSVVEY  442

Query  535   TSYADTSSVPGHYVIYWEIMHAGAA-AIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             TSYADT+++PGHYVIYWE++   +  +   +VL  CC+ +EE L+ VYR+CR  D  IGP
Sbjct  443   TSYADTTTIPGHYVIYWELLTKDSTNSPSHEVLNRCCLEMEECLNSVYRQCRVADHSIGP  502

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIRVV+ GTF+ LM   I+ G+SINQYK PRC+ + +  +++L+S V + +FS   P W
Sbjct  503   LEIRVVRNGTFEELMDYAISRGASINQYKVPRCV-NFTPIMELLDSRVVSVHFSQELPHW  561

Query  178   KP  173
              P
Sbjct  562   TP  563



>ref|XP_003518806.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Glycine max]
Length=595

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/542 (54%), Positives = 384/542 (71%), Gaps = 19/542 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PVI YED++P I RIANGD    ++  PI+E L SSGTS GE KLMP+I E+LDR
Sbjct  68    FKSKIPVITYEDVQPEIQRIANGDRSPILSAHPISEFLTSSGTSAGERKLMPTIKEELDR  127

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  TP GL AR VLTSYYKS HFK R +
Sbjct  128   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSETRTPGGLLARPVLTSYYKSDHFKTRPY  187

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILCSD+ QSMY Q+L GL+ R  VLRLGAVFAS  LRAI FLQ NWP 
Sbjct  188   DPYNVYTSPNEAILCSDSFQSMYTQMLCGLIERHHVLRLGAVFASGLLRAIRFLQLNWPE  247

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI+TG L+  I D   RS M K+L + DPELA  + + C   +W+GI+ R+WP  KY
Sbjct  248   LAHDIQTGTLNSRITDPAIRSYMDKVLKS-DPELAQFVTQQCSKDNWEGIITRIWPNTKY  306

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LPL CTMYASSECYFG+NL P+  P++V++T++PNM 
Sbjct  307   LDVIVTGAMAQYIPTLNYYSGGGLPLACTMYASSECYFGLNLNPMCKPSEVSYTIMPNMA  366

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P        S                SKLV+L  V +G  YELV+TT++GLYRYR
Sbjct  367   YFEFLPHDPKPGSTS----------------SKLVELADVEVGKEYELVITTYAGLYRYR  410

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQF F  R+NV+LSIDSDKT++ +L + I  A KLL      +VEY
Sbjct  411   VGDILRVTGFHNSAPQFHFVRRKNVLLSIDSDKTDESELQKGIENASKLLSEFNTSVVEY  470

Query  535   TSYADTSSVPGHYVIYWEIMHAGAA-AIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             TSYADT+++PGHYVIYWE++   +  +   +VL  CC+ +EE L+ VYR+CR  D  IGP
Sbjct  471   TSYADTTTIPGHYVIYWELLTKDSTNSPSHEVLNRCCLEMEECLNSVYRQCRVADHSIGP  530

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIRVV+ GTF+ LM   I+ G+SINQYK PRC+ + +  +++L+S V + +FS   P W
Sbjct  531   LEIRVVRNGTFEELMDYAISRGASINQYKVPRCV-NFTPIMELLDSRVVSVHFSQELPHW  589

Query  178   KP  173
              P
Sbjct  590   TP  591



>gb|EPS63059.1| hypothetical protein M569_11729, partial [Genlisea aurea]
Length=592

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/540 (57%), Positives = 390/540 (72%), Gaps = 21/540 (4%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  +PV+ YEDI P I RIA GD    +   PI+E L SSGTS GE K+MP+IAE+L+R
Sbjct  63    FKTTLPVVNYEDILPDINRIAAGDTSPILCSAPISEFLTSSGTSAGERKMMPTIAEELER  122

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R+ LY+L+MP+M Q++ G+++GKAMY  FVK+E  TP GL AR VLTSYYKS HFK R +
Sbjct  123   RSLLYSLLMPVMSQFVEGLEKGKAMYFLFVKSETRTPGGLLARPVLTSYYKSPHFKDRPY  182

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY D TSP+++ILCSD+ QSMY Q+L GL   R VLR+GAVFAS F+RA+ FL+++W  
Sbjct  183   DPYTDYTSPNEAILCSDSYQSMYSQMLCGLFLSRHVLRVGAVFASGFIRALHFLRNHWAL  242

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG L+ ++ADS  R A+  I L PDP LAD +E  C   SWKGI+ RLWP  +Y
Sbjct  243   LARDIRTGTLNPLVADSAVREAVMGI-LKPDPRLADFVEGECGKESWKGIIARLWPNTRY  301

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             IE ++TG+MSQY+P L YY DG LPL+CTMYASSECYFGVNL PL +P +VA+TL+P M 
Sbjct  302   IEVIVTGTMSQYIPTLDYYGDG-LPLVCTMYASSECYFGVNLSPLCEPGEVAYTLIPTMC  360

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             Y+EFIP+ ++                E   Q +LVDLV V+LG  YELVVTT+SGLYRYR
Sbjct  361   YYEFIPMDDD----------------EEEGQEQLVDLVDVKLGKEYELVVTTYSGLYRYR  404

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSIT-AAKKLLEPHQALLVE  539
             +GDVL+VAGF NKAPQF F CR+NVVLSIDSDKTN+ +LH ++  A ++ L P  A + E
Sbjct  405   VGDVLRVAGFKNKAPQFNFVCRKNVVLSIDSDKTNEVELHDAVNHAVRQHLSPFGARVSE  464

Query  538   YTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGP  359
             YTS A+T +VPGHYV+YWE+   G  A      QDCC+A+EE+LD VYR  R     IGP
Sbjct  465   YTSCAETGAVPGHYVLYWELEGGGGGAAPPSAFQDCCLAVEERLDNVYRHNRVLG-AIGP  523

Query  358   LEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAW  179
             LEIR+V+ GTFD LM   I+ G+SINQYKTPRC+K     +++L S V +R+FSP+ P W
Sbjct  524   LEIRIVEGGTFDKLMDYAISLGASINQYKTPRCVKF-PPIVELLNSRVVSRHFSPKCPKW  582



>ref|XP_010446666.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.2-like [Camelina 
sativa]
Length=603

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/544 (53%), Positives = 390/544 (72%), Gaps = 16/544 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P I RI+NGD    ++  PITE L SSGTS GE KLMP+I EDLDR
Sbjct  69    FKSKVPVVTYEDLKPEIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  T  GLPAR VLTSYYKS HFK R +
Sbjct  129   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTSGGLPARPVLTSYYKSDHFKRRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILC D++QSMY Q+L GL+ R  VLRLGAVFAS  LRAISFLQ+NW  
Sbjct  189   DPYNVYTSPNEAILCPDSSQSMYAQMLCGLLMRHDVLRLGAVFASGLLRAISFLQNNWKE  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI TG LS  I D   ++ MSKIL  PD ELA+ + E+C   +W+GI+ ++WP  KY
Sbjct  249   LARDISTGTLSSRIFDPAIKNRMSKILTKPDQELAEFLTEVCSQENWEGIITKIWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM 
Sbjct  309   LDVIVTGAMAQYIPTLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P   +G              E S+ ++ LV+L  V +G  YELV+TT++GL RYR
Sbjct  368   YFEFLPHNYDGD----------GAPEASLEETALVELADVEVGKEYELVITTYAGLCRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQFKF  R+NV+LSI+SDKT++ +L +++  A +L       ++EY
Sbjct  418   VGDILRVTGFHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASRLFAEQGTRVIEY  477

Query  535   TSYADTSSVPGHYVIYWEIM---HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
             TSYA+T ++PGHYVIYWE++      +   D +V+  CC+ +EE L+ VYR+ R  DK I
Sbjct  478   TSYAETKTIPGHYVIYWELLGRDQTNSLPSD-EVMAKCCLEMEESLNSVYRQSRVADKSI  536

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEIRVV+ GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P
Sbjct  537   GPLEIRVVQNGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVVSTHFSPSLP  595

Query  184   AWKP  173
              W P
Sbjct  596   HWSP  599



>ref|XP_010432064.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.2-like [Camelina 
sativa]
Length=603

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/543 (53%), Positives = 389/543 (72%), Gaps = 14/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED++P I RI+NGD    ++  PITE L SSGTS GE KLMP+I EDLDR
Sbjct  69    FKSKVPVVTYEDLKPEIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDR  128

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MP+M+ Y+PG+D+GK +Y  FVK+E  T  GLPAR VLTSYYKS HFK R +
Sbjct  129   RQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSESKTSGGLPARPVLTSYYKSDHFKRRPY  188

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN  TSP+++ILC D++QSMY Q+L GL+ R  VLRLGAVFAS  LRAISFLQ+NW  
Sbjct  189   DPYNVYTSPNEAILCPDSSQSMYAQMLCGLLMRHDVLRLGAVFASGLLRAISFLQNNWKE  248

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DI TG LS  I D   ++ MSKIL  PD ELA+ + E+C   +W+GI+ ++WP  KY
Sbjct  249   LARDISTGTLSSRIFDPAIKNRMSKILTKPDQELAEFLTEVCSQENWEGIITKIWPNTKY  308

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS G LP+ CTMYASSE YFG+NLKP+  P++V++T++PNM 
Sbjct  309   LDVIVTGAMAQYIPTLEYYSGG-LPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMA  367

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEF+P   +G              E S+ ++ LV+L  V +G  YELV+TT++GL RYR
Sbjct  368   YFEFLPHNYDGD----------GAPEASLEETALVELADVEVGKEYELVITTYAGLCRYR  417

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQFKF  R+NV+LSI+SDKT++ +L +++  A +L       ++EY
Sbjct  418   VGDILRVTGFHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASRLFAEQGTRVIEY  477

Query  535   TSYADTSSVPGHYVIYWEIM--HAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             TSYA+T ++PGHYVIYWE++      +    +V+  CC+ +EE L+ VYR+ R  DK IG
Sbjct  478   TSYAETKTIPGHYVIYWELLGRDQTNSLPSDEVMAKCCLEMEESLNSVYRQSRVADKSIG  537

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVV+ GTF+ LM   I+ G+SINQYK PRC+ S +  +++L+S V + +FSP  P 
Sbjct  538   PLEIRVVQNGTFEELMDYAISRGASINQYKVPRCV-SFTPIMELLDSRVVSTHFSPSLPH  596

Query  181   WKP  173
             W P
Sbjct  597   WSP  599



>ref|XP_003596546.1| Indole-3-acetic acid-amido synthetase GH3.6 [Medicago truncatula]
 gb|ABN09059.1| GH3 auxin-responsive promoter [Medicago truncatula]
 gb|AES66797.1| indole-3-acetic acid-amido synthetase [Medicago truncatula]
Length=607

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/544 (54%), Positives = 387/544 (71%), Gaps = 9/544 (2%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +P+I YEDI+  I  IANGD    +T  PI+  L SSGTSGGE KLMP+  E+  R
Sbjct  62    FKKLLPIITYEDIQNDINLIANGDTSPILTSNPISNFLTSSGTSGGERKLMPATEEEFGR  121

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+ +MPIM Q+IP +++GK MYL F+K E  TP G+ A  VLT+YYKS HF  R +
Sbjct  122   RYLLYSYLMPIMSQFIPDLEKGKGMYLMFIKNESKTPGGIKASPVLTNYYKSSHFLNRPY  181

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP++++LC D+ QSMY QLL GL+   +VLR+GAVFAS  +RAI FL+ NW  
Sbjct  182   DPYTNFTSPNETVLCLDSYQSMYSQLLCGLIQNNEVLRVGAVFASGLIRAIRFLEKNWRL  241

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DIRTG L  +I D   R A+ KIL  P+  LAD +E  C   SW+GI+ RLWP  KY
Sbjct  242   LCNDIRTGTLDLLITDDSVREAVMKIL-KPNKNLADFVEGECNKGSWQGIITRLWPNTKY  300

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+MSQY+P L YYS+G LPL+CTMYASSECYFGVNL PLS P  V++TL+P M 
Sbjct  301   VDVIVTGTMSQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLSKPCHVSYTLIPTMC  359

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSK---LVDLVHVRLGCYYELVVTTFSGLY  725
             Y+EF+P+  +      +N        +S+ + K   +VDLV V+LG  YELVVTT++GLY
Sbjct  360   YYEFLPVNRSN---CEVNGSIPPSTTKSLGEKKYQEVVDLVDVKLGQEYELVVTTYAGLY  416

Query  724   RYRIGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALL  545
             RY++GDVL+V GF NKAPQF F CR+NVVLSI+SDKT++ +L  ++  A   L P +A +
Sbjct  417   RYKVGDVLKVTGFKNKAPQFSFVCRKNVVLSIESDKTDEVELQNAMKNAVTHLAPFEADV  476

Query  544   VEYTSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCI  365
              EYTSYADT+++PGHYV+YWE+   G+  I   V +DCC+ IEE L+ VYR+ R  DK I
Sbjct  477   AEYTSYADTTTIPGHYVLYWELNLKGSTKIPHSVYEDCCLTIEESLNSVYRQGRVSDKSI  536

Query  364   GPLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDP  185
             GPLEI++V+ GTFD LM   IN G+SINQYKTPRC+K  +  +++LES V A+YFSP+ P
Sbjct  537   GPLEIKIVEQGTFDKLMDYAINLGASINQYKTPRCVKF-APMVELLESRVMAKYFSPKCP  595

Query  184   AWKP  173
              W P
Sbjct  596   KWVP  599



>ref|XP_007149669.1| hypothetical protein PHAVU_005G089200g [Phaseolus vulgaris]
 gb|ESW21663.1| hypothetical protein PHAVU_005G089200g [Phaseolus vulgaris]
Length=611

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/541 (55%), Positives = 389/541 (72%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK+ +PVI YED++P I RIANGD    +T +PITE L SSGTSGGE KLMP+I E+L R
Sbjct  67    FKKLLPVITYEDVQPDINRIANGDTSPILTSKPITEFLTSSGTSGGERKLMPTIEEELGR  126

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MPIM Q++  +++GK MYL FVK E  TP G+ AR VLTSYYKS +F+ R +
Sbjct  127   RCVLYSLLMPIMSQFVADLEKGKGMYLMFVKCESKTPGGIVARPVLTSYYKSPYFRDRPY  186

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY + TSP+Q++LC D+ QSMY QLL GL   ++VLR+GA+FAS F+RAI FL+ +W  
Sbjct  187   DPYTNYTSPNQTVLCPDSYQSMYSQLLCGLSQNKEVLRVGAIFASGFIRAIRFLEKHWTL  246

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L  DIRTG L+ +I D+  R A+ +I L PDP+LAD I + C   SW+GI+ RLWP  KY
Sbjct  247   LSNDIRTGTLNPLITDTSVREAVMRI-LKPDPKLADMIHKECSKGSWQGIITRLWPNTKY  305

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS+G LPL+CTMYASSECYFGVNL PL  P  V++TL+P M 
Sbjct  306   VDVIVTGTMAQYIPTLDYYSNG-LPLVCTMYASSECYFGVNLNPLCKPTQVSYTLIPTMC  364

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             Y+EF+P+  N T    L               +L++LV V+LG  YELVVTT +GLYRYR
Sbjct  365   YYEFLPV--NRTTDLTLPSRPTPTSLNHTQHQQLLELVDVKLGQEYELVVTTHAGLYRYR  422

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GF NKAPQF F CR+NV LSIDSDKT++ +L  ++  A   L P  AL+ EY
Sbjct  423   VGDILRVTGFKNKAPQFSFVCRKNVALSIDSDKTDEVELQNAMKNAVTHLVPFDALVSEY  482

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G+  I   V +DCC+ +EE L+ VYR+ R  DK IGPL
Sbjct  483   TSYADTTTIPGHYVLYWELSLKGSTPIPPCVYEDCCLTMEESLNSVYRQGRVSDKSIGPL  542

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYK PRC+K  +  +++L S V + YFSP+ P W 
Sbjct  543   EIKIVEQGTFDKLMDYAISLGASINQYKAPRCVKF-APIVELLNSRVTSNYFSPKCPKWV  601

Query  175   P  173
             P
Sbjct  602   P  602



>gb|KHN27995.1| Indole-3-acetic acid-amido synthetase GH3.6 [Glycine soja]
Length=612

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/541 (55%), Positives = 390/541 (72%), Gaps = 5/541 (1%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FKR +PVI YEDI+P I RIANGD    +T +PITE L SSGTSGGE KLMP+I E+L R
Sbjct  68    FKRLLPVITYEDIQPDINRIANGDKSPILTTKPITEFLTSSGTSGGERKLMPTIEEELGR  127

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             R  LY+L+MPIM Q++P +++GK MYL F+K E  TP G+ AR VLTSYYKS +F+ R +
Sbjct  128   RCILYSLLMPIMSQFVPDLEKGKGMYLMFIKCESKTPGGIVARPVLTSYYKSPYFRDRPY  187

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPY   TSP++++LC D+ QSMY QLL GL   ++VLR+GA+FAS F+RAI FL+ +W  
Sbjct  188   DPYTKYTSPNETVLCPDSYQSMYSQLLCGLCQHKEVLRVGAIFASGFIRAIRFLEKHWTL  247

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             LC DI+TG ++  I DS  R A+ +IL A DP+LAD I   C   SW+GI+ RLWP  KY
Sbjct  248   LCNDIKTGTINNSITDSSVREAVMRILKA-DPKLADFIHNECSKGSWQGIITRLWPNTKY  306

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS+  LPL+CTMYASSECYFGVNL PL  P+ V++TL+P M 
Sbjct  307   VDVIVTGTMAQYIPTLDYYSN-DLPLVCTMYASSECYFGVNLNPLCKPSQVSYTLIPTMC  365

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             Y+EF+P+  +   L+          +    Q +LV+LV V+LG  YELVVTT +GLYRYR
Sbjct  366   YYEFLPVNRSNNELAASRPSPTSLNQAQ--QEELVELVDVKLGQEYELVVTTHAGLYRYR  423

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V+GF NKAPQF F CR+NV LSIDSDKT++ +L  ++  A   LEP  A + EY
Sbjct  424   VGDILRVSGFKNKAPQFSFVCRKNVALSIDSDKTDEVELQNAMKNAVTHLEPFDAHVSEY  483

Query  535   TSYADTSSVPGHYVIYWEIMHAGAAAIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIGPL  356
             TSYADT+++PGHYV+YWE+   G+  I   V +DCC+ +EE L+ VYR+ R  DK IG L
Sbjct  484   TSYADTTTIPGHYVLYWELNLKGSTPIPPCVYEDCCLTVEESLNSVYRQGRVSDKSIGAL  543

Query  355   EIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPAWK  176
             EI++V+ GTFD LM   I+ G+SINQYK PRC+K  +  +++L S V + YFSP+ P W 
Sbjct  544   EIKIVEQGTFDKLMDYAISLGASINQYKAPRCVKF-APIVELLNSRVTSNYFSPKCPKWV  602

Query  175   P  173
             P
Sbjct  603   P  603



>ref|XP_009367779.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1 
[Pyrus x bretschneideri]
Length=599

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/543 (55%), Positives = 389/543 (72%), Gaps = 17/543 (3%)
 Frame = -1

Query  1795  FKRCVPVIAYEDIRPYILRIANGDHFSPITGQPITEMLCSSGTSGGEPKLMPSIAEDLDR  1616
             FK  VPV+ YED+ P I RIANGD    ++  PI+E L SSGTS GE KLMP+I E+LDR
Sbjct  68    FKSKVPVVTYEDLLPEIQRIANGDRSPILSSHPISEFLTSSGTSAGERKLMPTIHEELDR  127

Query  1615  RTFLYNLIMPIMDQYIPGMDEGKAMYLYFVKAEMSTPCGLPARTVLTSYYKSKHFKCRSF  1436
             RT LY+L+ P+M+ Y+P +D+GK +Y  F+KAE  TP GL AR VLTSYYKS+HFK R F
Sbjct  128   RTLLYSLLQPVMNLYVPDLDKGKGLYFLFIKAETKTPGGLVARPVLTSYYKSEHFKTRPF  187

Query  1435  DPYNDMTSPDQSILCSDTNQSMYCQLLAGLVYRRQVLRLGAVFASAFLRAISFLQHNWPS  1256
             DPYN +TSP+++ILC+D+ QSMY Q++ GL+ R+QVLR+GAVFAS  LRAI FLQ NW  
Sbjct  188   DPYNVLTSPNEAILCADSFQSMYTQMVCGLIMRQQVLRVGAVFASGLLRAIRFLQLNWQQ  247

Query  1255  LCLDIRTGQLSGMIADSECRSAMSKILLAPDPELADEIEEICRAASWKGIVYRLWPKAKY  1076
             L LDIR G L+  I D   R  MS I L PDP+LAD I + C   +W GI+ R+WP  KY
Sbjct  248   LSLDIRNGTLNPKITDPSLRETMSGI-LKPDPKLADFITKECCEENWAGIITRVWPNTKY  306

Query  1075  IEAVITGSMSQYVPALRYYSDGKLPLICTMYASSECYFGVNLKPLSDPADVAFTLLPNMG  896
             ++ ++TG+M+QY+P L YYS+G LP+ CTMYASSECYFG+NLKP+  P++V++T++PNM 
Sbjct  307   LDVIVTGAMAQYIPLLEYYSNG-LPMACTMYASSECYFGLNLKPMCKPSEVSYTIMPNMA  365

Query  895   YFEFIPLGENGTFLSNLNKegeeeeeESIPQSKLVDLVHVRLGCYYELVVTTFSGLYRYR  716
             YFEFIP   +   L+            S P  +LVDL  + +G  YELV+TT++GL RYR
Sbjct  366   YFEFIPHDPSAPSLTK----------HSPP--RLVDLADLEVGKKYELVITTYAGLCRYR  413

Query  715   IGDVLQVAGFHNKAPQFKFTCRRNVVLSIDSDKTNDEDLHRSITAAKKLLEPHQALLVEY  536
             +GD+L+V GFHN APQF+F  R+NV+LSIDSDKT++ +L ++I  A  LL      +VEY
Sbjct  414   VGDILEVTGFHNAAPQFRFVRRKNVLLSIDSDKTDEAELQKAIDNASVLLREFNTTVVEY  473

Query  535   TSYADTSSVPGHYVIYWEIMHAGAA--AIDAQVLQDCCIAIEEQLDYVYRRCRSHDKCIG  362
             TSYADT ++PGHYVIYWE++    A  +   +VL  CC+A+EE L+ VYR+ R  D  IG
Sbjct  474   TSYADTKTIPGHYVIYWELLVKDPANNSPSREVLDKCCLAMEESLNSVYRQGRVADNSIG  533

Query  361   PLEIRVVKPGTFDLLMGNFINEGSSINQYKTPRCIKSNSSALKILESNVRARYFSPRDPA  182
             PLEIRVVK GTF+ LM   I+ G+SINQYK PRC+ + S  +++L+S V + +FSP  P 
Sbjct  534   PLEIRVVKNGTFEELMDYAISRGASINQYKAPRCV-NFSPIMELLDSRVFSVHFSPSAPQ  592

Query  181   WKP  173
             W P
Sbjct  593   WTP  595



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5707078619816